WorldWideScience

Sample records for edi kulderknup rein

  1. EDI.

    Science.gov (United States)

    Bluh, Pamela; And Others

    1996-01-01

    This special section on EDI (Electronic Data Interchange) in libraries includes eight articles that discuss experiences in libraries in the United Kingdom, EDI and the acquisitions process in Europe, a Canadian viewpoint, the ILS (Integrated Library Systems) vendor and EDI, public libraries, and EDI in the information services industry. (LRW)

  2. Projekt EDI / Priit Põdra

    Index Scriptorium Estoniae

    Põdra, Priit, 1963-

    2000-01-01

    Projekt EDI töötab välja programmisüsteemi rahvusvaheliste kaubavedude korraldamiseks, dokumentide vormistamiseks ja firmade arvutiprogrammide koostöö korraldamiseks. Projekti tutvustab AS-i EDI VEKTOR juhatuse esimees Priit Põdra

  3. EDIS Investigation Filing Information

    Data.gov (United States)

    US International Trade Commission — This dataset contains investigation, document and attachment metadata from the USITC's Electronic Document Information System (EDIS), as well as access to attached...

  4. Rein tension during canter

    NARCIS (Netherlands)

    Egenvall, Agneta; Eisersiö, Marie; Rhodin, Marie; van Weeren, P.R.; Roepstorff, Lars

    2015-01-01

    Riders generally use reins as a means for communication with the horse. At present, the signalling pattern is poorly understood. The aim of this study was to illustrate and analyse the rein tension patterns in a number of rider/horse combinations across a variety of exercises in the canter gait. Our

  5. EDI-The Future.

    Science.gov (United States)

    Rusk, Harriet J.

    1991-01-01

    Considered are standardization efforts of the American National Standards Institute's Accredited Standards Committee X12 concerned with electronic data interchange (EDI). These efforts will effect dentistry first in the transmission of academic records, and then in communications between dental offices and businesses, including major insurance…

  6. EDI in the Public Sector

    DEFF Research Database (Denmark)

    Falch, Morten

    1998-01-01

    Introduction of EDI in the public administration is apriority for the Danish Government. EDI is both seen as a catlyst for development towards an information society ans as a means for more efficient use of scarce resources. EDI in the banking sector and the retail sector is reviewed, drivers...

  7. Kapital annab Rein Kilgile loominguvabaduse / Nils Niitra

    Index Scriptorium Estoniae

    Niitra, Nils, 1975-

    2004-01-01

    Rein Kilgil on 28 ettevõtet, see võimaldab rakendada ettevõtluses loomingulisust. Vt. samas: Priit Rajalo. Rein Kilk hämmastab oskusega ajast kõik võtta. Lisa: Rein Kilgi enamusosalusega ettevõtted; Rein Kilk on tööandja ligi 1000 inimesele; Rein Kilgi enamusosaluseta ettevõtted; Rein Kilgiga on seotud veel

  8. Rein Veidemann elab vana kodulinna provintslusilminguid valusalt läbi / Rein Veidemann ; interv. Rein Hallik

    Index Scriptorium Estoniae

    Veidemann, Rein, 1946-

    2007-01-01

    Pärnust pärit kirjanik-poliitik Rein Veidemann meenutab lapsepõlve, kooliaega, laulvat revolutsiooni. Vt. samas: Rein Veidemann; Kuidas Veidemann okupandiks sattus; Veidemann tegi koos Ojakääruga Rääma kooli hümni; Rein Kask. Meenutus

  9. Le Valais et ses Reines

    Directory of Open Access Journals (Sweden)

    Alberto Campi

    2012-06-01

    Full Text Available Combat de ReinesAu premier plan (la corde dans la main, un propriétaire de vaches. Dans l'arène se trouve le rabatteur. Les Reines sur la photo sont des reines de première catégorie (ainsi que le montre le « I » sur leur cuisse .Dimanche 6 mai 2012, « Schakira », la vache numéro 42, a gagné, non sans polémique, le titre de Reine. Elle peut donc être considérée comme la Reine des Reines, titre qu’elle a gagné en se battant contre ses rivales dans différents combats, qui ont commencé pour Sch...

  10. Introduction of EDI in the public sector

    DEFF Research Database (Denmark)

    Falch, Morten

    1997-01-01

    Reviews the status of EDI in the sectors of health, public transport and taxation and public administration. The impact of this on the diffusion of EDI in other sectors is analysed.......Reviews the status of EDI in the sectors of health, public transport and taxation and public administration. The impact of this on the diffusion of EDI in other sectors is analysed....

  11. Rein Raamat kunstnikest / Andri Ksenofontov

    Index Scriptorium Estoniae

    Ksenofontov, Andri, 1962-

    2009-01-01

    Dokumentaalfilm skulptor Jaan Varesest "Kahe peaga Jaanus", stsenarist ja režissöör Rein Raamat (Raamat-Film, 2009). Esilinastus 10. septembril Tallinna Kinomajas. Dokumentaalfilm "Siima Škopi muinasjutuline maailm", käsikiri Juta Kivimäe, režissöör Rein Raamat (Raamat-Film, 2009). Esilinastus 21. septembril Kumu auditooriumis

  12. EDI and the Technical Communicator.

    Science.gov (United States)

    Eiler, Mary Ann

    1994-01-01

    Assesses the role of technical communicators in electronic data interchange (EDI). Argues that, as experts in information design, human factors, instructional theory, and professional writing, technical communicators should be advocates of standard documentation protocols and should rethink the traditional concepts of "document" to…

  13. Rein Veidemann: vabadus on kohustus / Tuuli Jõesaar

    Index Scriptorium Estoniae

    Jõesaar, Tuuli

    2014-01-01

    Balti keti 25. aastapäeva puhul vestlus Eesti kirjanduse ja kultuuriloo professori Rein Veidemanniga vabadusest ning taasavaldatud luuletusest "Palve", mille ta kirjutas Eesti laulva revolutsiooni ajal. Artikkel sisaldab Rein Veidemanni luuletust "Palve"

  14. Eesti Panga vaheehitus Tallinnas / Toomas Rein

    Index Scriptorium Estoniae

    Rein, Toomas, 1940-

    1999-01-01

    Arhitektuur, ruumikujundus, tehnilisi näitajaid. Kitsa vaheehituse Estonia pst. 11/13 projekteeris OÜ Arhitektuuribüroo Toomas Rein, arhitekt Toomas Rein. Sisekujundaja AS Stuudio Gadis, sisearhitekt Taevo Gans

  15. Rein Lang : liitriiki ei tule / Rein Lang ; interv. Sten Hansson

    Index Scriptorium Estoniae

    Lang, Rein, 1957-

    2003-01-01

    Ilmunud ka: Severnoje Poberezhje 16. juuli lk. 2, Lääne Elu 17. juuli lk. 4, Meie Maa 17. juuli lk. 2, Koit 17. juuli lk. 6, Vooremaa 17. juuli lk. 2, Hiiu Leht 22. juuli lk. 2, Nädaline 2. august lk. 4. Intervjuu Euroopa Liidu tulevikukonvendis osalenud Rein Lang'iga EL-i põhiseaduse projektist

  16. Rein Pill tegi fantastilise sõidu / Rein Pill

    Index Scriptorium Estoniae

    Pill, Rein

    2008-01-01

    Septembris Chernjahovskis peetud CS14 taseme rahvusvahelistel ratsutamise takistussõiduvõistlustel tegi Rein Pill ajalugu, võites hobusel A Big Boy võistluste Grand Prix 160 cm kõrgusel parkuuril ja täites Euroopa meistrivõistluste kvalifikatsiooninormi

  17. Internal control in an EDI environment.

    OpenAIRE

    Bae, Dal Hyeoung

    1991-01-01

    Approved for public release; distribution in unlimited. Electronic Data Interchange(EDI) is the electronic transmission of standard business documents in machine-readable format between parent companies and respective trading partners. As the use of EDI has grown, there have been the associated risks due to an uncontrolled environment. Accordingly, the necessity for effective internal controls in an EDI environment is on the rise. This thesis evaluates and analyzes the feasi...

  18. Length and elasticity of side reins affect rein tension at trot.

    Science.gov (United States)

    Clayton, Hilary M; Larson, Britt; Kaiser, LeeAnn J; Lavagnino, Michael

    2011-06-01

    This study investigated the horse's contribution to tension in the reins. The experimental hypotheses were that tension in side reins (1) increases biphasically in each trot stride, (2) changes inversely with rein length, and (3) changes with elasticity of the reins. Eight riding horses trotted in hand at consistent speed in a straight line wearing a bit and bridle and three types of side reins (inelastic, stiff elastic, compliant elastic) were evaluated in random order at long, neutral, and short lengths. Strain gauge transducers (240 Hz) measured minimal, maximal and mean rein tension, rate of loading and impulse. The effects of rein type and length were evaluated using ANOVA with Bonferroni post hoc tests. Rein tension oscillated in a regular pattern with a peak during each diagonal stance phase. Within each rein type, minimal, maximal and mean tensions were higher with shorter reins. At neutral or short lengths, minimal tension increased and maximal tension decreased with elasticity of the reins. Short, inelastic reins had the highest maximal tension and rate of loading. Since the tension variables respond differently to rein elasticity at different lengths, it is recommended that a set of variables representing different aspects of rein tension should be reported. Copyright © 2010 Elsevier Ltd. All rights reserved.

  19. Rein Veidemanni romaan vene keeles

    Index Scriptorium Estoniae

    2015-01-01

    Kirjastus KPD on välja andnud vene keeles Rein Veidemanni 2012. aastal ilmunud romaani "Tund enne igavikku". Marina Tervoneni tõlkes ilmunud teos kannab vene keeles pealkirja "Вечный университет"

  20. Efficient Processing Of Voluminous EDI Documents

    NARCIS (Netherlands)

    Risse, T.; Wombacher, Andreas; Aberer, K.

    Business data is frequently exchanged between heterogeneous information systems using standard EDI formats like EDIFACT, X12 and in the future also XML/EDI. For inhouse use, data represented in these formats must be converted to inhouse data formats by message converters. With the growing usage of

  1. Rein Maran - Eesti looduse saadik maailmas / Rein Maran ; interv. Andres Laasik

    Index Scriptorium Estoniae

    Maran, Rein, 1931-

    2005-01-01

    Loodusfilmide meistril on esilinastunud uus film "Eesti kotkad". Lisad : "Rein Maran", "Digitaaltehnika muudab looduse elavamaks", "Eesti kõik kotkaliigid on kindlalt purgis", "Üliõpilased on Rein Maranile tänulikud"

  2. Rein Kilk : tahan saada Eesti suurimaks toiduainetöösturiks / Rein Kilk ; interv. Andres Reimer

    Index Scriptorium Estoniae

    Kilk, Rein, 1953-

    2007-01-01

    Suurärimees Rein Kilk vastab küsimustele, mis puudutavad Pere toiduainetetööstust ja teisi tema omanduses olevaid erinevatesse ärivaldkondadesse kuuluvaid ettevõtteid. Vt. samas: Rein Kilgiga seotud ettevõtted

  3. Kümnendikku riigikogust seovad peresidemed / Rein Sikk

    Index Scriptorium Estoniae

    Sikk, Rein, 1961-

    2007-01-01

    Vastvalitud riigikogus seovad kahtteist liiget perekondlikud sidemed. Vt. samas: Kas onupojapoliitika või juhus? Kommenteerivad: politoloog Rein Toomla, TÜ professor Marju Lauristin, TLÜ professor Rein Ruutsoo, emeriitprofessor Rein Taagepera

  4. Rein Maran tähistab juubelit

    Index Scriptorium Estoniae

    2016-01-01

    85. sünnipäev on loodusdokumentalistil, kauaaegsel Tallinna Ülikooli filmiõppejõul ning filmiõppetooli juhil Rein Maranil. Balti filmi- ja meediakooli Supernova kinoülikool pühendab Rein Marani loomingule sügissemestri esimese filmiõhtu. Tallinna Ülikooli Nova maja 4. korruse kinokoridoris avatakse Rein Marani loomingule pühendatud näitus "Loodusfilmi tuhat nägu"

  5. Uskumatult põnev maailm läbi Rein Marani kaamerasilma / Rein Maran ; üles kirjutanud Alo Lõhmus

    Index Scriptorium Estoniae

    Maran, Rein, 1931-

    2011-01-01

    Valitud katkendeid Alo Lõhmuse koostatud peatselt ilmuvast Rein Marani filmilooraamatust "Ööbikut ei tohi reeta". Rein Maran tähistab 13. septembril 80. sünnipäeva. Andmeid Rein Marani elukäigu kohta

  6. 1 küsimus / Rein Raud

    Index Scriptorium Estoniae

    Raud, Rein

    2007-01-01

    Hiljuti andis kirjastus Kegan Paul välja Rein Raua koostatud kogumiku "Japan and Asian Modernities" (Jaapan ja Aasia modernsused), mis koondab teadusartiklid maailma tuntud Aasia uurijatelt Jaapanist, USAst, Prantsusmaalt, Hongkongist jne, sealhulgas on ka Rein Raua uurimus. Mis võiks olla kogumiku tähendus Eesti jaoks?

  7. Effects on behaviour and rein tension on horses ridden with or without martingales and rein inserts.

    Science.gov (United States)

    Heleski, C R; McGreevy, P D; Kaiser, L J; Lavagnino, M; Tans, E; Bello, N; Clayton, H M

    2009-07-01

    Unsteady hand position can cause discomfort to the horse, potentially leading to conflict behaviours (CB) such as head tossing or tail lashing. Some instructors feel that martingales or elastic rein inserts can reduce discomfort caused by inexperienced and unsteady hands. Others consider these devices to be inappropriate 'crutches'. Four horses and nine riders were tested under three conditions in random order: plain reins, adjustable training martingales (TM), and elasticised rein inserts (RI). Rein-tension data (7s) and behavioural data (30s) were collected in each direction. Rein-tension data were collected via strain-gauge transducers. Behavioural data were assessed using an ethogram of defined behaviours. No differences in the number of CB were observed. Mean rein tension for TM was higher than that of RI or controls. Relative to the withers, the head was lower for horses ridden with martingales. Carefully fitted martingales may have a place in riding schools that teach novices.

  8. A little rein on addiction.

    Science.gov (United States)

    Mathuru, Ajay S

    2018-06-01

    Rewarding and aversive experiences influence emotions, motivate specific behaviors, and modify future action in animals. Multiple conserved vertebrate neural circuits have been discovered that act in a species-specific manner to reinforce behaviors that are rewarding, while attenuating those with an adverse outcome. A growing body of research now suggests that malfunction of the same circuits is an underlying cause for many human disorders and mental ailments. The habenula (Latin for "little rein") complex, an epithalamic structure that regulates midbrain monoaminergic activity has emerged in recent years as one such region in the vertebrate brain that modulates behavior. Its dysfunction, on the other hand, is implicated in a spectrum of psychiatric disorders in humans such as schizophrenia, depression and addiction. Here, I review the progress in identification of potential mechanisms involving the habenula in addiction. Copyright © 2017. Published by Elsevier Ltd.

  9. Muuseumisõbra tiitli sai Rein Veidemann

    Index Scriptorium Estoniae

    2017-01-01

    Muuseumiühing andis tänavuse muuseumisõbra tiitli ajakirjanikule ja kirjandusteadlasele Rein Veidemannile kirjanike muuseumide kaitseks meedias välja astumise ning Vilde ja Tammsaare Sõprade Seltsi loomisele kaasa aitamise eest

  10. Ministeerium kangutab Rein Porrot ametist / Mirko Ojakivi

    Index Scriptorium Estoniae

    Ojakivi, Mirko

    2006-01-01

    Ametkondlik juurdlus lennuametis tuvastas, et lennuamet pole rikkunud lennundusseadust. Samas on majandus- ja kommunikatsiooniministeeriumis pooleli lennuameti juhi asetäitja Rein Porro tegevuse suhtes algatatud ametkondlik juurdlus. Lisa: Porro - üks kogenumaid piloote

  11. Ilmus Rein Neggo "Vastutuuli. I" / Hannes Oja

    Index Scriptorium Estoniae

    Oja, Hannes

    1999-01-01

    rets. rmt.: Vastutuuli. I : valimik EELK Los Angelese koguduse ajakirjas "Vastutuuli" (1950-1965) avaldatud kirjasõna / koostanud ja toimetanud Rein Neggo. Los Angeles : Eesti Evangeelse Luterliku Kiriku Los Angelese kogudus, 1999. 199 lk. : ill.

  12. Langi retseptid majanduse restartimiseks / Rein Lang

    Index Scriptorium Estoniae

    Lang, Rein, 1957-

    2008-01-01

    Justiitsminister Rein Lang selgitab Maksumaksjale majanduse taaskäivitamise ideid, millest oli juttu 15. nov. 2008. aasta Reformierakonna majanduskonverentsil Restart ja Äripäev Onlines (15.11.2008)

  13. Rein Taagepera lahkub Res Publicast / Kristjan Roos

    Index Scriptorium Estoniae

    Roos, Kristjan, 1978-

    2005-01-01

    Res Publica asutaja Rein Taagepera, Jaan Einasto, Mare Taagepera ja Lauri Aaspõllu lahkuvad Res Publicast, kuna erakond on nende väitel muutunud paremtsentrist paremäärmuslikuks. Vt. samas: Erakonnad hoiavad uksed valla

  14. Rein Einasto : Eestis valitud ameerikalik valitsemise tee viib meid katastroofini / Rein Einasto ; interv. Kristi Leppik

    Index Scriptorium Estoniae

    Einasto, Rein, 1934-

    2008-01-01

    Kodanikuühiskonna edendamisest Eestis. Aasta missiooniinimese kandidaadiks esitatud professor Rein Einasto arvates päästaks meid avar mõtlemine, et viia inimkond tervikuna teisele teele. Praegune vaba turumajandus on pillamisele, raiskamisele ja kulutamisele üles ehitatud ummiktee. Lisa: Rein Einasto

  15. Rein Pakk: olen Jumala trumm, aga sina oled ka / Rein Pakk ; intervjueerinud Tiiu Laks

    Index Scriptorium Estoniae

    Pakk, Rein, 1968-

    2010-01-01

    Intervjuu Rein Pakuga, kellel meeldib kirjutada artikleid ja näidendeid, laval ja filmis mängida, teha sisekujunduslahendusi ja karikatuure. 27. augustil esietendus Tallinna Draamateatris tema esimene lavastajatöö, teatri Vanemuine lavastus "Kaos". Andmeid Rein Paku elu ja loomingu kohta

  16. Electronic Transcripts--EDI in Academic Administration.

    Science.gov (United States)

    Carson, E. W.

    1991-01-01

    Newly developed electronic data interchange (EDI) standards for exchanging academic records between colleges and universities are explained. It is argued that implementation of the new standards in college registrar and admissions offices can improve speed, costs, and accuracy and provide a prototype for a variety of campus business applications.…

  17. Luulelõunale tuleb Rein Veidemann / Kaja Tammar

    Index Scriptorium Estoniae

    Tammar, Kaja

    2017-01-01

    Rapla Keskraamatukogu suvisel luulelõunal esineb eesti kirjandusteadlane, ajakirjanik, kirjanik ja õppejõud, Tallinna Ülikooli humanitaarteaduste instituudi emeriitprofessor Rein Veidemann. Rein Veidemanni kultuurikriitikast ja ilmunud loomingust

  18. Rein Aidma: "Ma ei lähe riigikogusse tukkuma" / Rein Aidma ; interv. Erik Gamzejev

    Index Scriptorium Estoniae

    Aidma, Rein, 1950-

    2003-01-01

    Ilmunud ka: Severnoje Poberezhje : Subbota 15. märts lk. 3. Riigikokku valitud Ida-Viru maavanem Rein Aidma astumisest Reformierakonda, möödunud valimiskampaaniast, Ida-Viru arengut pidurdavatest teguritest

  19. Rein Taagepera : "Euroopa peab muutuma föderatsiooniks" / Rein Taagepera ; interv. Teet Korsten

    Index Scriptorium Estoniae

    Taagepera, Rein, 1933-

    2008-01-01

    Ilmunud ka: Severnoje Poberezhje : Subbota 16. aug. lk. 5. Eesti/USA politoloog muutustest Eestis, Uppsala ülikooli Skytte auhinnast, konverentsist "Diasporaa roll Eesti iseseisvuse taastamisel?". Arvamust avaldab parlamendiliige Peeter Tulviste. Lisa: Rein Taagepera CV

  20. Ability of EDI-2 and EDI-3 to correctly identify patients and subjects at risk for eating disorders.

    Science.gov (United States)

    Segura-García, Cristina; Aloi, Matteo; Rania, Marianna; Ciambrone, Paola; Palmieri, Antonella; Pugliese, Valentina; Ruiz Moruno, Antonio José; De Fazio, Pasquale

    2015-12-01

    The prevention and early recognition of eating disorders (EDs) are important topics in public health. This study aims to compare the efficacy of the Eating Disorder Inventory 2 (EDI-2) with the new version, EDI-3 in recognising patients and identifying subjects at risk for EDs. The EDI-2 and EDI-3 were administered to 92 female patients with ED and 265 females from a population at risk for EDs. Experienced psychiatrists in this field held blind interviews with participants by means of the SCID-I to determine the diagnosis. According to the cut-offs suggested by the authors, the EDI-3 correctly identified nearly all of the ED patients (99%), while the EDI-2 divulged less than half (48%). Both versions of the test showed comparable capability to identify participants at risk for EDs but the EDI-3 seemed slightly more reliable than the EDI-2. The EDI-2 remains a valid and very specific test. However, the new EDI-3 seems to be experimentally superior, because it typifies nearly all patients across the ED span, including those with Binge Eating Disorder and Eating Disorder Not Otherwise Specified. In addition, it appears to be more reliable. Copyright © 2015 Elsevier Ltd. All rights reserved.

  1. Rein Raua kuraatoridebüüt

    Index Scriptorium Estoniae

    2001-01-01

    Hausi galeriis Rein Raua kureeritud rahvusvaheline kunstinäitus "KevadSuviSügisTalv. Murdumispunkt". Esinevad Eve Kask, Peeter Laurits, Dainius Lickevicius, Rehka Menon, Mall Nukke, Herkki Merila, Jorma Puranen, Rosita Raud, Ene-Liis Semper, Liina Siib, S. ja P. Stanikas

  2. Mõõtmine ja intelligentsus / Rein Raud

    Index Scriptorium Estoniae

    Raud, Rein, 1961-

    2007-01-01

    Geeniteadlane James Watson leidis, et Aafrikas elavate inimeste intelligentsustase ei ole võrdne valge nahavärviga inimeste omaga. TLÜ professor Rein Raud leiab, et selle väite peamine nõrkus on eeldus, et on vaid üks ja universaalne mõõtmisparameeter

  3. Electronic Data Interchange (EDI) for Libraries and Publishers.

    Science.gov (United States)

    Santosuosso, Joe

    1992-01-01

    Defines electronic data interchange (EDI) as the exchange of data between computer systems without human intervention or interpretation. Standards are discussed; and the implementation of EDI in libraries and the serials publishing community in the areas of orders and acquisitions, claims, and invoice processing is described. (LRW)

  4. Cinco translações, 10 edições

    OpenAIRE

    Ângela Tonietto; Bruno Telles; Charles A. Andrade; Claudemir R. Dias Filho; Juliano A. Gomes

    2016-01-01

    Após cinco translações em torno da estrela do Sistema Solar e nove edições publicadas, a Revista Brasileira de Criminalística entrega hoje o terceiro número do seu quinto volume, completando assim cinco anos ininterruptos de publicações com sua décima edição.

  5. Vajame uut suhtumist sisejulgeolekusse / Rein Lang

    Index Scriptorium Estoniae

    Lang, Rein, 1957-

    2006-01-01

    Ilmunud ka: Hiiu Leht 31. märts lk. 2, Elva Postipoiss 1. apr. lk. 4, Harjumaa, Vooremaa 4. apr. lk. 2, Sakala, Põhjarannik, Severnoje Poberezhje, Võrumaa Teataja 6. apr. lk. 2, Koit 8. apr. lk. 6, Valgamaalane 18. apr. lk. 2, Pärnu Postimees 21. apr. lk. 11. Justiitsminister Rein Langi hinnangul ei seisne sisejulgeoleku arendamine üksnes politseinike ja päästjate palkade tõstmises, sisejulgeolek jaguneb vähemalt nelja ministeeriumi haldusalasse

  6. Zygmunt Bauman ja Rein Raud vestlesid kultuurist ja poliitikast

    Index Scriptorium Estoniae

    2014-01-01

    TLÜ Kultuuriteaduste ja kunstide doktorikooli kutsel Tallinnas viibinud sotsioloogi, Leedsi ülikooli emeriitprofessori Zygmunt Baumani ja TLÜ juhtivteadur Rein Raua vahel Kirjanike Liidu saalis toimunud avalikust vestlusest

  7. Business Process Redesign Using EDI: the BHP steel experience

    Directory of Open Access Journals (Sweden)

    Paula Swatman

    1994-05-01

    Full Text Available EDI should not be seen as a competitive weapon - it does not offer a sustainable competitive advantage to its users as did the earlier inter-organisational systems (such as the various airline reservation systems. Instead EDI provides a standardised infrastructure upon which an adopting organisation can reengineer its business processes and thus confers a long-term, strategic and comparative advantage upon such an adopter. The potential for sustained competitive advantage to be derived from EDI arises from its integration with the organisational structure of its implementor, depending upon the implementing organisation's ability to redesign its business processes appropriately. This paper examines the case of (arguably the most sophisticated EDI-using company in Australia, BHP Steel, demonstrating the advantages obtainable by an organisation using EDI as a foundation for its reengineered organisational structure and business processes and concludes that: • there are real benefits to be obtained from an inter organisational electronic trading strategy founded on EDI as the enabling mechanism - benefits which are considerably more extensive than EDI's comparatively simple technical nature would appear to offer; • organisational gateways utilising an Application Generic approach to system integration and isolating the communications issue by insisting on the use of international data communications standards do offer a realistic and successful solution to the problem of internal and external trade for large and sophisticated organisations; • the majority of these achievements would have been either unlikely or totally impossible without BHP Steel's commitment to organisation-wide Business Process Redesign.

  8. Development of the Electron Drift Instrument (EDI) for Cluster

    Science.gov (United States)

    Quinn, Jack; Christensen, John L. (Technical Monitor)

    2001-01-01

    The Electron Drift Instrument (EDI) is a new technique for measuring electric fields in space by detecting the effect on weak beams of test electrons. This U.S. portions of the technique, flight hardware, and flight software were developed for the Cluster mission under this contract. Dr. Goetz Paschmann of the Max Planck Institute in Garching, Germany, was the Principle Investigator for Cluster EDI. Hardware for Cluster was developed in the U.S. at the University of New Hampshire, Lockheed Palo Alto Research Laboratory, and University of California, San Diego. The Cluster satellites carrying the original EDI instruments were lost in the catastrophic launch failure of first flight of the Arianne-V rocket in 1996. Following that loss, NASA and ESA approved a rebuild of the Cluster mission, for which all four satellites were successfully launched in the Summer of 2000. Limited operations of EDI were also obtained on the Equator-S satellite, which was launched in December, 1997. A satellite failure caused a loss of the Equator-S mission after only 5 months, but these operations were extremely valuable in learning about the characteristics and operations of the complex EDI instrument. The Cluster mission, satellites, and instruments underwent an extensive on-orbit commissioning phase in the Fall of 2000, carrying over through January 2001. During this period all elements of the instruments were checked and careful measurements of inter-experiments interferences were made. EDI is currently working exceptionally well in orbit. Initial results verify that all aspects of the instrument are working as planned, and returning highly valuable scientific information. The first two papers describing EDI on-orbit results have been submitted for publication in April, 2001. The principles of the EDI technique, and its implementation on Cluster are described in two papers by Paschmann et al., attached as Appendices A and B. The EDI presentation at the formal Cluster Commissioning

  9. Rein Ruutsoo: Vaenlase tegemine on ikka veel mõnede poliitikute ainus poliitika / Rein Ruutsoo

    Index Scriptorium Estoniae

    Ruutsoo, Rein, 1947-

    2007-01-01

    Nõukogude Eestist saladokumente Läände toimetanud Rein Ruutsoo kommenteerib riiklike teenetemärkide jagamist endistele kommunistidele president Arnold Rüütli ja president Toomas Hendrik Ilvese ajal. T.H. Ilves on arvanud autasustatavate hulka Eestimaa Kommunistliku Partei poolt juhitud ideoloogiatöö võitlejad Eesti Raadios Aarne Rannamäe ja Peeter Kaldre

  10. Rein Raamat tiris eestlased joonisfilmi juurde / Rein Raamat ; interv. Tiit Tuumalu

    Index Scriptorium Estoniae

    Raamat, Rein, 1931-

    2006-01-01

    Kunstnil, anima- ja dokumentaalfilmirežissöör tähistab 75-ndat sünnipäeva. 20. märtsil Kinomajas on autoriõhtu filmidega "Rein Raamat animatsiooni maailmas" ja "Kursi koolkond". Lisatud R. Raamatu loometee lühiandmed ning Priit Pärna kommentaar

  11. Rein Kilk ei loobu Pärnust / Rein Kilk ; interv. Tiiu Leis

    Index Scriptorium Estoniae

    Kilk, Rein, 1953-

    2007-01-01

    Ilmunud ka: Linnaleht : Tartu, 12. okt. 2007, lk. 7-8; Linnaleht : Pärnu, 12. okt. 2007, lk. 7-8. Suurärimees Rein Kilk vastab küsimustele vanade majade taastamisest, plaanidest Pärnus, suhtumisest heidikutesse. Kommenteerivad Peeter Raudsepp ja Elmar Lepp

  12. Preemiad said Rein Raud, fs, Mart Kivastik

    Index Scriptorium Estoniae

    2005-01-01

    Eesti Kultuurkapitali 2004. aasta kirjanduse aastapreemia laureaadid on: Rein Raud ("Hector ja Bernard"), fs (luulekogu "2004"), Mart Kivastik (näidend "Külmetava kunstniku portree"), Jaan Rannap ("Nelja nimega koer"), Toomas Haug ("Troojamäe tõotus"), Harald Rajamets (tõlkeluule kogumik "Pegasos ja peegel"), Antoine Chalvin ("Kalevipoja" tõlge prantsuse keelde"), Ilmar Talve ("Eesti kultuurilugu"), Lauri Sommer (artikkel Uku Masingu käsikirja "Saadik Magellani pilvest" vaimne, ajalis-ruumiline ja elulooline taust), Boris Tuch ("Gorjatshaja desjatka estonskihh pisatelei")

  13. Rein Randver : keskkonnaminister olen nüüd mina, mitte Villu Reiljan / Rein Randver ; interv. Rasmus Kagge

    Index Scriptorium Estoniae

    Randver, Rein, 1956-

    2006-01-01

    Ilmunud ka: Postimees : na russkom jazõke 19. okt. lk. 4. Uus keskkonnaminister Rein Randver räägib talle varem esitatud ministriametite pakkumistest, oma tööplaanidest, avaldab seisukoha looduskaitsealuste maade vahetamise kohta. Lisa: Rein Randveri CV; Viis esimest tööd

  14. Rein Ratase allkiri paneb rattad käima ; kommenteerinud Rein Ratas, Neeme Reinap, Vilmar Rei...[jt.

    Index Scriptorium Estoniae

    Jakobson, Kadri, 1970-

    2010-01-01

    Riigikogu keskkonnakomisjoni liige Rein Ratas surub läbi firma EcoPro, mille üks omanik on Ratase hea tuttav, arendust Saaremaal Ruhve poolsaarel, mis asub kaitsealal ja ehituskeeluvööndis. Rein Ratas on tuludeklaratsioonis jätnud märkimata firmast Adepte Ekspert saadava tulu

  15. Binary trading relations and the limits of EDI standards

    DEFF Research Database (Denmark)

    Damsgaard, Jan; Truex, D.

    2000-01-01

    This paper provides a critical examination of electronic data interchange (EDI) standards and their application in different types of trading relationships. It argues that EDI standards are not directly comparable to more stable sets of technical standards in that they are dynamically tested...... and negotiated in use with each trading exchange. It takes the position that EDI standards are an emergent language form and must mean different things at the institutional and local levels. Using the lens of emergent linguistic analysis it shows how the institutional and local levels must always be distinct...... and yet can coexist. EDI standards can never represent the creation of an 'Esperanto of institutional communication'. Instead we believe that standards must be developed such that they support and accommodate general basic grammatical forms that can be customised to individual needs. The analysis...

  16. Thermal conductivity of REIn3 compounds

    International Nuclear Information System (INIS)

    Mucha, J

    2006-01-01

    The results of measurements of the thermal conductivity of REIn 3 (RE Pr, Nd, Dy, Ho, Tm) compounds as a function of the temperature in the interval 4-300 K in the absence and in the presence of an external magnetic field of 8 T are presented. Except for PRIn 3 all the compounds are antiferromagnetic. YIn 3 was also measured as a reference compound. The results were analysed in the paramagnetic phase, where an influence of the crystalline electric field on the thermal conductivity was found. Drastic changes in the thermal conductivity were observed and analysed in the vicinity of the Neel temperature and in the antiferromagnetic phases of the compounds. Below the Neel temperature an additional magnon contribution to the thermal conductivity was separated out

  17. Reines-Cowan team discovery of the electron neutrino

    International Nuclear Information System (INIS)

    Kruse, Herald W.

    2011-01-01

    Personal perspective and recollections by the author discuss the Reines-Cowan team discovery of the electron neutrino at a Savannah River reactor in 1956. First presented at the Neutrino Santa Fe 2006 Conference.

  18. Kuidas suhtute erakooli? / Andrus Kuusmann, Rein Rebane, Tiiu Kuurme ... [jt.

    Index Scriptorium Estoniae

    2012-01-01

    Küsimusele vastavad Tartu erakooli nõukogu esimees Andrus Kuusmann, Rocca al Mare Kooli AS-i juhataja Rein Rebane, TLÜ õppejõud Tiiu Kuurme, Viljandi Waldorfkooli õpetaja Sulev Ojap ja TLÜ õppejõud Tõnu Ploompuu

  19. 48 minutit pommirühma elust / Rein Kotov

    Index Scriptorium Estoniae

    Kotov, Rein, 1965-

    1997-01-01

    Intervjuu R. Kotoviga, kuna Discovery Channel Europe näitab 30.10. dokumentaalfilmi "Profid. Pommirühm" ("Professionals : Bomb Squad"), stsenarist, režissöör ja operaator Rein Kotov : Inglismaa - Eesti - Taani 1997

  20. TLÜ rektor Rein Raud valiti taas UNICA juhatusse / Maiki Voore

    Index Scriptorium Estoniae

    Voore, Maiki, 1983-

    2009-01-01

    Tallinna Ülikooli rektor Rein Raud valiti taas UNICA (Network of Universities from the Capitals of Europe) uue juhatuse liikmeks. UNICA rektorite 2010. aasta seminar otsustati korraldada Tallinna Ülikoolis

  1. Rein Müllerson - rahvusvahelise õiguse doktor / Eimar Rahumaa

    Index Scriptorium Estoniae

    Rahumaa, Eimar, 1948-

    1986-01-01

    1985. a. kaitses Rein Müllerson Moskva Riiklikus Ülikoolis doktoriväitekirja teemal "Rahvusvahelise avaliku, eraõiguse ja rahvusliku õiguse vahekord ning vastastikune mõju (teoreetilis-metodoloogiline uurimus)"

  2. Kas võlad tapavad Kilgi lambakarja? / Rein Raudvere

    Index Scriptorium Estoniae

    Raudvere, Rein, 1955-

    2008-01-01

    Ärimees Rein Kilgile kuuluva lambakasvatusfirma Nurmus Grupp OÜ 4000pealist lambakarja ootab katastroof. Selgitusi lambakasvatusfirma olukorra kohta jagavad Palamuse vallavolikogu liige Enn Kivi, Nurmus Grupi OÜ tegevjuht Hillar Kalda, Jõgevamaa veterinaarkeskuse juhataja Harles Kaup ning juhataja asetäitja Arbo Kepp. Vt. samas: Firma võlausaldajatel on mõõt täis saamas; intervjuud ärimees Rein Kilgiga: Sügiseks saavad lambafirma võlad likvideeritud. Lisa: Loomad võlgade katteks tapamajja

  3. Isepäine modernist Toomas Rein / Toomas Rein ; intervjueerinud Mait Väljas ja Reet Varblane

    Index Scriptorium Estoniae

    Rein, Toomas, 1940-

    2010-01-01

    23. aprillil avatakse Eesti Arhitektuurimuuseumis arhitekt Toomas Reinu 70. sünnipäevale pühendatud näitus. Kataloogi ja näituse on koostanud Toomas Rein ja Mait Väljas, kujundanud Tiit Jürna. Toomas Rein endast, oma loomingust, eeskujudest, näitusest, nõukogude perioodi hoonete olukorrast, viimase aja töödest, koostööst teiste arhitektidega, teostamata projektidest

  4. [A German version of the Eating Disorder Inventory EDI-2].

    Science.gov (United States)

    Thiel, A; Jacobi, C; Horstmann, S; Paul, T; Nutzinger, D O; Schüssler, G

    1997-01-01

    The paper presents a German version of the second revised edition of the Eating Disorder Inventory EDI-2 (Garner 1991). The EDI-2 is a self-rating inventory (self-report measure) with 91 items and 11 subscales designed for the assessment of attitudinal and behavioural dimensions relevant to anorexia and bulimia nervosa. It consists of the eight original subscales: drive for thinness, bulimia, body dissatisfaction, ineffectiveness, perfectionism, interpersonal distrust, interoception and maturity fears, and the three new subscales: asceticism, impulse regulation and social insecurity. The German EDI-2 was given to 71 patients with anorexia or bulimia nervosa, 30 patients with binge eating disorder, a control group of 186 women and a further control group of 102 men. In comparison to the female control group, patient groups showed significantly elevated means on all subscales. Item analysis revealed sufficient internal consistencies for all subscales except subscale 9 (asceticism) with Cronbachs alpha ranging from 0.58 to 0.90. Twelve of the 91 items showed poor item total scale correlations below 0.40. Factor analysis supported a six-factor-structure. Hence, the reliability and validity of the three new subscales was confirmed only partially. The use of the EDI-2 in therapy research and clinical practice is critically discussed.

  5. The ISO Edi Conceptual Model Activity and Its Relationship to OSI.

    Science.gov (United States)

    Fincher, Judith A.

    1990-01-01

    The edi conceptual model is being developed to define common structures, services, and processes that syntax-specific standards like X12 and EDIFACT could adopt. Open Systems Interconnection (OSI) is of interest to edi because of its potential to help enable global interoperability across Electronic Data Interchange (EDI) functional groups. A…

  6. Stride-related rein tension patterns in walk and trot in the ridden horse

    NARCIS (Netherlands)

    Egenvall, Agneta; Roepstorff, Lars; Eisersiö, Marie; Rhodin, Marie; van Weeren, René

    2015-01-01

    BACKGROUND: The use of tack (equipment such as saddles and reins) and especially of bits because of rein tension resulting in pressure in the mouth is questioned because of welfare concerns. We hypothesised that rein tension patterns in walk and trot reflect general gait kinematics, but are also

  7. Ujumismedalite peensepistaja Rein Haljand sätib detailid paika / Jaan Martinson

    Index Scriptorium Estoniae

    Martinson, Jaan, 1960-

    2015-01-01

    Professor Rein Haljandi hoolealused võitsid ujumise MM-il Kaasanis hulga medaleid. Kinesioloogiaprofessorit, ujumistehnika spetsialisti Rein Haljandit seob Rootsi koondisega leping Rio de Janeiro olümpiamängude lõpuni. Rein Haljand jagab selgitusi ujumistehnika ja Rootsi ujumise eduloo kohta

  8. Optomechanical fabrication of EDiFiSE spectrometer

    Science.gov (United States)

    Arredondo-Vega, Luis; Pérez-Santos, Carlos; Pompa-Carrera, Octavio; Ruiz-Márquez, Armando; Hurtado-Ortega, José; Paez, Gonzalo

    2011-09-01

    The purpose of this work is to describe some optical and mechanical issues relating to the fabrication of the camera and the collimator of the Equalized and Diffraction-Limited Field Spectrograph Experiment (EDiFiSE), an instrument which forms part of a bigger project of the Instituto de Astrofísica de Canarias (IAC), Spain, and that was designed and manufactured within the facilities of Centro de Investigaciones en Óptica in León, México.

  9. Edição Especial: 6 V-EEGAM

    OpenAIRE

    João Cândido André da Silva Neto; Thiago Oliveira Neto

    2017-01-01

    A sexta edição especial da Revista Geonorte acaba de ser publicada, contemplando os trabalhos submetidos e aceitos ao V Encontro dos Estudantes de Geografia do Amazonas-EEGAM com o tema: Geografia da Circulação, realizado nas dependências do Instituto de Ciências Humanas e Letras-ICHL entre 29 e 30 de novembro e 01 e 02 de dezembro de 2016.

  10. Edição Especial: 6 V-EEGAM

    Directory of Open Access Journals (Sweden)

    João Cândido André da Silva Neto

    2017-05-01

    Full Text Available A sexta edição especial da Revista Geonorte acaba de ser publicada, contemplando os trabalhos submetidos e aceitos ao V Encontro dos Estudantes de Geografia do Amazonas-EEGAM com o tema: Geografia da Circulação, realizado nas dependências do Instituto de Ciências Humanas e Letras-ICHL entre 29 e 30 de novembro e 01 e 02 de dezembro de 2016.

  11. Rein tension acceptance in young horses in a voluntary test situation.

    Science.gov (United States)

    Christensen, J W; Zharkikh, T L; Antoine, A; Malmkvist, J

    2011-03-01

    During riding, horses are frequently exposed to pressure from the rider, e.g. through the bit and reins, but few studies have investigated at which point rein tension becomes uncomfortable for the horse. To investigate how much rein tension young inexperienced horses are willing to accept in order to obtain a food reward; whether the tension acceptance changes during 3 consecutive test days; and whether rein tension correlates with the expression of conflict behaviour and heart rate. Pressure-naïve horses will apply only little rein tension in the first voluntary trial, but their acceptance will gradually increase. High levels of rein tension will lead to expression of conflict behaviour and increases in heart rate. Fifteen 2-year-old, bridle-naïve mares were encouraged to stretch their head forward (across a 0.95 m high metal bar) to obtain a food reward in a voluntary test situation. On each test day, each horse was exposed to 2 control sessions (loose reins), an intermediate and a short rein session (1 min/session). Rein tension, heart rate and behaviour were recorded. The horses applied significantly more tension on the first day (mean rein tension: 10.2 N), compared to the second and third test day (Day 2: 6.0 and Day 3: 5.7 N). The horses showed significantly more conflict behaviour in the short rein treatment. There was no treatment effect on heart rate. The horses applied the highest rein tension on the first day, and apparently learned to avoid the tension, rather than habituate to it. Rein tension correlated with expression of conflict behaviour, indicating that the horses found the tension aversive. Further studies should focus on the correlation between rein tension and conflict behaviour in ridden horses. © 2010 EVJ Ltd.

  12. Stride-related rein tension patterns in walk and trot in the ridden horse.

    Science.gov (United States)

    Egenvall, Agneta; Roepstorff, Lars; Eisersiö, Marie; Rhodin, Marie; van Weeren, René

    2015-12-30

    The use of tack (equipment such as saddles and reins) and especially of bits because of rein tension resulting in pressure in the mouth is questioned because of welfare concerns. We hypothesised that rein tension patterns in walk and trot reflect general gait kinematics, but are also determined by individual horse and rider effects. Six professional riders rode three familiar horses in walk and trot. Horses were equipped with rein tension meters logged by inertial measurement unit technique. Left and right rein tension data were synchronized with the gait. Stride split data (0-100 %) were analysed using mixed models technique to elucidate the left/right rein and stride percentage interaction, in relation to the exercises performed. In walk, rein tension was highest at hindlimb stance. Rein tension was highest in the suspension phase at trot, and lowest during the stance phase. In rising trot there was a significant difference between the two midstance phases, but not in sitting trot. When turning in trot there was a significant statistical association with the gait pattern with the tension being highest in the inside rein when the horse was on the outer fore-inner hindlimb diagonal. Substantial between-rider variation was demonstrated in walk and trot and between-horse variation in walk. Biphasic rein tensions patterns during the stride were found mainly in trot.

  13. Determinants of EDI (Electronic Data Interchange) Adoption and Integration in the US and Japanese Automobile Suppliers

    OpenAIRE

    Sam Kurokawa; Seiji Manabe

    2002-01-01

    This paper examines determinants of EDI adoption and integration in the US and Japanese automobile suppliers. The paper constructs several hypotheses based on the transaction-cost and resource- dependence approaches, and tests these hypotheses by using data from the automobile suppliers. Our study shows: (1) the resource-dependence approach seemed more effective in explaining EDI adoption, while the transaction-cost approach seemed more effective in explaining EDI integration; (2) the transac...

  14. Pro EDI in BizTalk Server 2006 R2 electronic document interchange solutions

    CERN Document Server

    Beckner, Mark

    2008-01-01

    As business becomes more dependent on working with partners, suppliers, and other organizations in a streamlined way, Electronic Data Interchange (EDI) is one of the next big waves in connected systems. Microsoft BizTalk Server 2006 R2 offers an efficient, integrated way to deploy EDI solutions, and with the help of this book, readers will see how EDI can be used in their business and how best to get it set up with BizTalk. This book offers insights into the brand-new Biztalk 2006 R2--based EDI functionality, including the far greater flexibility in handling interchange. It gives advice coveri

  15. The new Exponential Directional Iterative (EDI) 3-D Sn scheme for parallel adaptive differencing

    International Nuclear Information System (INIS)

    Sjoden, G.E.

    2005-01-01

    The new Exponential Directional Iterative (EDI) discrete ordinates (Sn) scheme for 3-D Cartesian Coordinates is presented. The EDI scheme is a logical extension of the positive, efficient Exponential Directional Weighted (EDW) Sn scheme currently used as the third level of the adaptive spatial differencing algorithm in the PENTRAN parallel discrete ordinates solver. Here, the derivation and advantages of the EDI scheme are presented; EDI uses EDW-rendered exponential coefficients as initial starting values to begin a fixed point iteration of the exponential coefficients. One issue that required evaluation was an iterative cutoff criterion to prevent the application of an unstable fixed point iteration; although this was needed in some cases, it was readily treated with a default to EDW. Iterative refinement of the exponential coefficients in EDI typically converged in fewer than four fixed point iterations. Moreover, EDI yielded more accurate angular fluxes compared to the other schemes tested, particularly in streaming conditions. Overall, it was found that the EDI scheme was up to an order of magnitude more accurate than the EDW scheme on a given mesh interval in streaming cases, and is potentially a good candidate as a fourth-level differencing scheme in the PENTRAN adaptive differencing sequence. The 3-D Cartesian computational cost of EDI was only about 20% more than the EDW scheme, and about 40% more than Diamond Zero (DZ). More evaluation and testing are required to determine suitable upgrade metrics for EDI to be fully integrated into the current adaptive spatial differencing sequence in PENTRAN. (author)

  16. Rein tension acceptance in young horses in a voluntary test situation

    DEFF Research Database (Denmark)

    Christensen, Janne Winther; zharkikh, T.L.; Antoine, A.

    2011-01-01

    Reasons for performing the study: During riding, horses are frequently exposed to pressure from the rider, e.g. through the bit and reins, but few studies have investigated at which point rein tension becomes uncomfortable for the horse. Objectives: To investigate how much rein tension young...... inexperienced horses are willing to accept in order to obtain a food reward; whether the tension acceptance changes during 3 consecutive test days; and whether rein tension correlates with the expression of conflict behaviour and heart rate. Hypotheses: Pressure-naïve horses will apply only little rein tension...... in the first voluntary trial, but their acceptance will gradually increase. High levels of rein tension will lead to expression of conflict behaviour and increases in heart rate. Methods: Fifteen 2-year-old, bridle-naïve mares were encouraged to stretch their head forward (across a 0.95 m high metal bar...

  17. High-temperature thermopower of some REIn3 compounds

    International Nuclear Information System (INIS)

    Kletowski, Z.; Resel, R.

    1995-01-01

    The temperature dependences of the thermopower of six REIn 3 compounds (RE=La, Pr, Gd, Dy, Er and Lu) were measured in the temperature range up to 1000 K. The observed changes in the slopes of the temperature versus thermopower curves for all the investigated compounds are interpreted as originating from a special shape of the density of states (DOS) near the Fermi energy, E F . ((orig.))

  18. Neutrinos and other matters collected works of Frederic Reines

    CERN Document Server

    Reines, Frederick; Moe, Michael; Price, LeRoy R; Schultz, J; Sobel, H

    This volume is a collection of the scientific papers of Frederick Reines. Its publication is to commemorate the 70th birthday, in 1988, of this distinguished scientist. The selected papers here cover many aspects of his work in neutrino physics, astrophysics and conservation law tests. They have been divided into logical groupings, each introduced by a leading authority in that field, who helps the reader to see the reprinted articles with a better historical and scientific perspective.

  19. Rein and Zheng Elected to American Academy of Microbiology | Poster

    Science.gov (United States)

    By Nancy Parrish, Staff Writer Earlier this year, Alan Rein, Ph.D., and Zhi-Ming (Thomas) Zheng, M.D., Ph.D., were elected to fellowship in the American Academy of Microbiology, the honorific leadership group within the American Society for Microbiology (ASM). They were among 88 microbiologists who were elected to the academy “through a highly selective, peer-review process,

  20. Measurement Invariance of Early Development Instrument (EDI) Domain Scores across Gender and ESL Status

    Science.gov (United States)

    Mousavi, Amin; Krishnan, Vijaya

    2016-01-01

    The Early Development Instrument (EDI) is a widely used teacher rating tool to assess kindergartners' developmental outcomes in Canada and a number of other countries. This paper examines the measurement invariance of EDI domains across ESL status and gender by means of multi-group confirmatory factor analysis. The results suggest evidence of…

  1. Does the EDI Equivalently Measure Facets of School Readiness for Aboriginal and Non-Aboriginal Children?

    Science.gov (United States)

    Muhajarine, Nazeem; Puchala, Chassidy; Janus, Magdalena

    2011-01-01

    The aim of the current paper was to examine the equivalence of the Early Development Instrument (EDI), a teacher rating measure of school readiness, for Aboriginal and non-Aboriginal children. The current study used an approach, which analyzes the structure and properties of the EDI at the subdomain level. Similar subdomain score distributions…

  2. Telegramme sent on June 14 1956 from physicists Fred Reines and Clyde Cowan to Wolfgang Pauli announcing the detection, for the first time, of neutrinos. The Physics Nobel Prize in 1995 was awarded to Reines for this discovery.

    CERN Document Server

    Maximiliem Brice

    2006-01-01

    Telegramme sent on June 14 1956 from physicists Fred Reines and Clyde Cowan to Wolfgang Pauli announcing the detection, for the first time, of neutrinos. The Physics Nobel Prize in 1995 was awarded to Reines for this discovery.

  3. 41 CFR 102-118.550 - How does a TSP file an administrative claim using EDI or other electronic means?

    Science.gov (United States)

    2010-07-01

    ... administrative claim using EDI or other electronic means? 102-118.550 Section 102-118.550 Public Contracts and... EDI or other electronic means? The medium and precise format of data for an administrative claim filed electronically must be approved in advance by the GSA Audit Division. GSA will use an authenticating EDI...

  4. Avalik pöördumine seoses Kihnu rahvamajaga / Toomas Rein, Leonhard Lapin

    Index Scriptorium Estoniae

    Rein, Toomas, 1940-

    2001-01-01

    Eskiisprojektist, Arhitektuuribüroo Toomas Rein poolt 31. V 2000. a. Kihnu vallavalitsusele üle antud tehnilisest projektist (arhitektid T. Rein, L. Lapin, sisearhitekt Helle Gans), ehitaja riigihankekonkursist, ehitusfirma FKSM tööjooniste ja valmishoone erinevusest tehnilisest projektist, autoriõigusest jm

  5. Statistical properties of effective drought index (EDI) for Seoul, Busan, Daegu, Mokpo in South Korea

    Science.gov (United States)

    Park, Jong-Hyeok; Kim, Ki-Beom; Chang, Heon-Young

    2014-08-01

    Time series of drought indices has been considered mostly in view of temporal and spatial distributions of a drought index so far. Here we investigate the statistical properties of a daily Effective Drought Index (EDI) itself for Seoul, Busan, Daegu, Mokpo for the period of 100 years from 1913 to 2012. We have found that both in dry and wet seasons the distribution of EDI as a function of EDI follows the Gaussian function. In dry season the shape of the Gaussian function is characteristically broader than that in wet seasons. The total number of drought days during the period we have analyzed is related both to the mean value and more importantly to the standard deviation. We have also found that according to the distribution of the number of occasions where the EDI values of several consecutive days are all less than a threshold, the distribution follows the exponential distribution. The slope of the best fit becomes steeper not only as the critical EDI value becomes more negative but also as the number of consecutive days increases. The slope of the exponential distribution becomes steeper as the number of the city in which EDI is simultaneously less than a critical EDI in a row increases. Finally, we conclude by pointing out implications of our findings.

  6. Magnetic field gradients inferred from multi-point measurements of Cluster FGM and EDI

    Science.gov (United States)

    Teubenbacher, Robert; Nakamura, Rumi; Giner, Lukas; Plaschke, Ferdinand; Baumjohann, Wolfgang; Magnes, Werner; Eichelberger, Hans; Steller, Manfred; Torbert, Roy

    2013-04-01

    We use Cluster data from fluxgate magnetometer (FGM) and electron drift instrument (EDI) to determine the magnetic field gradients in the near-Earth magnetotail. Here we use the magnetic field data from FGM measurements as well as the gyro-time data of electrons determined from the time of flight measurements of EDI. The results are compared with the values estimated from empirical magnetic field models for different magnetospheric conditions. We also estimated the spin axis offset of FGM based on comparison between EDI and FGM data and discuss the possible effect in determining the current sheet characteristics.

  7. Interhemispheric differences in ionospheric convection: Cluster EDI observations revisited

    Science.gov (United States)

    Förster, M.; Haaland, S.

    2015-07-01

    The interaction between the interplanetary magnetic field and the geomagnetic field sets up a large-scale circulation in the magnetosphere. This circulation is also reflected in the magnetically connected ionosphere. In this paper, we present a study of ionospheric convection based on Cluster Electron Drift Instrument (EDI) satellite measurements covering both hemispheres and obtained over a full solar cycle. The results from this study show that average flow patterns and polar cap potentials for a given orientation of the interplanetary magnetic field can be very different in the two hemispheres. In particular during southward directed interplanetary magnetic field conditions, and thus enhanced energy input from the solar wind, the measurements show that the southern polar cap has a higher cross polar cap potential. There are persistent north-south asymmetries, which cannot easily be explained by the influence of external drivers. These persistent asymmetries are primarily a result of the significant differences in the strength and configuration of the geomagnetic field between the Northern and Southern Hemispheres. Since the ionosphere is magnetically connected to the magnetosphere, this difference will also be reflected in the magnetosphere in the form of different feedback from the two hemispheres. Consequently, local ionospheric conditions and the geomagnetic field configuration are important for north-south asymmetries in large regions of geospace.

  8. Rein: Taming Tail Latency in Key-Value Stores via Multiget Scheduling

    KAUST Repository

    Reda, Waleed; Canini, Marco; Suresh, Lalith; Kostić, Dejan; Braithwaite, Sean

    2017-01-01

    the composition of aggregate requests and by carefully scheduling bottleneck operations that can otherwise create excessive queues. We design and implement a system called Rein, which reduces latency via inter-multiget scheduling using low overhead techniques. We

  9. Majanduse struktuur kujuneb isevoolu / Tiit Made, Rein Kask ; interv. Ester Shank

    Index Scriptorium Estoniae

    Made, Tiit, 1940-

    1999-01-01

    Riigikogu majanduskomisjoni esimees Tiit Made ja tema asetäitja Rein Kask nentisid Maailmakaubanduskeskuse klubi kokkutulekul, et kaheksa aasta jooksul ei ole Eesti valitsused suutnud ette näha, millise struktuuriga majandus peaks meie riigis kujunema

  10. An arithmetic transference proof of a relative Szemer\\'edi theorem

    OpenAIRE

    Zhao, Yufei

    2013-01-01

    Recently Conlon, Fox, and the author gave a new proof of a relative Szemer\\'edi theorem, which was the main novel ingredient in the proof of the celebrated Green-Tao theorem that the primes contain arbitrarily long arithmetic progressions. Roughly speaking, a relative Szemer\\'edi theorem says that if S is a set of integers satisfying certain conditions, and A is a subset of S with positive relative density, then A contains long arithmetic progressions, and our recent results show that S only ...

  11. Rancang Bangun Aplikasi Transaksi Elektronik Ritel Pupuk Dengan Metode Electronic Data Interchange (EDI

    Directory of Open Access Journals (Sweden)

    Nelly Oktavia Adiwijaya

    2015-03-01

    Full Text Available Fertilizer distribution from distributor to agents, are required to be responsive in addressing the demand for fertilizers. Distributors are also required to be able to manage inventory in the warehouse, to avoid overstocking of fertilizer. Design and implementation of a fertilizer retail electronic commerce applications using electronic data interchange (EDI method is applied in this study. The system is built to help distributors to control the existence of the stock of fertilizer so no excess stock. In addition, the use of EDI can provide information quickly (real-time without having to go directly to the warehouse locations.

  12. The EDIE method – towards an approach to collaboration-based persuasive design

    DEFF Research Database (Denmark)

    Hansen, Sandra Burri Gram

    2016-01-01

    This paper presents the initial steps towards a collaboration-based method for persuasive design – the EDIE method (Explore, Design, Implement, Evaluate). The method is inspired by Design-Based Research, but developed to combine different design approaches that have dominated the persuasive...... technology field over the past decade. The rhetorical notion of Kairos is considered a key element in the EDIE method, resulting in a distinct focus on participatory design and constructive ethics. The method is explained through a practical example of developing persuasive learning designs in collaboration...

  13. Reformierakonna "korrapidaja" riigikogus Rein Aidma: "Vajaliku hääletustulemuse saavutamisele eelneb peen mäng" / Rein Aidma ; interv. Erik Gamzejev

    Index Scriptorium Estoniae

    Aidma, Rein, 1950-

    2007-01-01

    Ilmunud ka: Severnoje Poberezhje : Subbota, 28. juuli 2007, lk. 5. Ida-Virumaalt Riigikokku valitud Rein Aidma roll erakonna fraktsiooni aseesimehena, saadikute ja riigiametnike privileegidest, Reformierakonna populaarsusest, riigiraha jagamisest. Arvamust avaldavad Jaanus Rahumägi ja Agu Värimäe

  14. Rein Veidemann: meil oli valida - nüüd või mitte kunagi / Rein Veidemann ; küsitles Tõnu Prei

    Index Scriptorium Estoniae

    Veidemann, Rein, 1946-

    2007-01-01

    Intervjuu Rein Veidemanniga, kes oli üks 1991.a. augustiputši päevil Eesti iseseisvust kinnitava otsuse poolt hääletanud 69 rahvasaadikust. Ülemnõukogu 20. augusti otsust peab ta sama tähtsaks kui Eesti Vabariigi väljakuulutamist 1918. aastal

  15. Prise en charge des traumatismes graves du rein

    Science.gov (United States)

    Lakmichi, Mohamed Amine; Jarir, Redouane; Sadiki, Bader; Zehraoui; Bentani; Wakrim, Bader; Dahami, Zakaria; Moudouni; Sarf, Ismail

    2015-01-01

    Les traumatismes graves du rein de grade III, IV et V selon la classification de l'Amercan Society for Surgery For Trauma (ASST) sont plus rares et se retrouvent dans 5% des cas en moyenne. Leur prise en charge est souvent délicate, nécessitant alors des centres expérimentés dotés de moyen adéquats d'imagerie (scanner spiralé). Cependant, durant ces dernières années, la prise en charge de ces traumatismes a évolué vers une attitude de moins en moins chirurgicale grâce à l’évolution des techniques de la radiologie interventionnelle, de l'endourologie et des moyens de surveillance aux urgences et de réanimation. L'objectif de cette étude est d’évaluer notre expérience dans la prise en charge des traumatismes rénaux de haut grade. Notre étude rétrospective porte sur 25 cas de traumatismes grave du rein de grade III, IV et V selon la classification de l'ASST, colligés entre Janvier 2002 et Juin 2009 au service d'urologie du centre Hospitalier Universitaire Mohammed VI, Université Cadi Ayyad de Marrakech, Maroc. Nous avons étudié les données épidémiologiques, les signes cliniques et biologiques à l'admission (état de choc hémorragique, taux d'hémoglobine), les données radiologiques (échographie et scanner), les lésions associées, la prise en charge thérapeutique et les complications. L’âge moyen de nos patients était de 24,9 ans 15 et 58 ans, avec une prédominance masculine (sex-ratio = 7, 3). Le rein droit était intéressé dans 15 cas (60%). Le traumatisme rénal était fermé dans 15 cas, et ouvert par arme blanche dans 10 cas. Huit patients se sont présentés en état de choc hémorragique (32%). Une anémie inférieur à 10g /100ml a été observée dans 10 cas (40%). L'uroscanner fait systématiquement à l'admission a retrouvé un grade III (10 cas), grade IV (13 cas) et grade V (2 cas). La prise en charge a consisté en une exploration chirurgicale avec néphrectomie chez 2 cas de Grade IV pour une instabilité h

  16. JST Thesaurus Headwords and Synonyms: EDI [MeCab user dictionary for science technology term[Archive

    Lifescience Database Archive (English)

    Full Text Available MeCab user dictionary for science technology term EDI 名詞 一般 * * * * EDI【情報交換】 EDI イーディーアイ Thesaurus2015 200906091295492920 C EG01 UNKNOWN_1 EDI

  17. Numerical simulation of the electrodeionization (EDI) process accounting for water dissociation

    International Nuclear Information System (INIS)

    Lu Jun; Wang Yuxin; Zhu Jia

    2010-01-01

    The electrodeionization process (EDI) is usually operated at overlimiting current density, and is thus characterized by water dissociation and concentration polarization. We attempt to study the useful and harmful effects of water dissociation on the EDI process. A numerical steady state model was established to simulate the process of EDI, accounting for the effects of water dissociation. The differences in concentration polarization of membranes were investigated to study the effects of water dissociation on cation and anion membranes. Protons produced by water dissociation caused the resin to transform into the H-form. The H-form resin, which has high conductivity and high transport number, depletes protons in the interstitial solution. This explains the experimentally detected phenomenon that at high current densities, the pH value of the effluency of the dilute compartment (DC) stops decreasing when current increases. We suggest that the useful role of water dissociation in EDI is due to the H-form resin bringing more salt cations of the interstitial solution into the resin phase, thus producing a high conductivity channel for the electro-migration of the salt cations. This mechanism avoids the decrease in salt ion conductivity brought about by concentration polarization. The disadvantageous effect of concentration polarization on the transportation of salt ions in interstitial solution is thus lessened. An intermediate point between the useful and harmful effects of water dissociation was determined by the dependence of current efficiency and removal rate for both cations and anions as a function of current density.

  18. Identification of Disciplines and Fields. Edis Task I Report, Work Unit 1.4.

    Science.gov (United States)

    Howard Research Co., Arlington, VA.

    This report presents the identification and definitions of subject oriented engineering and scientific disciplines and fields which are included in the EDIS Subject Categories. The discussion is extended to include the mix of subjects with other orientations, such as Item, Mission-Project, Expertise and Data Bank Categories. Sample queries are…

  19. Validation of Multilevel Constructs: Validation Methods and Empirical Findings for the EDI

    Science.gov (United States)

    Forer, Barry; Zumbo, Bruno D.

    2011-01-01

    The purposes of this paper are to highlight the foundations of multilevel construct validation, describe two methodological approaches and associated analytic techniques, and then apply these approaches and techniques to the multilevel construct validation of a widely-used school readiness measure called the Early Development Instrument (EDI;…

  20. Riigikogulased ongi teistmoodi asendis. Aga mitte nii teistmoodi, kui nad hetkel arvavad / Rein Taagepera ; interv. Urmo Soonvald

    Index Scriptorium Estoniae

    Taagepera, Rein, 1933-

    2007-01-01

    Politoloog Rein Taagepera vastab Riigikogu suurust, tööd ning seaduseelnõu, mis vabastab parlamendiliikmed kuluhüvitiste avalikustamisest, puudutavatele küsimustele. Lisa: Soome parlamendist õpitakse kulutamist, mitte tööl käimist; Rein Taagepera: teadlane, presidendikandidaat, Res Publica looja

  1. Alternatives to conventional evaluation of rideability in horse performance tests: suitability of rein tension and behavioural parameters.

    Science.gov (United States)

    König von Borstel, Uta; Glißman, Chantal

    2014-01-01

    Rideability, i.e. the ease and comfort with which a horse can be ridden, is considered to be one of the most important traits in riding horses. However, at present rideability is evaluated rather subjectively in breeding horse performance tests. The aim of the present study was to evaluate the role horse behaviour as well as degree and quality of rein tension might play in judges' evaluation of horses' rideability. Mares (n=33) and stallions (n=13) from two different mare- and one stallion-testing station were observed twice during their performance test dressage training. During these rides, rein tension was measured continuously, and frequency of behaviour patterns such as head-tossing, tail swishing, and snorting was recorded. Rein tension parameters showed reasonable repeatabilities within horse-rider pairs (e.g. mean rein tension: r(2)=0.61 ± 0.11; variance of rein tension: r(2)=0.52 ± 0.14). Regression analysis revealed that a larger proportion of variance in rideability scores could be explained by maximum (17%), mean (16%) and variance (15%) of rein tension compared to horses' or riders' behavioural parameters (tail-swishing: 5% and rider's use of hands: 5%, respectively). According to mixed model analysis, rideability scores dropped (all Prein tension (e.g. -0.37 ± 0.14 scores per additional 10 Newton in mean tension). However, mean rein tension differed between testing stations (Prein tension is either directly or indirectly an important factor for judges to derive rideability scores. Given the importance of rein tension parameters to both rider comfort and horse welfare, potentially, measurements of rein tension along with behaviour observations assessing the quality of rein contact (e.g. distinguishing a light contact from attempts to evade contact) might be used to make the assessment of rideability more impartial.

  2. EdiPy: a resource to simulate the evolution of plant mitochondrial genes under the RNA editing.

    Science.gov (United States)

    Picardi, Ernesto; Quagliariello, Carla

    2006-02-01

    EdiPy is an online resource appropriately designed to simulate the evolution of plant mitochondrial genes in a biologically realistic fashion. EdiPy takes into account the presence of sites subjected to RNA editing and provides multiple artificial alignments corresponding to both genomic and cDNA sequences. Each artificial data set can successively be submitted to main and widespread evolutionary and phylogenetic software packages such as PAUP, Phyml, PAML and Phylip. As an online bioinformatic resource, EdiPy is available at the following web page: http://biologia.unical.it/py_script/index.html.

  3. Biometry by ultrasonography of the epaxial and pelvic musculature in equines trained with Pessoa's rein

    Directory of Open Access Journals (Sweden)

    Kátia de Oliveira

    2014-11-01

    Full Text Available This study aimed to evaluate the use of Pessoa's rein in training equine, as a support in exercise training, on biometry by ultrasonography of the epaxial (Longíssimus Dorsi, Gluteus Medius e Musculus Multifidus and pelvic musculature (Biceps Femoris e Semitendinosus. Thereby, eight Quarter Horse mares was used, with eight years on average age, 400kg of body weight, trained with the Pessoa's rein twice a week, for two months. Variables were measured before and after training, consisting of assessment thickness (cm of the Longíssimus Dorsi and cross-sectional area (cm2 of muscles, Gluteus Medius, Biceps Femoris, Semitendinosus and Musculus Multifidus. It observed a significant effect of training with Pessoa's rein, on the Biceps Femoris (P<0.01 and Musculus Multifidus (P<0.01, which the average cross-sectional area at the final evaluation were of 28.66cm2 and 14.29cm2, respectively. Thus it can be conclude that training with Pessoa's rein modifies muscular function, promoting hypertrophy Musculus Multifidus and Biceps Femoris of horses

  4. Rein Veidemann ja Erkki Bahovski tulevad lugejale külla

    Index Scriptorium Estoniae

    2016-01-01

    Emeriitprofessor Rein Veidemann esitleb Pärnu keskraamatukogus oma uusi raamatuid: luuleantoloogiat "Sada hetke Eesti luules" ja debüütluulekogu "Lausungid ja pausid". Ajakirjanik Erkki Bahovski räägib huvilistele päevapoliitikast, Eesti ajaloost ja rahvusvahelistest suhetest

  5. On description of Δ(1232) region in the Rein-Sehgal model

    International Nuclear Information System (INIS)

    Graczyk, Krzysztof M.; Sobczyk, Jan T.

    2007-01-01

    New vector and axial form factors in the Rein-Sehgal model are proposed. The vector part is constructed after experimental fits of the helicity amplitudes for electroproduction of Δ(1232) resonance. The axial part is calculated after Q 2 distribution of events in the ANL experiment

  6. Luuleline lõuna Rein Veidemanni moodi: õnn olla koos oma põlvkonnaga / Juune Holvandus

    Index Scriptorium Estoniae

    Holvandus, Juune

    2017-01-01

    Rapla keskraamatukogus toimus luulehuviliste kohtumine, kuhu oli lubanud tulla mitmekülgne inimene - kirjandusteadlane, poliitik, ühiskonnategelane, üliõpilastele alati mõistev ja pühendunud õpetaja, nüüd Tallinna Ülikooli prof emeritus, vastne ringhäälingunõukogu esimees Rein Veidemann

  7. The lateral crural rein flap: a novel technique for management of tip rotation in primary rhinoplasty.

    Science.gov (United States)

    Kuran, Ismail; Öreroğlu, Ali Rıza; Efendioğlu, Kamran

    2014-09-01

    An important consideration in rhinoplasty is maintenance of the applied tip rotation. Different techniques have been proposed to accomplish this. Loss of rotation after surgery not only results in a derotated tip but also can create a supratip deformity. As a supplement to dorsal reconstruction, the authors introduced and applied the lateral crural rein flap technique, whereby cartilage flaps are created from the cephalic portion of the lateral crura to control and stabilize tip rotation. Eleven patients underwent primary open-approach rhinoplasty that included the lateral crural rein technique; the mean follow-up time was 18 months. Excess cephalic portions of the lateral crura were prepared as medial crura-based cartilaginous flaps and were incorporated into the nasal dorsum (similar to spreader grafts) and stabilized to achieve the desired tip rotation. The lateral crural rein flap technique provided stability to the nasal tip while minimizing derotation in the postoperative period. Long-term follow-up revealed maintenance of the nasal tip rotation and symmetric dorsal aesthetic lines. The lateral crural rein flap technique is effective for controlling nasal tip rotation while reducing lateral crural cephalic excess. Longevity of the applied tip rotation is reinforced by secure attachment of the lower nasal cartilage complex to the midvault structures. 4. © 2014 The American Society for Aesthetic Plastic Surgery, Inc.

  8. Rein Pilli hobusel on hüppamine sisse kodeeritud / Maarja Värv

    Index Scriptorium Estoniae

    Värv, Maarja

    2008-01-01

    Tänavusest aastast A Big Boyga ratsutav takistussõitja Rein Pill võitis septembri alguses Venemaal kõrgetasemelise maailmakarikaetapi ning püüab saavutust korrata ka Tallinn International Horse Show'l. Lisa: Takistussõidu grand prix' rajaskeem

  9. Rein Taaramäe virutas protestiks liidrisärgi porri ja katkestas / Jaan Martinson

    Index Scriptorium Estoniae

    Martinson, Jaan, 1960-

    2007-01-01

    Velotuuri Tour de Le Pays Roannaisþ finishis jäi Rein Taaramäe koos klubikaaslaste Tanel Kangerti ja Kalle Kriidiga enne joont seisma, võttis seljast liidrisärgi ja viskas selle protestiks porri. Eestlased olid viimasel etapil suunatud valele teele, kuid kohtunik sõitu ei peatanud

  10. Rein Pill võitis Venemaal kõrgetasemelise võistluse / Maarja Värv

    Index Scriptorium Estoniae

    Värv, Maarja

    2008-01-01

    Ratsutaja Rein Pill tegi Venemaal Tsherjahovskis CS14* taseme rahvusvahelistel ratsutamise takistussõiduvõistlustel ajalugu, võites hobusel A Big Boy võistluste Grand Prix' 160 cm kõrgusel parkuuril ja täites seega Euroopa meistrivõistluste kvalifikatsiooninormi

  11. Tavatu juhtum / Toomas Rein, Helle Gans, Leonhard Lapin ; interv. Reet Varblane

    Index Scriptorium Estoniae

    Rein, Toomas, 1940-

    2007-01-01

    Arhitektid Toomas Rein ja Leonhard Lapin ning sisearhitekt Helle Gans meenutavad Valgevene näidiskolhoosile Rassvet projekteeritud lasteaeda, mis valmis 1987. aastal. Kompleks pälvis 1987. a. NSVL Arhitektide Liidu preemia ja üleliidulise ametiühingupreemia

  12. Ediţii ale Clasificării Zecimale Dewey

    Directory of Open Access Journals (Sweden)

    Zenovia Niculescu

    2009-01-01

    Full Text Available Studiul abordează evoluţia ediţiilor C.Z.D. din perspective actualizării terminologiei, realocărilor şi extinderii structurii principale şi auxiliare a limbajului de indexare Dewey. Analiza comparativă a ediţiilor C.Z.D. reflectă amplificarea şi eficientizarea schemei Dewey din punct de vedere al îmbunătăţirii ofertei informaţionale, prin indici de bază revizuiţi şi dezvoltaţi, precum şi a valorizării notaţiilor auxiliare.

  13. Choroidal Thickness Analysis in Patients with Usher Syndrome Type 2 Using EDI OCT

    OpenAIRE

    Colombo, L.; Sala, B.; Montesano, G.; Pierrottet, C.; De Cillà, S.; Maltese, P.; Bertelli, M.; Rossetti, L.

    2015-01-01

    To portray Usher Syndrome type 2, analyzing choroidal thickness and comparing data reported in published literature on RP and healthy subjects. Methods. 20 eyes of 10 patients with clinical signs and genetic diagnosis of Usher Syndrome type 2. Each patient underwent a complete ophthalmologic examination including Best Corrected Visual Acuity (BCVA), intraocular pressure (IOP), axial length (AL), automated visual field (VF), and EDI OCT. Both retinal and choroidal measures were measured. Stati...

  14. DOD Electronic Commerce (EC)/Electronic Data Interchange (EDI) in contracting report

    Science.gov (United States)

    1993-12-01

    Use of Electronic Commerce (EC)/Electronic Data Interchange (EDI) to support Department of Defense (DoD) procurement processes has been under consideration for some time. A 1988 Deputy Secretary of Defense memo calls for maximum use of EDI, based on 10 years of DoD EDI investigation and experiments. In 1990, Defense Management Review Decision 941 stated, 'The strategic goal of DoD's current efforts is to provide the department with the capability to initiate, conduct, and maintain its external business related transactions and internal logistics, contracting, and financial activities without requiring the use of hard copy media.' The EC in Contracting PAT membership reflected a broad cross section of Military Services and Defense Agencies working on a full-time basis for 60 days. The diversity of the EC in Contracting PAT ensured that the needs and concerns of all DoD components were addressed during the creation of the report. The resultant plan, therefore, represents a comprehensive approach for implementing EC throughout the DoD.

  15. Investigation of the effect of heated ethanol fuel on combustion and emissions of an ethanol direct injection plus gasoline port injection (EDI + GPI) engine

    International Nuclear Information System (INIS)

    Huang, Yuhan; Hong, Guang

    2016-01-01

    Highlights: • Effect of EDI heating on the EDI + GPI engine performance was investigated. • CO and HC were significantly reduced and NO was slightly increased by EDI heating. • IMEP and combustion speed were slightly reduced by EDI heating. • EDI heating is effective to address the evaporation and over-cooling issues of EDI + GPI engine. - Abstract: Ethanol direct injection plus gasoline port injection (EDI + GPI) is a new technology to utilise ethanol fuel more efficiently and flexibly in spark ignition engines. One issue needs to be addressed in the development of EDI + GPI is the ethanol fuel’s low vapour pressure and large latent heat which slow down the ethanol’s evaporation and result in the mixture unready for combustion by the time of spark ignition and the consequent increase of CO and HC emissions. Heating the ethanol fuel to be directly injected (EDI heating) has been proposed to address this issue. This paper reports the investigation of the effect of EDI heating on the combustion and emissions of a research engine equipped with EDI + GPI. The results showed that EDI heating effectively reduced the CO and HC emissions of the engine due to the increase of evaporation rate and reduced fuel impingement and local over-cooling. The reduction of CO and HC became more significant with the increase of ethanol ratio. When the temperature of the ethanol fuel was increased by 40 °C, the CO and HC were reduced by as much as 43% and 51% respectively in EDI only condition at the original spark timing of 15 CAD BTDC, and 15% and 47% respectively at the minimum spark advance for best torque (MBT) timing of 19 CAD BTDC. On the other hand, the NO emission was slightly increased, but still much smaller than that in GPI only condition due to the strong cooling effect and low combustion temperature of EDI. The IMEP and combustion speed were slightly reduced by EDI heating due to the decrease of injector fuel flow rate and spray collapse of flash-boiling. The

  16. Rein Tammik : Pidu katku ajal = Feast during the plague / Anneli Porri

    Index Scriptorium Estoniae

    Epner, Eero, 1978-

    2007-01-01

    Rein Tammiku fotorealistlik pildimaailm on iseseisev organism, mis ajuti genereerib ootamatuid tähenduslikke lühiühendusi. Erinevalt loodusmaalijatest, portreemaalijatest, meremaalijatest ja teistest maalib Rein Tammik pilte. Ta on pildimaalija. Tammikut huvitavad eelkõige visuaalsed paradoksid. Tammik asus juba 1970. aastail ajastuid ühte pilti kokku keevitama. Rembrandti grupiportreele «Kangrute gildi eesistujaist» ilmusid «Visarite» näod, Manet’ «Eine murul» leidis järsku aseme punaruudulisel linal jne. Historitsistlik eklektika - postmodernismi peamisi strateegiaid - on Tammiku loomingus täiesti selgelt loetav, teda on nimetatud esimeseks nõukogude postmodernistiks. Teatav nõukogude ajastu traumaatiline tajumine ilmneb tema töödes suuresti igatsusest kestvuse, jätkuvuse ja üldkehtivuse järele, mida 1970-1980-ndad aastad ei võimaldanud. 1992. aastast resideerub Prantsusmaal

  17. [The development of Rein van Bemmelens (1904-1983) undation theory: forty years of Dutch geology].

    Science.gov (United States)

    Barzilay, Willemjan

    2009-01-01

    The Dutch geologist Rein van Bemmelen was the greatest opponent of plate tectonics in The Netherlands. He lived and worked during an important period in the history of earth sciences. He had studied geology when Wegeners theory was introduced and enthusiastically received in the Netherlands and he worked as a geologists during the period in which, after Wegeners theory was rejected in The Netherlands, several Dutch geologists came with their own theories to explain the origin of continents and oceans and in which plate tectonics was introduced in The Netherlands. He had proposed his own theory, the undation theory, at the beginning of the 1930s and kept on developing it during the following years. He continued to do so until his death in 1983. The history of the undation theory thus sheds light on the history of geology in The Netherlands. I will trace the history of geology in The Netherlands using Rein van Bemmelen and his undation theory as a lens.

  18. Rein: Taming Tail Latency in Key-Value Stores via Multiget Scheduling

    KAUST Repository

    Reda, Waleed

    2017-04-17

    We tackle the problem of reducing tail latencies in distributed key-value stores, such as the popular Cassandra database.We focus on workloads of multiget requests, which batch together access to several data elements and parallelize read operations across the data store machines. We first analyze a production trace of a real system and quantify the skew due to multiget sizes, key popularity, and other factors. We then proceed to identify opportunities for reduction of tail latencies by recognizing the composition of aggregate requests and by carefully scheduling bottleneck operations that can otherwise create excessive queues. We design and implement a system called Rein, which reduces latency via inter-multiget scheduling using low overhead techniques. We extensively evaluate Rein via experiments in Amazon Web Services (AWS) and simulations. Our scheduling algorithms reduce the median, 95, and 99 percentile latencies by factors of 1.5, 1.5, and 1.9, respectively.

  19. The use of a rein tension device to compare different training methods for neck flexion in base-level trained Warmblood horses at the walk.

    Science.gov (United States)

    Veen, I; Killian, D; Vlaminck, L; Vernooij, J C M; Back, W

    2018-03-08

    Debate surrounds the use of high rein tension for obtaining different head and neck positions in the training of sport horses on account of possible welfare issues. To compare auxiliary rein tension in two methods (Draw Reins and Concord Leader) for obtaining a standardised head and neck position on a hard and a soft surface. Intervention study. Left and right rein tensions were measured in 11 base-level trained client-owned sport horses (mean age ± s.d.; 10 ± 3.2 years) exercised in-hand with, in a random order, conventional draw reins or the newly developed Concord Leader in a standardised head and neck position. Rein tension was measured using a calibrated device operating at 10 Hz during six runs of 15 s in a straight line for each training method on both a hard and a soft surface. A linear mixed model and grouped logistic regression analysis were applied to compare the two methods (Preins than with the Concord Leader. The rein tension (mean sum of the force applied, in N) of the draw reins was 13.8 times higher than that of the Concord Leader. This study was performed on horses exercised in-hand; however, these auxiliary aids are normally used when lungeing. Possible redirection of rein tension towards the poll was not measured. We showed that when using the Concord Leader a similar head and neck position is achieved with a much lower rein tension than with the draw reins and, more importantly, with a much greater likelihood of 0 N. It is unnecessary to use high auxiliary rein tension to obtain a standard, flexed head and neck position. © 2018 The Authors. Equine Veterinary Journal published by John Wiley & Sons Ltd on behalf of EVJ Ltd.

  20. System overview of the fully implantable destination therapy--ReinHeart-total artificial heart.

    Science.gov (United States)

    Pelletier, Benedikt; Spiliopoulos, Sotirios; Finocchiaro, Thomas; Graef, Felix; Kuipers, Kristin; Laumen, Marco; Guersoy, Dilek; Steinseifer, Ulrich; Koerfer, Reiner; Tenderich, Gero

    2015-01-01

    Owing to the lack of suitable allografts, the demand for long-term mechanical circulatory support in patients with biventricular end-stage heart failure is rising. Currently available Total Artificial Heart (TAH) systems consist of pump units with only limited durability, percutaneous tubes and bulky external equipment that limit the quality of life. Therefore we are focusing on the development of a fully implantable, highly durable destination therapy total artificial heart. The ReinHeart-TAH system consists of a passively filling pump unit driven by a low-wear linear drive between two artificial ventricles, an implantable control unit and a compliance chamber. The TAH is powered by a transcutaneous energy transmission system. The flow distribution inside the ventricles was analysed by fluid structure interaction simulation and particle image velocimetry measurements. Along with durability tests, the hydrodynamic performance and flow balance capability were evaluated in a mock circulation loop. Animal trials are ongoing. Based on fluid structure interaction simulation and particle image velocimetry, blood stagnation areas have been significantly reduced. In the mock circulation loop the ReinHeart-TAH generated a cardiac output of 5 l/min at an operating frequency of 120 bpm and an aortic pressure of 120/80 mmHg. The highly effective preload sensitivity of the passively filling ventricles allowed the sensorless integration of the Frank Starling mechanism. The ReinHeart-TAH effectively replaced the native heart's function in animals for up to 2 days. In vitro and in vivo testing showed a safe and effective function of the ReinHeart-TAH system. This has the potential to become an alternative to transplantation. However, before a first-in-man implant, chronic animal trials still have to be completed. © The Author 2014. Published by Oxford University Press on behalf of the European Association for Cardio-Thoracic Surgery. All rights reserved.

  1. Le kyste hydatique du rein fistulisé dans les voies urinaires, prise en ...

    African Journals Online (AJOL)

    Les suites ont été marquées par une fistule stercorale colique chez un patient et deux cas d'infection de paroi. Conclusion: Tout kyste hydatique du rein doit avoir un bilan d'imagerie comportant un uroscanner avec des clichés tardifs à la recherche d'une fistulisation dans la voie excrétrice urinaire. Il est conseillé de mettre ...

  2. De ontwikkelingsgeschiedenis van Rein van Bemmelens (1904-1983 undatietheorie: veertig jaar Nederlandse geologie

    Directory of Open Access Journals (Sweden)

    Willemjan Barzilay

    2009-03-01

    Full Text Available The development of Rein van Bemmelens (1904-1983 undation theory: Forty years of Dutch geology The Dutch geologist Rein van Bemmelen was the greatest opponent of plate tectonics in the Netherlands. He lived and worked during an important period in the history of earth sciences. He had studied geology when Wegeners theory was introduced and enthusiastically received in the Netherlands and he worked as a geologists during the period in which, after Wegeners theory was rejected in the Netherlands, several Dutch geologists came with their own theories to explain the origin of continents and oceans and in which plate tectonics was introduced in the Netherlands. He had proposed his own theory, the undation theory, at the beginning of the 1930s and kept on developing it during the following years. He continued to do so until his death in 1983. The history of the undation theory thus sheds light on the history of geology in the Netherlands. I will trace the history of geology in the Netherlands using Rein van Bemmelen and his undation theory as a lense.

  3. Direct Observations of ULF and Whistler-Mode Chorus Modulation of 500eV EDI Electrons by MMS

    Science.gov (United States)

    Paulson, K. W.; Argall, M. R.; Ahmadi, N.; Torbert, R. B.; Le Contel, O.; Ergun, R.; Khotyaintsev, Y. V.; Strangeway, R. J.; Magnes, W.; Russell, C. T.

    2016-12-01

    We present here direct observations of chorus-wave modulated field-aligned 500 eV electrons using the Electron Drift Instrument (EDI) on board the Magnetospheric Multiscale mission. These periods of wave activity were additionally observed to be modulated by Pc5-frequency magnetic perturbations, some of which have been identified as drifting mirror-mode structures. The spacecraft encountered these mirror-mode structures just inside of the duskside magnetopause. Using the high sampling rate provided by EDI in burst sampling mode, we are able to observe the individual count fluctuations of field-aligned electrons in this region up to 512 Hz. We use the multiple look directions of EDI to generate both pitch angle and gyrophase plots of the fluctuating counts. Our observations often show unidirectional flow of these modulated electrons along the background field, and in some cases demonstrate gyrophase bunching in the wave region.

  4. Research-Based Teacher Education and Professional Development. Achievements and Contributions of EDiTE

    Directory of Open Access Journals (Sweden)

    Rozalia Małgorzata Ligus

    2013-12-01

    Full Text Available This article’s aim is to describe some of the sources of the European debate over the third cycle studies in teacher education in Europe. Then it will introduce the international Project EDiTE as one of the collaborative initiatives concerning the European scientific proposal of the teachers’ lifelong learning development. Next, some good practices of promoting the doctoral research based teacher education on national levels will be presented. Finally, in the article, there will be revealed selected findings of the EDiTE team that are focused on the current needs in teacher education that have been pointed by different stakeholders of five European countries represented by the project consortium, while interviewing them in 2013 y. The main goal of this article is to involve the stakeholders in a thought provoking debate for future roles of teachers in Europe, but not through looking for a ‘standardized teacher model’ or to create a ‘European super teacher’, but to see the dilemmas that should be shared while questioning ‘What makes a teacher European?,’ as Michael Schratz underlines, in a diversity of national identities and in the face of challenges of 21st century.

  5. Conventional resin cation exchangers versus EDI for CACE measurement in power plants. Feasibility and practical field results

    Energy Technology Data Exchange (ETDEWEB)

    Sigrist, Manuel [Swan Systeme AG, Hinwil (Switzerland)

    2017-10-15

    The conductivity measurement after a cation exchanger in power plants with steam turbines was introduced soon after 1950 by Larson and Lane. Due to the simple measuring principle, the sensitivity to ionic contaminations and to its high reliability, the conductivity measurement after a cation exchanger (CACE) has become the most commonly used online analytical method in power plants with steam generators. Swan has investigated electro deionisation (EDI) as substitution of the conventional cation exchange resin and has developed a new conductivity instrument using this principle. This paper provides a description of the conventional method for cation conductivity measurements as well as of the new AMI CACE using EDI method.

  6. Conventional resin cation exchangers versus EDI for CACE measurement in power plants. Feasibility and practical field results

    International Nuclear Information System (INIS)

    Sigrist, Manuel

    2017-01-01

    The conductivity measurement after a cation exchanger in power plants with steam turbines was introduced soon after 1950 by Larson and Lane. Due to the simple measuring principle, the sensitivity to ionic contaminations and to its high reliability, the conductivity measurement after a cation exchanger (CACE) has become the most commonly used online analytical method in power plants with steam generators. Swan has investigated electro deionisation (EDI) as substitution of the conventional cation exchange resin and has developed a new conductivity instrument using this principle. This paper provides a description of the conventional method for cation conductivity measurements as well as of the new AMI CACE using EDI method.

  7. Analysis of Dream in Gholamhossein Sa'edi's Short Stories: A Model for Dream Analysis in Literary Works

    Science.gov (United States)

    Veskari, Hassan; Pouralkhas, Shokrollah; Moharrami, Ramin; Ranjbar, Ebrahim

    2017-01-01

    Gholam Hussein Sa'edi is one of the greatest Iranian writers of short stories in the present era. Sa'edi's stories are based on the existence of fanciful and dreamlike settings in which he attempts to establish the endings of the stories to be the direct result of the characters' psychological reaction against their dreams. The linguistic and…

  8. Mining inter-organizational business process models from EDI messages : a case study from the automotive sector

    NARCIS (Netherlands)

    Engel, R.; Aalst, van der W.M.P.; Zapletal, M.; Pichler, C.; Werthner, H.; Ralyté, J.; Franch, X.; Brinkkemper, S.; Wrycza, S.

    2012-01-01

    Traditional standards for Electronic Data Interchange (EDI), such as EDIFACT and ANSI X12, have been employed in Business-to-Business (B2B) e-commerce for decades. Due to their wide industry coverage and long-standing establishment, they will presumably continue to play an important role for some

  9. Inter-Organizational Trust in EDI Adoption: The Case of Ford Motor Company and PBR Limited in Australia.

    Science.gov (United States)

    Ratnasingam, Pauline

    2001-01-01

    This study examines behavioral dimensions of trading partner trust in EDI (electronic data interchange) adoption via a qualitative interpretative case study conducted between an automotive manufacturer (Ford Motor Company) in Australia and their first tier supplier, PBR Limited. Findings suggest that trust is important for cooperative long-term…

  10. O Encheirídion de Epicteto: Edição Bilíngue

    Directory of Open Access Journals (Sweden)

    Aldo Lopes Dinucci

    2012-02-01

    Full Text Available Edição bilíngue do Encheirídion de Epicteto, obra do aluno de Epicteto (55-135 e cidadão romano de origem grega Lúcio Flávio Arriano de Nicomédia (86-160. Tal tradução, produzida por Aldo Dinucci (doutor em filosofia pela PUC-RJ e professor associado do Departamento de Filosofia da UFS e Alfredo Julien (doutor em história pela USP e professor adjunto do Departamento de História da UFS, foi financiada pelo CNPq (edital MCT/CNPq 02/2009 - Ciências Humanas, Sociais e Sociais Aplicadas.

  11. Millisecond resolution electron fluxes from the Cluster satellites: Calibrated EDI ambient electron data

    Science.gov (United States)

    Förster, Matthias; Rashev, Mikhail; Haaland, Stein

    2017-04-01

    The Electron Drift Instrument (EDI) onboard Cluster can measure 500 eV and 1 keV electron fluxes with high time resolution during passive operation phases in its Ambient Electron (AE) mode. Data from this mode is available in the Cluster Science Archive since October 2004 with a cadence of 16 Hz in the normal mode or 128 Hz for burst mode telemetry intervals. The fluxes are recorded at pitch angles of 0, 90, and 180 degrees. This paper describes the calibration and validation of these measurements. The high resolution AE data allow precise temporal and spatial diagnostics of magnetospheric boundaries and will be used for case studies and statistical studies of low energy electron fluxes in the near-Earth space. We show examples of applications.

  12. Drought severity in intensive agricultural areas by means of the EDI index

    Science.gov (United States)

    Procházková, Petra; Chuchma, Filip; Středa, Tomáš

    2016-12-01

    The aim of this work was the evaluation of drought severity development in the Czech Republic for the period 1971-2015 by the means of the Effective Drought Index (EDI). Annual values of the EDI index were determined using the method of effective precipitation for 14 localities spread throughout the Czech Republic (Central Europe). The seven categories were created according to obtained index values for the drought conditions determination for years during the period 1971-2015 through the percentile method. The annual index values were compared with acquired 2nd, 15th, 45th, 55th, 85th and 98th percentiles. Both the years with precipitation unfavourable conditions: 1972, 1973, 1984, 1990, 1991, 1992, 1993 and 2015 and the years with precipitation favourable conditions: 1977, 1987, 1995, 2001, 2002 and 2010 were determined. Precipitation conditions in the growing season from 61st to 180th day of the year were also analysed. This evaluation was conducted during the period 1971-2015 through the ten-day index values which were compared with acquired 2nd, 15th, 45th, 55th, 85th and 98th percentiles. Dry growing seasons occurred in 1973, 1974, 1976 and 1993. Wet growing seasons occurred in 1987, 2006 and 2010. Trend analysis of annual index values was performed through the Mann-Kendall test. Highly statistically significant increasing linear trends (P < 0.01) were found for four localities (Uherský Ostroh, Vysoká, Znojmo-Oblekovice and Žatec); statistically significant increasing trends (P < 0.05) were found for three localities (Brno-Chrlice, Lednice and Lípa). Based on the extrapolation of the trend, a slightly higher effective precipitation can be expected during the year in a substantial part of the country. However, these findings do not necessarily mean an optimal supply of agricultural land with water. Precipitation exhibits considerable unevenness of distribution through time. Given the increasing evapotranspiration demands of the environment their

  13. Transfer of Air Force technical procurement bid set data to small businesses, using CALS and EDI: Test report

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    1994-08-15

    This report documents a test transfer of three Air Force technical procurement bid sets to one large and twelve small businesses, using the Department of Defense (DoD) Continuous Acquisition and Life-cycle Support (CALS) and ANSI ASC X12 Electronic Data Interchange (EDI) standards. The main goal of the test was to evaluate the effectiveness of using CALS technical data within the context of the DoD`s EDI-based standard approach to electronic commerce in procurement, with particular emphasis on receipt and use of the data by small contractors. Air Force procurement data was provided by the Sacramento Air Logistics Center at McClellan Air Force Base; the manufacturing participants were selected from among McClellan`s ``Blue Ribbon`` contractors, located throughout the US. The test was sponsored by the Air Force CALS Test Network, headquartered at Wright-Patterson Air Force Base. The test successfully demonstrated the technical feasibility of including CALS MIL-R-28002 (Raster) engineering data in an EDI Specification/Technical Information transaction set (ANSI ASC X12 841) when issuing electronic requests for quotation to small businesses. In many cases, the data was complete enough for the contractor participant to feel comfortable generating a quote. Lessons learned from the test are being fed back to the CALS and EDI standards organizations, and to future implementors of CALS-EDI based acquisition or contracting systems, which require the transfer of technical information, such as engineering data, manufacturing process data, quality test data, and other product or process data, in the form of a CALS or other digital datafile.

  14. Feng shui väärtus on vaimujõus / Marika Tomberg ; komment. Lea Eermann, komment. Rein Weber

    Index Scriptorium Estoniae

    Tomberg, Marika

    1999-01-01

    Feng shui järgi korraldatud Lea Eermanni kodust Nõmmel. Feng shui- ja geobioloogia-alase nõustamisega tegelev arhitekt Rein Weber keskkonna mõjust tervisele, magamistoast. Enda ja maja kaitsmisest halbade mõjude eest. 10 illustratsiooni

  15. Transfer of Air Force technical procurement bid set data to small businesses, using CALS and EDI. Summary report. Revision 1

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    1995-01-10

    This report provides a summary of the Air Force CALS Test Network (AFCTN) Test Report Transfer of Air Force Technical Procurement Bid Set Data to Small Businesses, Using CALS and EDI (AFCTN Test Report 94-034, UCRL-ID-118619). It represents a synthesis of the results, conclusions, and recommendations, as well as a more concise presentation of the issues and strategies as viewed from AFCTN`s perspective. This report documents a test transfer of three Air Force technical procurement bid sets to one large and twelve small businesses, using the Department of Defense (DoD) Continuous Acquisition and Life-cycle Support (CALS) and ANSI ASC X12 Electronic Data Interchange (EDI) standards. The main goal of the test was to evaluate the effectiveness of using CALS technical data within the context of the DoD`s EDI-based standard approach to electronic commerce in procurement, with particular emphasis on receipt and use of the data by small contractors. Air Force procurement data was provided by the Sacramento Air Logistics Center at McClellan Air Force Base; the manufacturing participants were selected from among McClellan`s {open_quote}Blue Ribbon{close_quote} contractors, located throughout the United States. The test was sponsored by the Air Force CALS Test Network, headquartered at Wright-Patterson Air Force Base. The test successfully demonstrated the technical feasibility of including CALS MIL-R-28002 (Raster) engineering data in an EDI Specification/Technical Information transaction set (ANSI ASC X12 841) when issuing electronic requests for quotation to small businesses. In many cases, the data was complete enough for the contractor participant to feel comfortable generating a quote.

  16. Calibrating MMS Electron Drift Instrument (EDI) Ambient Electron Flux Measurements and Characterizing 3D Electric Field Signatures of Magnetic Reconnection

    Science.gov (United States)

    Shuster, J. R.; Torbert, R. B.; Vaith, H.; Argall, M. R.; Li, G.; Chen, L. J.; Ergun, R. E.; Lindqvist, P. A.; Marklund, G. T.; Khotyaintsev, Y. V.; Russell, C. T.; Magnes, W.; Le Contel, O.; Pollock, C. J.; Giles, B. L.

    2015-12-01

    The electron drift instruments (EDIs) onboard each MMS spacecraft are designed with large geometric factors (~0.01cm2 str) to facilitate detection of weak (~100 nA) electron beams fired and received by the two gun-detector units (GDUs) when EDI is in its "electric field mode" to determine the local electric and magnetic fields. A consequence of the large geometric factor is that "ambient mode" electron flux measurements (500 eV electrons having 0°, 90°, or 180° pitch angle) can vary depending on the orientation of the EDI instrument with respect to the magnetic field, a nonphysical effect that requires a correction. Here, we present determinations of the θ- and ø-dependent correction factors for the eight EDI GDUs, where θ (ø) is the polar (azimuthal) angle between the GDU symmetry axis and the local magnetic field direction, and compare the corrected fluxes with those measured by the fast plasma instrument (FPI). Using these corrected, high time resolution (~1,000 samples per second) ambient electron fluxes, combined with the unprecedentedly high resolution 3D electric field measurements taken by the spin-plane and axial double probes (SDP and ADP), we are equipped to accurately detect electron-scale current layers and electric field waves associated with the non-Maxwellian (anisotropic and agyrotropic) particle distribution functions predicted to exist in the reconnection diffusion region. We compare initial observations of the diffusion region with distributions and wave analysis from PIC simulations of asymmetric reconnection applicable for modeling reconnection at the Earth's magnetopause, where MMS will begin Science Phase 1 as of September 1, 2015.

  17. Choroidal Thickness Analysis in Patients with Usher Syndrome Type 2 Using EDI OCT.

    Science.gov (United States)

    Colombo, L; Sala, B; Montesano, G; Pierrottet, C; De Cillà, S; Maltese, P; Bertelli, M; Rossetti, L

    2015-01-01

    To portray Usher Syndrome type 2, analyzing choroidal thickness and comparing data reported in published literature on RP and healthy subjects. Methods. 20 eyes of 10 patients with clinical signs and genetic diagnosis of Usher Syndrome type 2. Each patient underwent a complete ophthalmologic examination including Best Corrected Visual Acuity (BCVA), intraocular pressure (IOP), axial length (AL), automated visual field (VF), and EDI OCT. Both retinal and choroidal measures were measured. Statistical analysis was performed to correlate choroidal thickness with age, BCVA, IOP, AL, VF, and RT. Comparison with data about healthy people and nonsyndromic RP patients was performed. Results. Mean subfoveal choroidal thickness (SFCT) was 248.21 ± 79.88 microns. SFCT was statistically significant correlated with age (correlation coefficient -0.7248179, p patients (p = 0.2138). Conclusions. Our study demonstrated in vivo choroidal thickness reduction in patients with Usher Syndrome type 2. These data are important for the comprehension of mechanisms of disease and for the evaluation of therapeutic approaches.

  18. Plasma convection in the magnetotail lobes: statistical results from Cluster EDI measurements

    Directory of Open Access Journals (Sweden)

    S. Haaland

    2008-08-01

    Full Text Available A major part of the plasma in the Earth's magnetotail is populated through transport of plasma from the solar wind via the magnetotail lobes. In this paper, we present a statistical study of plasma convection in the lobes for different directions of the interplanetary magnetic field and for different geomagnetic disturbance levels. The data set used in this study consists of roughly 340 000 one-minute vector measurements of the plasma convection from the Cluster Electron Drift Instrument (EDI obtained during the period February 2001 to June 2007. The results show that both convection magnitude and direction are largely controlled by the interplanetary magnetic field (IMF. For a southward IMF, there is a strong convection towards the central plasma sheet with convection velocities around 10 km s−1. During periods of northward IMF, the lobe convection is almost stagnant. A By dominated IMF causes a rotation of the convection patterns in the tail with an oppositely directed dawn-dusk component of the convection for the northern and southern lobe. Our results also show that there is an overall persistent duskward component, which is most likely a result of conductivity gradients in the footpoints of the magnetic field lines in the ionosphere.

  19. Choroidal Thickness Analysis in Patients with Usher Syndrome Type 2 Using EDI OCT

    Directory of Open Access Journals (Sweden)

    L. Colombo

    2015-01-01

    Full Text Available To portray Usher Syndrome type 2, analyzing choroidal thickness and comparing data reported in published literature on RP and healthy subjects. Methods. 20 eyes of 10 patients with clinical signs and genetic diagnosis of Usher Syndrome type 2. Each patient underwent a complete ophthalmologic examination including Best Corrected Visual Acuity (BCVA, intraocular pressure (IOP, axial length (AL, automated visual field (VF, and EDI OCT. Both retinal and choroidal measures were measured. Statistical analysis was performed to correlate choroidal thickness with age, BCVA, IOP, AL, VF, and RT. Comparison with data about healthy people and nonsyndromic RP patients was performed. Results. Mean subfoveal choroidal thickness (SFCT was 248.21±79.88 microns. SFCT was statistically significant correlated with age (correlation coefficient −0.7248179, p<0.01. No statistically significant correlation was found between SFCT and BCVA, IOP, AL, VF, and RT. SFCT was reduced if compared to healthy subjects (p<0.01. No difference was found when compared to choroidal thickness from nonsyndromic RP patients (p=0.2138. Conclusions. Our study demonstrated in vivo choroidal thickness reduction in patients with Usher Syndrome type 2. These data are important for the comprehension of mechanisms of disease and for the evaluation of therapeutic approaches.

  20. Free Rein

    Science.gov (United States)

    Galley, Michelle

    2004-01-01

    This article presents Fairhaven School, located in a still-bucolic area near Washington, which operates in a way that would baffle many educators, much less the public. Known as a "free school," Fairhaven offers students a radical alternative to the demands of traditional education since it was founded in 1998. In this article, the author…

  1. A novel PSB-EDI system for high ammonia wastewater treatment, biomass production and nitrogen resource recovery: PSB system.

    Science.gov (United States)

    Wang, Hangyao; Zhou, Qin; Zhang, Guangming; Yan, Guokai; Lu, Haifeng; Sun, Liyan

    A novel process coupling photosynthetic bacteria (PSB) with electrodeionization (EDI) treatment was proposed to treat high ammonia wastewater and recover bio-resources and nitrogen. The first stage (PSB treatment) was used to degrade organic pollutants and accumulate biomass, while the second stage (EDI) was for nitrogen removal and recovery. The first stage was the focus in this study. The results showed that using PSB to transform organic pollutants in wastewater into biomass was practical. PSB could acclimatize to wastewater with a chemical oxygen demand (COD) of 2,300 mg/L and an ammonia nitrogen (NH4(+)-N) concentration of 288-4,600 mg/L. The suitable pH was 6.0-9.0, the average COD removal reached 80%, and the biomass increased by an average of 9.16 times. The wastewater COD removal was independent of the NH4(+)-N concentration. Moreover, the PSB functioned effectively when the inoculum size was only 10 mg/L. The PSB-treated wastewater was then further handled in an EDI system. More than 90% of the NH4(+)-N was removed from the wastewater and condensed in the concentrate, which could be used to produce nitrogen fertilizer. In the whole system, the average NH4(+)-N removal was 94%, and the average NH4(+)-N condensing ratio was 10.0.

  2. Inter-instrument calibration using magnetic field data from Flux Gate Magnetometer (FGM) and Electron Drift Instrument (EDI) onboard Cluster

    Science.gov (United States)

    Nakamura, R.; Plaschke, F.; Teubenbacher, R.; Giner, L.; Baumjohann, W.; Magnes, W.; Steller, M.; Torbert, R. B.; Vaith, H.; Chutter, M.; Fornaçon, K.-H.; Glassmeier, K.-H.; Carr, C.

    2013-07-01

    We compare the magnetic field data obtained from the Flux-Gate Magnetometer (FGM) and the magnetic field data deduced from the gyration time of electrons measured by the Electron Drift Instrument (EDI) onboard Cluster to determine the spin axis offset of the FGM measurements. Data are used from orbits with their apogees in the magnetotail, when the magnetic field magnitude was between about 20 nT and 500 nT. Offset determination with the EDI-FGM comparison method is of particular interest for these orbits, because no data from solar wind are available in such orbits to apply the usual calibration methods using the Alfvén waves. In this paper, we examine the effects of the different measurement conditions, such as direction of the magnetic field relative to the spin plane and field magnitude in determining the FGM spin-axis offset, and also take into account the time-of-flight offset of the EDI measurements. It is shown that the method works best when the magnetic field magnitude is less than about 128 nT and when the magnetic field is aligned near the spin-axis direction. A remaining spin-axis offset of about 0.4 ~ 0.6 nT was observed between July and October 2003. Using multi-point multi-instrument measurements by Cluster we further demonstrate the importance of the accurate determination of the spin-axis offset when estimating the magnetic field gradient.

  3. Interinstrument calibration using magnetic field data from the flux-gate magnetometer (FGM) and electron drift instrument (EDI) onboard Cluster

    Science.gov (United States)

    Nakamura, R.; Plaschke, F.; Teubenbacher, R.; Giner, L.; Baumjohann, W.; Magnes, W.; Steller, M.; Torbert, R. B.; Vaith, H.; Chutter, M.; Fornaçon, K.-H.; Glassmeier, K.-H.; Carr, C.

    2014-01-01

    We compare the magnetic field data obtained from the flux-gate magnetometer (FGM) and the magnetic field data deduced from the gyration time of electrons measured by the electron drift instrument (EDI) onboard Cluster to determine the spin-axis offset of the FGM measurements. Data are used from orbits with their apogees in the magnetotail, when the magnetic field magnitude was between about 20 and 500 nT. Offset determination with the EDI-FGM comparison method is of particular interest for these orbits, because no data from solar wind are available in such orbits to apply the usual calibration methods using the Alfvén waves. In this paper, we examine the effects of the different measurement conditions, such as direction of the magnetic field relative to the spin plane and field magnitude in determining the FGM spin-axis offset, and also take into account the time-of-flight offset of the EDI measurements. It is shown that the method works best when the magnetic field magnitude is less than about 128 nT and when the magnetic field is aligned near the spin-axis direction. A remaining spin-axis offset of about 0.4 ∼ 0.6 nT was observed for Cluster 1 between July and October 2003. Using multipoint multi-instrument measurements by Cluster we further demonstrate the importance of the accurate determination of the spin-axis offset when estimating the magnetic field gradient.

  4. Eesti Päevaleht palus erinevate elualade esindajatel hinnata presidendikandidaatide ametissesobivust / Aivar Voog, Rein Ruutsoo, Kaur Hanson ; küsis Kai Kalamees

    Index Scriptorium Estoniae

    Voog, Aivar

    2001-01-01

    Presidendikandidaatide Toomas Savi, Andres Tarandi, Tunne Kelami, Peeter Kreitzbergi ja Peeter Tulviste kohta avaldavad arvamust Aivar Voog, Rein Ruutsoo, Kaur Hanson, Ivo Rull, Tarmu Tammerk, Mart Helme, Pavel Ivanov ja Jaan Kaplinski

  5. Ex uno plures´est e pluribus unum´ini? / Rein Müllerson ; inglise keelest tõlkinud Marek Laane

    Index Scriptorium Estoniae

    Müllerson, Rein, 1944-

    2010-01-01

    Õigusteadlane Rein Müllerson ühiskondliku mitmekesisuse ja homogeensuse arengutest, dissimilatsiooni asendumisest assimilatsiooniga, Ida ja Lääne ühiskondade ühildumisest üleilmastumise protsessis

  6. Assisted editing od SensorML with EDI. A bottom-up scenario towards the definition of sensor profiles.

    Science.gov (United States)

    Oggioni, Alessandro; Tagliolato, Paolo; Fugazza, Cristiano; Bastianini, Mauro; Pavesi, Fabio; Pepe, Monica; Menegon, Stefano; Basoni, Anna; Carrara, Paola

    2015-04-01

    Sensor observation systems for environmental data have become increasingly important in the last years. The EGU's Informatics in Oceanography and Ocean Science track stressed the importance of management tools and solutions for marine infrastructures. We think that full interoperability among sensor systems is still an open issue and that the solution to this involves providing appropriate metadata. Several open source applications implement the SWE specification and, particularly, the Sensor Observation Services (SOS) standard. These applications allow for the exchange of data and metadata in XML format between computer systems. However, there is a lack of metadata editing tools supporting end users in this activity. Generally speaking, it is hard for users to provide sensor metadata in the SensorML format without dedicated tools. In particular, such a tool should ease metadata editing by providing, for standard sensors, all the invariant information to be included in sensor metadata, thus allowing the user to concentrate on the metadata items that are related to the specific deployment. RITMARE, the Italian flagship project on marine research, envisages a subproject, SP7, for the set-up of the project's spatial data infrastructure. SP7 developed EDI, a general purpose, template-driven metadata editor that is composed of a backend web service and an HTML5/javascript client. EDI can be customized for managing the creation of generic metadata encoded as XML. Once tailored to a specific metadata format, EDI presents the users a web form with advanced auto completion and validation capabilities. In the case of sensor metadata (SensorML versions 1.0.1 and 2.0), the EDI client is instructed to send an "insert sensor" request to an SOS endpoint in order to save the metadata in an SOS server. In the first phase of project RITMARE, EDI has been used to simplify the creation from scratch of SensorML metadata by the involved researchers and data managers. An interesting by

  7. Rein Maran soovitab / Rein Maran

    Index Scriptorium Estoniae

    Maran, Rein, 1931-

    2007-01-01

    Silmas pidades 19. septembril avatavat 5. Matsalu rahvusvahelist loodusfilmide festivali kirjutab autor loodusfilmi rollist ja olemusest ning tutvustab Gay ja Anita Chaumette'i filmi "Räägime kaladega" ("Talking with Fishes") : Suurbritannia 2003

  8. Rein Lang: Eesti kõige väärtuslikum ressurss on mõistus / Rein Lang ; interv. Peep Lillemägi ; komment. Siim Kallas, Jüri Pihl, Väino Linde

    Index Scriptorium Estoniae

    Lang, Rein, 1957-

    2009-01-01

    Justiitsminister Rein Lang vastab küsimustele, mis puudutavad Ameerika Ühendriike kui vabaduse kantsi, ettevõtlusvabadust Ameerika Ühendriikides ja Eestis, tööd justiitsministrina, varasemat karjääri, Eesti põhiseaduse loomist, Euroopa Liidu aluslepingu välja töötamist, avaliku võimu rolli tänapäeva maailmas ning Eesti jõudmist Euroopa rikkamate riikide hulka

  9. L'adénome métanéphrique bilatéral du rein

    African Journals Online (AJOL)

    ra

    L'adénome métanéphrique du rein est une tumeur épithéliale bénigne rare. Son diagnostic est exclusivement histologique. Le diagnostic différentiel se fait essentiellement avec le néphroblastome et le carcinome papillaire à cellules rénales. L'étude cytogénétique apporte des éléments importants pour différencier entre ...

  10. A new method used in laparoscopic hysterectomy for uterine manipulation: uterine rein technique.

    Science.gov (United States)

    Boztosun, Abdullah; Atılgan, Remzi; Pala, Şehmus; Olgan, Şafak

    2018-03-22

    The aim of this study is to define a new method of manipulating the uterus during laparoscopic hysterectomy. A total laparoscopic hysterectomy (TLH) with the newly defined technique was performed in 29 patients between July 2016 and July 2017. In this new technique, the uterus was bound from uterine corpus and fundus like a bridle with polyester tape, to allow abdominal manipulation. The technique was successfully performed at the first attempt in 93.1% of cases. It was repeated in two cases (6.9%) since the polyester tape departed away from the uterus at the first attempt. The mean application time was 11.2 min. The vaginal manipulator was not required in any of the cases. There were no intraoperative complications. In conclusion, this method has the advantages of not requiring any vaginal manipulator, reducing the number of people required during operation, permitting a near maximum manipulation of the uterus in all three dimensions, and giving the control of these manipulations directly to the surgeon. On the other hand, the technique also has some inadequacies which should be discussed and improved on in the future. Impact of statement What is already known on this subject? In a laparoscopic hysterectomy, manipulation of the uterus is essential for anatomical dissection of the regions and completion of the operation without complications. An ideal uterine manipulator is defined as inexpensive, as convenient, fast and suitable for injecting solutions, removing the need for an assistant and most importantly offering the most suitable range of motion. In this study, we describe a new and different technique (rein technique) allowing the abdominal manipulation of the uterus in a laparoscopic hysterectomy and discuss the advantages and disadvantages of this method. What do the results of this study add? The procedure was easily accomplished in most patients. We did not need to use an extra uterine manipulator in any of the cases. What are the implications of these

  11. The French Chronic Kidney Disease-Renal Epidemiology and Information Network (CKD-REIN) cohort study.

    Science.gov (United States)

    Stengel, Bénédicte; Combe, Christian; Jacquelinet, Christian; Briançon, Serge; Fouque, Denis; Laville, Maurice; Frimat, Luc; Pascal, Christophe; Herpe, Yves-Edouard; Deleuze, Jean-François; Schanstra, Joost; Pisoni, Ron L; Robinson, Bruce M; Massy, Ziad A

    2014-08-01

    While much has been learned about the epidemiology and treatment of end-stage renal disease (ESRD) in the last 30 years, chronic kidney disease (CKD) before the end-stage has been less investigated. Not enough is known about factors associated with CKD progression and complications, as well as its transition to ESRD. We designed the CKD-renal epidemiology and information network (REIN) cohort to provide a research platform to address these key questions and to assess clinical practices and costs in patients with moderate or advanced CKD. A total of 46 clinic sites and 4 renal care networks participate in the cohort. A stratified selection of clinic sites yields a sample that represents a diversity of settings, e.g. geographic region, and public versus for-profit and non-for-profit private clinics. In each site, 60-90 patients with CKD are enrolled at a routine clinic visit during a 12-month enrolment phase: 3600 total, including 1800 with Stage 3 and 1800 with Stage 4 CKD. Follow-up will continue for 5 years, including after initiation of renal replacement therapy. Data will be collected from medical records at inclusion and at yearly intervals, as well as from self-administered patient questionnaires and provider-level questionnaires. Patients will also be interviewed at baseline, and at 1, 3 and 5 years. Healthcare costs will also be determined. Blood and urine samples will be collected and stored for future studies on all patients at enrolment and at study end, and at 1 and 3 years in a subsample of 1200. The CKD-REIN cohort will serve to improve our understanding of the biological, clinical and healthcare system determinants associated with CKD progression and adverse outcomes as well as of international variations in collaboration with the CKD Outcome and Practice Pattern Study (CKDopps). It will foster CKD epidemiology and outcomes research and provide evidence to improve the health and quality of life of patients with CKD and the performances of the

  12. Numerical investigation to the dual-fuel spray combustion process in an ethanol direct injection plus gasoline port injection (EDI + GPI) engine

    International Nuclear Information System (INIS)

    Huang, Yuhan; Hong, Guang; Huang, Ronghua

    2015-01-01

    Highlights: • A 5D PDF table was used to model the dual-fuel turbulence–chemistry interactions. • The cooling effect of ethanol direct injection (EDI) was examined. • The higher flame speed of ethanol in EDI + GPI increased the thermal efficiency. • The partially premixed combustion in EDI + GPI reduced the combustion temperature. • Ethanol’s low evaporation rate in low temperature led to incomplete combustion. - Abstract: Ethanol direct injection plus gasoline port injection (EDI + GPI) is a new technology to make the use of ethanol fuel more effective and efficient in spark ignition engines. Multi-dimensional computational fluid dynamics modelling was conducted on an EDI + GPI engine in both single and dual fuelled conditions. The in-cylinder flow field was solved in the realizable k−ε turbulence model with detailed engine geometry. The temporal and spatial distributions of the liquid and vapour fuels were simulated with the spray breakup and evaporation models. The combustion process was modelled with the partially premixed combustion concept in which both mixture fraction and progress variable were solved. The three-dimensional and five-dimensional presumed Probability Density Function (PDF) look-up tables were used to model the single-fraction-mixture and two-fraction-mixture turbulence–chemistry interactions respectively. The model was verified by comparing the numerical and experimental results of spray pattern and cylinder pressure. The simulation results showed that the combustion process of EDI + GPI dual-fuelled condition was partially premixed combustion because of the low evaporation rate of ethanol spray in low temperature environment before combustion. Compared with GPI only, the higher flame speed of ethanol fuel contributed to the greater pressure rise rate and maximum cylinder pressure in EDI + GPI condition, which consequently resulted in higher power output and thermal efficiency. The lower adiabatic flame temperature of

  13. Livros do Brasil e a edição de romances brasileiros em Portugal nos anos 1940

    Directory of Open Access Journals (Sweden)

    Thiago Mio Salla

    2017-12-01

    Full Text Available Enquanto esforço de historiografia literária e editorial, o presente artigo tem como objetivo lançar luz sobre as edições portuguesas de romances brasileiros realizadas pela editora Livros do Brasil, casa fundada em Lisboa, em 1944, por António de Sousa Pinto. A partir da recuperação de fontes primárias (com destaque para cartas e contratos, examinam-se, sobretudo, as negociações travadas entre Sousa Pinto e José Olympio no que diz respeito à edição, em Portugal, de títulos de dois importantes autores de nossa chamada geração de 1930: José Lins do Rego e Rachel de Queiroz. Mais especificamente, recupera-se o embate travado entre a atitude interventiva do editor luso, que defendia a necessidade de se ajustar o texto das obras de ambos os escritores à variante europeia do idioma, de modo a aproximá-las do leitorado português, e a recusa inicial dos romancistas, que exigiam o respeito estrito aos “brasileirismos” por eles empregados.

  14. Une reine entre ombres et lumières ou le pouvoir au féminin : le cas d’Isabelle Bourbon, reine d’Espagne, première femme de Philippe IV (1603-1644

    Directory of Open Access Journals (Sweden)

    Frédérique Sicard

    2009-09-01

    Full Text Available Le rôle de la Reine et sa relation au pouvoir sont strictement réglementés, mais son influence politique est paradoxalement difficile à apprécier car elle s’exerce à l’ombre de ce qui est permis. Isabelle de Bourbon, née Princesse de France, épouse en 1615 le Prince héritier Philippe d’Espagne et fait partie de ces Reines de l’ombre, peu étudiées. Elevée dans une certaine liberté, le contraste avec la cour d’Espagne et la surveillance de l’omniprésent Favori, le Comte-Duc d’Olivares, lui pèsent d’autant plus. Quel éclairage le cas de la Reine Isabelle permet-il d’apporter à la relation entre genre et pouvoir au Siècle d’Or ? Trois points seront abordés : les tensions et dominations qui se jouent autour du Roi Philippe IV, le poids de la famille, au sens large, indissociable des relations entretenues entre genre et pouvoir. Enfin, nous nous intéresserons à l’activité politique de la Reine Isabelle.The role of French queens and their relation to power were strictly regulated, but their political influence is difficult to assess given the shadows within which they worked. In 1615, Isabelle of Bourbon, born Princess of France, married Philip of Spain and became one of these seldom-studied Queens of the shadows. What illumination does Queen Isabelle’s case bring to the gender-power relationship during the Golden Age? Three points are addressed in the article: the tensions and power dynamics around Philip IV; the weight of the family, in a broad sense, which necessarily affected relations between gender and power. Finally, we will focus on the political activity of Queen Isabelle; her example constitutes a concrete example of women’s power in the Golden Age.

  15. Omnidirectional Internal Fixation by Double Approaches for Treating Rüedi-Allgöwer Type III Pilon Fractures.

    Science.gov (United States)

    Dai, Chong-Hua; Sun, Jun; Chen, Kun-Quan; Zhang, Hui-Bo

    In the present study, we explored the effectiveness and complications of omnidirectional internal fixation using a double approach for treating Rüedi-Allgöwer type III pilon fractures. A retrospective analysis was performed of 19 cases of Rüedi-Allgöwer type III unilateral closed pilon fracture. With preoperative preparation and correct surgical timing, the reduction was performed using anteromedial and posterolateral approaches, and the fracture fragments were fixed by omnidirectional internal fixation. Imaging evaluation was performed using the Burwell-Charnley scoring system. The Johner-Wruhs scoring system was used to assess the functional status of the patients. A comprehensive evaluation of efficacy was performed using a 5-point Likert score. The complications were also recorded and analyzed. All patients were followed up for an average of 16.2 months. The operative incisions of 15 cases healed by primary intent and with delayed healing in 4. All patients had achieved bony union at an average of 16 weeks postoperatively. No deep infection, broken nail or withdrawn nail, exposed plate, or skin flap necrosis occurred. The Burwell-Charnley imaging evaluation showed that 14 patients had anatomic reduction of the articular surface and 5 had acceptable reduction. Using the Johner-Wruhs scoring system, the results were excellent for 8, good for 7, fair for 2, and poor for 2 patients; the combined rate of excellent and good results was 78.9%. The Likert score of efficacy self-reported by the patients was 3 to 4 points for 12 patients, 2 points for 4 patients, and 0 to 1 point for 3 patients. The Likert score of therapeutic efficacy reported by the physicians was 3 to 4 points for 10 patients, 2 points for 5 patients, and 0 to 1 point for 4 patients. Omnidirectional internal fixation using double approaches was an effective method to treat Rüedi-Allgöwer type III pilon fractures with satisfactory reduction and rigid fixation, good joint function recovery, and

  16. Tulevast aastast alustab tööd elektrooniline andmevahetussüsteem EDI : piiriületus muutub kiiremaks / Margo Kokerov

    Index Scriptorium Estoniae

    Kokerov, Margo, 1978-

    2001-01-01

    Eesti kaubaveo logistika elektroonilise andmevahetussüsteemi EDI (Electronic Data Interchange) projekti esimese etapina käivitub piiriületuse dokumentatsiooni ja kaubadeklaratsioonide elektroonilise esitamise võimalus. Toivo Jürgenson ja Jaan Pillesaar e-piiriületuse eelistest

  17. The essential of 2012 results from the French Renal Epidemiology and Information Network (REIN) ESRD registry.

    Science.gov (United States)

    Lassalle, Mathilde; Ayav, Carole; Frimat, Luc; Jacquelinet, Christian; Couchoud, Cécile

    2015-04-01

    The French Renal Epidemiology and Information Network (REIN) registry began in 2002 to provide a tool for public health decision support, evaluation and research related to renal replacement therapies (RRT) for end-stage renal disease (ESRD). It is relying on a network of nephrologists, epidemiologists, patients and public health representatives. Continuous registration covers all dialysis and transplanted patients. In 2012, in France, 10,048 patients started a RRT (154 per million inhabitants). Elders provided majority of new patients (median age at RRT start: 70 years old). New patients had a high and age increasing rate of comorbidities, especially diabetes (42% of the new patients) and cardiovascular comorbidities (>50% of the new patients). Like previous years, incidence is stabilized. On December 31, 2012, 73,491 patients were receiving a RRT in France (1127 per million inhabitants, 56% on dialysis and 44% living with a functional renal transplant). More than 50% of patients were undergoing in-center hemodialysis with significant variations among regions. An increase in medical satellite unit hemodialysis but a decrease in self-care unit hemodialysis rates were noticed across the time, whereas peritoneal dialysis remained stable at 7%. Five years after starting RRT, the overall survival rate was 51% but only 16% among patients over 85 years. Mortality rate was highly dependent on treatment and age; transplanted patients aged 60-69 had a 27/1000 patients-year mortality rate versus 133 for a dialysis patient. Patients who started dialysis had a probability of first wait-listing of 4.8% at the start of dialysis (pre-emptive registrations) and 27% at 72 months. Whatever their diabetes status was, patients older than 60 had poor access to the waiting list. Seventeen percent of the patients received a first renal transplant within 15.4 month median time; 3% had received a pre-emptive graft. Ten years after the start of the French ESRD registry, this report provides

  18. High-latitude plasma convection during Northward IMF as derived from in-situ magnetospheric Cluster EDI measurements

    Directory of Open Access Journals (Sweden)

    M. Förster

    2008-09-01

    Full Text Available In this study, we investigate statistical, systematic variations of the high-latitude convection cell structure during northward IMF. Using 1-min-averages of Cluster/EDI electron drift observations above the Northern and Southern polar cap areas for six and a half years (February 2001 till July 2007, and mapping the spatially distributed measurements to a common reference plane at ionospheric level in a magnetic latitude/MLT grid, we obtained regular drift patterns according to the various IMF conditions. We focus on the particular conditions during northward IMF, where lobe cells at magnetic latitudes >80° with opposite (sunward convection over the central polar cap are a permanent feature in addition to the main convection cells at lower latitudes. They are due to reconnection processes at the magnetopause boundary poleward of the cusp regions. Mapped EDI data have a particular good coverage within the central part of the polar cap, so that these patterns and their dependence on various solar wind conditions are well verified in a statistical sense. On average, 4-cell convection pattern are shown as regular structures during periods of nearly northward IMF with the tendency of a small shift toward negative clock angles. The positions of these high-latitude convection foci are within 79° to 85° magnetic latitude and 09:00–15:00 MLT. The MLT positions are approximately symmetric ±2 h about 11:30 MLT, i.e. slightly offset from midday toward prenoon hours, while the maximum (minimum potential of the high-latitude cells is at higher magnetic latitudes near their maximum potential difference at ≈−10° to −15° clock angle for the North (South Hemisphere. With increasing clock angle distances from ≈IMFBz+, a gradual transition occurs from the 4-cell pattern via a 3-cell to the common 2-cell convection pattern, in the course of which one of the medium-scale high-latitude dayside cells diminishes and disappears while the

  19. Arhitektuurselt põnev, kuid muuseumina saamatu võidutöö : ERM / Rein Murula ; interv. Reet Varblane

    Index Scriptorium Estoniae

    Murula, Rein, 1955-

    2006-01-01

    Intervjuu Eesti Rahva Muuseumi hoone arhitektuurivõistluse žüriiliikme arhitekt Rein Murulaga. Konkursist, kaasaegsest muuseumihoonest, võidutööst "Memory Field" (autorid itaalia arhitekt Dan Dorell, liibanoni arhitekt Lina Ghotmeh, jaapani arhitekt Tsuyoshi Tane), II preemia saanud tööst "Gems" (autorid soome arhitektid Juho Grönholm, Antti Nousjoki, Janne Teräsvirta, Samuli Woolston), III preemia saanud tööst "Estonia is on the verge of a new millennium" (autorid austria arhitektid Alfred Bramberger, Thomas Pucher, Heidrun Steinhauser, Martin Mathy, Christa Pucher), ostupreemia pälvinud töödest "Crochet" (AB Kosmos: Ott Kadarik, Villem Tomiste, Mihkel Tüür, Krista Saluveer, Urmas Oja) ja "Lake Whisper" (autorid šveitsi arhitektid Manuel Bieler, Marco de Francesco, Antoine Robert-Grandpierre, Laurent Saurer)

  20. Sarcome à cellules claires du rein : À propos d’un cas chez un jeune de 17 ans

    Science.gov (United States)

    Mazdar, Adil; Sakel, Adil Ait; Essatara, Younes; Beddouche, Ali; Elsayegh, Hachem; Iken, Ali; Benslimane, Lounis; Nouini, Yassine

    2014-01-01

    Résumé Le sarcome à cellules claires du rein (SCCR) se voit très rarement chez les jeunes. Il est caractérisé par une évolution agressive marquée par un taux élevé de récidive et de mortalité. Nous rapportons le cas d’un SCCR chez un patient de 17 ans et nous discutons de son apport et de son intérêt médical en vue d’une bonne prise en charge thérapeutique. L’agressivité du SCCR et la prolifération de métastases surtout osseuses impliquent qu’il ne faut pas méconnaître ce diagnostic afin de mettre en place un traitement adapté. PMID:24940474

  1. Interhemispheric differences and solar cycle effects of the high-latitude ionospheric convection patterns deduced from Cluster EDI observations

    Science.gov (United States)

    Förster, Matthias; Haaland, Stein

    2015-04-01

    Here, we present a study of ionospheric convection at high latitudes that is based on satellite measurements of the Electron Drift Instrument (EDI) on-board the Cluster satellites, which were obtained over a full solar cycle (2001-2013). The mapped drift measurements are covering both hemispheres and a variety of different solar wind and interplanetary magnetic field (IMF) conditions. The large amount of data allows us to perform more detailed statistical studies. We show that flow patterns and polar cap potentials can differ between the two hemispheres on statistical average for a given IMF orientation. In particular, during southward directed IMF conditions, and thus enhanced energy input from the solar wind, we find that the southern polar cap has a higher cross polar cap potential. We also find persistent north-south asymmetries which cannot be explained by external drivers alone. Much of these asymmetries can probably be explained by significant differences in the strength and configuration of the geomagnetic field between the Northern and Southern Hemisphere. Since the ionosphere is magnetically connected to the magnetosphere, this difference will also be reflected in the magnetosphere in the form of different feedback from the two hemispheres. Consequently, local ionospheric conditions and the geomagnetic field configuration are important for north-south asymmetries in large regions of geospace. The average convection is higher during periods with high solar activity. Although local ionospheric conditions may play a role, we mainly attribute this to higher geomagnetic activity due to enhanced solar wind - magnetosphere interactions.

  2. Hydronéphrose géante sur rein ectopique pelvien révélée par un ...

    African Journals Online (AJOL)

    Les auteurs rapportent un cas d'hydronéphrose majeure sur un rein gauche ectopique en position pelvienne, chez un patient de 17 ans, révélé par une occlusion intestinale aigüe. Un drainage premier par néphrostomie per-cutanée écho-guidée a permis de soulager la patient. Le traitement définitif a consisté en une ...

  3. Variantes textuais no Livro do Desassossego: edição, codificação e interpretação

    Directory of Open Access Journals (Sweden)

    Diego Giménez

    2016-09-01

    Full Text Available http://dx.doi.org/10.5007/1807-9288.2016v12n1p54 Em 1988, Ivo Castro, responsável pela edição crítica da obra de Fernando Pessoa para a Imprensa Nacional Casa da Moeda, perguntava, numa comunicação intitulada “Edição Crítica de Pessoa: O Modelo Editorial Adoptado”: “como negar ao leitor o máximo de conhecimento sobre o que está escrito por Pessoa nos manuscritos, quando sabemos que dentro de uma geração, provavelmente, nem o leitor, nem nós, seremos ainda capazes de decifrar a tinta sumida dos papéis?”. Neste artigo mantenho que a codificação das fases de escrita no Livro do Desassossego permite representar o processo de composição textual que é interpretado de maneira diferente pelos especialistas. A especificidade da escrita pessoana presenta uma série de dificuldades que os especialistas enfrentam de forma diferente. Desta forma, a comparação entre o trabalho realizado com a edição crítica e o trabalho realizado com a codificação informática permite pôr em paralelo os problemas e soluções adotados em dois momentos diferenciados dos estudos pessoanos e dos estudos humanísticos em geral.

  4. A ansiedade da unidade: uma teoria da edição / L’ansia di unità: Una teoria dell’edizione

    Directory of Open Access Journals (Sweden)

    Jerónimo Pizarro

    2016-12-01

    Full Text Available Em 1973 Harold Bloom publicou o livro The Anxiety of Influence: A Theory of Poetry. Uma variação sobre este título poderá ser-nos hoje útil para abordar um outro tipo de ansiedade: o da unidade. Os campos da edição e da interpretação vivem imersos nesse outro tipo de ansiedade. Tanto a interpretação, preocupada com a intenção do autor, da obra ou do leitor, como a edição, angustiada com as intenções finais do autor e o estabelecimento do copy-text, parecem, por vezes, pouco capazes de se libertarem desse ensejo de unidade e de se adaptarem à existência da multiplicidade. Neste artigo, procuro fazer um novo apelo a uma necessária mudança de paradigma, atendendo, em especial, às novas e libertadoras possibilidades potenciadas pela edição electrónica. In 1973 Harold Bloom published his book The Anxiety of Influence: A Theory of Poetry. A variation on this title might be useful for us today to refer to another kind of anxiety: the anxiety of unity. The fields of editing and interpretation lie within this other kind of anxiety. Interpretation, concerned with the author’s, the reader’s or the work’s intention, and editing, worried about the author’s final intentions and the setting up of the copy-text, seem, at times, unable to free themselves from the need to attain unity and adapt to the existence of multiplicity. In this article I intend to make a new appeal on behalf of a change of paradigm, addressing, especially, the new and liberating possibilities of electronic editing

  5. The Psychology of Music, editado por Diana Deutsch, 3ª edição: resenha dos capítulos 10 a 13

    Directory of Open Access Journals (Sweden)

    Ricieri Carlini Zorzal

    2016-03-01

    Full Text Available O presente texto traz uma resenha de quatro capítulos da terceira edição do livro The Psychology of Music, editado por Diana Deutsch. Nominalmente, são analisados os seguintes capítulos: 10 Performance musical: movimento e coordenação, de autoria de Caroline Palmer; 11 Desenvolvimento musical, de autoria de Laurel Trainor e Erin Hannon; 12 Música e habilidades cognitivas, de autoria de Glenn Schellenberg e Michael Weiss; e 13 As fundações biológicas da música: insights da amusia congênita, de autoria de Isabelle Peretz.

  6. EDI Performance Statistics

    Data.gov (United States)

    U.S. Department of Health & Human Services — This section contains statistical information and reports related to the percentage of electronic transactions being sent to Medicare contractors in the formats...

  7. End stage renal disease in French Guiana (data from R.E.I.N registry): South American or French?

    Science.gov (United States)

    Rochemont, Dévi Rita; Meddeb, Mohamed; Roura, Raoul; Couchoud, Cécile; Nacher, Mathieu; Basurko, Célia

    2017-06-30

    End-Stage renal disease (ESRD) causes considerable morbidity and mortality, and significantly alters patients' quality of life. There are very few published data on this problem in the French Overseas territories. The development of a registry on end stage renal disease in French Guiana in 2011 allowed to describe the magnitude of this problem in the region for the first time. Using data from the French Renal Epidemiology and Information Network registry (R.E.I.N). Descriptive statistics on quantitative and qualitative variables in the registry were performed on prevalent cases and incident cases in 2011, 2012 and 2013. French Guiana has one of the highest ESRD prevalence and incidence in France. The two main causes of ESRD were hypertensive and diabetic nephropathies. The French Guianese population had a different demographic profile (younger, more women, more migrants) than in mainland France. Most patients had at least one comorbidity, predominantly (95.3%) hypertension. In French Guiana dialysis was initiated in emergency for 71.3% of patients versus 33% in France (p < 0.001). These first results give important public health information: i) End stage renal disease has a very high prevalence relative to mainland France ii) Patients have a different demographic profile and enter care late in the course of their renal disease. These data are closer to what is observed in the Caribbean or in Latin America than in Mainland France.

  8. Um 13 de maio antecipado: edições temáticas, atualidade e memória no circuito TRIP e TPM

    Directory of Open Access Journals (Sweden)

    Frederico de Mello Brandão Tavares

    2016-05-01

    Full Text Available Em abril de 2014, as revistas brasileiras TRIP e TPM publicaram uma edição temática, sob o mesmo título base – “Ser negro/negra no Brasil é f*da”, e estabeleceram um diálogo editorial a partir de um gancho temporal: o dia 13 de maio, quando se comemora a abolição da escravatura no país. Com um mês de antecedência e a partir de coberturas estruturadas por conteúdos específicos, em contato ou não, as publicações anteciparam o acontecimento, previsto, encerrando-o em uma “totalidade” de pautas, acionada por seções e provocadora de um circuito que, antes do “acontecer do acontecimento”, atualizou-o como temática, indicando seus sentidos. Neste contexto, o presente artigo observa relações existentes em acionamentos acontecimentais no jornalismo, mesmo quando estes não partem de uma cobertura factual. Tendo como objeto as edições de TRIP e TPM indicadas, busca-se percorrer a transversalidade originada pela tematização das revistas e compreender as afetações e/ou “determinações” que nela aparecem.

  9. [Tiit-Rein Viitso. Līvõkīel-estikīel-leţkīel sõnārōntõz] / Eberhard Winkler

    Index Scriptorium Estoniae

    Winkler, Eberhard, 1955-

    2013-01-01

    Arvustus: Līvõkīel-estikīel-leţkīel sõnārōntõz = Liivi-eesti-läti sõnaraamat = Lībiešu-igauņu-latviešu vārdnīca / [koostamine:] Tiit-Rein Viitso, [toimetamine ja läti vasted:] Valts Ernštreits. Riga : Latviešu valodas aģentūra ; Tartu : Tartu Ülikool, 2012

  10. Edição Temática “Cidades inteligentes: planejamento e gestão da sustentabilidade”

    OpenAIRE

    Cláudia Terezinha Kniess

    2016-01-01

    É com satisfação que apresentamos a edição temática da revista Gestão e Secretariado – Revista GeSec - com foco em “Cidades inteligentes: planejamento e gestão da sustentabilidade”. Os estudos nesta temática respondem a uma forte demanda da sociedade para o enfrentamento dos desafios atuais relacionados à crescente concentração da população nos centros urbanos e à diversidade de problemas técnicos e políticos relacionados a esta dinâmica.   A revista GeSeC é classificada como Qualis B...

  11. Integrating effective drought index (EDI) and remote sensing derived parameters for agricultural drought assessment and prediction in Bundelkhand region of India

    Science.gov (United States)

    Padhee, S. K.; Nikam, B. R.; Aggarwal, S. P.; Garg, V.

    2014-11-01

    Drought is an extreme condition due to moisture deficiency and has adverse effect on society. Agricultural drought occurs when restraining soil moisture produces serious crop stress and affects the crop productivity. The soil moisture regime of rain-fed agriculture and irrigated agriculture behaves differently on both temporal and spatial scale, which means the impact of meteorologically and/or hydrological induced agriculture drought will be different in rain-fed and irrigated areas. However, there is a lack of agricultural drought assessment system in Indian conditions, which considers irrigated and rain-fed agriculture spheres as separate entities. On the other hand recent advancements in the field of earth observation through different satellite based remote sensing have provided researchers a continuous monitoring of soil moisture, land surface temperature and vegetation indices at global scale, which can aid in agricultural drought assessment/monitoring. Keeping this in mind, the present study has been envisaged with the objective to develop agricultural drought assessment and prediction technique by spatially and temporally assimilating effective drought index (EDI) with remote sensing derived parameters. The proposed technique takes in to account the difference in response of rain-fed and irrigated agricultural system towards agricultural drought in the Bundelkhand region (The study area). The key idea was to achieve the goal by utilizing the integrated scenarios from meteorological observations and soil moisture distribution. EDI condition maps were prepared from daily precipitation data recorded by Indian Meteorological Department (IMD), distributed within the study area. With the aid of frequent MODIS products viz. vegetation indices (VIs), and land surface temperature (LST), the coarse resolution soil moisture product from European Space Agency (ESA) were downscaled using linking model based on Triangle method to a finer resolution soil moisture product

  12. Risk profile, quality of life and care of patients with moderate and advanced CKD : The French CKD-REIN Cohort Study.

    Science.gov (United States)

    Stengel, Bénédicte; Metzger, Marie; Combe, Christian; Jacquelinet, Christian; Briançon, Serge; Ayav, Carole; Fouque, Denis; Laville, Maurice; Frimat, Luc; Pascal, Christophe; Herpe, Yves-Edouard; Morel, Pascal; Deleuze, Jean-François; Schanstra, Joost P; Lange, Céline; Legrand, Karine; Speyer, Elodie; Liabeuf, Sophie; Robinson, Bruce M; Massy, Ziad A

    2018-04-09

    The French Chronic Kidney Disease-Renal Epidemiology and Information Network (CKD-REIN) cohort study was designed to investigate the determinants of prognosis and care of patients referred to nephrologists with moderate and advanced chronic kidney disease (CKD). We examined their baseline risk profile and experience. We collected bioclinical and patient-reported information from 3033 outpatients with CKD and estimated glomerular filtration rates (eGFRs) of 15-60 mL/min/1.73 m2 treated at 40 nationally representative public and private facilities. The patients' median age was 69 (60-76) years, 65% were men, their mean eGFR was 33 mL/min/1.73 m2, 43% had diabetes, 24% had a history of acute kidney injury (AKI) and 57% had uncontrolled blood pressure (BP; >140/90 mmHg). Men had worse risk profiles than women and were more likely to be past or current smokers (73% versus 34%) and have cardiovascular disease (59% versus 42%), albuminuria >30 mg/mmol (or proteinuria > 50) (40% versus 30%) (all P REIN study highlights high-risk profiles of cohort members and identifies several priorities, including improving BP control and dietary counselling and increasing doctors' awareness of AKI, polypharmacy and QoL. ClinicalTrials.gov identifier: NCT03381950.

  13. Determination of endogenous and exogenous corticosteroids in bovine urine and effect of fighting stress during the "Batailles des Reines" on their biosynthesis.

    Science.gov (United States)

    Leporati, Marta; Nobile, Maria; Capra, Pierluigi; Alladio, Eugenio; Vincenti, Marco

    2017-10-01

    Natural corticosteroids include two families of substances: mineralocorticoids and glucocorticoids. Several drugs of similar structure and biological activity have been synthesized and are currently used in the clinical practice. Beside legal pharmacological treatments, these drugs have been consistently misused in animal breeding. One of the most abused corticosteroids is prednisolone. For many years, prednisolone has been considered of exclusive synthetic origin, but nowadays a debate about its possible endogenous production is under way. Several studies have been addressed to ascertain the potential relationship between stressful conditions, such as transportation and slaughtering, and endogenous production of prednisolone. In order to verify further the effect of stressful conditions, our laboratory analysed urine samples collected from the cows participating to the "Batailles des Reines" (a traditional contest based on ritual and spontaneous fights of pregnant cows), to verify if an endogenous prednisolone production may occur in these animals. We developed and validated a LC-MS/MS method for the simultaneous determination of cortisol, cortisone, prednisolone and five of its metabolites. The method was applied to the analysis of urine samples collected from "Batailles des Reines" competitions in 2012 and 2013. All these samples had been previously analysed within an anti-doping control program and tested compliant to all screenings. Copyright © 2017 Elsevier Ltd. All rights reserved.

  14. Estudo comparativo sobre as atividades experimentais em coleções de Física coincidentes recomendados nas edições 2012 e 2015 do PNLD

    Directory of Open Access Journals (Sweden)

    Wendel Fajardo Reis

    2016-09-01

    Full Text Available http://dx.doi.org/10.5007/2175-7941.2016v33n2p462   O Ensino Médio pressupõe uma aprendizagem abrangente e significativa dos conteúdos, em que o professor deve valer-se de recursos didáticos disponíveis e adequados à sua prática. Nessa perspectiva, a atividade experimental torna-se um importante instrumento de ensino a ser explorado no estudo da Física, que também pode ser vivenciado pelos alunos por meio do livro didático (LD. Nesta pesquisa, realiza-se uma análise comparativa das atividades experimentais nas coleções de Física coincidentes nas edições de 2012 e 2015 do Programa Nacional do Livro Didático (PNLD. Para isso, aplica-se a classificação proposta por Barros (2009, fundamentada em competências e habilidades dos Parâmetros Curriculares Nacionais para o Ensino Médio (PCNEM (BRASIL, 1999 e nos temas estruturadores de suas orientações educacionais complementares (PCN+ (BRASIL, 2002. Os resultados mostram uma distribuição não uniforme dos experimentos nos temas da Física, em que ainda prevalecem os arranjos relacionados aos movimentos dos corpos. Para as categorias e dimensões de análise, verifica-se que os autores procuram evidenciar as competências e habilidades do PCNEM, entretanto os aspectos históricos sociais continuam pouco contemplados nas duas edições do Programa. Por fim, espera-se que as informações apresentadas nesse trabalho possam contribuir para a prática docente, com foco nas atividades experimentais dos livros didáticos de Física.

  15. Hemodiafiltration Versus Hemodialysis and Survival in Patients With ESRD: The French Renal Epidemiology and Information Network (REIN) Registry.

    Science.gov (United States)

    Mercadal, Lucile; Franck, Jeanna-Eve; Metzger, Marie; Urena Torres, Pablo; de Cornelissen, François; Edet, Stéphane; Béchade, Clémence; Vigneau, Cécile; Drüeke, Tilman; Jacquelinet, Christian; Stengel, Bénédicte

    2016-08-01

    Recent randomized trials report that mortality is lower with high-convection-volume hemodiafiltration (HDF) than with hemodialysis (HD). We used data from the French national Renal Epidemiology and Information Network (REIN) registry to investigate trends in HDF use and its relationship with mortality in the total population of incident dialysis patients. The study included those who initiated HD therapy from January 1, 2008, through December 31, 2011, and were dialyzed for more than 3 months; follow-up extended to the end of 2012. HDF use at the patient and facility level. All-cause and cardiovascular mortality, using Cox models to estimate HRs of HDF as time-dependent covariate at the patient level, with age as time scale and fully adjusted for comorbid conditions and laboratory data at baseline, catheter use, and facility type as time-dependent covariates. Analyses completed by Cox models for HRs of the facility-level exposure to HDF updated yearly. Of 28,407 HD patients, 5,526 used HDF for a median of 1.2 (IQR, 0.9-1.9) years; 2,254 of them used HDF exclusively. HRs for all-cause and cardiovascular mortality associated with HDF use were 0.84 (95% CI, 0.77-0.91) and 0.73 (95% CI, 0.61-0.88), respectively. In patients treated exclusively with HDF, these HRs were 0.77 (95% CI, 0.67-0.87) and 0.66 (95% CI, 0.50-0.86). At the facility level, increasing the percentage of patients using HDF from 0% to 100% was associated with HRs for all-cause and cardiovascular mortality of 0.87 (95% CI, 0.77-0.99) and 0.72 (95% CI, 0.54-0.96), respectively. Observational study. Whether analyzed as a patient- or facility-level predictor, HDF treatment was associated with better survival. Copyright © 2015 National Kidney Foundation, Inc. Published by Elsevier Inc. All rights reserved.

  16. Hommikuti peab sul olema suurim soov teatrisse tulla ja tööpäeva lõpus peab sul olema suurim soov koju minna / Rein Neimar ; intervjueerinud Triin Sinissaar

    Index Scriptorium Estoniae

    Neimar, Rein

    2011-01-01

    Intervjuu Tallinna Linnateatri asedirektori Rein Neimariga, kes tähistas 24. märtsil oma 60. sünnipäeva. Leningradi õppima minekust, teatritööst kui kollektiivsest tööst, teatriimest, sellest, mida teater on talle andnud jm.

  17. Arvustused / Rein Vader

    Index Scriptorium Estoniae

    Vader, Rein

    2000-01-01

    Uute plaatide AC/DC "Stiff Upper Lip", Alex Attias "Hi-Fi Jazz", Asian Dub Foundation "Community Music", Beastie Boys "Anthology: The Sounds Of Sciense", Blind "Jolly Good", Charlotte Church "Charlotte Church", Crazy Town "The Gift of Game", Cure "Bloodflowers", Tracy Chapman "Telling Stories", "Bringing Out The Dead" arvustused

  18. Kolmekordne kupar / Rein Saluri

    Index Scriptorium Estoniae

    Saluri, Rein

    1998-01-01

    Arvustus: Kristof, Agota. Kaustik; Katsumus; Kolmas vale / prantsuse k. tlk. Urmas Rattus. Tallinn : Varrak, 1997. (Moodne klassika); Oz, Amos. Ära ütle, et öö / heebrea k. tlk. Kalle Kasemaa. Tallinn : Kupar, 1998; Weldon, Fay. Kuu Minneapolise kohal / inglise k. tlk. Faina Laksberg. Tallinn : Kupar, 1997

  19. Eerosest valgustatud / Rein Veidemann

    Index Scriptorium Estoniae

    Veidemann, Rein, 1946-

    2002-01-01

    Arvustus: Saarsen, Karin. Lõvi ja orhidee : [luuletused]. Tallinn : Eesti Raamat, 2002 ; Under, Marie. Under armastusest : [luuletused ja katkendid kirjadest] / valik ja järelsõna: Sirje Olesk. Tallinn : Tänapäev, 2002

  20. Raamatututvustus / Rein Põder

    Index Scriptorium Estoniae

    Põder, Rein, 1943-

    1995-01-01

    Rousseau, Jean-Jacques. Üksildase uitaja mõtisklused; Hill, Susan. Proua de Winter; Kõrvemaast põhjarannani : Kuusalu kihelkonna kirjanduslik-kodulooline antoloogia / Koost. Helmut Elstrok; Tead.toim. Oskar Kuningas

  1. Kriitika kriis / Rein Veidemann

    Index Scriptorium Estoniae

    Veidemann, Rein, 1946-

    2003-01-01

    Eesti Filmiajakirjanike Ühing andis auhinna Aasta film 2002 mängufilmile "Agent Sinikael" : režissöör Marko Raat. Autor jagab auhinna rahastajate Ene ja Tõnis Kase rahuloematust seoses filmi "Nimed marmortahvlil" väljajätmisega isegi nominentide hulgast

  2. Plaadid / Rein Vader

    Index Scriptorium Estoniae

    Vader, Rein

    2006-01-01

    Uutest heliplaatidest Deftones "Saturday Night Wrist", Robb Scott "Afro Adyssey", Zucchero "Fly", Agoria "The Green Armchair", "Back To The Bus ئ Babyshambes", Fratellis "Costello Music", Rod Stewart "Still The Same..."

  3. Estlinki merekaabel / Rein Aro

    Index Scriptorium Estoniae

    Aro, Rein, 1942-

    2006-01-01

    Järg. nr. 6 lk. 20-21. Eesti ja Soome vahelise elektrilise ühenduse loomisest. Kaabelliini haldab ühisettevõte Nordic Energy Link. Ehitaja leidmiseks kuulutatud hanke võitis Šveitsi-Rootsi kontsern ABB

  4. Grupo escolar de Alfarnate (Málaga: colegio y casas para maestros de José María Santos Rein

    Directory of Open Access Journals (Sweden)

    Sergio Romero Bueno

    2015-01-01

    Full Text Available Este artículo estudia y destaca el valor arquitectónico del grupo escolar de Alfarnate (un colegio y once viviendas para maestros, por su singularidad constructiva de claro tinte racionalista y por desarrollar un funcionalismo propio del Movimiento Moderno. Su atrevida modernidad, para un lugar alejado del núcleo urbano de Málaga, trascendió la arquitectura popular y tradicional para establecer su prevalencia como solución a los problemas de escolarización y de habitabilidad en la zona rural en los años sesenta del siglo XX. Documentamos y analizamos las vicisitudes que el arquitecto José María Santos Rein consiguió superar para realizar la obra y aportamos un estudio formal para dejar constancia de su existencia tras la inevitable demolición de las once casas en el año 2011.

  5. Využití možností IoT pro reinženýring podnikových procesů

    OpenAIRE

    Hujňák, Vilém

    2017-01-01

    Bakalářská práce se zabývá problematikou reinženýringu podnikových procesů s využitím možností Internetu věcí. V práci je navržena metoda implementace IoT procesním způsobem a ověřena na případové studii procesu zajištění pohybu oprávněných osob ve firemních prostorách s vyžitím vícefaktorové autentizace. The bachelor's thesis deals with the issue of Business Process Reengineering using possibilities of the Internet of Things. The thesis describes a method for implementing IoT solutions in...

  6. In Order to Translate the Pāli Canon: Reine Sprache on the Other Side of the Möbius Strip

    Directory of Open Access Journals (Sweden)

    Nils Goran Skare

    2018-05-01

    Full Text Available The present study proposes to analyze some potentialities in the translation of the pāli canon, language in which are the writings of Theravāda buddhism. In order to do this, we use the concept of pure language (reine Sprache as formulated by Benjamin. After this, we proceed to a reading of the concept under the light of buddhist doctrine. Thus, we defend a Revelation without Creator, which brings us to the idea of pure language as a karmic parameter. In our discussion, we point to translating as a practice. In our conclusion, we translate some verses from the Dhammapada and we discuss them, and we respond to some possible objections.

  7. [Case-control study on effects of external fixation combined with limited internal fixation for the treatment of Pilon fractures of Rüedi-Allgower type III].

    Science.gov (United States)

    Duan, Da-Peng; You, Wu-Lin; Ji, Le; Zhang, Yong-Tao; Dang, Xiao-Qian; Wang, Kun-Zheng

    2014-01-01

    To analyze the effects of three surgical operations in the treatment of Pilon fracture of Rüedi-Allgower type III, and put forward the best therapeutic method. The clinical data of 33 patients with Pilon fracture who received surgical operations (plaster immobilization group, 10 cases; distal tibia anatomical plate group, 11 cases; external fixation with limited internal fixation group, 12 cases) from October 2009 to January 2012 were analyzed. There were 5 males and 5 females, ranging in age from 24 to 61 years in the plaster immobilization group. There were 7 males and 4 females, ranging in age from 21 to 64 years in the distal tibia anatomical plate group. There were 7 males and 5 females, ranging in age from 23 to 67 years in the external fixation with limited internal fixation group. The Ankle X-ray of Pilon fracture after operation, ankle score, early and late complications were collected. Bourne system was used to evaluate ankle joint function. After 8 months to 3 years follow-up, it was found that three kinds of treatment had significant differences in the outcomes and complications (P external fixation with limited internal fixation group got the best results. The number of anatomic reduction cases in the external fixation with limited internal fixation group (7 cases) and the distal tibia anatomical plate group (8 cases) was more than the plaster immobilization group (2 cases). According to the ankle score, 8 patients got an excellent result, 3 good and 1 poor in the limited internal fixation group ,which was better than those of distal tibia anatomical plate group (5 excellent, 4 good and 2 poor) and the plaster immobilization group (3 excellent, 4 good and 3 poor). The number of early and late complications in the external fixation with limited internal fixation group was more than those in the plaster immobilization group and the distal tibia anatomical plate group (Pexternal fixation with limited internal fixation in the treatment of Pilon fracture

  8. JAMSTEC E-library of Deep-sea Images (J-EDI) Realizes a Virtual Journey to the Earth's Unexplored Deep Ocean

    Science.gov (United States)

    Sasaki, T.; Azuma, S.; Matsuda, S.; Nagayama, A.; Ogido, M.; Saito, H.; Hanafusa, Y.

    2016-12-01

    The Japan Agency for Marine-Earth Science and Technology (JAMSTEC) archives a large amount of deep-sea research videos and photos obtained by JAMSTEC's research submersibles and vehicles with cameras. The web site "JAMSTEC E-library of Deep-sea Images : J-EDI" (http://www.godac.jamstec.go.jp/jedi/e/) has made videos and photos available to the public via the Internet since 2011. Users can search for target videos and photos by keywords, easy-to-understand icons, and dive information at J-EDI because operating staffs classify videos and photos as to contents, e.g. living organism and geological environment, and add comments to them.Dive survey data including videos and photos are not only valiant academically but also helpful for education and outreach activities. With the aim of the improvement of visibility for broader communities, we added new functions of 3-dimensional display synchronized various dive survey data with videos in this year.New Functions Users can search for dive survey data by 3D maps with plotted dive points using the WebGL virtual map engine "Cesium". By selecting a dive point, users can watch deep-sea videos and photos and associated environmental data, e.g. water temperature, salinity, rock and biological sample photos, obtained by the dive survey. Users can browse a dive track visualized in 3D virtual spaces using the WebGL JavaScript library. By synchronizing this virtual dive track with videos, users can watch deep-sea videos recorded at a point on a dive track. Users can play an animation which a submersible-shaped polygon automatically traces a 3D virtual dive track and displays of dive survey data are synchronized with tracing a dive track. Users can directly refer to additional information of other JAMSTEC data sites such as marine biodiversity database, marine biological sample database, rock sample database, and cruise and dive information database, on each page which a 3D virtual dive track is displayed. A 3D visualization of a dive

  9. [The French Chronic Kidney Disease-Renal Epidemiology and Information Network (CKD-REIN) cohort study: To better understand chronic kidney disease].

    Science.gov (United States)

    Stengel, Bénédicte; Combe, Christian; Jacquelinet, Christian; Briançon, Serge; Fouque, Denis; Laville, Maurice; Frimat, Luc; Pascal, Christophe; Herpe, Yves-Édouard; Morel, Pascal; Deleuze, Jean-François; Schanstra, Joost P; Pisoni, Ron L; Robinson, Bruce M; Massy, Ziad A

    2016-04-01

    Preserving kidney function and improving the transition from chronic kidney disease to end stage is a research and healthcare challenge. The national Chronic Kidney Disease-Renal Epidemiology and Information Network (CKD-REIN) cohort was established to identify the determinants, biomarkers and practice patterns associated with chronic kidney disease outcomes. The study will include more than 3000 adult patients with moderate to advanced chronic kidney disease from a representative sample of 40 nephrology clinics with respect to regions and legal status, public or private. Patients are recruited during a routine visit and followed for 5 years, before and after starting renal replacement therapy. Patient-level clinical, biological, and lifestyle data are collected annually, as well as provider-level data on clinical practices, coordinated with the International Chronic Kidney Disease Outcomes and Practice Pattern Study. Blood and urine samples are stored in a biobank. Major studied outcomes include survival, patient-reported outcomes, disease progression and hospitalizations. More than 13,000 eligible patients with chronic kidney disease were identified, 60% with stage 3 and 40% with stage 4. Their median age is 72 years [interquartile range, 62-80 years], 60% are men and 38% have diabetes. By the end of December 2015, 2885 patients were included. The CKD-REIN cohort will serve to improve our understanding of chronic kidney disease and provide evidence to improve patient survival and quality of life as well as health care system performances. Copyright © 2016 Association Société de néphrologie. All rights reserved.

  10. The photographic edition as a visual narrative construction A edição fotográfica como construção de uma narrativa visual

    Directory of Open Access Journals (Sweden)

    Fernanda Jansen Mira Catanho

    2007-01-01

    Full Text Available This article, based on the concept of intellectual montage, developed by russian movie director Sergei Eisenstein, works in the premises that the photographic edition may be responsible for the construction of a visual narrative. Thus, it adopts a photographic essay composed of 26 pictures and sends it to three specialists for edition. The results are three different narratives. With this, it becomes evident that the photographic message may undergo a creative rearrange and compose distinctive enunciation discourses. At the end, the work shows that the differences between the discourses elaborated by the editors are captured by the receiver of the photographic message. Este artigo, baseado no conceito de montagem intelectual, desenvolvido pelo cineasta russo Sergei Eisenstein, trabalha com a premissa de que a edição fotográfica pode ser responsável pela construção de uma narrativa visual. Para tanto, adota um ensaio fotográfico composto por 26 fotografias e o passa para três especialistas editá-lo. O resultado são três narrativas diferentes. Com isso, torna-se evidente que a mensagem fotográfica pode passar por uma re-elaboração criativa e formar discursos enunciativos distintos. Ao final, o trabalho mostra que as diferenças entre os discursos elaborados pelos editores são apreendidos pelo receptor da mensagem fotográfica.

  11. Examining the extreme 2017 spring drought event in South Korea using a suite of drought indices (SPI, SC-PDSI, SPEI, EDI)

    Science.gov (United States)

    Nam, W. H.; Hayes, M. J.; Svoboda, M. D.; Fuchs, B.; Tadesse, T.; Wilhite, D. A.; Hong, E. M.; Kim, T.

    2017-12-01

    South Korea has experienced extreme droughts in 1994-1995, 2000-2001, 2012, 2015, and 2016-2017. The 2017 spring drought (with especially low winter precipitation recorded in winter 2016) affected a large portion of central and western South Korea, and was one of the most severe droughts in the region since the 2000-2001 drought. The spring drought of 2017 was characterized by exceptionally low precipitation with total precipitation from January to June being 50% lower than the mean normal precipitation record (1981-2010) over most of western South Korea. It was the climatologically driest spring over the 1961-2016 record period. Effective drought monitoring and management depends on which drought indices are selected because each drought index has different drought criteria or levels of drought severity, associated with drought responses. In this study, for the quantitative analysis of the spring 2017 drought event in South Korea, four widely-used drought indices, including the Standardized Precipitation Index (SPI), the Standardized Precipitation Evapotranspiration Index (SPEI), the Self-Calibrated Palmer Drought Severity Index (SC-PDSI), and the Effective Drought Index (EDI) are compared with observed drought damaged areas in the context of agricultural drought impacts. The South Korean government (Ministry of Agriculture, Food and Rural Affairs (MAFRA) and Korea Rural Community Corporation (KRC)) has been operating a government-level drought monitoring system since 2016. Results from this study can be used to improve the drought monitoring applications, as well as drought planning and preparedness in South Korea.

  12. Carta do editor de edições especiais da Encontros Bibli 10.5007/1518-2924.2011v16nesp1piv

    Directory of Open Access Journals (Sweden)

    Francisco das Chagas de Souza

    2011-06-01

    Full Text Available Dos horizontes arquivísticos e de seu sentido É significativo observar que a discussão sobre Arquivologia e sobre as práticas profissionais arquivisticas tem avançado muito nos últimos anos no Brasil, e as razões são claramente apontadas pelos organizadores desta edição especial de Encontros Bibli em seu texto editorial. Contendo sete artigos, esta edição temática traz o título Horizontes Arquivísticos.Para dar vida a este número, foi desenvolvido um trabalho de quase dois anos, liderado pelo pesquisador José Maria Jardim e colaboração de Renata Silva Borges. Aqui estão reunidos nove autores e seis avaliadores, todos vinculados a instituições de ensino e de pesquisa ligadas ao Serviço Público Federal, com sede nas cidades de Brasilia, Rio de Janeiro, Niteroi e Florianópolis: UNB, UNIRIO, UFF, UFRJ, UFSC, Arquivo Nacional e FIOCRUZ.Neste momento da história brasileira ─ em que se anunciam políticas governamentais em prol da cidadania, em que se diz da disposição de resgate da verdade sobre os fatos políticos acontecidos na gestão do estado brasileiro dos anos de 1964 a 1989 ─ os arquivos e seus profissionais passam a divisar um relevante protagonismo. Pode-se dizer que, de certa maneira, deu-se um movimento de preparação deste protagonismo e que, simultaneamente, essa preparação alicerçou a percepção de segmentos importantes do setor público para oferecer essa perspectiva para a sociedade nacional.Nesse sentido, tem peso relevante a instalação de novos cursos de bacharelado na área, totalizando, em 2011, o número de 14 universidades que os oferecem: UNIRIO, UFF, UFSM, UFES, UNB, UEL, UFBA ,UNESP/MARÍLIA, UFRGS, UEPB, UFAM, FURG, UFMG, UFSC. Uma nota marcante é que todas essas Instituições de Ensino Superior têm vínculos governamentais, sendo onze federais e três estaduais. Esse movimento não se faz por outro caminho senão o da pesquisa histórica e social. Em áreas como a História, Educa

  13. Impacto da tecnologia de informação no Supply Chain Management: um estudo multicaso sobre a adoção de EDI entre varejo e indústria agroalimentar The impact of information technology on the Supply Chain Management: a multicase study in EDI adoption between the agrifood industry and retailers

    Directory of Open Access Journals (Sweden)

    Andrea Lago da Silva

    1999-12-01

    Full Text Available As tecnologias de informação têm alterado as formas de coordenação entre os diferentes elos da cadeia de suprimentos. A coordenação pode ser entendida como a habilidade de transmitir informação, estímulos e controles ao longo das etapas seqüenciais que integram o conjunto de atividades necessárias para atender o mercado (FARINA & ZYLBERSZTAJN, 1994. O conjunto destas etapas é o que tem sido chamado de Supply Chain ou Cadeia de Suprimentos. Neste artigo, discute-se alguns casos de adoção de uma tecnologia de informação, o EDI (troca eletrônica de dados como ferramenta de coordenação entre varejistas e indústrias agroalimentares. Conclui-se que o processo de adoção é relativamente recente para que se possa mensurar resultados quantitativos e qualitativos significativos, mas já se observa alterações na freqüência de desabastecimento, em estoques melhor dimensionados e vendas maiores em decorrência da maior disponibilidade de mercadorias. Sinalizam-se também mudanças qualitativas, como alteração na função do vendedor tradicional, maior interação entre as áreas técnicas, com um aprendizado comum das novas formas de usar a tecnologia e o importante papel da confiança nos relacionamentos interorganizações.Information technology has changed the patterns of coordination among the different linkages of supply-chains. Coordination can be understood as the ability to transfer information, incentives and controls throughout the sequential stages which integrate the set of activities indispensable to serve the market (FARINA & ZYLBERSZTAJN, 1994. The sum of these stages is currently known as Supply-Chains. This paper discusses cases of adopting a specific information technology, EDI (Electronic Data Interchange, as an integration tool between the food industry and retailers. It was found that the adoption process is too recent to measure significative quantitative results, but it is possible to observe changes in the

  14. «Dos benefícios de Deus»: três edições de um capítulo do tratado medieval português

    Directory of Open Access Journals (Sweden)

    Rita de Cássia Ribeiro Queiroz

    2010-12-01

    Full Text Available Resumo: O tratado “Dos benefícios de Deus” integra a obra da literatura medieval portuguesa intitulada Castelo perigoso, a qual é uma adaptação do texto francês escrito por Frère Robert, monge cartuxo, à sua prima Soeur Rose, da Ordem Fontevrault. A versão em língua portuguesa foi realizada no Mosteiro de Alcobaça, provavelmente no século XV, existindo dois códices (ALC 197 e ALC 214, os quais se encontram na Biblioteca Nacional de Portugal. O tratado “Dos benefícios de Deus” é o segundo na ordem dos textos que compõem a obra Castelo perigoso. Propõem-se, neste trabalho, três edições de um capítulo do tratado“Dos benefícios de Deus”, a saber: uma edição conservadora ou semidiplomática; uma edição crítica, executada a partir da collatio entre os códices ALC 197 e ALC 214 e a edição realizada por Augusto Magne na década de 1940; e, por último, uma edição modernizada. Palavras-chave: Crítica textual; edição; português medieval.  Résumé: Le traité “Dos benefícios de Deus” intègre l’oeuvre de la littérature médiévale potugaise Chastel périlleux, qui est une adaptation du texte français écrit par Robert Frère, moine chartreux, à sa cousine Soeur Rose, de l’Ordre Fontevrault. La version en langue portugaise a été réalisée au Monastère d’Alcobaça, probablement au XVe siècle: il y a deux codex (ALC 197 et ALC 214, qui sont à la Bibliothèque Nationale du Portugal. Le traité “Dos benefícios de Deus” est le deuxième dans l’ordre des textes qui constituent l’oeuvre Chastel périlleux. Sont proposées dans le présent travail trois éditions d’un chapitre du traité “Dos benefícios de Deus”, à savoir: une édition conservatrice ou semidiplomatique; une édition critique, faite à partir de la collation des manuscrits entre les codex 197 et 214 et l’édition faite par Augusto Magne en 1940; et, enfin, une édition modernisée. Mots-clés: Critique textuelle

  15. O Brasil através dos Para-brisas: O Turismo na Primeira Edição da Revista Quatro Rodas

    Directory of Open Access Journals (Sweden)

    Maria Henriqueta S. Garcia Gimenes-Minasse

    2014-07-01

    Full Text Available É grande a importância dos guias turísticos na construção da imagem de destinos turísticos, pois auxiliam a organização de viagens, selecionando o que merece ser visto e visitado. No Brasil, um dos mais respeitados pelos turistas domésticos é o Guia Quatro Rodas, publicado anualmente pela Editora Abril, desde setembro de 1965. Contudo, já em 1960 a revista Quatro Rodas, criada nesse ano, e da qual o Guia nasceu, já vinha desempenhando o papel de informar e orientar o leitor sobre passeios e roteiros que poderiam ser feitos de automóvel. Este artigo tem o objetivo de analisar o conteúdo relacionado ao Turismo da primeira edição da Revista Quatro Rodas. Os principais resultados encontrados evidenciam a transformação social do Brasil com o advento de uma matriz econômica pautada na indústria do automóvel e com a incorporação das viagens de lazer como uma forma de descoberta desse ‘novo’ país.  Brazil through the Windshield: Tourism in the First Edition of Quatro Rodas Magazine - Tour guides are very important in building the image of touristic attractions, as they help with travel arrangements and selection of attractions to be seen and visited. In Brazil Guia Quatro Rodas is one of the guides most respected by domestic tourists. It is annually published by Editora Abril, since September 1965. Nevertheless, since 1960 the newly formed Quatro Rodas magazine, and from which the Guia Quatro Rodas was borne, was already playing the role of informing and guiding its readers in relation to tours that could be made by car. The scope of this article is to analyze the first edition of Quatro Rodas magazine with respect to its tourism-related content. The main results show the social transformation of Brazil with the advent of an economic matrix based on the automotive industry and the incorporation of leisure travel as a way to discover the ‘new’ country.

  16. Esta tenzon fezeron Pero da Ponte e Afonso Anes do Coton. Edição e estudo do debate B969/V556

    Directory of Open Access Journals (Sweden)

    Déborah González Martínez

    2013-07-01

    Full Text Available Pero da Ponte e Afonso Eanes do Coton são dois destacados autores de cantigas transmitidas nos cancioneiros galego-portugueses: o Cancioneiro da Ajuda, o Cancioneiro da Biblioteca Nacional (Cód. 10991 e o Cancioneiro da Biblioteca Vaticana (Vat. Lat. 4803. A estreita relação entre estes dois trovadores confirma-se pelas menções a ambos no interior de vários textos de natureza satírica e pela interação em duas cantigas dialogadas. O presente trabalho consiste numa nova edição crítica da tenção entre Afonso Eanes do Coton e Pero da Ponte (Pero da Pont’, e[n] un vosso cantar, B969 / V556, oferecendo novas respostas a velhas dificuldades ecdóticas. O texto vai acompanhado de anotação e estudo, pois o diálogo desenvolve vários temas de especial interesse para os estudos trovadorescos: a classe social e a atividade profissional dos interlocutores.Pero da Ponte and Afonso Eanes do Coton are two renowned authors of cantigas contained in the galician-portuguese songbooks: the Cancioneiro da Ajuda, the Cancioneiro da Biblioteca Nacional (Cód. 10991 and the Cancioneiro da Biblioteca Vaticana (Vat. Lat. 4803. The close relationship between these troubadours is confirmed by some references in satirical texts and, mainly, by the dialogued song Pero da Pont’, e[n] un vosso cantar (B969 / V556. This work offers a new critical edition of this tenção with notes and literary study. The dialogue develops several topics of interest for the studies about troubadours: social class and professional activity of the interlocutors.  

  17. Employee-Driven Innovation (EDI)

    DEFF Research Database (Denmark)

    Kesting, Peter; Ulhøi, John Parm

      The responsibility to be innovative and think of useful ideas and the privilege of making decisions in processes of innovation are typically restricted to specifically assigned R&D functions and/or upper echelon managers. Given the importance of innovation to most organizations, it may seem...

  18. A gripe suína na Wikipédia em português: análise da dinâmica de edições e qualificação do conteúdo de dois artigos

    OpenAIRE

    Bernardo Esteves Gonçalves da Costa; Carlos Frederico de Brito d'Andréa

    2011-01-01

    Este artigo tem como objetivo analisar e comparar a edição colaborativa de dois artigos sobre pandemia de gripe A (H1N1) — ou gripe suína — na Wikipédia em português. Monitoramos as edições feitas nos dois artigos ao longo de um mês após a criação de ambos, em 25 de abril de 2009. Caracterizamos o processo de edição dos textos e a dinâmica de interações entre os editores e, de forma complementar, analisamos seu conteúdo a partir de três critérios: autoridade, verificabilidade e atualidade....

  19. Avaliação da anotação semântica do PALAVRAS e sua pós-edição manual para o Corpus Summ-it

    Directory of Open Access Journals (Sweden)

    Élen Cátia Tomazela

    2011-01-01

    Full Text Available Este artigo apresenta uma avaliação da anotação semântica automática do parser PALAVRAS e sua pós-edição manual para um corpus de textos em português – o Corpus Summ-it. Essa pós-edição visou ao aprimoramento de um modelo linguístico para a sumarização automática de textos e buscou atribuir  etiquetas semânticas mais adequadas aos itens lexicais, comparadas às empregadas pelo parser. Essa tarefa foi realizada por linguistas e os casos problemáticos são apresentados neste artigo, os quais levam a considerações sobre o próprio modelo de etiquetagem do PALAVRAS. O corpus revisado estará disponível para a comunidade e poderá ser útil para várias aplicações de Processamento de Línguas Naturais.

  20. Avaliação da anotação semântica do PALAVRAS e sua pós-edição manual para o Corpus Summ-it

    Directory of Open Access Journals (Sweden)

    Élen Cátia Tomazela

    2011-01-01

    Full Text Available Este artigo apresenta uma avaliação da anotação semântica automática do parser PALAVRAS e sua pós-edição manual para um corpus de textos em português – o Corpus Summ-it. Essa pós-edição visou ao aprimoramento de um modelo linguístico para a sumarização automática de textos e buscou atribuir  etiquetas semânticas mais adequadas aos itens lexicais, comparadas às empregadas pelo parser. Essa tarefa foi realizada por linguistas e os casos problemáticos são apresentados neste artigo, os quais levam a considerações sobre o próprio modelo de etiquetagem do PALAVRAS. O corpus revisado estará disponível para a comunidade e poderá ser útil para várias aplicações de Processamento de Línguas Naturais.

  1. "Economia e sociedade": a herança de Max Weber à luz da edição de sua Obra completa (MWG "Economy and society": Max Weber's legacy following the publication of his Complete works (MWG

    Directory of Open Access Journals (Sweden)

    M. Rainer Lepsius

    2012-01-01

    Full Text Available O artigo relata o entendimento atual do conjunto de textos conhecido como Economia e sociedade, procurando esclarecer em que consistia originalmente; como foi organizado nas edições anteriores por Marianne Weber e Johannes Winckelmann; como foi tratado no âmbito da nova edição da MWG. Para tanto, procura indicar como Max Weber situava os diversos textos, as diversas versões e fases de concepção e composição desses escritos. A partir daí, sistematiza os principais aspectos dos textos evidenciados na MWG, assim como os principais campos de discussão que se abrem para a pesquisa, em especial a sociologia econômica.The article reviews the current understanding of the set of texts known as Economy and Society, looking to identify the original content, how these texts were edited in previous editions by Marianne Weber and Johannes Winckelmann, and how they have been dealt with in the new edition of the MWG. These aims in mind, the text looks to show how Max Weber himself situated the various texts, including the different versions and phases of conception and composition of the writings. The article then summarizes the main aspects of the works, as evinced in the MWG, as well as the principal fields of discussion opened up for research, especially in economic sociology.

  2. O, 5 mm: a nova edição brasileira de Problemas da poética de Dostoiévski/0.5 mm: The New Brazilian Edition of Problems of Dostoevsky’s Poetics

    Directory of Open Access Journals (Sweden)

    Adriana Pucci Penteado de Faria e Silva

    2011-11-01

    Full Text Available RESUMO: Neste artigo, retomo brevemente a história da recepção de Problemas da poética de Dostoiévski, de Mikhail Bakhtin, no Brasil, estabelecendo alguns paralelos com aspectos da recepção da obra na Itália, na França e nos Estados Unidos, para, então, descrever os acréscimos da nova edição brasileira e analisar, considerando a relevância da obra para os estudos da linguagem, algumas modificações efetuadas pelo tradutor Paulo Bezerra na quarta edição da obra, lançada em 2008. ABSTRACT: In this article I briefly review the history of the Brazilian reception of Mikhail Bakhtin’s Problems of Dostoevsky’s Poetics, establishing a few parallels with aspects of this work’s reception in Italy, France, and the United States in order to describe the additions made to the new Brazilian edition and, considering the relevance of this work to Language Studies, analyze some changes proposed by translator Paulo Bezerra in its

  3. (Desmetaforizando significados na pós-edição: um estudo exploratório do esforço despendido por estudantes de tradução

    Directory of Open Access Journals (Sweden)

    Adriana Silvina Pagano

    2014-03-01

    Full Text Available Este artigo examina dados de um experimento-piloto e tem por objetivo investigar o esforço despendido por estudantes de tradução em uma tarefa de pós-edição, a partir da análise de pausas e movimentos recursivos registrados durante a produção textual em tempo real para instâncias gramaticalmente metafóricas (cf. HALLIDAY,1998. O estudo contempla o processo e o produto da pós-edição de três alunos de pós-graduação em tradução. Para se proceder à análise, foram observados os registros de uso de teclado e movimentos de cursor mapeados pelo programa Translog 2006 para a produção textual em tempo real. Como resultado, verificou-se um grande esforço para se processar algumas instâncias gramaticalmente metafóricas, sendo que esse esforço não resultou em uma maior adequação dos significados produzidos.

  4. Effects of cyclosporine A pretreatment of deceased organ donors on kidney graft function (Cis-A-rein): study protocol for a randomized controlled trial.

    Science.gov (United States)

    Orban, Jean-Christophe; Fontaine, Eric; Cassuto, Elisabeth; Baumstarck, Karine; Leone, Marc; Constantin, Jean-Michel; Ichai, Carole

    2018-04-17

    Renal transplantation represents the treatment of choice of end-stage kidney disease. Delayed graft function (DGF) remains the most frequent complication after this procedure, reaching more than 30%. Its prevention is essential as it impedes early- and long-term prognosis of transplantation. Numerous pharmacological interventions aiming to prevent ischemia-reperfusion injuries failed to reduce the rate of DGF. We hypothesize that cyclosporine as an early preconditioning procedure in donors would be associated with decreased DGF. The Cis-A-rein study is an investigator-initiated, prospective, multicenter, double-blind, randomized, controlled study performed to assess the effects of a donor preconditioning with cyclosporine A on kidney grafts function in transplanted patients. After randomization, a brain dead donor will receive 2.5 mg kg -1 of cyclosporine A or the same volume of 5% glucose solution. The primary objective is to compare the rate of DGF, defined as the need for at least one dialysis session within the 7 days following transplantation, between both groups. The secondary objectives include rate of slow graft function, mild and severe DGF, urine output and serum creatinine during the first week after transplantation, rate of primary graft dysfunction, renal function and mortality at 1 year. The sample size (n = 648) was determined to obtain 80% power to detect a 10% difference for rate of DGF at day 7 between the two groups (30% of the patients in the placebo group and 20% of the patients in the intervention group). Delayed graft function is a major issue after renal transplantation, impeding long-term prognosis. Cyclosporine A pretreatment in deceased donors could improve the outcome of patients after renal transplantation. ClinicalTrials.gov, ID: NCT02907554 Registered on 20 September 2016.

  5. [Is cancer incidence different between type 2 diabetes patients compared to non-diabetics in hemodialysis? A study from the REIN registry].

    Science.gov (United States)

    Le Guillou, Aurélie; Pladys, Adelaide; Kihal, Wahida; Siebert, Muriel; Haddj-Elmrabet, Atman; Cernon, Charlotte; Bernard, Anne; Charasse, Christophe; Mandart, Lise; Hamel, Didier; Tanquerel, Tugdual; Strullu, Bernard; Richer, Christine; Siohan, Pascale; Sawadogo, Théophile; Baleynaud, Juliette; Baluta, Simona; Bayat, Sahar; Vigneau, Cécile

    2018-05-01

    In France, diabetes mellitus is now the second cause of end stage renal disease. In a large previous French national study, we observed that dialyzed diabetics have a significant lower risk of death by cancer. This first study was focused on cancer death but did not investigate cancer incidence. In this context, the aim of this second study was to compare the incidence of cancer in diabetic dialyzed patients compared to non-diabetic dialyzed patients in a French region. This epidemiologic multicentric study included 588 diabetic and non-diabetic patients starting hemodialysis between 2002 and 2007 in Bretagne. Data were issued from REIN registry and cancer incidence were individually collected from medical records. Diabetics and non-diabetics were matched one by one on age, sex and year of dialysis initiation. During the follow-up, we observed 28 cancers (9.4%) in diabetic patients and 26 cancers (8.9%) in non-diabetics patients. The cumulative incidence to develop a cancer 2 years after the dialysis start was approximately 6% in both diabetics and non-diabetics patients. In univariate Fine and Gray analysis, BMI, hemoglobin, statin use had P-value<0.2. However, in the adjusted model, these variables were not significantly associated with cancer incidence. This study lead on a little number of dialyzed patients did not show any significant difference on cancer incidence between diabetic and non-diabetic patients after hemodialysis start. Copyright © 2017 Société francophone de néphrologie, dialyse et transplantation. Published by Elsevier Masson SAS. All rights reserved.

  6. O objecto dúctil: a emergência de uma sociologia histórica da edição The ductile object: emergency a historical sociology of publishing

    Directory of Open Access Journals (Sweden)

    Nuno Medeiros

    2010-12-01

    Full Text Available Localizada, desde o início das diligências explicativas para a apreender, numa matriz temática e disciplinar em que se multiplicam os cruzamentos, a edição de livros foi sendo construída como objeto para cuja captura e definição convergiu e converge sinuosamente um feixe de tradições e perspectivas, tanto na sociologia como na história. Este artigo procura estabelecer um percurso sistematizado que se possa constituir para o leitor interessado como baliza de entendimento de um campo de pesquisa teórica e empírica em construção, que aqui se denomina "sociologia histórica da edição". Projeto necessariamente parcelar, o propósito apresentado concretiza-se seletivamente, tentando proceder a uma exploração do tema a partir especificamente de duas tradições, a francesa e a anglo-saxônica, com enfoque particular na produção do último meio século.Since the first attempts to apprehend and explain the phenomenon, book publishing has been apprehended within a disciplinary and thematic context formed by a constellation of traditions and approaches in both sociology and history with multiple interconnections. This article looks to provide a systematic framework for the reader interested in gaining an understanding of one particular field of theoretical and empirical research, what I call here a historical sociology of publishing. A necessarily incomplete project, the approach is purposefully selective, examining the theme through the exploration of two specific traditions, French and Anglo-Saxon, with a particular focus on the last half century.

  7. Um estudo das edições de Ou isto ou aquilo, de Cecília Meireles A study of Cecília Meirelles' Ou isto ou aquilo editions

    Directory of Open Access Journals (Sweden)

    Norma Sandra de Almeida Ferreira

    2009-08-01

    Full Text Available Localizar em sua materialidade a obra Ou isto ou aquilo, de Cecília Meireles, em suas edições - 1964; 1969; 1977; 1987; 1990; 2002 -; cotejá-las para compreender as formas pelas quais os textos são apresentados aos seus leitores, em diferentes tempos; e indagar como e por que essas formas são pensadas e concretizadas são desafios deste artigo. Esta pesquisa de cunho exploratório, à luz, principalmente, dos estudos da História Cultural, privilegia, no exame das diferentes edições, as partes externas que envolvem os poemas (o texto propriamente dito e suas ilustrações. Identifica e discute a produção de sentidos e valores ligados à educação do leitor, ao reconhecimento de uma escritora consagrada pela tradição literária, à singularidade da linguagem, à importância de uma prática prazerosa da leitura.This article brings the challenges of locating Cecília Meireles' book Ou isto ou aquilo (Either this or that in its materialness, with considerations on its 1964, 1969, 1977, 1987, 1990 and 2002 editions, as well as comparing these editions in order to understand the forms in which texts are presented to their readers at different times, and questioning how and why these forms are conceived and put into practice. In the light of studies on cultural history, in the analysis of the different editions, this exploratory research prioritizes the external parts that involve poems (the texts themselves and their illustrations. It provides identification and a discussion on the production of senses and values related to readers' education, the recognition of a writer who is consecrated by literary tradition, the uniqueness of the language used, and the importance of pleasant reading practice.

  8. Seaduslikkus taktikaliste eranditeta / Rein Org

    Index Scriptorium Estoniae

    Org, Rein

    2005-01-01

    Sotsiaaldemokraatliku Erakonna peasekretär kritiseerib Reformierakonna ja Keskerakonna poolt sõnavabaduse kaitsmiseks algatatud välireklaamikampaaniat, millega püütakse mõjutada õiguskantsleri hinnangut poliitilist välireklaami keelustavale seadusemuudatusele

  9. Taotlused ja tulemus / Rein Tootmaa

    Index Scriptorium Estoniae

    Tootmaa, Rein

    2002-01-01

    Helle Karise kavandatava portreefilmide sarja "Contra mortem" esimene film "Dr. Andres Ellamaa" : operaatorid Peter Murdmaa ja Marko Piirsoo : monteerija Eero Karis : produtsendid Helle Karis ja Maret Hirtentreu : kasutatud Carl Orffi muusikat : Myth Film 2002

  10. Terrorism muutuvas maailmas / Rein Tammsaar

    Index Scriptorium Estoniae

    Tammsaar, Rein

    2003-01-01

    Tulevikuperspektiivis tagab tõhusa terrorismivastase tegevuse otsese sõjalise sekkumise kõrval laiaulatuslik rahvusvaheliselt koordineeritud tegevus, leiab autor. Skeem: Terrorismi ennetamine ja terrorismivastase tegevuse üldine koordineerimine Eestis. Tabel: Terrorismi ohtlikumad valdkonnad. Vt. samas Sven Sakkovi retsensiooni artiklile lk. 201

  11. Plaadid : Pop & rock / Rein Vader

    Index Scriptorium Estoniae

    Vader, Rein

    2002-01-01

    Uutest plaatidest Cypress Hill "Stoned raiders", Anastacia "Freak Of Nature", Alicia Keys "Songs In A Minor", Robbie Williams "Swing When You're Winning", "Royal House Dance", Yoko Ono "Blueprint For A Sunrise"

  12. Taking the reins of power

    International Nuclear Information System (INIS)

    Cavenagh, Andrew.

    1997-01-01

    The growing contract energy management business in the United Kingdom is examined. At the top end, established electricity generators are supplying combined heat and power plants of over 20MW or so to meet the steam, power and heating requirements of large industrial sites on contracts of, typically, 15-20 years. These are very much the province of companies such as National Power and PowerGen familiar with linking into the high voltage transmission system and hence able to sell surplus power from these projects into the National Grid. A much wider range of services is on offer by other more specialised companies. These range from the supply and operation of combined heat and power plants to smaller companies, to fuel purchasing contracts and the monitoring of energy consumption of existing facilities in public buildings. Cost cutting is the driving attraction of contract energy management for the purchasers, but there are other advantages. The view of one company, for example, is that it enables them to focus on their core business while leaving energy production and management to a third party whose core business that is. Energy costs become totally forecastable and expertise is always at hand. (UK)

  13. Seitse miljardit veemajandusele / Rein Randver

    Index Scriptorium Estoniae

    Randver, Rein, 1956-

    2007-01-01

    Ilmunud ka: Sakala, 3. apr. 2007, lk. 2; Võrumaa Teataja, 3. apr. 2007, lk. 2; Vooremaa, 3. apr. 2007, lk. 2; Vali Uudised, 4. apr. 2007, lk. 2; Meie Maa, 4. apr. 2007, lk. 2; Põhjarannik, 4. apr. 2007, lk. 2; Severnoje Poberezhje, 4. apr. 2007, lk. 2; Harju Ekspress, 5. apr. 2007, lk. 8; Harjumaa, 5. apr. 2007, lk. 4; Lääne Elu, 10. apr. 2007, lk. 2; Oma Saar, 13. apr. 2007, lk. 5. Ametist lahkuv keskkonnaminister peab kõige olulisemaks ja rahaliselt suuremahulisemaks tegevusvaldkonnaks veemajandust

  14. Kiire, mugav, odav? / Rein Raud

    Index Scriptorium Estoniae

    Raud, Rein, 1961-

    2006-01-01

    Ilmunud ka: Infopress 18. aug. nr. 33 lk. 151. TLÜ rektor viitab, et bakalaureusetase on vaid vahefaas, kus inimene on saanud spetsialiseerumiseks ettevalmistuse. Talle tundub, et Eesti praegune jõukusetase võimaldaks tagada vähemasti koha tasuta magistriõppes kõigile neile ülikoolilõpetajatele, kelle bakalaureuseõpingute tulemus on ületanud mingi teatava künnise, ning loobuda õpingute nominaalaja fetišeerimisest

  15. Inimesed ja mesilased / Rein Tootmaa

    Index Scriptorium Estoniae

    Tootmaa, Rein

    2005-01-01

    Nukufilm "Gene+ratio" : stsenarist, kunstnik ja režissöör Mait Laas : konsultant Paavo Matsin : operaatorid Ragnar Neljandi, Raivo Möllits : helilooja Tiit Kikas : Nukufilm OÜ - Icon Film (Saksamaa) 2005

  16. Journey towards yourself / Rein Veidemann

    Index Scriptorium Estoniae

    Veidemann, Rein, 1946-

    2011-01-01

    Arvustus: Luik, Viivi. Varjuteater. Tallinn : Eesti Keele Sihtasutus, 2010 ; Luik, Viivi, Rosma, Hedi. Ma olen raamat. Tallinn : SE & JS, 2010 ; Jõerüüt, Jaak. Armastuse laiad, kõrged hooned. Tallinn : Tuum, 2010 ; Jõerüüt, Jaak. Muutlik. Tallinn : Tuum, 2010

  17. Iseolemise uus paradigma / Rein Lang

    Index Scriptorium Estoniae

    Lang, Rein, 1957-

    2004-01-01

    Oma essees nimetab autor 1992. aasta põhiseaduse neli kontseptuaalset eesmärki ning leiab, et neli peamist ülesannet, mis sellele põhiseadusele esitati, on enamjaolt täidetud, vaja on aga minna edasi. Meil tuleb mõtestada oma sõnum EL-is ja oma tahtmised järgmiseks iseolemise etapiks, ütleb autor kokkuvõtteks

  18. Digital TV: the aparattus and the representation of real on image edition in news casting TV Digital: o aparelho e a representação do real na edição de imagens no telejornalismo

    Directory of Open Access Journals (Sweden)

    Fernanda Aiex Boni

    2011-08-01

    Full Text Available This study investigates some changes on image edition due to the transfer of Analogic to Digital Television in Brazil. Beginning with Vilém Flusser’s Media Theory and its concept of “apparatus”, it develops a theoretical analysis of the new relationship between journalists and digital editing instruments, taking into account the concept of hyperreality proposed by Jean Baudrillard. Retrieving the philosophical discourse of “real” throughout History and also the positivist concepts, base of the journalistic activity, it discusses how digital image manipulation and the construction of graphic universes meddle with the new representation of real presented by television news casting. From interviews with Rede Globo editors in São Paulo, Rio de Janeiro and Curitiba (cities where digital television has already been implemented, it analyses how this new technology can hinder the main commitment of journalism, which is reporting facts as faithfully as possible. The discussion proposes an engagement of professionals and society regarding digital images in the search of greater critical conscience towards digital images in news casting, with an ethic view of the use of manipulation resources and scene construction on news editing. Este trabalho investiga algumas mudanças na edição de imagens com a passagem da TV Analógica para a Digital no Brasil. A partir da teoria da mídia de Vilém Flusser e seu conceito de “aparelho” desenvolve-se uma análise teórica da nova relação entre os jornalistas e os equipamentos digitais de edição, levando-se em conta o conceito de hiper-realidade, proposto por Jean Baudrillard. Retomando o percurso filosófico do real ao longo da história e ainda os conceitos positivistas, que embasam a atividade jornalística, discute-se de que maneira a manipulação das imagens digitais e a construção deuniversos gráficos interferem na nova representação do real apresentada pelo telejornalismo. Com base em

  19. Edição e tradução, entre a cultura e a política: Argentina e Brasil na Feira do Livro de Frankfurt

    Directory of Open Access Journals (Sweden)

    José de Souza Muniz Jr.

    Full Text Available Resumo Este artigo analisa a participação da Argentina e do Brasil como países convidados de honra (em 2010 e 2013, respectivamente na Feira do Livro de Frankfurt. Remetemos tais presenças à história recente da feira e ao seu papel na estrutura dos fluxos e circuitos de edição e tradução em nível mundial, estrutura esta regulada pelas relações desiguais entre distintos países e mercados linguísticos. Analisamos as negociações entre entidades do poder público e da política setorial que deram origem a tais participações; as ênfases temáticas escolhidas para compor os estandes; e as características socioprofissionais dos autores de cada delegação. A conclusão é que tais casos permitem observar relações específicas entre intelectuais e Estado em cada contexto, na medida em que fazem emergir não apenas as tensões entre cultura e economia, mas também os modos específicos como cada país “traduz” questões locais para um âmbito de trocas simbólicas transnacionais.

  20. A nova edição de Why Suyá Sing, de Anthony Seeger, e alguns estudos recentes sobre música indígena nas terras baixas da América do Sul

    Directory of Open Access Journals (Sweden)

    Luís Fernando Hering Coelho

    2007-04-01

    Full Text Available Lançado originalmente em 1987, Why Suya Sing? ganhou uma nova edição norte-americana em 2004. Apesar de constituir um marco teórico e etnográfico importante nos campos da etnologia indígena e da antropologia da música, o livro ainda não conta com uma tradução para o português. Neste ensaio, oferece-se uma leitura da obra, buscando resumir alguns de seus pontos principais, junto a uma contextualização geral sumária dos estudos sobre povos Gê, e uma nota breve sobre alguns desenvolvimentos recentes nas pesquisas sobre música indígena nas terras baixas da América do Sul.Originally published in 1987, Why Suyá Sing? acquired a new US edition in 2004. Despite constituting a theoretical and ethnographic landmark in the fields of indigenous ethnology and anthropology of music, Seeger’s book has yet to be translated into Portuguese. This essay offers a reading of the work, looking to resume some of its key points, along with a brief overall contextualization of the studies on Gê peoples, and a short note on some of the recent developments in the research on indigenous music in the South American lowlands.

  1. Measurements and Clinical Findings on Thorotrast Deposits in the Kidney; Mesures et Observations Cliniques Faites sur des Depots de Thorotrast dans le Rein; 0418 0417 041c 0414 ; Determinaciones y Datos Clinicos Relativos a los Depositos Renales de Torotrasto

    Energy Technology Data Exchange (ETDEWEB)

    Oberhausen, E.; Muth, H.; Grillmaier, R. [Institut Fuer Biophysik der Universitaet des Saarlandes, Homburg (Saar), Federal Republic of Germany (Germany)

    1964-11-15

    thorotrast dans le rein. Il n'en faut pas moins s'attendre a trouver de nombreux malades dont les reins contiennent des depots de thorotrast car le thorotrast a ete utilise tres souvent comme substance opaque dans les pyelographies retrogrades. Dans les conditions normales, tout le thorotrast aurait du etre emporte par l'urine. Cependant, si l'application a ete faite sous forte pression ou qu'il y eut a l'epoque une infection renale, il se peut qu'une partie du thorotrast se soit deposee dans les tissus. Il est possible qu'un nombre important de ces depots ne puisse etre identifie sur les radiographies, car ils ressemblent beaucoup a des depots de calcium dans le rein et il faut une certaine experience pour distinguer les depots de calcium des depots de thorotrast. Au cours des dernieres annees, les auteurs, en collaboration avec des urologues, ont pu reperer sept cas de ce genre. Lorsqu'il n'y avait de depot que dans un seul'rein, ce qui etait le- cas chez six sujets, on a procede a l'ablation de l'organe. L'examen histol ogique a'revele cinq carcinomes ainsi'qu'une degenerescence tres poussee d'un rein. D'apres les observations des auteurs, il faut entre 20 et 25 annees pour qu'un carcinome se developpe. Dans deux cas, il a ete possible d'examiner le sujet dans l'anthropogamraametre et de doser les{sup r}adionucleides contenus dans l'urine et le thoron contenu dans l'air exhale. Ces dosages ont ete effectues avant et apres la nephrectomie. On a egalement mesure les rayons gamma emis par l'organe isole. Ces diverses mesures ont permis de proceder a une evaluation de la dose de rayonnements. (author) [Spanish] Los trabajos publicados acerca de los depositos de torotrasto en el sistema reticuloendotelial y de los datos clinicos obtenidos son bastante abundantes. En cambio, son contados los casos de depositos renales de toro- trasto descritos en la bibliografia. Sin embargo, es de suponer que hay muchos pacientes con estos ultimos depositos, ya que el torotrasto se utilizo con

  2. A construção sociológica de uma posição regionalista: Reflexões sobre a edição e recepção de Casa-grande & senzala de Gilberto Freyre

    Directory of Open Access Journals (Sweden)

    Sorá Gustavo

    1998-01-01

    Full Text Available Este artigo analisa disputas e momentos de inflexão no processo de autonomização das ciências sociais e das estruturas de produção e circulação de mensagens escritas sobre o Brasil, a partir da análise da edição e recepção de Casa-grande & senzala, de Gilberto Freyre. Entre os sucessivos prefácios do livro, da 1ª à 14ª edições, e a consagração de autores como Florestan Fernandes, desenvolve-se uma prolongada e violenta batalha simbólica para universalizar as formas legítimas (estilos narrativos, projetos institucionais, fórmulas editoriais, invenção e representação de comunidades de leitores para pensar o Brasil. Seguindo este percurso, o artigo mostra como as representações que pesam sobre Freyre e seu livro de estréia, como regionalista, derivam tanto das posições e concepções que Freyre foi assumindo em sua trajetória, quanto das posições que foram se impondo no campo intelectual a partir dos anos 40 em São Paulo, com o objetivo de consolidar a "Sociologia científica e nacional". Somando à interpretação dos discursos os princípios de sua dispersão, como a edição e a institucionalização dos saberes universitários, o artigo busca compreender como livro e autor chegaram a ser o que são hoje em dia à luz de mudanças nos mecanismos de seleção do panteão dos intérpretes do Brasil.

  3. Edição Inspiradora

    Directory of Open Access Journals (Sweden)

    Luciana Di Leone

    2012-12-01

    Full Text Available Embriaguez e engajamento (“Une ivresse belle m’engage” raramente se associam talvez por isso, quando a associação acontece a imagem que gera pode parecer imprevisível, fragmentada, inaudita com uma exceção discutida longamente desde a antiguidade: a do poeta ou artista inspirado. O poeta, para ser poeta, deve estar embriagado, deve ter bebido o elixir da musa. Inclusive, no seio da própria modernidade – que por todos os meios tentou afastar a arte de qualquer relação com o incompreensível – Mallarmé retoma, em “Brinde”, o gesto da inspiração, levanta a taça para beber, colocar o elemento estonteante dentro de si: e entusiasmar-se. Esse gesto complexo, pelo qual se interpenetram o eu e o outro, o poeta e os deuses, o dentro e o fora, sob diversos pontos de vistas e através de diversos objetos, é o foco da instigante coletânea organizada pelo professor de filosofia da Universidade Federal Fluminense, Fernando Muniz.

  4. Edição Inspiradora

    Directory of Open Access Journals (Sweden)

    Luciana Di Leone

    2012-03-01

    Full Text Available http://dx.doi.org/10.5007/1984-784X.2012v12n17p120 Embriaguez e engajamento (“Une ivresse belle m’engage” raramente se associam talvez por isso, quando a associação acontece a imagem que gera pode parecer imprevisível, fragmentada, inaudita com uma exceção discutida longamente desde a antiguidade: a do poeta ou artista inspirado. O poeta, para ser poeta, deve estar embriagado, deve ter bebido o elixir da musa. Inclusive, no seio da própria modernidade – que por todos os meios tentou afastar a arte de qualquer relação com o incompreensível – Mallarmé retoma, em “Brinde”, o gesto da inspiração, levanta a taça para beber, colocar o elemento estonteante dentro de si: e entusiasmar-se. Esse gesto complexo, pelo qual se interpenetram o eu e o outro, o poeta e os deuses, o dentro e o fora, sob diversos pontos de vistas e através de diversos objetos, é o foco da instigante coletânea organizada pelo professor de filosofia da Universidade Federal Fluminense, Fernando Muniz.

  5. EDI at the Jet Propulsion Laboratory Library

    Science.gov (United States)

    Amago, B.

    1994-01-01

    The JPL Library and Information Center orders and claims material elecronically whenever feasible. The NASA Aerospace Research Information Network (ARIN) is used to order books for the library collection; BIP Plus on CD-ROM is used to order office copies. Paper copies of invoices are processed when material is received. Subscriptions are ordered using the vendor's online system; monthly and annual invoices are received both in paper and electronic format (diskette of FTP). Library-developed dbase programs complement or duplicate functions available through ARIN and/or the JPL institutional accounting system.

  6. Impact of sex and glucose-lowering treatments on hypoglycaemic symptoms in people with type 2 diabetes and chronic kidney disease. The French Chronic Kidney Disease - Renal Epidemiology and Information Network (CKD-REIN) Study.

    Science.gov (United States)

    Balkau, B; Metzger, M; Andreelli, F; Frimat, L; Speyer, E; Combe, C; Laville, M; Jacquelinet, C; Briançon, S; Ayav, C; Massy, Z; Pisoni, R L; Stengel, B; Fouque, D

    2018-04-06

    To describe current practices of glucose-lowering treatments in people with diabetes and chronic kidney disease (CKD), the associated glucose control and hypoglycaemic symptoms, with an emphasis on sex differences. Among the 3033 patients with CKD stages 3-5 recruited into the French CKD-REIN study, 645 men and 288 women had type 2 diabetes and were treated by glucose-lowering drugs. Overall, 31% were treated only with insulin, 28% with combinations of insulin and another drug, 42% with non-insulin glucose-lowering drugs. In CKD stage 3, 40% of patients used metformin, 12% at stages 4&5, similar for men and women; in CKD stage 3, 53% used insulin, similar for men and women, but at stages 4&5, 59% of men and 77% of women used insulin. Patients were reasonably well controlled, with a median HbA1c of 7.1% (54mmol/mol) in men, 7.4% (57mmol/mol) in women (P=0.0003). Hypoglycaemic symptoms were reported by 40% of men and 59% of women; they were not associated with the estimated glomerular filtration rate, nor with albuminuria or with HbA1c in multivariable analyses, but they were more frequent in people treated with insulin, particularly with fast-acting and pre-mixed insulins. Glucose-lowering treatment, HbA1c and hypoglycaemic symptoms were sex dependent. Metformin use was similar in men and women, but unexpectedly low in CKD stage 3; its use could be encouraged rather than resorting to insulin. Hypoglycaemic symptoms were frequent and need to be more closely monitored, with appropriate patient-education, especially in women. Copyright © 2018 Elsevier Masson SAS. All rights reserved.

  7. The production process of "Étude sur le Rein des Urinaires", doctoral thesis of Joaquin María Albarrán at the Faculty of Medicine in Paris.

    Science.gov (United States)

    Fernández-Arias, M; Otero, I; Pérez-Albacete, M; Fariña, L A; Angulo, J C

    2014-01-01

    The manuscript of the Doctoral Thesis of Joaquín Albarrán in the Faculty of Medicine in Paris "Étudesur le Rein des Urinaires" has been donated to Asociación Española de Urología. Direct comparison of the original and printed material gives information of the production process of this master work. Direct comparison between the original hand-written work, a single hard bound volume covered with loin cloth and water paper composed of 145 numbered pages plus 206 newly numbered pages of clinico-pathological (37 subjects) and experimental (19 assays in 20 rabbits) data, and the printed work edited by Georges Steinheil in 1889. Prints included 4 plates with 14 figures, 9 temperature charts and 5 tables describing urine examinations. Figures were trichromic and charts and tables black & white. Chromolithographs were produced by Mr. Leuba in the printing owned by Lemercier et Cie, Paris. The original work was completed in 1887 without any correction or deletion. Differences are noticeable between the text in the master and printed works: rearrangement of data and inclusion of a new clinical observation, 5 new experiments, summary and dedications. Changes in iconography are noticeable. The masterwork included 24 plates (numbered from 1 to 22, 13bis, 16bis) with 46 figures (44 colored) integrated within the text and 26 double-page temperature registries that accompany clinical observations. Anatomical, histological and microbiological illustrations, including culture media, microbiological stains and histobacteriological preparations were depicted as watercolors (44%), watercolors mixed with pencil or ink (52%) or pencil drawings (4%). Four (9%) were signed by the author, 5 (11%) had numerical annotations and only 14 (30%) were definitely printed with loss of the black component and redrawn of 4/14 (29%) images. The largest images were not printed. Joaquín Albarrán described and beautifully illustrated himself the role "pyogenic bacillus" (E. coli) played in renal

  8. La traduction anglaise de Maria Stuarda : paradoxes et contradictions d’une reine catholique et puritaine The English Translation of Maria Stuarda: Paradoxes and Contradictions of a Catholic and Puritan Queen

    Directory of Open Access Journals (Sweden)

    Pierre Degott

    2011-12-01

    Full Text Available Cette étude vise à étudier l’unique traduction anglaise de l’opéra de Donizetti Maria Stuarda (1835, réalisée pour l’English National Opera en 1973. Dans le cadre d’une réflexion sur la « réécriture du patrimoine anglophone », ce travail cherche à montrer comment le recours à la traduction dans un contexte culturel particulier, la Grande-Bretagne des années 1970 et 1980, modifie considérablement les enjeux historiques et politiques qui ressortent de l’œuvre- source. Ainsi, si l’opéra de Donizetti propose une lecture « revisitée » de l’histoire, par le biais notamment l’œuvre de Schiller, le processus de la « traduction » permet lui aussi de recadrer et de recontextualiser le propos. On s’attachera ainsi à examiner le traitement des aspects historiques et religieux de l’opéra de Donizetti. Enfin, on pourra également analyser les modifications faites sur le plan musical, ainsi que sur celui de la distribution vocale. Loin d’être innocent, le choix assez curieux de Janet Baker – valeur « nationale » s’il en est – pour incarner l’infortunée reine Stuart n’était-il pas à lui-même destiné à émousser, ou à recadrer, les enjeux essentiels de l’ouvrage de Donizetti ?This article is about the only English singing-translation of Donizetti’s Maria Stuarda, as performed by the ENO in the 1970s and 80s. It aims at showing how the translated text considerably modifies the historical and political issues of the original version, the English text being a form of correction of the work of Schiller and Donizetti’s librettist, Giuseppe Bardari. If Donizetti’s work already offers, via Schiller, a somewhat revised version of History, the translation and recontextualisation of the opera pushes the transformation a little bit further. The paper thus examines some of the religious and historical aspects of such a cultural transfer, but also some of the musical modifications brought to

  9. Baixa prevalência de discromatopsia, pela 4ª edição do teste pseudoisocromático HRR (Hardy, Rand e Rittler), da população indígena de etnia terena da aldeia lalima na região de Miranda: Mato Grosso do Sul

    OpenAIRE

    Piccinin,Marcos Rogério Mistro; Cunha,Juliana Ferrari; Almeida,Herbert Paulo de; Bach,Cleiton Cassio; Dossa,Andréa Cristina Grubits Gonçalves de Oliveira; Silva,Reinaldo Ferreira da; Pessoa,Valdir Filgueiras

    2007-01-01

    OBJETIVO: Avaliar a freqüência de discromatopsias através da 4ª edição do teste pseudoisocromático HRR (Hardy, Rand and Rittler) entre a população indígena masculina da aldeia Lalima, etnia Terena, na região de Miranda-MS. MÉTODOS: Foram realizadas viagens à aldeia Lalima em Miranda-MS, nos meses de janeiro e fevereiro de 2005. As viagens para realizar os exames só foram iniciadas após o projeto ter sido avaliado e aprovado pelos Comitê de Ética e Pesquisa da UFMS, Comitê Nacional de Ética e ...

  10. HÉNAUX, Victor. De l’amour des femmes pour les sots / Queda que as mulheres têm para os tolos. Tradução de Machado de Assis. Edição Bilíngue. Organização: Ana Cláudia Suriani da Silva e Eliane Fernanda Cunha Ferreira. Campinas: Editora Unicamp. 2008.

    Directory of Open Access Journals (Sweden)

    Kall Lyws Barroso Sales

    2014-11-01

    Full Text Available http://dx.doi.org/10.5007/2175-7968.2015v35n1p313   Em 2008, em comemoração ao centenário de Machado, as professoras Ana Cláudia Suriani da Silva e Eliane Fernanda Cunha Ferreira retomam as discussões sobre autoria, plágio e tradução, propondo uma edição bilíngue na qual cotejam a obra de Hénaux, De l'amour des femmes pour les sots de 1858 e a tradução de Machado Queda que as mulheres têm para os tolos de 1861. Assim, esta resenha analisa a tradução de Machado de Assis, cuja autoria da obra, durante muito tempo, foi atríbuida ao escritor brasileiro.

  11. HÉNAUX, Victor. De l’amour des femmes pour les sots / Queda que as mulheres têm para os tolos. Tradução de Machado de Assis. Edição Bilíngue. Organização: Ana Cláudia Suriani da Silva e Eliane Fernanda Cunha Ferreira. Campinas: Editora Unicamp. 2008.

    Directory of Open Access Journals (Sweden)

    Kall Lyws Barroso Sales

    2015-06-01

    Full Text Available Em 2008, em comemoração ao centenário de Machado, as professoras Ana Cláudia Suriani da Silva e Eliane Fernanda Cunha Ferreira retomam as discussões sobre autoria, plágio e tradução, propondo uma edição bilíngue na qual cotejam a obra de Hénaux, De l'amour des femmes pour les sots de 1858 e a tradução de Machado Queda que as mulheres têm para os tolos de 1861. Assim, esta resenha analisa a tradução de Machado de Assis, cuja autoria da obra, durante muito tempo, foi atríbuida ao escritor brasileiro.

  12. A queda da bancada e as mudanças na cena de apresentação dos telejornais: em busca da identidade e aproximação com o telespectador – uma análise do MGTV Primeira Edição

    OpenAIRE

    Pereira, Renata Venise Vargas

    2013-01-01

    Este trabalho teve como proposta investigar como as alterações na cena de apresentação do telejornal, que incluem a retirada da bancada como o principal elemento cênico e a circulação e posicionamento do apresentador no estúdio, constituem tentativas de aproximação com o telespectador, estabelecer vínculos de pertencimento e relações identitárias com seu público. Na pesquisa empírica avaliou-se as alterações adotadas pelo MGTV 1ª Edição, veiculado pela TV Integração de Juiz de Fora, emissora ...

  13. Final report for EDI energy conservation with diode light; Slutrapport for EDI energibesparelser med diodelys

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    2006-07-01

    The aim of this project has been to develop technological knowledge and a competence platform for utilization of new light emitting diode technology for general lighting purposes. Furthermore the project has aimed at developing a 3 W light diode bulb to replace 15-20 W filament bulbs and halogen spotlights, and thereby demonstrating a large energy conservation potential in the use of LED technology for lighting purposes. (BA)

  14. Julge unistada! / Timo Rein, Martin Sookael

    Index Scriptorium Estoniae

    Rein, Timo

    2003-01-01

    Autorid leiavad, et unistuste olemasolu ja unistamine mõjuvad motiveerivalt ning soovitavad lähtudes Dale Garnegiest "elada tänase päeva sektsioonis", mis tähendab unistamist, planeerimist ja tegutsemist ainult tänases päevas.

  15. States Eye Looser Rein on Districts

    Science.gov (United States)

    Jacobson, Linda

    2008-01-01

    The push to give school districts greater operating flexibility--a grassroots rallying cry eclipsed in recent years by the charter school movement--is seeing a resurgence, as states seek to spur innovation that will help raise student achievement. In Georgia, Governor Sonny Perdue is proposing "performance contracts" that would free…

  16. Taking the Reins: Preservice Teachers Practicing Leadership

    Science.gov (United States)

    Dunlap, Karen; Hansen-Thomas, Holly

    2011-01-01

    What makes the difference between a good teacher and a great one? Knowing one's content is important, but having strong leadership skills can tip the scales from mediocrity to excellence. The best time to begin practicing being a teacher leader is during the preservice years. By practicing leadership skills, one can begin to view oneself not only…

  17. Erisused ja elu hind / Rein Tootmaa

    Index Scriptorium Estoniae

    Tootmaa, Rein

    2000-01-01

    IV Pimedate Ööde Filmifestivalil linastunud mängufilmidest : Prantsusmaa "Harry aitab sind" : režissöör Dominik Moll, Jaapani "Tabu" ("Gohatto") : režissöör Nagisha Oshima, Prantsusmaa "Vägista mind" ("Baise-moi") : režissöör Coralie Trinh Thi, Soome "Tundra seitse laulu" : režissöör Markku Lehmuskallio ja Prantsusmaa "Dogma 5 : Armastajad" : režissöör Jean-Marc Barri

  18. Edasi - Juhan Liivi juurde! / Rein Veidemann

    Index Scriptorium Estoniae

    Veidemann, Rein, 1946-

    2008-01-01

    Arvustus: Liiv, Juhan. Tuulehoog lõi vetesse : [luuletused] / koostanud Jüri Talvet. Tallinn : Tänapäev, 2007. (Suur luuleraamat) ; Liiv, Juhan. Meel paremat ei kannata : valik luulet eesti ja inglise keeles = The Mind Would Bear No Better : A Selection of Poetry in Estonian and English / tõlkinud ja koostanud Jüri Talvet. Tartu : Tartu Ülikooli Kirjastus, 2007

  19. Edasi - Juhan Liivi juurde! / Rein Veidemann

    Index Scriptorium Estoniae

    Veidemann, Rein, 1946-

    2008-01-01

    Rets. rmt.: Liiv, Juhan. Tuulehoog lõi vetesse / koost. Jüri Talvet. Tallinn : Tänapäev, 2007; Liiv, Juhan. Meel paremat ei kannata : valik luulet eesti ja inglise keeles = The mind would bear no better : a selection of poetry in Estonian and English / koostanud Jüri Talvet; tõlkinud Jüri Talvet & H. L. Hix. Tartu : Tartu Ülikooli Kirjastus, 2007

  20. Rahvarinde esimene suurvõit / Rein Ruutsoo

    Index Scriptorium Estoniae

    Ruutsoo, Rein, 1947-

    2008-01-01

    17. juuni 1988 kui poliitilise revolutsiooni algus, mis viis kommunistliku režiimi kokkukukkumiseni. 1988. aasta kronoloogiad vaadates jääb autorile mulje, et Eesti taasvabanemise sisuks oli Alo Mattiiseni laulude esitamise tähe all sinimustvalgete lehvides kulgemine ühest kooslaulmisest teise

  1. USSR reins-in nuclear plans

    International Nuclear Information System (INIS)

    Perera, Judith.

    1989-01-01

    The USSR had hoped to double its nuclear capacity by the year 2000 to provide 20 per cent of its electricity. But this may no longer be possible in the face of the growing anti-nuclear movement allowed by Glasnost and given a focus by Chernobyl. Local protest has forced Moscow to drop its plans to build one of the world's biggest nuclear power plants at Ignalina in Lithuania. Although two 1,500 MW units are operating, there is national opposition to two more being built there. A year ago the Government had to scrap plans to build a 1,000MW VVER (pressurised water reactor) at Krasnador near the Black Sea, because of high seismic activity in the area. In the Ukraine, building has also stopped at the Chigirin plant. Plans to build nuclear heat and power plants at Odessa and Kharkov were cancelled last July. Construction of a nuclear power and heat plant at Minsk has been suspended and the Byelorussian government has proposed to Moscow that it should be redesigned to run on gas. A planned nuclear power and heat plant in Gorky and a plant being built in the Crimea are in doubt. Armenia's two reactors in the Ararat valley are to be closed and converted to a thermal plant, following increased concern after the 1988 earthquake. The USSR are looking at other energy sources, geothermal, solar, wind and wave. (author)

  2. Sotsialistlik realism kui modernsuse projekt / Rein Veidemann

    Index Scriptorium Estoniae

    Veidemann, Rein, 1946-

    2001-01-01

    Artikkel põhineb 19. mail 2001 Tartus peetud konverentsiettekandel ja seda võib vaadelda ka kui üht järjekordset lüli viimastel aastatel modernismi ja postmodernismi ning eesti sõjajärgse kirjandussituatsiooni üle käivast dialoogist

  3. Allilma ja pealilma dilemma / Rein Lang

    Index Scriptorium Estoniae

    Lang, Rein, 1957-

    2007-01-01

    Justiitsminister kirjutab organiseeritud kuritegevusest Eestis, toob näiteid riikidest, kus on püütud organiseeritud kuritegevuse abil lahendada oma probleeme ning peab oluliseks, et riigi koostöö sellega peab olema võimatu. Kaitsepolitsei ja keskkriminaalpolitsei tähtsus organiseeritud kuritegevuse kaotamisel

  4. Balti "Ungari tee" taotlus 1965 / Rein Taagepera

    Index Scriptorium Estoniae

    Taagepera, Rein, 1933-

    2010-01-01

    1965. aastal H. Raagi, H. Susi ja R. Taagepera poolt koostatud ja levitatud satelliitsusmemorandumist, milles toodi välja idee kehtestada Balti riikides rahvademokraatia; Zbigniew Brzezinski rollist memorandumi vahendajana ning selle avaldamisele järgnenud vastukajadest ja tegevustest kuni aastani 1973

  5. Eesti kirjab EXPO paviljoni rahvamustritega / Rein Sikk

    Index Scriptorium Estoniae

    Sikk, Rein, 1961-

    2009-01-01

    Eesti paviljoni projekteerimine Hiinas Shanghais 1. maist 31. oktoobrini 2010 toimuvaks maailmanäituseks EXPO 2010 on lõppemas. Oktoobris algavast paviljoni ehitamisest ja sisustamisest ning Eestist EXPO-l osaleda soovijatest. Eesti osalemise peasõnum: "Me elame siin ja meil on siin hea elada". Eesti paviljoni konkursi võidutöö "Savecity.org" autoritest nimetatud: Illimar Truverk, Andres Labi, Janno Roos, Ionel Lehari

  6. Teiseste andmete kasutamine turundusuuringutes / Rein Sirkel

    Index Scriptorium Estoniae

    Sirkel, Rein

    2003-01-01

    Probleemidest, mis kerkivad üles seoses teiseste andmete kasutamisega, teiseste teabeallikate klassifitseerimise süsteemist Eesti tingimustes, teabeallikate praktilise kasutamise võimalustest turundusuuringu läbiviimisel. Skeem

  7. Linnaehitusest ja -kindlustustest Eestis uusajal / Rein Zobel

    Index Scriptorium Estoniae

    Zobel, Rein, 1928-2012

    2005-01-01

    Tallinna, Tartu, Narva, Pärnu, Kuressaare ja väikelinnade (Paide, Haapsalu, Rakvere, Viljandi) linnaehitusest ja -kindlustustest uusajal. 18. sajandil rajatud uuest kindluslinnast Paldiskist. Bibliograafia lk. 443-444

  8. Taastuvenergiaallikad ja Eesti rahvuslikud huvid / Rein Veski

    Index Scriptorium Estoniae

    Veski, Rein, 1933-

    2002-01-01

    Eesti riigi huvides on kasulik rahvusvaheliste energeetikaalaste lepete täitmine, sest need suurendavad taastuvenergiaallikate osatähtsust, mis omakorda suurendab riigi energeetilist sõltumatust, mis vastab Eesti rahvuslikele huvidele. Tabelid

  9. August Kingu reisikaaslane Richard Vilmansen / Rein Saukas

    Index Scriptorium Estoniae

    Saukas, Rein, 1947-

    2008-01-01

    Bibl. lk. 212. Ette kantud 25. oktoobril 2007 Akadeemilise Rahvaluule Seltsi kogumiskonverentsil "Võõrsil ja kodus". R. Vilmansen osales ühel rahvaluule kogumismatkal - koos August Kinguga Vaivara kihelkonnas 1913. a. kevadsuvel

  10. Mälestus laulvast revolutsioonist / Rein Veidemann

    Index Scriptorium Estoniae

    Veidemann, Rein, 1946-

    2008-01-01

    Rets. rmt. : Vesilind, Priit J. The Singing Revolution : how culture saved a nation / by Priit Vesilind with James and Maureen Tusty, based on their film "The Singing Revolution". Tallinn : Varrak, 2008

  11. Hasso Krulli eepiline pesamuna / Rein Veidemann

    Index Scriptorium Estoniae

    Veidemann, Rein, 1946-

    2015-01-01

    Eesti Kultuurkapitali aastapreemia laureaat Hasso Krull. Arvustus: Krull, Hasso. Pesa : tekstid 2000-2012. Tallinn : Eesti Keele Sihtasutus, 2014 ; Krull, Hasso. Muna : tekstid 1987-2012. Tallinn : Eesti Keele Sihtasutus, 2014 ; Krull, Hasso. Kui kivid olid veel pehmed. Tallinn : Eesti Keele Sihtasutus, 2014

  12. Kuidas valiti president 1996. aastal? / Rein Toomla

    Index Scriptorium Estoniae

    Toomla, Rein, 1951-

    2002-01-01

    Autor leiab 1996. aasta presidendivalimisi analüüsides, et oluliseks tuleb pidada seda, et valimised suudeti põhiseaduses ettenähtud korras läbi viia ning ei pidanud käivituma erakorraliste valimiste mehhanism. Tabelid: 1995. a. Riigikogu valimised; Riigikogu fraktsioonid 1996. a. suvel; Toetus presidendikandidaatidele; Presidendivalimised Riigikogus; Arvatavasti Lennart Meri poolt; Arvatavasti Arnold Rüütli poolt; Presidendivalimised Valimiskogus

  13. Jalgratta leiutamine meie energiapoliitikas? / Rein Hanni

    Index Scriptorium Estoniae

    Hanni, Rein

    2004-01-01

    Autor leiab, et Eesti Energia peaks oma strateegiliste eesmärkide seadmisel lähtuma kütuse ja energiamajanduse pikaajalisest riiklikust arengukavast, mille vastuvõtmisega otsustati vähendada põlevkivienergia kasutamist

  14. Ants Paju exegi monumentum / Rein Veidemann

    Index Scriptorium Estoniae

    Veidemann, Rein, 1946-

    2004-01-01

    13. juunist 20. augustini 2004 toimunud graniitskulptuurifestivalist Põltsamaa lähedal Sõpruse pargis. Osales Erland Knudsson Madsen Taanist, Arto Lappalainen Soomest, Sandis Kondratas Lätist, Algirdas Kuzma Leedust, Christos Mondzios Poolast, Tauno Kangro, Are Haljas ja Art Allmägi Eestist

  15. Étude anatomique d'une espèce de lémurien (Eulemur fulvus) : coupes topographiques et tomodensitométriques du thorax, de l'abdomen et du bassin. Application à la pratique de l'échographie du cœur et des reins

    OpenAIRE

    Raharison, Fidiniaina

    2008-01-01

    L'objectif de notre étude est d'élaborer un document de référence mettant en relation l'anatomie, l'imagerie et la clinique du lémurien brun (Eulemur fulvus) et débouchant sur des mesures échographiques normales des reins et du cœur. Les études anatomique et tomodensitométrique ont été effectuées sur deux lémuriens et l'étude échographique sous différents modes sur 16 animaux après anesthésie. Les coupes anatomiques et tomodensitométriques nous ont permis de préciser la position et la conform...

  16. Water excretion mechanisms of the kidney studied in the rabbit using tritiated water during the stop-flow assay; Les mecanismes d'excretion de l'eau par le rein etudies a l'aide d'eau tritiee chez le lapin au cours de l'epreuve de diurese interrompue

    Energy Technology Data Exchange (ETDEWEB)

    Morel, F.; Amiel, CI.; Falbriard, A. [Commissariat a l' energie atomique et aux energies alternatives - CEA, Service de Biologie (France)

    1960-07-01

    The pattern of water turnover in the kidney and the mechanisms of water transfer into the urine have been studied in the rabbit using tritiated water as a tracer and the stop-flow technique. The experiments have given the following results: a) During the interruption of the diuresis, the injected tritiated water is completely exchanged with the water of the renal cortex, but the tracer does not reach the deep regions of the kidney, despite the fact that the blood circulation is maintained in these regions; this suggests that the vascular loops of the vasa recta function as a mechanism of water exchange by countercurrent. b) During the osmotic polyuria following the stop-flow period, the concentration gradient of tritiated water inside the kidney diminishes progressively. The concentration of the tracer in the urine is at all time similar to that existing in the deep medulla and the renal papilla and markedly different from that of the cortex or arterial blood. This fact shows that the molecules of water in the urine excreted do not come from either the glomerular filtrate or the convoluted tubules but from the water contained in the deep regions of the kidney. Also these results indicate that the walls of the collecting ducts have a very high permeability to water diffusion. Reprint of a paper published in Revue francaise d'etudes cliniques et biologiques, Vol. IV, no. 8, p. 773-779, 1959 [French] Les modalites du renouvellement de l'eau dans le rein et les mecanismes de son passage dans l'urine ont ete etudies chez le lapin a l'aide d'eau tritiee, employee comme indicateur au cours de l'epreuve de 'diurese interrompue' (stop flow). Les experiences effectuees montrent que: a) pendant l'interruption de la diurese, l'eau tritiee injectee s'echange completement avec l'eau contenue dans le cortex renal, mais elle n'atteint pratiquement pas les regions profondes du rein, bien que la circulation sanguine y soit maintenue; cette observation suggere que les anses

  17. Renal Scintiscanning with Hg{sup 209}-Neohydrin in Urologic Diseases; Scintigraphy du Rein dans les Maladies des Voies Urin Aires au Moyen de Neohydrine Marquee avec {sup 203}Hg; Stsintillyatsionnoe skennirovanie pochek s pomoshch'yu neogidrina,mechennogo Rtut'yu-203, pri urologicheskikh zabolevaniyakh; Exploracion Centelleografica del Rinon con Neohydrina - {sup 203}hg en las Afecciones Urologicas

    Energy Technology Data Exchange (ETDEWEB)

    Bollini, V.; Tori, G. [Radiology Institute of the University of Bologna (Italy)

    1964-10-15

    which point to a compensatory hypertrophy should be distinguished from the dishomogeneous and irregular ones. These last pictures suggest the presence of large hydronephroses, tumours or multiple cysts. In renal vascular disease, the character of the uptake in the two kidneys can be of significant value in assessing the reduced function and in differentiating unilateral from bilateral diseases. Renal scintiscanning thus shows promise of proving a useful clinical technique, particularly if combined with radiological examination of the kidneys by traditional means (urography, ascending pyelography, retropneumoperitoneum, tomography, aortography, etc.). (author) [French] Les auteurs ont procede a des scintigraphies du rein au moyen de neohydrine marquee avec {sup 203}Hg. Ils ont utilise le dispositif de scintigraphie 'NuclearChicago', type 1700, a cristal de 5 x 5 cm et collimateur alveolaire de 7 cm de distance focale. En general, les scintigrammes sont enregistres a la fois sur papier et sur film photographique; la neohydrine marquee avec {sup 203}Hg est administree en doses de 120 a 160 {mu}c (environ 2 {mu}c/kg). L'examen scintigraphique commence deux heures environ apres l'injection et dure de 40 a 50 min. Le fait que la neohydrine marquee se fixe selectivement au niveau du cortex renal permet d'obtenir une representation graphique des deux reins et de determiner leur position, leur orientation et leur forme, ainsi que le degre d'homogeneite du parenchyme normal. Dans certains cas, des examens autobiographiques ont ete effectues sur des reins malades, apres ablation. Cette methode permet de determiner les anomalies, congenitales ou acquises, dans la position et l'orientation des reins. En ce qui concerne la forme de l'organe, les contours de l'image du rein sont d'autant plus nets que la fonction renale est meilleure. Des caracteristiques techniques telles que la largeur du cristal, le type.de collimateur (dont le plan focal doit couper le plan median transversal des

  18. Study, with the help of nuclear indicators (HTO, Urea {sup 14}C and {sup 24}Na), of the renewal of water, urea and sodium in different parts of the rat kidney in aqueous diuresis and of the gerbil kidney in osmotic diuresis or in oliguria; Etude, a l'aide d'indicateurs nucleaires (HTO, UREE {sup 14}C et {sup 24}Na), du renouvellement de l'eau, de l'uree et du sodium dans les differentes regions du rein de rat en diurese aqueuse et de merion en diurese osmotique ou en oligurie

    Energy Technology Data Exchange (ETDEWEB)

    Lechene, C P [Commissariat a l' Energie Atomique, Saclay (France). Centre d' Etudes Nucleaires

    1965-06-01

    In the kidney of the gerbil in oliguria there exists a cortico-papillary gradient in the concentration of the sodium and of the urea; this gradient disappears in the gerbil kidney in osmotic diuresis or in the rat kidney in aqueous diuresis; in these three states of diuresis there is no significant difference in the potassium concentration between the surface and interior regions of the kidneys. Kinetic studies using tritiated water, urea {sup 14}C and {sup 24}Na show that water and urea in the interior regions of the kidney are only renewed very slowly (1 h) whereas the sodium is rapidly changed (1 mn). These results can be explained using WIRZ's theory concerning the mechanism of the counter-current concentration of urine. Furthermore, the evolution of the specific radioactivity of urea {sup 14}C is favorable for a cortical synthesis of urea. (author) [French] II existe dans le rein de Merions en oligurie un gradient cortico papillaire de la concentration du sodium et de l'uree; ce gradient est aboli dans le rein de Merions en diurese osmotique ou de rats en diurese aqueuse; dans ces 3 etats de diurese il n'y a pas de difference significative de la concentration du potassium entre les regions superficielles et profondes des reins. Des etudes cinetiques a l'aide d'eau tritiee, d'uree {sup 14}C et de {sup 24}Na montrent que l'eau et l'uree des regions profondes des reins ne sont renouveles que tres lentement (1 h), alors que le sodium est tres vite renouvele (1 mn). Ces resultats s'expliquent par la theorie de WIRZ sur le mecanisme de la concentration de l'urine par contre-courant. En outre, l'evolution renale de la radioactivite specifique de l'uree {sup 14}C est en faveur d'une synthese corticale de l'uree. (auteur)

  19. Rein Porro : ma ei kavatse lennuametist lahkuda / Rein Porro ; interv. Mirko Ojakivi

    Index Scriptorium Estoniae

    Porro, Rein, 1943-

    2006-01-01

    Lennuameti peadirektori asetäitja vastab küsimustele, kas ta rikkus lennundusseadust, väljastades lennuloa ettevõttele Pakker Avio, kas ta on läinud tülli lennuõnnetustega tuntuks saanud lennufirmaga ning seepärast püütakse temast vabaneda. Lisa: Uurimine rikkumisi ei tuvastanud

  20. Misjoniseminar Tartus / Rein Kalmus, Janos Kovacs Biro, Rein Käsk...[jt.] ; interv. Mare Pihlak

    Index Scriptorium Estoniae

    2007-01-01

    Vestlus osalejatega Pereraadio saates "Elupuu," mis valmis märtsis Trans-Euroopa Divisjoni väikegruppide ja misjonitöö juhi Janos Kovacs-Biro Tartu Ülikooli Ajaloomuuseumis peetud loengusarja "Ela oma elu täiel määral" põhjal

  1. Baixa prevalência de discromatopsia, pela 4ª edição do teste pseudoisocromático HRR (Hardy, Rand e Rittler), da população indígena de etnia terena da aldeia lalima na região de Miranda: Mato Grosso do Sul Low prevalence of dyschromatopsia using the fourth edition of HRR (Hardy, Rand and Rittler) pseudoisochromatic plate test among the Indian population of Lalima village, Terena

    OpenAIRE

    Marcos Rogério Mistro Piccinin; Juliana Ferrari Cunha; Herbert Paulo de Almeida; Cleiton Cassio Bach; Andréa Cristina Grubits Gonçalves de Oliveira Dossa; Reinaldo Ferreira da Silva; Valdir Filgueiras Pessoa

    2007-01-01

    OBJETIVO: Avaliar a freqüência de discromatopsias através da 4ª edição do teste pseudoisocromático HRR (Hardy, Rand and Rittler) entre a população indígena masculina da aldeia Lalima, etnia Terena, na região de Miranda-MS. MÉTODOS: Foram realizadas viagens à aldeia Lalima em Miranda-MS, nos meses de janeiro e fevereiro de 2005. As viagens para realizar os exames só foram iniciadas após o projeto ter sido avaliado e aprovado pelos Comitê de Ética e Pesquisa da UFMS, Comitê Nacional de Ética e ...

  2. Acta Unitatis Fratrum. Ediční projekt

    Czech Academy of Sciences Publication Activity Database

    Just, Jiří

    2014-01-01

    Roč. 29, č. 2 (2014), s. 451-462 ISSN 0231-7494 Institutional support: RVO:67985963 Keywords : The Bohemian Brethren * protestant historiography * manuscript sources * regesta edition * Acta Unitatis Fratrum Subject RIV: AB - History

  3. Identification of User Needs. EDIS Task I Report.

    Science.gov (United States)

    Howard Research Co., Arlington, VA.

    This report presents the identification of user needs in the Army research, development, test and evaluation (RDT&E) community. Two types of information are provided in this report. The first type includes discussions of the RDT&E cycle, the level of informational need, time response, item categories and other factors as they relate to the…

  4. From EDI to Internet Commerce: The BHP Steel Experience.

    Science.gov (United States)

    Chan, Caroline; Swatman, Paula M. C.

    2000-01-01

    Discusses the issue of business-to-business electronic commerce implementation and the factors affecting it. Discusses electronic data interchange technology, describes the results of a case study of BHP Steel (Australia), and considers paradigm shifts in implementation issues related to electronic commerce that occur over time. (Author/LRW)

  5. Study, with the help of nuclear indicators (HTO, Urea {sup 14}C and {sup 24}Na), of the renewal of water, urea and sodium in different parts of the rat kidney in aqueous diuresis and of the gerbil kidney in osmotic diuresis or in oliguria; Etude, a l'aide d'indicateurs nucleaires (HTO, UREE {sup 14}C et {sup 24}Na), du renouvellement de l'eau, de l'uree et du sodium dans les differentes regions du rein de rat en diurese aqueuse et de merion en diurese osmotique ou en oligurie

    Energy Technology Data Exchange (ETDEWEB)

    Lechene, C.P. [Commissariat a l' Energie Atomique, Saclay (France). Centre d' Etudes Nucleaires

    1965-06-01

    In the kidney of the gerbil in oliguria there exists a cortico-papillary gradient in the concentration of the sodium and of the urea; this gradient disappears in the gerbil kidney in osmotic diuresis or in the rat kidney in aqueous diuresis; in these three states of diuresis there is no significant difference in the potassium concentration between the surface and interior regions of the kidneys. Kinetic studies using tritiated water, urea {sup 14}C and {sup 24}Na show that water and urea in the interior regions of the kidney are only renewed very slowly (1 h) whereas the sodium is rapidly changed (1 mn). These results can be explained using WIRZ's theory concerning the mechanism of the counter-current concentration of urine. Furthermore, the evolution of the specific radioactivity of urea {sup 14}C is favorable for a cortical synthesis of urea. (author) [French] II existe dans le rein de Merions en oligurie un gradient cortico papillaire de la concentration du sodium et de l'uree; ce gradient est aboli dans le rein de Merions en diurese osmotique ou de rats en diurese aqueuse; dans ces 3 etats de diurese il n'y a pas de difference significative de la concentration du potassium entre les regions superficielles et profondes des reins. Des etudes cinetiques a l'aide d'eau tritiee, d'uree {sup 14}C et de {sup 24}Na montrent que l'eau et l'uree des regions profondes des reins ne sont renouveles que tres lentement (1 h), alors que le sodium est tres vite renouvele (1 mn). Ces resultats s'expliquent par la theorie de WIRZ sur le mecanisme de la concentration de l'urine par contre-courant. En outre, l'evolution renale de la radioactivite specifique de l'uree {sup 14}C est en faveur d'une synthese corticale de l'uree. (auteur)

  6. Análise da morfometria nuclear: descrição da metodologia e o papel dos softwares de edição de imagem Nuclear morphometric analysis: description of the methodology and the role of image-editing softwares

    Directory of Open Access Journals (Sweden)

    Carlos Eduardo de Andrea

    2008-02-01

    Full Text Available A análise morfométrica de imagens é utilizada em patologia para se obter dados precisos de componentes celulares e teciduais, por meio da mensuração e contagem, que são importantes para o diagnóstico e prognóstico de vários tumores. Essa técnica, mesmo sendo ferramenta útil e de baixo custo, mantém-se restrita a poucos centros de diagnóstico ou pesquisa. O objetivo deste trabalho é apresentar e descrever o método de morfometria nuclear com a utilização complementar de softwares de edição de imagens, fazendo a análise detalhada das etapas críticas do processo. A correção de problemas encontrados durante a captura das imagens, como temperatura e matiz da cor erroneamente ajustados, e de imagens com iluminação desigual provenientes de microscópio mal regulado, é fundamental para a correta análise. Assim, utilizando o recurso máscara de cor disponível em vários softwares de editoração de imagens, é possível selecionar e separar objetos de cores semelhantes, resultando numa imagem final que apresenta somente os objetos de interesse para análise. A morfometria é realizada por meio de softwares específicos como o ImageTool (versão 3.0, que possibilitam a mensuração automática de um ou mais parâmetros, com precisão e em curto intervalo de tempo. A interface do ImageTool permite ainda trabalhar simultaneamente com a imagem original e a imagem processada em que se fez a seleção das cores semelhantes. Dessa forma, pode-se confrontar o objeto que está sendo selecionado com o mesmo objeto na sua imagem original, garantindo assim correta seleção. Esse sistema possibilita conferência interobservador de 100% dos objetos, o que permite desprezar aqueles que posteriormente constatou-se que não deveriam ter sido selecionados e mensurados.The morphometric analysis of images, which comprises measuring and counting, is used in pathology to obtain accurate data of cellular and tissue components that are important for

  7. Eesti Vabariigiga ühevanused memmed kirjutavad presidendile / Rein Sikk

    Index Scriptorium Estoniae

    Sikk, Rein

    2007-01-01

    Neli memme, kes on sündinud 1918. a. veebruaris, Eesti Vabariigiga ühel ajal, kirjutavad ajakirjaniku vahendusel presidendile. Vt. samas: Alide Sepp: ehk saate päästa meie hooldekodu; Meeta Hütt: kaege perra, et elu oles rahulik; Milli Rump: andke pidustuste raha hoopis vaeslastele; Helmi Kõrnas: mõelge alati hästi. Sõna saavad Alide Sepp ja Helmi Kõrnas Pärnust, Meeta Hütt Võrust ja Milli Rump Väike-Maarjast

  8. Plaadid / Rein Vader, Heidi Purga, Tiiu Laks...[jt.

    Index Scriptorium Estoniae

    2008-01-01

    Uutest heliplaatidest Nick Cave & The Bad Seeds "Dig, Lazarus, Dig!", Erykah Badu "New Amerikah Part One", Leslie da Bass "Nights By Open Windows", Jack Johnson "Sleep Througth The Static", Janet Jackson "Discipline", "Rock & Roll City"

  9. Oaasid üksilduse kõrbes / Rein Veidemann

    Index Scriptorium Estoniae

    Veidemann, Rein, 1946-

    2012-01-01

    Mõtteid seoses 2011. aastal Eesti kultuuriministeeriumis vastu võetud otsusega broneerida osa rahvaraamatukogude raamatute ostuks eraldatavast eelarvelisest rahast kaasaja kirjanduse ja kultuuriajakirjanduse soetamiseks

  10. High Court Case Could Rein in Private Placements under IDEA

    Science.gov (United States)

    Walsh, Mark

    2007-01-01

    This article reports on starkly contrasting portraits of special education that the justices are sure to hear on the first day of the new U.S. Supreme Court term. In a case from New York City, the 1.1 million-student district argues that school officials made every attempt to provide an appropriate education plan under the federal Individuals with…

  11. Porter Takes Reins of the FNL Green Team | Poster

    Science.gov (United States)

    Courtesy of the FNL Green Team Melissa Porter, who recently joined the staff of Craig Reynolds, Ph.D., director, Office of Scientific Operations, as administrative manager, has stepped forward to lead the Frederick National Laboratory for Cancer Research (FNL) Green Team in its efforts to promote a “green” work environment. “I am excited to lead the FNL Green Team and have

  12. Prise en charge des traumatismes graves du rein | Lakmichi | Pan ...

    African Journals Online (AJOL)

    Une surveillance active clinique, biologique, et radiologique a été préconisée dans 23 cas (92%). Le scanner de contrôle fait à J7, a objectivé une stabilisation des lésions dans 17 cas et la constitution d'un urinome dans 2 cas drainé par sonde double J. Une néphrectomie d'hémostase était nécessaire dans 4 cas de grade ...

  13. Suitsusaun pürib UNESCO nimekirja / Rein Raudvere

    Index Scriptorium Estoniae

    Raudvere, Rein, 1955-

    2010-01-01

    Võrulased soovivad, et nende kodukandis tänini laialt levinud suitsusaun pääseks UNESCO vaimse kultuuripärandi nimekirja. 12. novembril saunakonverentsil Väimelas kutsusid võrulased koostööle kõiki kogukondi (setud, mulgid), kelle meelest nende suitsusaunakultuur vajab uurimist, väärtustamist ja kaitset. Eesti vaimse kultuuripärandi nimistust

  14. Plaadid / Rein Vader, Brigitta Davidjants, Liisi Laanemets...[jt.

    Index Scriptorium Estoniae

    2008-01-01

    Uutest heliplaatidest R.E.M. "Accelerate",, Lenny Kravitz "Love Revolution", MGMT "Oracular Spectacular", Nits "Doing the Dishes", The Hilliard Ensemble "Audivi Vocem", Helena Tulve "Lijnen", "Heima a film by Sigur Ros"

  15. Omavalitsuste tulubaas tuleb seada uutele alustele / Rein Org

    Index Scriptorium Estoniae

    Org, Rein

    2002-01-01

    Ilmunud ka: Koit 22. jaan. lk. 6, Vooremaa 22. jaan. lk. 3, Elva Postipoiss 26. jaan. lk. 4, Vali Uudised 18. jaan. lk.4. Mõõdukad leiavad, et omavalitsuste ülesannete täitmiseks peab enamus tuludest laekuma riigieelarvest kulupõhisena - vastavalt elanike arvule vallas või linnas. Autor: Rahvaerakond Mõõdukad

  16. Mis seal teletornis siis tegelikult juhtus? / Avo-Rein Tereping

    Index Scriptorium Estoniae

    Tereping, Avo-Rein, 1945-

    2005-01-01

    Eesti Raadio endine tehnikadirektor kirjeldab 1991. aastal augustiputshi päevil teletornis toimunut ning rõhutab, et ei tohi unustada neid tehnilisi töötajaid, kes päästsid teletorni aparatuuri hävingust ning lõid alternatiivsed infokanalid. Ka Ilmar Raagi lavastatud Eesti Televisiooni fiktiivsest dokumentaaldraamast "August 1991"

  17. La nephrolithotomie sur rein unique: a propos de vingt cas ...

    African Journals Online (AJOL)

    Through a series of 20 patients, we study the feasibility and morbidity of this technique in a solitary kidney. Patients and methods: we retrospectively reviewed a series of twenty patients with a calculus in a solitary kidney during a 9-year period, all treated with (PCNL). The results were analyzed emphasizing complications ...

  18. Eestlane tahab muulase lahkumist : eestlane ihkab rahvusriiki / Rein Sikk

    Index Scriptorium Estoniae

    Sikk, Rein, 1961-

    2000-01-01

    Järg Sep/12;13;14 lk. 4. Saar Polli integratsioonimonitooring. Ligi pooled eestlastest peavad muulaste riigist lahkumist Eestile kasulikuks. Diagr.: Mitte-eestlaste osakaal väheneb. Geneetiline mitmekesisus on rahvale kasulik. Muulaste lahkumise järel peaks Eesti tööjõudu sisse tooma hakkama. Diagr.: Kas tahate elada kiratsevas Eestis

  19. Maailmarändur vaimustus eesti folkloorist / Rein Sikk

    Index Scriptorium Estoniae

    Sikk, Rein, 1961-

    2010-01-01

    Inglise tantsuõpetajast Chris Davisest, kes on käinud Viljandi pärimusmuusika festivalil, meeste rahvatantsupeol Rakveres ja mujal Eestis ning peab eestlasi maailma parimateks vaimuvara hoidjateks. Chris Davis õpetab inglise rahvatantse oma kodumaal ja nüüd ka Eestis ning liitus kaerajaani Euroopasse viimise kampaaniaga

  20. Valimissüsteemi tuleks muuta / Rein Taagepera

    Index Scriptorium Estoniae

    Taagepera, Rein, 1933-

    2007-01-01

    Autor on seisukohal, et praegune Riigikogu valimise süsteem on liiga keeruline ja seda tuleks lihtsustada. Ta vaatleb, mis juhtuks siis, kui Eesti oleks jagatud 101 valimisringkonnaks, kus enim hääli saanud kandidaat võidab, või kui Eesti oleks üksainus valimispiirkond, kus 101 enim hääli saanud kandidaati võidavad

  1. The purifying bridge of Res Publica / Rein Taagepera

    Index Scriptorium Estoniae

    Taagepera, Rein, 1933-

    2004-01-01

    Res Publica edust Eesti poliitilisel maastikul. Autor käsitleb Res Publicat kui puhastava toimega ja silla funktsiooni täitvat parteid, mis üritab siduda tervikuks Keskerakonna ja Reformierakonna seisukohad

  2. Prishla pora otdat Viiraltu dolg / Rein Raamat ; interv. Nikolai Hrustaljov

    Index Scriptorium Estoniae

    Raamat, Rein, 1931-

    2000-01-01

    Endine joonisfilmide looja, praegune tõsielufilmide produtsent ja režissöör oma tööst, eriti kahest viimasest portreefilmist "Inimene, kes oskab olla õnnelik" ja "Maire Männik, 54 rue du Montparnasse"

  3. Peaks Venemaa tükeldama / Rein Taagepera

    Index Scriptorium Estoniae

    Taagepera, Rein, 1933-

    2001-01-01

    Ettekanne "Should Russia Break Up" Ameerika Politoloogia Ühingu aastakoosolekul Washingtonis 3.septembril 2000.a. Venemaa majanduslik ja poliitiline olukord seoses kolme revolutsiooni toimumisega: demokratiseerimine, turumajanduse sissetoomine ning dekoloniseerimine. Venemaa territoriaalse arengu võimalused

  4. Pakistan’s Nuclear Future: Reining in the Risk

    Science.gov (United States)

    2009-12-01

    contribute to the fog of war, which is further thickened by other conditions, as elucidated by Carl von Clausewitz in On War. Second, during peacetime...Emerging Power, Washington, DC: Brookings Institution Press, 2001, pp. 204, 209- 211. 16. Scott D. Sagan and Kenneth N. Waltz, The Spread of Nuclear

  5. Märts - kirjutajate lõikuskuu / Rein Veidemann

    Index Scriptorium Estoniae

    Veidemann, Rein, 1946-

    2003-01-01

    Kultuurkapitali kirjandusauhindadest ja nende saajatest. Proosa - Jüri Ehlvest, "Hobune eikusagilt"; luule - Karl Martin Sinijärv, "Artutart & 39"; näitekirjandus - Vaino Vahing, "Mängud ja kõnelused" ; lastekirjandus - Heino Kiik, "Kuresaapad"; esseistika - Peeter Mudist, "Ratsukäik"; tõlge eesti keelde - Mati Sirkel, Franz Kafka "Hiina müüri ehitamisel"; tõlge eesti keelest (Via Estica) - Antoine Chalvin, Jaan Kaplinski "Le désir de la pousière"; artiklipreemia - Tõnu Õnnepalu, "Kui...Küpsemine. Aleksander Suumani kaks luuletust ja üks raamat ("Meil siin Hüperboreas")", ilmus Loomingus, nr. 5-6; venekeelsete autorite auhind - Mihhail Veller - viimase 10 aasta proosaloomingu eest, ka ilmus 2002. a. eesti keeles tema "Nulltund"

  6. Meie mees Reykjavikis - see, kes julges / Rein Veidemann

    Index Scriptorium Estoniae

    Veidemann, Rein, 1946-

    2015-01-01

    Dokumentaalfilmist "Need, kes julgevad", režissöör Ólafur Rögnvaldsson (Island-Eesti-Läti-Leedu 2015) ETV-s. Film Baltimaade iseseisvumisest ja Islandi tolleaegsest välisministrist Jón Baldvin Hannibalssonist selles protsessis

  7. Mereväe lipulaev pakub virulaste õlut / Rein Sikk

    Index Scriptorium Estoniae

    Sikk, Rein, 1961-

    2005-01-01

    Sõjalaeval "Admiral Pitka" hakatakse ametlikel protokollilistel üritustel pakkuma Viru õlletehase Toolse ja Palmse õlut. "Admiral Pitka" võtab osa Trafalgari lahingu 200. aastapäevale ja admiral Nelsonile pühendatud üritustest. Lisa: Lipulaev

  8. Rahvaliidu kants Palamusel käärib / Rein Sikk

    Index Scriptorium Estoniae

    Sikk, Rein, 1961-

    2010-01-01

    Rahvaliidu Jõgeva maakonna juhi Riina Kulli väitel pole ükski sotsiaaldemokraat ega Rahvaliidu liider käinud kohapeal kahe erakonna võimalikku liitumist selgitamas. Palamuse elanike arvamusi Rahvaliidu ja SDE võimaliku ühinemise kohta

  9. Mälestusmärk iseendale / Rein Veidemann

    Index Scriptorium Estoniae

    Veidemann, Rein, 1946-

    2009-01-01

    Lembit Petersonist ja tema lavastusest "Maarja kuulutamine", mille eest ta pälvis aastapreemia ja osatäitmiste eest samas lavastuses said aasta naisnäitlejapreemiad tema tütred Maria ja Laura Peterson. Poeg Marius Peterson sai preemia osatäitmise eest lavastuses "Linn"

  10. Mõõdukad on sotsiaaldemokraatlik erakond / Rein Järvelill

    Index Scriptorium Estoniae

    Järvelill, Rein, 1966-

    2001-01-01

    Kuigi mõne kommentaatori arvates on Rahvaerakond Mõõdukad teinud järsu pöörde vasakule, on Mõõdukad ajanud niisugust poliitikat juba aastaid. Autor: Rahvaerakond Mõõdukad. Parlamendisaadik. Ilmunud ka: Severnoje Poberezhje, 24. mai 2001, lk. 2; Valgamaalane, 24. mai 2001, lk. 2; Koit, 24. mai 2001, lk. 6; Järva Teataja, 25. mai 2001, lk. 2; Virumaa Teataja, 25. mai 2001, lk. 7; Nädaline, 26. mai 2001, lk. 4; Meie Maa, 31. mai 2001, lk. 2

  11. Jörg Haideri miljonid tekitavad kahtlusi / Marlen Rein

    Index Scriptorium Estoniae

    Rein, Marlen, 1990-

    2010-01-01

    Austria ajakiri Profil avaldas väljavõtteid Iraagi siseminiseeriumi toimikust, mis heidavad halba varju Austria parempopulistliku partei Austria Tulevikuallianss autoõnnetuses hukkunud liidrile Jörg Haiderile ja teistele prominentsetele poliitikutele

  12. Sotsiaalne positsioneerimine / Rein Ahas, Ülar Mark, Heikki Kalle

    Index Scriptorium Estoniae

    Ahas, Rein

    2004-01-01

    Mobiiltelefonitehnoloogia arengust ja sellega kaasnevast võimalusest inimeste asukohta määrata. Privaatsuse ja turvalisuse probleemidest ning sotsiaalse positsioneerimise mõjust ühiskondliku elu korraldusele

  13. Kohaliku arengu võti on kohapeal / Rein Aidma

    Index Scriptorium Estoniae

    Aidma, Rein, 1950-

    2004-01-01

    Ilmunud ka: Pärnu Postimees, 15. okt. 2004, lk. 15; Meie Maa, 15. okt. 2004, lk. 2; Põhjarannik, 15. okt. 2004, lk. 2; Severnoje Poberezhje, 15. okt. 2004, lk. 2; Võrumaa Teataja, 16. okt. 2004, lk. 2; Koit, 16. okt. 2004, lk. 6; Nädaline, 16. okt. 2004, lk. 4; Hiiu Leht, 19. okt. 2004, lk. 2; Harjumaa, 19. okt. 2004, lk. 2; Sakala, 22. okt. 2004, lk. 2; Sõnumitooja, 22. okt. 2004, lk. 2; Virumaa Nädalaleht, 26. nov. 2004, lk. 5. Riigikogu maaelukomisjoni liige pöördub kohalike omavalitsuste poole soovitades neil säilitada koostöötahet ja mõistvat suhtumist kohalike probleemide lahendamisel

  14. Eksistentsialism Rein Põdra romaanis "Imelik vang" / Maret Vaher

    Index Scriptorium Estoniae

    Vaher, Maret

    2011-01-01

    Artikkel vaatleb J.-P. Sartre'i ja A. Camus' teoste mõju R. Põdra romaanile. Eksistentsialistlik filosoofia on eesti kirjandust sügavalt ja pikaajaliselt mõjutanud ning võib huvitavaid perspektiive pakkuda ka tänapäeva lahtimõtestamisel

  15. Kuulsuste keeruline elu : [anekdoodid] / Toomas Kall ; karikatuur: Rein Lauks

    Index Scriptorium Estoniae

    Kall, Toomas, 1947-

    2014-01-01

    Anekdoodid järgmistest kuulsustest: Luisa Värk, Taavi Rõivas, Ardo Hansson, Bill Gates, Nicolas Sarkozy, Dmitri Medvedev, Edgar Savisaar, Vladimir Putin, Anton Vaino, Astrid Kannel, Viktor Janukovitš, Evelin Ilves, Toomas Hendrik Ilves, Jürgen Ligi, Urve Palo, Indrek Tarand

  16. Miks on joonestamine vajalik? / Rein Mägi

    Index Scriptorium Estoniae

    Mägi, Rein

    2002-01-01

    Joonestamise kui õppeaine vajalikkusest, selle huvitavamaks muutmisest ja täiustamisest. Tallinna Tehnikagümnaasiumi õpilaste hinnanguid joonestustundide kohta, mille käigus läbisid nad ka arvutigraafika kursuse

  17. La chirurgie conservatrice dans le cancer du rein

    African Journals Online (AJOL)

    A. Qarro

    Renal cancer;. Conservative surgery;. Nephron-sparing;. Clamping;. Cold ischemia. Conservative surgery in kidney cancer. Abstract. Kidney cancer accounts for 3% of cancers. It ranks third in urological cancers after prostate and bladder cancers. Since the radical nephrectomy described by Robson in 1963, there has been ...

  18. Baltic Quest for a Hungarian Path, 1965 / Rein Taagepera

    Index Scriptorium Estoniae

    Taagepera, Rein, 1933-

    2013-01-01

    1965. aastal H. Raagi, H. Susi ja R. Taagepera poolt koostatud ja levitatud satelliitsusmemorandumist, mille idee oli kehtestada Balti riikides rahvademokraatia ja riikidele spetsiaalne satelliitrežiim; Zbigniew Brzezinski rollist memorandumi vahendajana; memorandumi mõju nende autorite eludele

  19. Kuus kandidaati Finlandia auhinnale : [Elisabeth Nordgreni ettekandest] / Rein Põder

    Index Scriptorium Estoniae

    Põder, Rein, 1943-

    1995-01-01

    Joenpelto, Eeva. Kohtunik Müller (1994.a. Finlandia preemia); Fagerholm, Monika. Kaunid naised rannal; Rintala, Paavo. Maria armastus; Turkka, Jouko. Häbi; Kiiskinen, Jyrki. Soomees; Lander, Leena. Las tulla torm

  20. Huvi või sundus - meie valik / Rein Rebane

    Index Scriptorium Estoniae

    Rebane, Rein

    2011-01-01

    Eesti õpilaste tulemused rahvusvaheliste PISA ja TIMSS-i testide põhjal on olnud head. Samadest uuringutest on aga selgunud, et nii Eesti õpilaste kui ka õpetajate rahulolu kooliga on üks madalamaid maailmas

  1. Teatr v kino ili kino v teatre? / Rein Veidemann

    Index Scriptorium Estoniae

    Veidemann, Rein, 1946-

    2008-01-01

    Võimalusest jälgida Metropolitan Opera lavastusi kinolavalt Tallinna kobarkinos ja Tartu kinos Ekraan. The Metropolitan Operas 26. IX etendunud R. Straussi ooperist "Salome", lavastaja J. Flimm, dirigent P. Summers, peaosas K. Mattila.

  2. Tartu Ülikool 375 / interv. Rein Raudvere

    Index Scriptorium Estoniae

    2007-01-01

    Küsitlus: Mida on teile andnud Tartu Ülikool? Millest oleksite jäänud ilma, kui poleks olnud õnne õppida Tartu Ülikoolis? Vastavad: Tõnis Lukas, Hannes Kaljujärv, Aili Paju, Ain Kallis, Aarne Liiv ja Hans Trass. Vt. samas: EV ministrid TÜ vilistlased; Riigikogu liikmed TÜ vilistlased

  3. Physicist takes the reins at Santa Fe complexity centre

    CERN Document Server

    Brumfiel, Geoff

    2003-01-01

    "Robert Eisenstein is a seasoned administrator who ran the physics directorate at the National Science Foundation (NSF) from 1997 to 2001 [...] Last month, he was named president of the SFI, which specializes in the study of complexity - an approach to the modelling of everything from the pattern of spots on a cheetah to the movements of the stock market"

  4. T-algebra - samm drillist edasi / Rein Prank

    Index Scriptorium Estoniae

    Prank, Rein, 1949-

    2009-01-01

    Õpiprogrammist T-algebra, mille andis Tartu Ülikooli arvutiteaduse instituudi töörühm üle Tiigrihüppe sihtasutusele ja mis võimaldab õpilastel saada kiiresti tagasisidet lahenduste õigsuse kohta

  5. Alatskivi vanadaam vuntsitakse üles / Rein Raudvere

    Index Scriptorium Estoniae

    Raudvere, Rein, 1955-

    2009-01-01

    2009. aasta sügisel agas Alatskivi lossi ennistamise viimane etapp. Lossist saab piirkonna turismi- ja kultuurikeskus. Hoone teisele korrusele tuleb Eduard Tubina muuseum. Lühidalt lossi ajaloost ja ennistamisest

  6. Political chaos reins progress on new joint ventures in Russia

    International Nuclear Information System (INIS)

    Anon.

    1992-01-01

    This paper reports that frustration is mounting among foreign petroleum companies chasing business opportunities in Russia. Political uncertainty continues to block large oil and gas exploration and production deals there. Most foreign officials believe Russia's transformation from a centrally planned economy to a market economy is irreversible. But enough political, social, and economic uncertainty persists that Russian leaders are hesitant to approve deals with foreign companies. The lack of certainty among leaders of the former Soviet republic about who controls Russia's natural resources, who can approve contracts, and who determines winners of bid tenders is causing confusion among foreign companies trying to negotiate major E and P deals. With no clearly successful path apparent for completing large deals, various secondary negotiating strategies are prevailing. Russian industry specialists say those secondary strategies work best for small deals involving relatively small players in less prospective regions. Meantime, countervailing political forces within the country, the world's top producer of oil and gas, continue to buffet petroleum companies that are negotiating deals or getting projects off the ground

  7. Eesti kultuur XXI sajandi künnisel / Rein Veidemann

    Index Scriptorium Estoniae

    Veidemann, Rein, 1946-

    2006-01-01

    Eesti kultuuri käsitlemisest tekstina, eesti kultuurist üldisemalt 20. saj. lõpus ja 21. saj. alguses. Sisaldab Hando Runneli luuletust "Ei taha mina tagasi ei tea mis kuldseid aegu..." ja Paul-Eerik Rummo luuletust "Con affetto"

  8. Eestlased külmal maal / Rein Raudvere

    Index Scriptorium Estoniae

    Raudvere, Rein, 1955-

    2007-01-01

    23. märtsil tähistasid WMO (Maailma Meteoroloogiaorganisatsioon) ja selle 188 liikmesriiki ülemaailmset meteoroloogiapäeva. EMHI tähistas pidupäeva konverentsiga, mille arutlusteemaks oli polaarmeteoroloogia (nii Arktika kui Antarktika) ja selle üleilmsete mõjude mõistmine

  9. Mäo kolmnurka kerkib mini-Eesti / Rein Sikk

    Index Scriptorium Estoniae

    Sikk, Rein, 1961-

    2010-01-01

    Järvamaale Mäo kolmnurka kavandatavast Eestimaad vähendatuna näitavast teemapargist mini-Eesti, mis peaks valmima 2014. aastaks. Kavandatavast Narva vanalinna rekonstruktsioonist maketina, mis peaks tulema umber 200 korda 400 meetri suurune

  10. Construction insolvency in Australia: reining in the beast

    Directory of Open Access Journals (Sweden)

    Jeremy Coggins

    2016-09-01

    Full Text Available Insolvency has become endemic in the Australian construction industry. The scale of the problem has reached such proportions that both the NSW Parliament and the Senate have, in recent times, commissioned inquiries into construction insolvency. This paper aims to identify the reasons as to why the construction industry is so susceptible to insolvency, evaluate the effectiveness of any existing insolvency protection measures available to construction firms, and to identify proposed future measures to address the factors causing construction insolvency. The results of a questionnaire survey designed to discover the extent of the construction insolvency problem, as well as building contractors’ views with respect to the causes and regulation of construction insolvency, in South Australia are presented. The research found that there is an appetite amongst building contractors for the introduction of further regulation to address construction insolvency. Further, although the research found underbidding to be the biggest contributory factor towards construction insolvency, it appears to be the most difficult factor to address through regulation which explains the paucity of recommendations which directly address underbidding emanating from the Senate inquiry in 2015.

  11. Laenu tagamisest munitsipaalmaaga ehk kuidagi ikka saab / Rein Tiivel

    Index Scriptorium Estoniae

    Tiivel, Rein, 1940-

    2006-01-01

    AS Kinnisvaratehingud ja Puulinna Linnavalitsus leppisid kokku linna omandis oleva kinnisasja koormamises kinnisvarafirma kasuks. Esitatud kaasus sisaldas mitmeid kokkuleppeid, mis seadsid kahtluse alla tehingu kehtivuse ja valitud tee otstarbekuse

  12. Teoloogiatudengite meditsiiniteemalised oratsioonid Tartu Academia Gustavianas / Kaarina Rein

    Index Scriptorium Estoniae

    Rein, Kaarina

    2010-01-01

    Tartu ülikooli esimese meditsiiniprofessori Johannes Belowi professuurist Academia Gustavianas (1632-1642) ning sel ajal peetud kahest interdistsiplinaarsest oratsioonist meditsiini ja teoloogia vallas, mis on esimesteks meditsiinialasteks töödeks Academia Gustavianas

  13. Mis see jumal meid on loonud? / Rein Veidemann

    Index Scriptorium Estoniae

    Veidemann, Rein, 1946-

    2017-01-01

    Eesti teatriuuenduse 1969 aastal lavastas Evald Hermaküla Paul-Eerik Rummo näidendi "Tuhkatriinumäng", Jaan Tooming August Kitzbergi "Laseb käele suud anda". Jaak Alliku arvustus Jaan Toominga lavastusele ilmus ajakirjas Noorus 1970. aasta märtsinumbris pealkirjaga "Mis see jumal meid on loonud?". Sama küsimuse esitab artikli autor. Elumõttest, elu eesmärgist ja tähendusest

  14. Imaging of transplanted kidney. Imagerie du rein transplante

    Energy Technology Data Exchange (ETDEWEB)

    Helenon, O.; Attlan, E.; Correas, J.M.; Chabriais, J.; Souissi, M.; Hanna, S.; Legendre, C.; Kreis, H.; Moreau, J.F. (Hopital Necker, 75 - Paris (FR))

    1991-01-01

    The evolution of transplantation entails multiple complications, whose frequency and severity depend on the conditions of sampling and the quality of conservation, the grafting technique, the immunosuppressant treatment and the quality of surveillance. The latter has been significantly improved by the progress of imaging, which has allowed improving the prognosis of renal transplantation. Imaging is used for the diagnosis, surveillance and, in some cases, the treatment of these complications. Among the modern imaging techniques, color Doppler is a non-aggressive technique which currently ranks first for the screening of pedicular and peripheral vascular complications. The role of MRI is still ill-defined. While the initial results demonstrated its poor specificity, the use of paramagnetic contrast media provides a remarkable diagnostic effectiveness in case of peripheral necrosis. The lack of diagnostic specificity of imaging for medical complications most often confines its use to the follow-up of evolution. Thus renal biopsy remains the key examination for the diagnosis of immunological, ischemic or toxic complications. Ultrasound plays an essential part in the screening of urological complications, for which the diagnosis and assessment are based on plain radiological examinations. The indications of CT, which are defined according to ultrasound findings, are limited to the study of postoperative fluid collections and infectious complications. Arteriography remains essential for some selected indications, such as the study of the vascular pedicle. Intraoperative radiology plays an important part in the diagnosis and treatment of urological complications, the treatment of arterial stenoses and the drainage of some postoperative fluid collections. 34 figs.

  15. Tera siit, teine sealt - keskpõrandale kokku! / Rein Tootmaa

    Index Scriptorium Estoniae

    Tootmaa, Rein

    2003-01-01

    7. Pimedate Ööde Filmifestivali filme - sakslase Hans-Christian Schmid'i mängufilm "Kauged tuled" ("Lichter"), taanlase Lars von Trieri "Dogville", norralase Morte Tydlumi "Semu" ("Buddy"), tema kaasmaalase Jens Lieni ("Jonny Vang"), jaapanlase Takeshi Kitano "Nukud" ("Dolls") ja taanlase Jesper W. Nielseni "Mees ukse taga" ("Manden bag doren")

  16. Arhitektuurivõistluse pinged / Endrik Mänd, Toomas Rein, Rein Murula, Tomomi Hayashi ; intervjueerinud Margit Mutso

    Index Scriptorium Estoniae

    2011-01-01

    Tallinna Muusikakeskkooli, Georg Otsa nimelise Tallinna Muusikakooli ja Tallinna Balletikooli ühishoone arhitektuurikonkursist räägivad arhitektid-kohtunikud. Võidutööst "Vaikuse aed" (Austria AB Atelier Thomas Pucher ZT GmbH), 2. preemia pälvinud tööst "Octopus" (AB Emil Urbel), 3. koha saanud tööst "Pausid ja poosid" (Ninja Stuudio). Loetletud premeeritud ja äramärgitud tööd, nende autorid, žürii koosseis

  17. Contrast Enhancement by Multicolour Print-Out of Thyroid, Kidney, Liver and Brain Scans; Accentuation des Contrastes dans les Scintigrammes Polychromes du Cerveau, du Foie, du Rein et de la Thyroide; Kontrastnoe usilenie s pomoshch'yu mnogotsvetnogo otpechatka skennogramm shchitovidnoj zhelezy, pochek, pecheni i golovnogo mozga; Aumento del Contraste en los Centelleogramas Policromos de la Tiroides, el Rinon, el Higado y el Cerebro

    Energy Technology Data Exchange (ETDEWEB)

    Hine, G. J.; Patten, D. H.; Burrows, B. A. [Radioisotope Service, Veterans Administration Hospital Boston University School of Medicine Boston, MA (United States)

    1964-10-15

    contour de zones ou les differences de taux de comptage sont faibles. Des rubans de machines a ecrire de diverses couleurs sont montes sur un chariot unique; un stylet, dont le mouvement est commande par un debitmetre, avec une constante de temps de 0 ,3 s, frappe l'un des rubans. Le premier ruban, qui correspond a la gamme des taux de comptage la plus basse, n'est pas encre; ainsi, il n'y a pas de marques colorees pour les taux de comptage inferieurs a 12, 5% du maximum, qui est ajuste pour chaque scintigramme lorsque les huit rubans colores sont utilises en meme temps. Toutefois, tous les coups sont enregistres en noir sur des copies carbone. Du point de vue clinique, le scintigramme polychrome a l'avantage de faire apparaitre immediatement les differences de taux de comptage qui delimitent des zones oue la concentration du radioisotope n'est pas la meme. La suppression de la couleur, pour les taux de comptage peu eleves, permet de mieux distinguer certaines zones difficiles a localiser par suite de l'intensite du bruit de fond du aux tissus, par exemple les lesions cerebrales. Le scintigramme polychrome fait apparaitre les contours correspondant a l'epaisseur du tissu hepatique qui participe aux fonctions du foie et qu'il est difficile de voir autrement. Il permet d'identifier plus aisement les zones de fibrose et d'infiltration neoplasique, en le comparant avec des scintigrammes de foies normaux. Il en est de meme pour des scintigrammes de reins, oiei une modification de la couleur peut indiquer la presence de zones ischemiques, cystiques ou tumorales. Le scintigramme polvchrome de la thyroiede permet de proceder a des comparaisons semi-quantitatives de la fixation du radioiode entre les differentes zones. (author) [Spanish] Un centelleograma puede proporcionar datos cuantitativos si el color de la impresion varia segun el indice de recuento. La estructura de la impresion indica entonces la reparticion de los radioisotopos; su color sirve de clave para la evaluacion

  18. Baixa prevalência de discromatopsia, pela 4ª edição do teste pseudoisocromático HRR (Hardy, Rand e Rittler, da população indígena de etnia terena da aldeia lalima na região de Miranda: Mato Grosso do Sul Low prevalence of dyschromatopsia using the fourth edition of HRR (Hardy, Rand and Rittler pseudoisochromatic plate test among the Indian population of Lalima village, Terena

    Directory of Open Access Journals (Sweden)

    Marcos Rogério Mistro Piccinin

    2007-03-01

    Full Text Available OBJETIVO: Avaliar a freqüência de discromatopsias através da 4ª edição do teste pseudoisocromático HRR (Hardy, Rand and Rittler entre a população indígena masculina da aldeia Lalima, etnia Terena, na região de Miranda-MS. MÉTODOS: Foram realizadas viagens à aldeia Lalima em Miranda-MS, nos meses de janeiro e fevereiro de 2005. As viagens para realizar os exames só foram iniciadas após o projeto ter sido avaliado e aprovado pelos Comitê de Ética e Pesquisa da UFMS, Comitê Nacional de Ética e Pesquisa, Fundação Nacional do Índio e do cacique da aldeia Lalima. O teste HRR foi aplicado em 226 índios após terem sido submetidos a exame oftalmológico para detecção de anormalidades que pudessem comprometer a aplicabilidade do teste. O teste foi realizado sob luz natural, em dias ensolarados, sem incidência direta de sol. O teste foi aplicado e interpretado pelo mesmo examinador em todos os índios. RESULTADOS: Realizaram-se 226 exames (60,1% de uma população de 376 homens entre 10 e 45 anos de idade, que vivem na Aldeia Lalima. Não foi encontrado nenhum caso de discromatopsia na população examinada com o teste HRR. CONCLUSÃO: O resultado do presente estudo mostra a baixa prevalência de discromatopsia nesta população indígena de etnia Terena, uma vez que não se detectou nenhum caso de discromatopsia na população estudada, sendo a prevalência de discromatopsia entre homens caucasianos de 6 a 8%. A ausência de discromatopsia na população estudada, no entanto, deve ser mais bem avaliada tentando aumentar o tamanho da amostra, utilização de outros testes e, principalmente, por estudos genéticos para verificar os genes codificadores dos fotopigmentos para melhor compreensão das condições relacionadas à visão de cores dessa comunidade indígena.PURPOSE: to evaluate the frequency of dyschromatopsias among the 10 to 45-year-old male Indian population of Lalima village, Terena ethnicity, in Miranda-MS, using

  19. Fosrenol for Enhancing Dietary Protein Intake in Hypoalbuminemic Dialysis Patients (FrEDI Study

    Directory of Open Access Journals (Sweden)

    Tara Koontz

    2012-06-01

    Full Text Available Protein-energy wasting (PEW, reflected by serum albumin 5.5 mg/dL is also common and is associated with high death risk. The traditional dietary approach to control hyperphosphatemia by limiting protein foods may cause or worsen PEW. We hypothesized that provision of a high protein diet including during HD treatment results in favorable outcomes if a potent phosphorus binder such as lanthanum carbonate (Fosrenol™ can control phosphorus simultaneously and conducted a pilot/feasibility randomized controlled trial in 110 hypoalbuminemic (<4.0 mg/dL MHD patients in several dialysis clinics. After a washout period and upon 1:1 randomization, we provided the INTERVENTION group with 8 weeks of high protein meals as prepared meal boxes (50 g protein, 850 Cal, phosphorus to protein ratio <10 mg/gm during each HD treatment, along with 0.5 to 1.5 g Fosrenol (titrated as needed plus dietary counseling to maintain a high dietary protein intake at home. The CONTROL group received meal boxes containing low calorie (<50 Cal and almost no protein (<1 g, such as salads during each HD treatment and continued non-Fosrenol binders. We examined combined change in serum albumin with remaining in target phosphorus range of 3.5-<5.5 mg/dL over the 8 weeks of intervention. Among the 51 intervention and 55 control subjects who qualified for the intention-to-treat analyses, the combined rise in albumin ≥0.2 g/dL while maintaining phosphorus in 3.5-<5.5 mg/dL range was achieved in 25.5% and 9.8%, respectively (χ² p-value 0.036. No serious adverse events were reported, and patients reported satisfaction with high protein meals during HD. Hence, provision of high protein meals combined with Fosrenol™ during HD is safe and may improve albumin while controlling serum phosphorus. ClinicalTrials.gov # NCT0111694

  20. A Study of EDI, Processes, Operations and How Employees are Motivated at a Kenyan Bank

    OpenAIRE

    Fazal, Waheed Sultanali Muradali

    2009-01-01

    According to Brabston, L. and Porter, (2004) Information system (IS) and business strategy are essential facets in any organization particularly a bank, we are interested in this sector because it is a major component in Kenya‟s growing economy and so far hardly any research has been done on the efficiency of a Kenyan banks. This dissertation concentrates on a small service enterprise and how IS/IT as well as work motivation strategy can influence the business strategy; we also study how the ...

  1. Analisis Koalisi Lukman Edy dan Suryadi Khusaini pada Pemilihan Gubernur dan Wakil Gubernur Riau Tahun 2013

    OpenAIRE

    ", ISHAK; YULIANSYAH, HADI

    2014-01-01

    A political party is an organized group, whose members have orientation, values and ideals are the same. Political Recruitment is the process by which individuals enroll warrant or to occupy a position. Recruitment is a two way process , and its nature can be formal or informal. Recruitment candidates are strongly associated with the selection of leadership, both internal party leadership and the broader national leadership.The coalition formation occurs at the end of the second second, at wh...

  2. Predicting Early School Achievement with the EDI: A Longitudinal Population-Based Study

    Science.gov (United States)

    Forget-Dubois, Nadine; Lemelin, Jean-Pascal; Boivin, Michel; Dionne, Ginette; Seguin, Jean R.; Vitaro, Frank; Tremblay, Richard E.

    2007-01-01

    School readiness tests are significant predictors of early school achievement. Measuring school readiness on a large scale would be necessary for the implementation of intervention programs at the community level. However, assessment of school readiness is costly and time consuming. This study assesses the predictive value of a school readiness…

  3. Does the EDI Measure School Readiness in the Same Way across Different Groups of Children?

    Science.gov (United States)

    Guhn, Martin; Gadermann, Anne; Zumbo, Bruno D.

    2007-01-01

    The present study investigates whether the Early Development Instrument (Offord & Janus, 1999) measures school readiness similarly across different groups of children. We employ ordinal logistic regression to investigate differential item functioning, a method of examining measurement bias. For 40,000 children, our analysis compares groups…

  4. Application of the EDYS Model to Evaluate Control Methods for Invasive Plants at Fort Carson, Colorado

    National Research Council Canada - National Science Library

    Hunter, Rachael G

    2004-01-01

    .... Non-indigenous invasive plants can also reduce and destroy forage for livestock and wildlife, displace native plant species, increase fire frequency, reduce recreational opportunities, and can poison domestic animals...

  5. Supply Chain Management: A Case Study of Using EDI and Bar Code Information Technology

    National Research Council Canada - National Science Library

    Wu, Wei-Ya

    1997-01-01

    .... Together, these two business solutions, targeted at purchasing, receiving and shipping systems, allow everyone to operate more efficiently and profitably, while reacting more quickly and providing...

  6. Application of the EDYS Model to Evaluate Control Methods for Invasive Plants at Fort Carson, Colorado

    Science.gov (United States)

    2004-12-01

    increase fire frequency, reduce recreational opportunities, and can poison domestic animals. It is imperative to find economical , ecologically sound...Technology 15:257-269. Childress, W. Michael, Terry McLendon, and David L. Price. 1999a. A Multiscale Ecological Model for Allocation of Training...of some ecologically distinct plant species to nitrate and to ammonium nitrogen. Journal of Ecology 60: 93-102. Gould, Frank W. 1975. The Grasses

  7. Acordo ortográfico: o discurso governamental da 5ª Edição

    Directory of Open Access Journals (Sweden)

    Indianara Luzia Peron

    2014-07-01

    Full Text Available O presente artigo é o resultado de uma análise sobre o novo acordo ortográfico, visando o discurso governamental. Desde a colonização linguística tenta-se unificar a língua dos países lusófonos, tendo o poder político como impulsionador desta unificação. O novo acordo ortográfico gera muitas mudanças, como atualização de livros, revistas, jornais e sites. As opiniões sobre a nova ortografia despertam dúvidas, pois os países da comunidade lusófona possuem uma cultura própria. Vários os fatores que contribuem para a busca dessa unificação, uma delas é o uso de duas ortografias, que se torna prejudicial à unidade intercontinental da língua. Palavras-chave: acordo ortográfico; comunidade lusófona; discurso governamental; unificação.

  8. Paneeldiskussioon (fonogrammilt lühendatult) / Ain Heinaru, Rein Vaikmäe, Rein Raud, Hardi Tullus, Urve Lippus, Andres Tali, Martin Zobel

    Index Scriptorium Estoniae

    2006-01-01

    Projekti "Eesti doktoriõppe kvaliteedi, tulemuslikkuse ja jätkusuutlikkuse tagamise süsteem" (2005-2008) II konverentsi "Doktorid Eesti tuleviku arengumootoriks" paneeldiskussioonist, millel arutleti doktoriõppe rahastamise ning doktoriõppe korralduse ja doktorandi juhendamise teemadel

  9. Rein Sillar : Kui argumente ei jätku, on hea KGB kaart välja tõmmata / Rein Sillar ; interv. Toomas Sildam

    Index Scriptorium Estoniae

    Sillar, Rein

    2001-01-01

    Eesti NSV KGB viimane esimees ei usu, et eestlased sooviksid minevikuhaavu lahti rebida. Vare-Shironini kokkuleppest KGB tegevuse lõpemisest Eestis, süümevandest, ENSV Riiklikust Julgeolekukomiteest. Kommenteerivad: Ain Kaalep, Peeter Olesk, Heinz Valk. Parlamendisaadik (P. Olesk)

  10. Elmut Paavel : Soomlased tulnuks Eestisse niikuinii / Elmut Paavel ; interv. Rein Raudvere

    Index Scriptorium Estoniae

    Paavel, Elmut, 1954-

    2004-01-01

    AS-i Valga Lihatööstus tegevjuht põhjendab kolmveerandi aktsiate müümist Soome suurimale lihatööstusettevõttele Atria Group Plc. Kommenteerivad: Otepää lihatööstuse Edgar juht Maie Niit ja Eesti Lihaliidu juhatuse esimees Olle Horm

  11. "Relinquish the reins": persuasion and consensus in the discourse of pregnancy and childbirth advice literature.

    Science.gov (United States)

    Rodgers, Ornaith

    2015-03-01

    Popular pregnancy and childbirth advice books constitute an important source of information for pregnant women. These texts shape women's perceptions of pregnancy, childbirth and the medical care they will receive during this time. This article reports on a study of the enactment of power relations between pregnant women and their medical caregivers in the discourse of pregnancy and childbirth advice literature and its implications for practice. The study focuses on the discursive positioning of women in relation to medical personnel through a critical discourse analysis of two popular advice books, one in English and one in French. The article suggests that through the use of a number of key discursive strategies, pregnant women are constructed as under the control of the medical institution in these texts. However, this control is not achieved by an overt oppressive discourse, instead it is achieved through persuasion and consensus by generating the consent of pregnant women to comply with medical norms. The medical institution is represented in these texts as a dominant force while women are constructed as powerless recipients of medical care. Medical professionals should firstly consider whether the power relations represented in these texts correspond to those enacted in clinics and delivery rooms. Secondly, caregivers should be cautious about recommending popular pregnancy and childbirth advice books to women as the relationship between pregnant women and their caregivers may be undermined by the negative power asymmetry enacted in these texts. Copyright © 2014 Australian College of Midwives. Published by Elsevier Ltd. All rights reserved.

  12. Ajatu Ita Ever pühendab end jäägitult teatrile / Rein Veidemann

    Index Scriptorium Estoniae

    Veidemann, Rein, 1946-

    2006-01-01

    Näitleja Ita Everi 75. sünnipäeva puhul. Arvamust tema kohta avaldavad ka näitlejad Aleksander Eelmaa, Rasmus Kaljujärv, Tiit Sukk, teatrikunstnikud Ene-Liis Semper ja Aime Unt, teatrinõunik Tõnu Lensment

  13. Uued teenused ja innovatsioonipoliitika teenindussektori arenguks / Rein Lumiste, Rünno Lumiste

    Index Scriptorium Estoniae

    Lumiste, Rein

    2003-01-01

    Teenindussektor on muutunud Eesti majanduse arengus määravaks: majanduse edasine areng ei saa toimuda ilma uute teenuste turule tulekuta, teenuse innovatsiooni ja selle innovatsiooni üht olulisemat osa, uute teenuste juurutamist peab soodustama riiklik innovatsiooni poliitika. Tabelid

  14. One Way to Rein in the Cost of Textbooks: Make Them Free

    Science.gov (United States)

    Delespinasse, Paul F.

    2008-01-01

    The prices for college texts have soared way beyond inflation for the last quarter-century. As such, they have become a burden on today's financially strapped students. From the point of students and of faculty members who are concerned about their students' welfare, the important question is what can be done to drive text prices back down. In…

  15. Take the Reins on Model Quality with ModelCHECK and Gatekeeper

    Science.gov (United States)

    Jones, Corey

    2012-01-01

    Model quality and consistency has been an issue for us due to the diverse experience level and imaginative modeling techniques of our users. Fortunately, setting up ModelCHECK and Gatekeeper to enforce our best practices has helped greatly, but it wasn't easy. There were many challenges associated with setting up ModelCHECK and Gatekeeper including: limited documentation, restrictions within ModelCHECK, and resistance from end users. However, we consider ours a success story. In this presentation we will describe how we overcame these obstacles and present some of the details of how we configured them to work for us.

  16. Cancer du rein et Grossesse: A propos d’une nouvelle observation

    Directory of Open Access Journals (Sweden)

    A. Majdoub

    2017-12-01

    Nous rapportons le cas d’une patiente âgée de 38 ans, sans antécédents pathologiques notables, enceinte avec un terme de 16 semaines d’aménorrhée, présentant des lombalgies gauches. Le diagnostic de tumeur rénale était retenu sur les données du couple échographie rénale et IRM abdominale. La patiente a bénéficié d’une néphrectomie élargie par voie lombaire. L’analyse histologique de la pièce de néphrectomie totale a révélé un adénocarcinome à cellules claires. L’évolution était favorable après le traitement avec une grossesse menée à terme.

  17. Amid Fiscal Crisis, L.A. Gives Site Councils Budget Reins

    Science.gov (United States)

    Sawchuk, Stephen

    2009-01-01

    At Jefferson High School, a governing body made up of teachers, nonclassroom-based educators, parents, and Principal Michael Taft appears to be living the dream, to the extent such a thing is possible during a staggering fiscal crisis. The leadership team, officially known as a "school site council," has mainly used an infusion of…

  18. Eesti elanike valimiskäitumise motiivid ja mehhanismid / Marti Taru, Rein Toomla

    Index Scriptorium Estoniae

    Taru, Marti

    2003-01-01

    Uuringutest selgub, et sotsiaaldemograafilistest omadustest suurendavad valima mineku tõenäosust kõrgem haridustase ja elukoha paiknemine väikeasulas, valima mineku tõenäosust vähendavad kuulumine pensionäride, õppurite või ettevõtjate hulka. Diagrammid: Valima mittemineku ja mineku põhjused; Valimiskriteeriumid. Tabelid: Riigikogusse valitavate inimeste oluliseks peetavad omadused (%-des); Valijate tähelepanu erakonnale (%-des)

  19. Violante Sánchez, fille de roi et filleule de reine

    Directory of Open Access Journals (Sweden)

    Charles Garcia

    2008-05-01

    Full Text Available Fière de son ascendance royale, l’infante Violante, fille illégitime de Sanche IV, arbora toujours son prestigieux lignage avec ostentation. Bien qu’elle n’ait pas joué un rôle politique de premier plan en Castille, cette femme sut utiliser sa lignée pour prendre le contrôle d’un certain nombre de monastères, par le biais de la mise en commende. C’est donc à travers la gestion de ses affaires que nous avons eu accès au sens du rang social d’une rica hembra du début du XIVe siècle, mais aussi au vécu d’une femme d’influence, si ce n’est de pouvoir.Orgullosa de su ascendencia regia, doña Violante, una hija ilegítima de Sancho IV, siempre hizo gala de sus ancestros. Aunque nunca desempeñó un papel político relevante en la Castilla de principios del siglo XIV, dicha infante consiguió hacerse con el poder de varios monasterios, mediante el conocido sistema de la encomienda. Así pues, estudiando su testamento, hemos intentado aproximarnos al significado de lo que entonces era una “rica hembra”, desde el punto de vista social, pero también a su actuación como mujer gobernadora de notable influencia.

  20. The size of second chambers and European assemblies / Rein Taagepera, Steven P Recchia

    Index Scriptorium Estoniae

    Taagepera, Rein, 1933-

    2002-01-01

    Autorid võrdlevad eri maade esinduskogude kodade suurust ja elanike arvu neis maades ning arutlevad, kui suur kohtade arv peaks olema Euroopa Liidu Nõukogus ja Euroopa Parlamendis. Tabelid, diagrammid

  1. Mütoloogia, ajalugu, kaasaeg : uuskreeka kirjandus eesti keeles Kalle Kasemaa vahendusel / Kaarina Rein

    Index Scriptorium Estoniae

    Rein, Kaarina

    2008-01-01

    Käsitletakse Nikos Kazantzakise, Pandelis Prevelakise, Odisseas Elitise, Ilias Venezise, Dido Sotiriu, Manolis Karagatsise, Menis Kumandarease, Aleksandros Papadiamandise, Kostas Asimakopulose, Nikos Kavvadiase loomingut

  2. Taking the reins: the effects of new leader status and leadership style on team performance.

    Science.gov (United States)

    Sauer, Stephen J

    2011-05-01

    New leaders face a challenging task when they take charge of their teams. They have to determine how best to guide the work process, and they must understand how their behaviors will affect the members of their team. This research examines how a newly assigned team leader's status moderates subordinates' reactions to different leadership styles to affect assessments of the leader's self-confidence and effectiveness, and how this impacts team performance. Across 2 experimental studies, results demonstrate that low-status leaders are rated as more effective when they use a directive style, whereas high-status leaders are viewed as more effective when they use a participative style, and this relationship is mediated by perceptions of self-confidence. In addition, teams whose leaders are viewed more favorably perform better on a complex group task. These findings imply that low-status individuals are able to enhance their level of personal power by drawing on whatever positional power they hold, whereas high-status individuals are better off relying solely on their personal power to influence others. This research also provides a clear demonstration that assessments of new leaders' behaviors are subject to an appraisal that is clouded by observers' status perceptions and attributions.

  3. Viirastuslikud Sinimäed. Mõtteid Raimo Jõeranna filmi ainetel / Rein Ruutsoo

    Index Scriptorium Estoniae

    Ruutsoo, Rein, 1947-

    2006-01-01

    6-osalise ajaloodokumentaalide sarja "Kuum külm sõda" teist filmi "Sinimäed" : stsenaristid Kiur Aarma, Mart Laar, Eerik-Niiles Kross, Raimo Jõerand : režissöör Raimo Jõerand : Ruut Pictures 2006

  4. Kultuur ja geopoliitika / Immanuel Wallestein ; interv. Rein Raud, tõlk. Kaarel Tarand

    Index Scriptorium Estoniae

    Wallestein, Immanuel

    2008-01-01

    Intervjuu Yale'i ülikooli professoriga, kes peatub teemadel, mis puudutavad Nõukogude Liidu kokkuvarisemist, võimalikku Kirde-Aasia alianssi, Venemaa edasist arengut, etnilisuse probleeme, Euroopa kultuurilist hoiakut ja poliitilist integratsiooni

  5. Saaremaa lad brings FBI conference to Estonia / Kalle Laanet ; interv. Rein Sikk

    Index Scriptorium Estoniae

    Laanet, Kalle, 1965-

    2007-01-01

    Riigikogu liige vastab küsimustele, mis puudutavad tema õpinguid FBI akadeemias, Tallinnas toimuvat FBI konverentsi ning Eesti sisejulgeolekut. Lisa: Estonian Police statistics; Registered crimes in Estonia; From police officer to minister; What happened in April?

  6. Ilma tahtmata ja teadmata paradiisi ehk Arhetüüp eesti moodi / Rein Tootma

    Index Scriptorium Estoniae

    Tootma, Rein

    2006-01-01

    Lühimängufilm "Vanameeste paradiis" : stsenaristid Ove Musting (ka idee autor), Urmas Lennuk : režissöör Ove Musting : operaator Mait Mäekivi : helilooja Arian Levin : kunstnik Eva-Marina Gramanovski : näitlejad Tõnu Aav, Aleksander Eelmaa, Tõnu Oja, Ants Ander, Henry Kõrvits : Downtown Pictures 2005

  7. Tapa ja Tartu vaksal ärkavad uuele elule / Rein Sikk

    Index Scriptorium Estoniae

    Sikk, Rein, 1961-

    2011-01-01

    Tapa vaksalihoone (1928) renoveerimise, uute perroonide rajamise, raudteepargi kordategemise plaanidest, vana auruveduri taastamisest. Tartu linn toetab 100 000 euroga Tartu vaksalihoone (1877) muinsuskaitse all olevate ootesaalide ehitust ja algupärasel kujul taastamist

  8. Tartu- ja Viljandimaa 2025 : Nobeli preemia, tuumajaam ja laevaühendus Peterburiga / Rein Sikk

    Index Scriptorium Estoniae

    Sikk, Rein, 1961-

    2014-01-01

    Milline võiks olla elu peaga Eestis ehk Tartu ja Viljandi maakondades aastal 2025? Kas Võrtsjärve veerde tuleb tuumajaam? Kas Tartust saab laevaga Peterburi? Kas Viljandi folk püsib või kaob? Kas Salvest murrab Hiina turule? Küsimustele vastasid 14 asjatundjat

  9. Inimgeograafid aitavad Tartu linna nutikaks muuta / Rein Ahas ; intervjueerinud Merilyn Säde

    Index Scriptorium Estoniae

    Ahas, Rein, 1966-2018

    2016-01-01

    TÜ geograafide, Tartu linnavalitsuse, Tartu Smart City Lab-i ja Rakvere Targa Maja koostöös osaletakse Euroopa Liidu suurprojektis SmartEnCity, mis aitab Tartul energiatõhusamaks ja nutikamaks saada

  10. Sokivabrik Suva põrutab soomlaste etnomustritega Soomet vallutama / Rein Sikk

    Index Scriptorium Estoniae

    Sikk, Rein, 1961-

    2009-01-01

    AS Suva sokkide müügiedust, tootearendusest. Vabriku disainer on Leila Tamm. Suurt tähelepanu pälvinud rahvusmustritega etnosari sündis koostöös Eesti Kunstiakadeemia tekstiilieriala üliõpilastega. Kalevala sarja sokkidega minnakse Soome turule

  11. Bookreview: Noortje MARRES DIGITAL SOCIOLOGY: THE REIN-VENTION OF SOCIAL RESEARCH

    Directory of Open Access Journals (Sweden)

    Javier CALLEJO GALLEGO

    2017-12-01

    Full Text Available Decir que el libro aquí abordado es sobre métodos -digitales, en este caso- es que-darse en uno de los márgenes de sus inten-ciones. La propuesta de Marres va más allá, lo que queda especialmente manifies-to en la primera parte del libro; páginas que pueden considerarse realizadas bajo el paraguas del debate que abrieron Savage y Burrows (2007 en la sociología británi-ca cuando nombraron a las cosas por su nombre: “The Coming Crisis of Empirical Sociology” (trabajo continuado en Rup-pert, Law y Savage, 2013. Tal vez su gran aportación al respecto es esa, hacer despe-gar en la esfera pública del sistema de la ciencia -revistas científicas, libros, confe-rencias- lo que se comentaba en los pasi-llos de las universidades y, sobre todo, los centros privados de investigación social.

  12. Harju Elekter 40 / Andres Allikmäe ; interv. Rein Aro

    Index Scriptorium Estoniae

    Allikmäe, Andres, 1957-

    2008-01-01

    AS Harju Elekter juhatuse esimees oma ettevõtte arengust 40 aasta jooksul, üleminekust käsumajandusest turumajandusse, iseseisva väliskaubanduslitsentsi saamisest 1988. a., põhitoodetest ja tegevusvaldkondadest, ekspordist, hakkamasaamisest Eesti praeguses raskes majanduslikus olukorras

  13. Kogumispension on inimväärse vanaduspõlve jaoks paratamatu / Rein Järvelill

    Index Scriptorium Estoniae

    Järvelill, Rein, 1966-

    2001-01-01

    Kolmesambaline pensionisüsteem. Autor: Rahvaerakond Mõõdukad. Parlamendisaadik. Ilmunud ka: Hiiumaa, 8. veebr. 2001, lk. 2; Koit, 10. veebr. 2001, lk. 7; Nädaline, 13. veebr. 2001, lk. 7; Valgamaalane, 13. veebr. 2001, lk. 2; Lääne Elu, 13. veebr. 2001, lk. 4; Järva Teataja, 16. veebr. 2001, lk. 2; Meie Maa, 2. märts 2001, lk. 2

  14. Ühine tuberkuloosiprojekt Tallinnas / Rein Rannamäe, Jevgenia Epstein, Galina Kikos...[jt.

    Index Scriptorium Estoniae

    2001-01-01

    Tallinna linnavolikogu toetas 2000. aastal oma eelarvega projekti "Koldekontrolli läbiviimine tuberkuloosi haigestunu koldes ja töökohal, kontaktsete isikute vajaduste välja selgitamine" läbiviimist

  15. Sündinud kunstnikuks - kahe Eestis kasvanud juudi lugu / Rein Veidemann

    Index Scriptorium Estoniae

    Veidemann, Rein, 1946-

    2009-01-01

    Arvustus: Tali, Piret. Eino Baskin. Naer läbi pisarate / kirja pannud Piret Tali. [Tallinn] : Fookus Meedia, [2009] ; Tammer, Enno. Simon Levin : sündinud advokaadiks. [Tallinn] : Tammerraamat, 2009

  16. Teadlase elukutse kui missioon ja pühendumine / Rein Ruutsoo

    Index Scriptorium Estoniae

    Ruutsoo, Rein, 1947-

    2011-01-01

    Tutvustus: Weber, Max. Poliitika kui elukutse ja kutsumus ; Teadus kui elukutse ja kutsumus / tõlkijad: Jaan Isotamm, Henn Käärik, Kaia Sisask. Tallinn : TLU Press, 2010. (Bibliotheca controversiarum)

  17. Rein Oja, Kirsti Timmer ja Avo Põhjala võitluskunstidest / Simo Meinert

    Index Scriptorium Estoniae

    Meinert, Simo

    2001-01-01

    Seriaali "Walker - Texase korravalvur" nimitegelast mängiva Chuck Norrise võitluskunstide oskusi aluseks võttes arendatakse teemat idamaa võitluskunstidest kinos, teatris ja elus. Ka : Teleleht nr. 49, lk. 42-43

  18. Kas minna õppekogunemisele ja lasta kodutalu põhja? / Rein Raudvere ; kommenteerinud Kaul Nurm

    Index Scriptorium Estoniae

    Raudvere, Rein, 1955-

    2011-01-01

    Vajadusest muuta kaitseväeteenistuse seadust, et põllumehi ebasobival ajal kordusõppustele ei kutsutaks. Varem vabastas taluseadus põllumeestest reservväelased õppekogunemistest, kuid 2 aastat tagasi tunnistati vastav säte kehtetuks

  19. Via Hanseatica arendamine on saadikute tähelepanu all / Rein Aidma

    Index Scriptorium Estoniae

    Aidma, Rein, 1950-

    2006-01-01

    Ilmunud ka: Severnoje Poberezhje 11. apr. lk. 2. Riigikogu Ida-Viru saadikuühendus kohtus Ida-Viru, Jõgeva, Tartu ja Valga maavalitsuse spetsialistidega arutamaks Via Hanseatica e. Jõhvi-Tartu-Valga majandusvööndi arenguvõimalusi

  20. Tallo: IT-ala vajab arhitekti kätt / Ivar Tallo ; intervjueerinud Rein Sikk

    Index Scriptorium Estoniae

    Tallo, Ivar, 1964-

    2010-01-01

    Autor analüüsib ebaõnnestumisi avaliku sektori IT-projektides ning ütleb, et kõige suurem kaotus on olnud usalduse kaotus uute e-lahenduste vastu. Riigis peaks olema üks inimene, kes vastutaks kogu avaliku sektori IT eest

  1. Pack also the sauna. Integration of electricity storage; Auch die Sauna mit rein. Einbindung von Stromspeichern

    Energy Technology Data Exchange (ETDEWEB)

    Ullrich, Sven

    2013-10-01

    The installers have to handle with a variety of variables and options to plan and integrate the correct personal use system of solar power systems for their customers. [German] Die Installateure muessen mit einer Vielzahl von Variablen und Varianten zurechtkommen, um das richtige Eigenverbrauchssystem einer Solarstromanlage fuer ihre Kunden zu planen und einzubauen.

  2. Kanada koolimõrv nõudis ühe ohvri / Rein Kärner

    Index Scriptorium Estoniae

    Kärner, Rein

    1999-01-01

    Veidi enam kui nädal pärast tapatalguid Colorado osariigi Littletoni koolis laskis Kanadas Taberi väikelinnas W. R. Myersi keskkoolis sama kooli endine õpilane Jason Lang maha oma endise koolikaaslase

  3. New therapeutic targets in idiopathic pulmonary fibrosis. Aiming to rein in runaway wound-healing responses.

    Science.gov (United States)

    Ahluwalia, Neil; Shea, Barry S; Tager, Andrew M

    2014-10-15

    Idiopathic pulmonary fibrosis (IPF) is a devastating disease, with a median survival as short as 3 years from the time of diagnosis and no pharmacological therapies yet approved by the U.S. Food and Drug Administration. To address the great unmet need for effective IPF therapy, a number of new drugs have recently been, or are now being, evaluated in clinical trials. The rationales for most of these therapeutic candidates are based on the current paradigm of IPF pathogenesis, in which recurrent injury to the alveolar epithelium is believed to drive aberrant wound healing responses, resulting in fibrosis rather than repair. Here we discuss drugs in recently completed or currently ongoing phase II and III IPF clinical trials in the context of their putative mechanisms of action and the aberrant repair processes they are believed to target: innate immune activation and polarization, fibroblast accumulation and myofibroblast differentiation, or extracellular matrix deposition and stiffening. Placed in this context, the positive results of recently completed trials of pirfenidone and nintedanib, and results that will come from ongoing trials of other agents, should provide valuable insights into the still-enigmatic pathogenesis of this disease, in addition to providing benefits to patients with IPF.

  4. Loodusteaduslik mõtteviis on arengu aluseseks / Uno Mäeorg, Rein Pullerits

    Index Scriptorium Estoniae

    Mäeorg, Uno

    2007-01-01

    Kooliõpilaste 54. keemiaolümpiaadist, võitjatest. Konkurentsist Rahvusvahelisele keemiaolümpiaadile (RKO) pääsemiseks. Eesti õpilaste osalemisest Heidelbergi Ülikooli Life Science Laboratory poolt organiseeritud rahvusvahelise teaduste akadeemia töös

  5. Jüri Talveti luulepiiriületamised / Jüri Talvet ; intervjueerinud Rein Veidemann

    Index Scriptorium Estoniae

    Talvet, Jüri, 1945-

    2010-01-01

    IX Moncayo luulefestivalist Aragoonias 10. aug. 2010 ja Jüri Talveti luule tõlgetest: Del sueno, de la nieve / tõlkinud Albert Lázaro Tinaut (Olifante, 2010) ; Of Snow, of Soul / tõlkinud H. L. Hix (Guernica, 2010)

  6. Jüri Uluots jõudis võõrsilt koju / Rein Hanson

    Index Scriptorium Estoniae

    Hanson, Rein, 1948-

    2008-01-01

    Endise Eesti peaministri ja peaministri presidendi ametis Jüri Uluotsa ja tema abikaasa ning poja säilmed maeti 31. augustil 2008 Kirbla kalmistule. Ümbermatmise tseremoonial esines kõnega ka president Toomas Hendrik Ilves. Vt. samas foto: Koguduse juhatuse esimees vallavanem Anu-Lii Jürman tervitab Kirbla kiriku trepil Eesti Vabariigi presidenti Toomas Hendrik Ilvest

  7. Integrated modelling of corrosion-induced deterioration in rein-forced concrete structures

    DEFF Research Database (Denmark)

    Michel, Alexander; Geiker, M.R.; Stang, Henrik

    2013-01-01

    at the reinforcement surface, a FEM based me-chanical model was used to simulate corrosion-induced concrete damage. Both FEM models were fully coupled, i.e. information, such as corrosion current density, dam-age state of concrete cover, etc., were constantly exchanged between the models. To demonstrate the potential......An integrated finite element based modelling approach is presented, which allows for fully coupled simulation of reinforcement corrosion and corrosion-induced concrete damage. While a finite element method (FEM) based corrosion model was used to describe electrochemical processes...... use of the modelling approach, a numerical example is presented which illustrates full coupling of formation of corrosion cells, propagation of corrosion, and subsequent development of corrosion-induced concrete damage....

  8. Imetabane väljapanek toob Kumu saali kogu maailma looduse kirevuse / Rein Maran

    Index Scriptorium Estoniae

    Maran, Rein, 1931-

    2006-01-01

    Rahvusvahelise fotokonkursi näitusest "Loodusfoto 2005" Kumu suures saalis. Briti Loodusloomuuseumi ja ajakirja BBC Wildlife Magazine korraldatud fotokonkursist. Lähemalt võidutöödest: Alexander Mustard (Suurbritannia) "Riffahvenate parv", Manuel Presti (Itaalia) "Taevane jaht", Bence Mate (Ungari) "Haigutav rebane", Thorsten Milse (Saksamaa) "Polaarretk"

  9. Benign renal complex cysts: MR imaging. Kystes atypiques benins du rein: aspects IRM

    Energy Technology Data Exchange (ETDEWEB)

    Levy, P.; Helenon, O.; Melki, P.; Paraf, F.; Chauveau, D.; Chretien, Y.; Moreau, J.F. (Hopital Necker-Enfants-Malades, 75 - Paris (France))

    1994-10-01

    The aim of this study was to assess the magnetic resonance imaging (MRI) characteristics of 13 benign complex renal cysts using T1 and T2-weighted images and contrast-enhanced images. The results have been compared to CT and ultrasonographic findings in all cases and correlated with histopathologic datas in 12 cases. Five groups have been defined according to the MR features. Group 1: homogeneous low signal intensity on T1-weighted images and homogeneous high signal intensity on T2-weighted images mimicking simple cyst (n = 2); group 2: homogeneous high signal intensity on both T1 and T2-weighted images mimicking hemorrhagic cyst (n = 1); group 3: characterized by high signal intensity on T1-weighted images and fluid-iron level on T2-weighted images (n = 3); group 4: characterized by fluid-iron level on both T1 and T2-weighted images (n = 3); group 5: pseudotumoral feature: heterogeneous signal intensity and/or wall contrast enhancement (n = 3). Among the 13 indeterminate lesions on ultrasonography and CT, MRI was of diagnostic value in 8 cases, whereas the 5 remaining cases remained indeterminate on MR images. Our results suggest that MRI can be useful in the diagnosis of benign complex cyst of the kidney presenting as indeterminate cystic lesion on other modalities. (authors). 40 refs., 7 figs., 2 tabs.

  10. Evaluation of mechanical properties of calotropis giganteastem fiber-rein forced composite material

    CSIR Research Space (South Africa)

    Aruna, M

    2016-12-01

    Full Text Available as an alternative reinforcement for fiber reinforced polymer (FRP) composites. Owing to their availability, low cost, good mechanical properties, high specific strength, non-abrasive, eco-friendly and bio-degradability characteristics, they are exploited as a...

  11. Eesti korvpallurid on võitnud 12 MM-võistluste medalit / Rein Järva

    Index Scriptorium Estoniae

    Järva, Rein

    2006-01-01

    1959-1990 tuli Eestisse kokku 12 medalit, neist 7 kuldset, 2 hõbedast ja 3 pronksist. Maailmameistrivõistlustel on Eesti edukaim korvpallur olnud Priit Tomson. Lisaks: Korvpalli MM-i medali võitnud eestlased

  12. Ilmus lihtne ja asjalik poliitilise mõtte ABC / Rein Veidemann

    Index Scriptorium Estoniae

    Veidemann, Rein, 1946-

    2005-01-01

    Tartu Ülikooli eetikakeskus esitles inglise professori Jonathan Wolffi raamatut "Sissejuhatus poliitikafilosoofiasse". Esitlusel Tartus viibis ka raamatu autor, kes on Londoni ülikooli kolledzhi professor ja filosoofiaosakonna juhataja ning Briti filosoofiaühingu sekretär. Lisa: Raamat

  13. Lähenedes kaanonile : tüpoloogia ja tähendus / Rein Undusk

    Index Scriptorium Estoniae

    Undusk, Rein

    2000-01-01

    Bibl. joonealustes viidetes. 18. sept. 1998. a. Budapestis Eesti-Ungari kaanonialasel ühiskonverentsil peetud ettekanne "Approaching the canon: typology and meaning" muudatuste ja täiendustega eestikeelne variant

  14. Ennastunustav ja põhjuseta lõhkumine / Pete Nolan ; interv. Rein Saavel

    Index Scriptorium Estoniae

    Nolan, Pete

    2008-01-01

    Küsimustele vastab müra-rock'i viljeleva USA duo Magik Markers trummar Pete Nolan (ansambel osaleb režissöör Veiko Õunapuu uue mängufilmi "Püha Tõnu kiusamine" võtetel ja annab kaks kontserti - 13. nov. Tallinnas klubis Tapper ja 15. nov. Tartus klubis Trehv). Heliplaadist "Boss"

  15. Chemical characterization of composites developed from glycerol and dicarboxylic acids rein forced with piassava fiber

    International Nuclear Information System (INIS)

    Miranda, Cleidiene S.; Oliveira, Jamerson C.; Guimaraes, Danilo H.; Jose, Nadia M.; Carvalho, Ricardo F.

    2011-01-01

    In search of alternative technologies that enable the use of products with lower environmental impact, This study aims to develop a composite polymer-based piassava fiber. The sludge, waste and byproduct of commercial uses currently being used as reinforcement in polymer matrices, due to presence of lignocellulosic materials. The matrix polymer used was synthesized from glycerol with dicarboxylic acids, in order to open future perspectives on the use of glycerin generated from purified biodiesel production plastics. Composites with 2, 5, 10 wt% of piassava fiber cut into 5 mm raw and treated were obtained a mixture of solution. The materials were characterized by TGA, DSC, XRD and SEM. It was observed that the material under study is promising for the industrial market, because it has good compatibility with natural fibers allowing wider application of fiber natural and glycerol, producing semicrystalline composites and with good thermal properties. (author)

  16. Taking the Reins: Institutional Transformation in Higher Education. The ACE Series on Higher Education

    Science.gov (United States)

    Eckel, Peter D.; Kezar, Adrianna

    2011-01-01

    Peter Eckel and Adrianna Kezar have written this book to offer insight to campus leaders who face transformational change--to help them mount a proactive, rather than a reactive, process to effect transformation. They believe that most institutional leaders have little to no experience with implementing large-scale change and lack a solid…

  17. Selgusid kirjanduse aastapreemiate saajad / Rein Veidemann ; komment. Karl Martin Sinijärv, Viivi Luik

    Index Scriptorium Estoniae

    Veidemann, Rein, 1946-

    2006-01-01

    Eesti Kultuurkapitali aastapreemiad: Kristiina Ehini luulekogu "Kaitseala" ja Jürgen Rooste luulekogu "Ilusaks inimeseks", Piret Raud "Sanna ja salakütid", Merle Karusoo näidend "Misjonärid", Madis Kõivu artiklikogumik "Luhta-minek". Tõlkepreemiad tõlkijatele Anu Saluäär, Heili Einasto, Lembi Loigu, Veronika Kivisilla, Risto Järv. Vabaauhind Käbi Laretei. Artiklipreemia Aare Pilv. Venekeelse autori kirjandusauhind Gohar Markosjan-Käsper, Svetlan Semenenko

  18. The Sleeper and the Spindle de Neil Gaiman : quand les reines prennent leur destin en main

    Directory of Open Access Journals (Sweden)

    Stéphanie Schneider

    2016-12-01

    Full Text Available Dans le recueilintitulé "Rags and Bones: New Twists on Timeless Tales", chaque auteur choisissait un conte qui l’avait particulièrement touché (soit inspiré, émerveillé ou profondément agacé, le désossait et le reconstruisait à l’attention des jeunes lecteurs actuels. Ainsi, réécrit d’un point de vue contemporain, chacun des contes du recueil se propose, tout en rendant hommage aux textes sources, de soulever un débat particulier. Nous axerons le nôtre autour du destin des personnages féminins.

  19. Tarkvara ja riistvara ei pea firma kapis seisma / Rein Türkson ; interv. Lemmi, Kann

    Index Scriptorium Estoniae

    Türkson, Rein

    2006-01-01

    Kui ettevõttel pole soovi infotehnoloogia tarvis spetsiaalset meeskonda pidada ning infrastruktuuri luua, on võimalik kogu majandustarkvara ning isegi selle majutus teenusena sisse osta. Tallinna kauplus E-Lux kasutab Gate Communicationsi loodud äritarkvara Directo. Skeem

  20. Ohio koolitüdruku parim reis viis ta Eesti saatkonda / Rein Sikk

    Index Scriptorium Estoniae

    Sikk, Rein, 1961-

    2006-01-01

    Eesti saatkonnas Washingtoni töötab administraatorina USA rahukorpuse liikmena Eestis töötanud Blaine Carvalho. Suursaadik Jüri Luik ei kahtle, et USA presidendi George W. Bushi visiidil Eestisse tõstatatakse viisavabaduse küsimus

  1. Wiedemanni keeleauhinna keelepäev Väike-Maarjas / Rein Joamets

    Index Scriptorium Estoniae

    Joamets, Rein, 1950-

    2009-01-01

    30. aprillil Väike-Maarjas toimunud igakevadisest Wiedemanni keeleauhinna keelepäevast, kus tegi ettekande tänavune keeleauhinna laureaat, Ohio ülikooli professor Ilse Lehiste. Ettekannetega esinesid ka tänavused keeleauhinna kandidaadid Krista Kerge ja Jaan Kaplinski

  2. New Therapeutic Targets in Idiopathic Pulmonary Fibrosis. Aiming to Rein in Runaway Wound-Healing Responses

    Science.gov (United States)

    Ahluwalia, Neil; Shea, Barry S.

    2014-01-01

    Idiopathic pulmonary fibrosis (IPF) is a devastating disease, with a median survival as short as 3 years from the time of diagnosis and no pharmacological therapies yet approved by the U.S. Food and Drug Administration. To address the great unmet need for effective IPF therapy, a number of new drugs have recently been, or are now being, evaluated in clinical trials. The rationales for most of these therapeutic candidates are based on the current paradigm of IPF pathogenesis, in which recurrent injury to the alveolar epithelium is believed to drive aberrant wound healing responses, resulting in fibrosis rather than repair. Here we discuss drugs in recently completed or currently ongoing phase II and III IPF clinical trials in the context of their putative mechanisms of action and the aberrant repair processes they are believed to target: innate immune activation and polarization, fibroblast accumulation and myofibroblast differentiation, or extracellular matrix deposition and stiffening. Placed in this context, the positive results of recently completed trials of pirfenidone and nintedanib, and results that will come from ongoing trials of other agents, should provide valuable insights into the still-enigmatic pathogenesis of this disease, in addition to providing benefits to patients with IPF. PMID:25090037

  3. See meeletu, meeletu maailm ehk Ära siit! / Rein Tootmaa

    Index Scriptorium Estoniae

    Tootmaa, Rein

    2001-01-01

    IV Pimedate Ööde Filmifestivalil linastunud absurdifilmidest : Prantsusmaa "Harry aitab sind" : režissöör Dominik Moll, Jaapani "Esmaspäev" ("Monday") : režissöör Hiroyuki Tanaka, Horvaatia "Marssal Tito vaim" ("Marshal") : režissöör Vinko Breshan, Taani "Kuningas on elus" ("King Is Alive") : režissöör Kristian Levring, Rootsi "Laulud teiselt korruselt" ("Sånger från andra våningen"): režissöör Roy Andersson, Šveitsi "Kes on järgmine ?" ("Who's Next ?") : režissöör Felix Tissi, Saksamaa "Tuvalu" : režissöör Veit Helmer ja Venemaa ning mitme Euroopa riigi ühisfilm "Kuu isaks" ("Luna papa") : režissöör Bahtijer Hudoinazarov. Kokkuvõte inglise keeles lk. 128

  4. Leading Change to Improve Student Achievement: Novice Leaders Take the Reins

    Science.gov (United States)

    Brazer, S. David; Bauer, Scott C.

    2011-01-01

    This article addresses the effects of education leadership candidates' experiences taking a non-traditional research course in which they identify a specific instructional performance gap in their school sites, then engage in action research, consult published literature, and develop an action plan to address the gap. Candidates are required to…

  5. Reining China's industrial energy-Challenges of promoting expedient measures in a Chinese actor environment

    International Nuclear Information System (INIS)

    Nordqvist, Joakim

    2007-01-01

    This article aims to illuminate the complexities involved in efforts to influence China's energy future. It brings forth three observations. First: China's authoritarian appearance is deceptive. Second: learning about concealed but pivotal actors and their motivations is not easy but important. Third: technology diffusion is obstructed by differences in expectations. Three summarising messages conclude the presentation, noting that in order to progress one needs to (i) look beyond official consensus, (ii) address differences in technology perceptions and (iii) be watchful of the inconclusiveness of synthesised information-such as projections of the future. These findings are the result of an analytic and China-oriented exploration of three adjoining fields, i.e. of actors and their different roles in decision-making, of two recent energy futures studies, and of conceptual frameworks for understanding technology

  6. Armastav Traat ja valutav Rooste, Tuglased mõlemad / Rein Veidemann

    Index Scriptorium Estoniae

    Veidemann, Rein, 1946-

    2007-01-01

    Täna antakse Jürgen Roostele ja Mats Traadile üle Friedebert Tuglase novelliauhinnad. Auhinnavääriliseks tunnistati Jürgen Rooste novell "Pornofilm ja pudel viina" (Vikerkaar 2006, nr 6) ja Mats Traadi novell "Sarviku armastus" (Looming 2006, nr 11)

  7. Jumalaga, ainsus! : (Postmodernismi väljakutse eesti kirjandusele ja kriitikale) / Rein Veidemann

    Index Scriptorium Estoniae

    Veidemann, Rein, 1946-

    1995-01-01

    Ka Harald Peebu artiklist 'Arvustaja teeristil' (Keel ja Kirjandus, 1993, nr. 10), postmodernismi klassiku Jacques Derrida seisukohtadest, tema terminist 'différance' - 'siirdus' ja kirjanduskriitikast

  8. Dilated uropathies in children; Dilatation des reins et voies urinaires chez l`enfant

    Energy Technology Data Exchange (ETDEWEB)

    Bouissou, F. [Centre Hospitalier Universitaire Purpan, 31 - Toulouse (France)

    1995-12-31

    These uropathies are frequent in children and are often diagnosed by ante-natal ultrasound examination. The dilatation, hydronephrosis or uretero-hydro-nephrosis may be due to a large pattern of malformations, either anatomical dysplasia, vesico-ureteric reflux or obstruction of the pelvi-ureteric junction, of the vesical-ureteric junction or due to a chronic urethral obstruction. The investigations must determine the exact urinary tract abnormalities, the renal function and the uro-dynamic change. They are guided by the ultrasound findings and cystography. In obstructive malformation, the MAG3 renogram with furosemide test is the best way to precise the uro-dynamic status, but it requires a careful technique in children and its interpretation is sometimes equivocal. DMSA scan is very useful to give precise separate kidney function and to follow the maturational change with age. All the results must be carefully analysed ; the final therapeutic decision and specially surgery is dependent of the type of uropathy and its natural history. In many cases, surgical treatment is only indicated after a longer follow-up and repeated evaluations. (authors). 11 refs., 2 figs.

  9. Kangur Ivan ajab triipu, naised lähevad arust ära / Rein Sikk

    Index Scriptorium Estoniae

    Sikk, Rein, 1961-

    2011-01-01

    Ivan Uvarovist, kes koob oma pisikeses töökojas Rakveres rahvarõivamustritega puuvillast triibukangast, mille järele on suur nõudmine. Ivan Uvarov on töötanud 30 aastat kangastelgede mehaanikuna

  10. Professor Jüri Talvetist sai Ida-Lääne akadeemia liige / intervjueerinud Rein Veidemann

    Index Scriptorium Estoniae

    Talvet, Jüri, 1945-

    2011-01-01

    Intervjuu Tartu ülikooli maailmakirjanduse professori Jüri Talvetiga luulefestivalist Curtea de Argeş ("Nopţile de Poezie de la Curtea de Argeş") ja tema rumeenia keelde tõlgitud luulekogust „Unest, lumest” ("De din somn, de din zăpadă" - tõlkija Dumitru M. Ion), mida autor seal esitlemas käis ning Ida-Lääne akadeemiast (Academia Internationala Orient-Occident), mille tegevliikmeks ta valiti

  11. The new synagogue has given the Jewish community something to sing and dance about / Rein Sikk

    Index Scriptorium Estoniae

    Sikk, Rein, 1961-

    2007-01-01

    Tallinnas Karu tänaval avati 16. mail 2007 uus juudi sünagoog, avamistseremoonial viibisid Iisraeli asepeaminister Shimon Peres, Eesti president Toomas Hendrik Ilves, peaminister Andrus Ansip, Venemaa pearabi Berl Lazar, Iisraeli pearabi Yona Metzger ja sünagoogi suurrahastaja Aleksander Bronštein. President Toomas Hendrik Ilves viitas oma kõnes paralleelidele eestlaste ja juutide ajaloos

  12. Eesti paevarude kaevandamisest ja säästlikust kasutamisest / Rein Einasto

    Index Scriptorium Estoniae

    Einasto, Rein, 1934-

    2005-01-01

    Riiklikku maavara peaks kaevandada saama maaomanikust sõltumatult seal, kus keskkonnakahjud minimaalsed, kvaliteetne paekivi kasutajale võimalikult lähedal, kaevandamistingimused soodsad ja seetõttu omahind madalam, leiab autor

  13. Hasselblatti Eesti jõudmine eesti keelde / Cornelius Hasselblatt ; intervjueerinud Rein Veidemann

    Index Scriptorium Estoniae

    Hasselblatt, Cornelius, 1960-

    2016-01-01

    Intervjuu estofiilist keele- ja kirjandusteadlase ning tõlkija, Tartu ülikooli audoktori ja Eesti Teaduste Akadeemia välisliikme Cornelius Hasselblattiga tema neljast värskest eesti kirjandust ja kultuuri käsitlevast teosest, neist kolm eesti keeles

  14. Ühinemise ja iseolemise vastuseis. Ideaalid ja reaalsus / Rein Tootmaa

    Index Scriptorium Estoniae

    Tootmaa, Rein

    2001-01-01

    Mängufilmid "Keiser ja palgamõrtsukas" ("Jing ke ci qin wang") : režissöör Chen Kaige : Jaapan-Hiina-Prantsusmaa 1999 ja "Tiiger ja draakon" ("Wo hu chang long") : režissöör Ang Lee : Hiina-Hongkong-Ameerika Ühendriigid 2000. Lisa : Aare Ermeli koostatud Chen Kaige ja Ang Lee loomingu lühikokkuvõtted. Kokkuvõte inglise keeles lk. 128

  15. Kaasomandi mõttelise osaga seotud servituudiprobleemidest ja kinnistusraamatu pidamise reformimisest / Rein Tiivel

    Index Scriptorium Estoniae

    Tiivel, Rein, 1940-

    2010-01-01

    Kaasomandi mõttelisest osast ja servituutidest. Kinnistusraamatu pidamise õiguslikest alustest. Kohtute seaduse eelnõust, maksekäsu kiirmenetluse eelnõust ja justiitsregistrimenetluse seaduse eelnõust

  16. Tightening the Reins. Towards a strengthened international nuclear safeguards system. Final report

    International Nuclear Information System (INIS)

    Haeckel, E.; Stein, G.

    1999-12-01

    This book has grown out of a research project dealing with political and technical challenges to international nuclear material and technology controls. The project, which was carried out in the period 1997-1999, was made possible through financial support from the Federal Ministry of Education, Science, Research and Technology and, after reorganization of the German Government following the September 1998 elections, from the Federal Ministry of Economics and Technology. Our research project was a co-operative effort linked to a joint Working Group on Nuclear Nonproliferation, sponsored by the German Society for Foreign Affairs (DGAP, Berlin) in collaboration with the Research Centre Juelich (FZJ, Juelich). The working group, a long-standing institution under the chairmenship of Professors Wolf Haefele and Karl Kaiser, is a unique undertaking for the purpose of continuous information exchange, intellectual debate and political consensus formation on all aspects of German nuclear nonproliferation policy. Members of the group comprise leading experts and decision-makers from government and politics, the natural and social sciences, engineering and nuclear industrial enterprises, as well as mass media and the specialized press. Many among them have shaped and executed the Federal Republic's nuclear policies in a variety of responsible positions. (orig.)

  17. Putting reins on the brain. How the body and environment use it.

    Directory of Open Access Journals (Sweden)

    Dobromir eDotov

    2014-10-01

    Full Text Available Radical embodied cognitive neuroscience (RECN will probably rely on dynamical systems theory (DST and complex systems theory for methods and formalism. Yet, there have been plenty of non-radical neurodynamicists out there for quite some time. How much of their work fits with radical embodied cognitive science, what do they need RECN for, and what are the inconsistencies between RECN and established neurodynamics that would have to be resolved? This paper is both theoretical hypothesis and review. First, it provides a brief overview of the typical, purely structural considerations why the central nervous systems (CNS should be treated as a nonlinear dynamical system and what this entails. The reader will learn about the circular causality enclosing brain and behavior and different attempts to formalize this circularity. Then, three different attempts at linking dynamics and theory of brain function are described in more detail and criticized. A fourth method based on ecological psychology could fix some of the issues that the others encounter. It is argued that studying self-organization of the brain without taking its ecological embedding into account is insufficient. Finally, based on existing theoretical work we propose two roles that the CNS has to be fulfilling in order to allow an animal to behave adequately in its niche. In its first role the CNS has to be enslaved easily by patterns of behavior that guide the animal through its environment. In the second role the brain has to flexibly switch among patterns, what can be called the metastable circuit breaker. The relevance of this idea is supported using certain motor symptoms of Parkinson's disease. These symptoms can be explained as consequent to an excessive stability of the (metastable circuit breaker.

  18. Teater kinos või kino teatris? "Salome" juhtum / Rein Veidemann

    Index Scriptorium Estoniae

    Veidemann, Rein, 1946-

    2008-01-01

    Ooper kinolinal : Richard Strauss. "Salome". Dirigent Patrick Summers, lavastaja Jürgen Flimm. New Yorgi Metropolitan Opera etenduse otseülekanne 11. oktoobril Tallinna kobarkinos ja Tartu kinos Ekraan

  19. Ratastooli-Phil lõikas ministri jalad ära / Rein Sikk

    Index Scriptorium Estoniae

    Sikk, Rein, 1961-

    2003-01-01

    Sotsiaalminister Marko Pomerantsi ja Phare programmi koostööna läbi viidud üritusest "Puuetega inimeste tööhõive edendamine", kus osales ka inglise puuetega inimeste õiguste eest võitleja Phil Friend

  20. Estonian contemporary poetry in Galician : [intervjuu] / Arturo Casas Vales ; interv. by Rein Veidemann

    Index Scriptorium Estoniae

    Casas Vales, Arturo

    2002-01-01

    Santiago de Compostelas ilmus galeegi keeles eesti luule antoloogia "Vello ceo n̤rdico" (2002), kogu ilmus kirjandusajakirja Boletin Galego de Literatura erinumbrina. Intervjuu ilmus eesti k.: Postimees, 2002, 28. märts

  1. Tiigri seljas ratsutav Naan ei naase mitte ainult õhtuti / Rein Ruutsoo

    Index Scriptorium Estoniae

    Ruutsoo, Rein, 1947-

    2008-01-01

    Eesti Draamateatris 16. märtsil esietendunud Enn Vetemaa, Erki Aule ja Merle Karusoo dokumentaallavastusest "Sigma Tau-C705", lavastaja Merle Karusoo. Lavastuse kohta avaldavad arvamust ka Arvo Valton ja Teet Kallas

  2. Ajalooõpiku autor kirjutas võistluse parima romaani / Rein Veidemann

    Index Scriptorium Estoniae

    Veidemann, Rein, 1946-

    2009-01-01

    Romaanivõistluse võitjaks kuulutati romaan "Liblikad janus", autoriks ajalooharidusega Milvi Martina Piir, kelle sulest on varem ilmunud 5. klassi ajalooõpik "Inimesed ajas" ja luulekogu "Kõrkjavaas"

  3. Eesti hüpoteegist rahvusvahelise mõõdupuuga mõõtes / Rein Tiivel

    Index Scriptorium Estoniae

    Tiivel, Rein, 1940-

    2012-01-01

    Eesti hüpoteegi tekkeloost ja kinnispandiõiguse võrdlemisest Saksa Pandikirjapankade Liidu eestvedamisel toimuvate kinnispandiõiguse paindlikkuse teemaliste ümarlauakohtumiste töö tulemuste põhjal. Diagrammid

  4. Kultuuri ärklikorrusel käib vilgas elu / Rein Veidemann

    Index Scriptorium Estoniae

    Veidemann, Rein, 1946-

    2001-01-01

    Artiklis tutvustatakse Interlitteraria 6. nr-t (Tartu Ülikooli Kirj., 2001) ja kogumikke "Uurimusi müüdist ja maagiast" (Tallinna Pedagoogikaülikooli Kirj., 2001) ning Acta Semiotica Estica I (Tartu Ülikooli Kirj., 2001)

  5. Erakondade suuruse ennustamine : Skytte auhinnaloeng / Rein Taagepera ; autori tõlge

    Index Scriptorium Estoniae

    Taagepera, Rein, 1933-

    2009-01-01

    27. septembril 2008 Skytte auhinna vastuvõtu kõne ning Uppsala ülikooli peahoones peetud auhinnaloeng, kus autor selgitab, milles seisneb süvaanalüüs valimissüsteemide osa kohta esindusdemokraatias

  6. Ettevõtte saab pankroti asemel uuesti jalule tõsta / Rein Lang

    Index Scriptorium Estoniae

    Lang, Rein, 1957-

    2008-01-01

    Seaduseelnõust, millega luuakse makseraskustesse sattunud firmade jaoks saneerimismenetlus, mis on alternatiiv senisele pankrotimenetlusele. Ilmunud ka Sakala 29. juuli 2008, lk. 2, pealkiri kujul: menetlus aitab makseraskustes ettevõtte jalule ; Pärnu Postimees 30. juuli 2008, lk. 15 ; Põhjarannik 29. juuli 2008, lk. 2 ; Võrumaa Teataja 31. juuli 2008, lk. 2 ; Koit 31. juuli 2008, lk. 6 ; Kuulutaja 1. august 2008, lk. 4 ; Nädaline 5. aug. 2008, lk. 4 ; Oma Saar 5. aug. 2008, lk. 5

  7. Meeli Kõiva vitraažid ajakirja Stained Glass talvenumbris / Rein Eriksson

    Index Scriptorium Estoniae

    Eriksson, Rein

    1998-01-01

    Intervjuust Meeli Kõivaga Ameerika Ühendriikide vitraažikunstnike Assotsiatsiooni ajakirja "Stained Glass" talvenumbris. Avaldati 8 fotot kunstniku vitraažidest. Artikli "Unistused transparentsest ruumist" autor - USA vitraažikunstnike Assotsiatsiooni endine president Helene Weiss. M. Kõiva esines aprillis 1997 akvarellidega grupinäitusel New Yorgis, Broadway galeriis Art 54.

  8. Proua direktor ohjas ka kineaste / Sigrid Saarep

    Index Scriptorium Estoniae

    Saarep, Sigrid

    2008-01-01

    Dokumentaalfilm "Inge Tederi maailm". Stsenarist Juta Kivimäe, režissöör Rein Raamat, operaatorid Arvo Vilu ja Rein Raamat, montaaž Rein Raamat, produtsendid Helvi ja Rein Raamat. Raamat-Film OÜ, 2007

  9. Leveling the Playing Field: Giving Girls An Equal Chance for Basic Education--Three Countries' Efforts. EDI Learning Resources Series.

    Science.gov (United States)

    Stromquist, Nelly; Murphy, Paud

    This booklet examines the efforts of Pakistan, Bangladesh and Malawi to increase the enrollment of girls in their schools. Each country has severe problems of access to education for girls; the gender gap in the gross enrollment rate at the primary school level is at least 10 percentage points in each country. What is noteworthy about these three…

  10. High-speed low-complexity video coding with EDiCTius: a DCT coding proposal for JPEG XS

    Science.gov (United States)

    Richter, Thomas; Fößel, Siegfried; Keinert, Joachim; Scherl, Christian

    2017-09-01

    In its 71th meeting, the JPEG committee issued a call for low complexity, high speed image coding, designed to address the needs of low-cost video-over-ip applications. As an answer to this call, Fraunhofer IIS and the Computing Center of the University of Stuttgart jointly developed an embedded DCT image codec requiring only minimal resources while maximizing throughput on FPGA and GPU implementations. Objective and subjective tests performed for the 73rd meeting confirmed its excellent performance and suitability for its purpose, and it was selected as one of the two key contributions for the development of a joined test model. In this paper, its authors describe the design principles of the codec, provide a high-level overview of the encoder and decoder chain and provide evaluation results on the test corpus selected by the JPEG committee.

  11. 5 anos de trabalho, 10 edições e mais de 100 trabalhos publicados: a identidade da revista Navus

    Directory of Open Access Journals (Sweden)

    Eduardo Gomes Carvalho

    2016-01-01

    Full Text Available Um dos principais veículos, se não o principal, para comunicação científica são os periódicos. Portanto, faz sentido estudar uma ou mais revistas científicas. Tais tipos de estudos não são raros na literatura, mesmo na brasileira, podendo citar como exemploMueller e Pecegueiro (2001. Esses estudos são importantes pois apresentam indicadores científicos de produção científica em uma determinada área. Assim, é objetivo do presente trabalho realizar uma análise bibliométrica da revista Navus buscando identificar características significativas da produção científica em gestão e tecnologia. A escolha do referido periódico se justifica primeiramente por publicar majoritariamente trabalhos nacionais, e em segundo por ser uma publicação jovem, trimestral e indexada em importantes bases. Serão apresentados os principais autores, os trabalhos mais relevantes do periódico e as palavras-chave mais utilizadas. Também serão apresentados caminhos para a melhoria da classificação do periódico no sistema Qualis de avaliação da Coordenação de Aperfeiçoamento de Pessoal de Nível superior. 

  12. RESENHA: BROADIE, A. Introduction to medieval logic. Segunda edição. Oxford: Clarendon Press, 2002.

    Directory of Open Access Journals (Sweden)

    Alexandre Cabeceiras

    2011-05-01

    Full Text Available Nessa obra, Broadie, após discutir qual seria a melhor ordem de exposição paraum texto sobre lógica medieval, decide tratar primeiro dos termos, depois dasproposições e, por fim, das inferências. Mas, não se restringindo ao que era uniforme oupredominante na Idade Média, explora disputas envolvendo lógicos ou filósofos daqueleperíodo. Delimitando seu objeto, estabelece que a obra lidará, hegemonicamente, commaterial produzido no período entre a segunda metade do século XIII e o final do séculoXV, por considerar essa a fase mais produtiva no que se refere à lógica medieval.

  13. Ecological DYnamics Simulation Model - Light (EDYS-L): User’s Guide Version 4.6.4

    Science.gov (United States)

    2011-08-01

    precipitation amount. Normal precipitation uses a value of 1.00. A wet cycle of a 25% increase would use a value of 1.25, while a drought 75% of normal would...tridentata Little bluestem Schizachyrium scoparium Mesquite Prosopis glandulosa Ponderosa pine Pinus ponderosa Ragweed Ambrosia artemisiifolia Russian

  14. Na sala de edição: “Mãe judia, 1964”, de Moacyr Scliar

    Directory of Open Access Journals (Sweden)

    Nicola Gavioli

    2014-01-01

    Full Text Available In contemporary Brazil, efforts continue to conceal liabilities of crimes committed during the years of dictatorship and to alter or weaken the testimony of victims who have spoken out against their perpetrators. This article explores how the short story “Jewish mother, 1964” by Moacyr Scliar, under the guise of a coming-of-age story and a monologue of a mentally ill patient, sheds light on violent practices that, without leaving visible marks on the body, have incurred serious and longstanding wounds within Brazilian society. Readers are made to see how persuasion, trivialization, and silencing are complicit in the “normalizing” of recent and traumatic histories. If made recognizable, this silencing practice could directly be challenged.

  15. O descobrimento do Brasil através dos textos: edições críticas e comentadas

    Directory of Open Access Journals (Sweden)

    Joaquim Barradas de Carvalho

    1968-03-01

    Full Text Available IV - O Esmeraldo de Situ Orbis  O título da obra de Duarte Pacheco Pereira é composto pela palavra Esmeraldo e pela expressão De Situ Orbis. A compreensão da expressão De Situ Orbis não apresenta a mínima dificuldade. To-dos os autores que abordâram o assunto foram unânimes em consi-derar que se trata do título da obra de Pompônio Mela .

  16. O descobrimento do Brasil através dos textos: edições críticas e comentadas

    Directory of Open Access Journals (Sweden)

    Joaquim Barradas de Carvalho

    1967-09-01

    Full Text Available Apesar da célebre "Carta" ter sido muitas vêzes editada (1, a verdade é que quase nada se sabe àcêrca do seu autor . Tendo em con-ta a documentação conhecida, surgem-nos até três, ou mesmo quatro, personagens com êste nome: existiu um Mestre João de Menelau, grego; existiu um Mestre João, alemão; existiu um Mestre João Fa-ras, espanhol, talvez aragonês, autor de uma tradução para espanhol do De Situ Orbis de Pompônio Mela (2, que bem poderá ser o Mestre João autor da célebre "Carta".

  17. O descobrimento do Brasil através dos textos: edições críticas e comentadas

    Directory of Open Access Journals (Sweden)

    Joaquim Barradas de Carvalho

    1966-06-01

    Full Text Available É um fato incontestável que a História de Portugal, e até a História da Civilização Ibérica, avultam na História Universal mercê dos Descobrimentos Marítimos e da Expansão dos séculos XV e XVI. Só os Descobrimentos e a Expansão puderam ter dado origem a algo de inteiramente nôvo na História da Humanidade que tenha provindo de Portugal.

  18. O descobrimento do Brasil através dos textos: edições críticas e comentadas

    Directory of Open Access Journals (Sweden)

    Joaquim Barradas de Carvalho

    1969-03-01

    Full Text Available Duarte Pacheco Pereira pertenceu a uma família cujas origens, segundo certos autores, seriam muito longínqüas . Os Pachecos descenderiam, com efeito, de um Lasius Suavius Paciecus que teria guerreado em Espanha (1 . Outros genealogistas, menos temerários, remontam a um D. Fernando Geremias, oriundo da Galiza, e rico-homem de Afonso VI de Leão.

  19. O descobrimento do Brasil através dos textos: edições críticas e comentadas

    Directory of Open Access Journals (Sweden)

    Joaquim Barradas de Carvalho

    1969-06-01

    Full Text Available Em 14 de dezembro de 1508 (94 D. Manuel encarregou um chamado João Serrão de dar caça, com uma pequena frota, ao corsário francês Mondragon, que tinha atacado navios portuguêses pro-venientes da Ilidia . João Serrão não cumpriu a contento a sua mis-são e o rei substituiu-o por Duarte Pacheco Pereira .

  20. O descobrimento do Brasil através dos textos: edições críticas e comentadas

    Directory of Open Access Journals (Sweden)

    Ana Maria de Almeida Camargo

    1966-12-01

    Full Text Available Muitas são as conjeturas em tôrno da figura de Pero Vaz de Caminha. Vários autores tentaram sua biografia, sem contudo, por falta de documentação esclarecedora, chegarem a resultados satisfatórios. O nosso caso não diferirá, infelizmente, em muito, do dos nossos antecessores.

  1. O descobrimento do Brasil através dos textos: edições críticas e comentadas

    Directory of Open Access Journals (Sweden)

    Miyoko Makino

    1967-03-01

    A Relação do Pilôto Anônimo constitui, ao lado das Cartas de Pero Vaz de Caminha e do Mestre João, um importante documento sôbre o descobrimento do Brasil, pois seu autor participou da expedição de Pedro Álvares Cabral. Contêm os principais acontecimentos da viagem às índias, desde a partida da armada até o seu regresso a Portugal. Foi conhecida e divulgada na época, através de várias coleções de viagens.

  2. O descobrimento do Brasil através dos textos: edições críticas e comentadas

    Directory of Open Access Journals (Sweden)

    Joaquim Barradas de Carvalho

    1968-12-01

    Full Text Available Não há nenhum documento referente à biografia de Duarte Pa-checo Pereira que nos possa ajudar a estabelecer a data, ou entre que datas, êle redigiu o seu Esmeraldo de situ orbis. Em conseqüên-cia, somos levados a considerar muito atentamente o texto da sua obra, o texto do Esmeraldo.

  3. The use of EDI to reduce the ammonia concentration in steam generators blowdown of PWR nuclear power plants

    International Nuclear Information System (INIS)

    Calay, J.C.; Goffin, C.

    2000-01-01

    To be recycled, PWR steam generator blowdown must be purified by mechanical filters, followed by ion exchangers (mixed bed preceded by a cationic ion exchange resin). The cationic ion exchange resin eliminates the conditioning agent ammonia in order to lengthen the cycles of the mixed bed. In the Doel nuclear power plant, Laborelec performed tests on a pilot plant for continuous electrodeionization that might replace the cation exchanger. The test campaign lasted six months. It is concluded that ammonia is removed well (1,000 μg/kg in the feed vs. 3 - 4 μg/kg in the product). The electrodeionization removes also other impurities; the conductivity of the treated water amounts to nearly 0.07 μs/cm

  4. Factors Associated with the Retinal Nerve Fiber Layer Loss after Acute Primary Angle Closure: A Prospective EDI-OCT Study.

    Directory of Open Access Journals (Sweden)

    Eun Ji Lee

    Full Text Available To determine the factors associated with retinal nerve fiber layer (RNFL loss in eyes with acute primary angle-closure (APAC, particularly focusing on the influence of the change in the anterior lamina cribrosa surface depth (LCD.After the initial presentation, 30 eyes with unilateral APAC were followed up at the following specific time points over a 12-month period: 1 week, 1~2 months, 2~3 months, 5~6 months, and 11~12 months. These follow-ups involved intraocular pressure measurements, enhanced depth-imaging spectral-domain optical coherence tomography (SD-OCT scanning of the optic disc, and measurements of the circumpapillary RNFL thickness. The prelaminar tissue thickness (PLT and LCD were determined in the SD-OCT images obtained at each follow-up visit.Repeated measures analysis of variance revealed a significant pattern of decrease in the global RNFL thickness, PLT, and LCD (all p<0.001. The global RNFL thickness decreased continuously throughout the follow-up period, while the PLT decreased until 5~6 months and did not change thereafter. The LCD reduced until 2~3 months and then also remained steady. Multivariable regression analysis revealed that symptoms with a longer duration before receiving laser peripheral iridotomy (LI (p = 0.049 and a larger LCD reduction (p = 0.034 were significant factors associated with the conversion to an abnormal RNFL thickness defined using OCT normative data.Early short-term decreases in the PLT and LCD and overall long-term decrease in the peripapillary RNFL were observed during a 12-month follow-up after an APAC episode. A longer duration of symptoms before receiving LI treatment and larger LCD reduction during follow-up were associated with the progressive RNFL loss. The LCD reduction may indicate a prior presence of significant pressure-induced stress that had been imposed on the optic nerve head at the time of APAC episode. Glaucomatous progression should be suspected in eyes showing LCD reduction after the APAC remission.

  5. An Indigenous Knowledges Perspective on Valid Meaning Making: A Commentary on Research with the EDI and Aboriginal Communities

    Science.gov (United States)

    Sam, Michele A.

    2011-01-01

    Offering an Indigenous perspective, this commentary discusses collaborative research, shared meaning making, and knowledge building specific to child development, and reflects on social, cultural, and historical aspects that influence these processes. Drawing upon experiences of developing a collaborative research approach with which to engage…

  6. Application of the EDYS Model to Evaluate Control Methods for Invasive Plants at Yakima Training Center, Washington

    National Research Council Canada - National Science Library

    Hunter, Rachael G; Mata-Gonzalez, Ricardo; McLendon, Terry

    2004-01-01

    .... Non-indigenous invasive plants can also reduce and destroy forage for livestock and wildlife, displace native plant species, increase fire frequency, reduce recreational opportunities, and can poison domestic animals...

  7. Nota editorial - Geonorte Edição 1 de 2017 v8 n°29

    OpenAIRE

    João Cândido André da Silva Neto

    2017-01-01

    Prezados leitores e autores, a Revista Geonorte está passando por uma reestruturação do conselho científico, corpo editorial e novo editor gerente, buscando assim, novos patamares para revista na perspectiva da divulgação do conhecimento científico produzido pela ciência geográfica e áreas afins. Informamos ainda que a Revista Geonorte a partir do ano de 2017 está com o DOI - Digital Object Identifier, um identificador único de metadados, além de estar compartilhada em diversas bases inde...

  8. Nota editorial - Geonorte Edição 1 de 2017 v8 n°29

    Directory of Open Access Journals (Sweden)

    João Cândido André da Silva Neto

    2017-08-01

    Full Text Available Prezados leitores e autores, a Revista Geonorte está passando por uma reestruturação do conselho científico, corpo editorial e novo editor gerente, buscando assim, novos patamares para revista na perspectiva da divulgação do conhecimento científico produzido pela ciência geográfica e áreas afins. Informamos ainda que a Revista Geonorte a partir do ano de 2017 está com o DOI - Digital Object Identifier, um identificador único de metadados, além de estar compartilhada em diversas bases indexadoras (18, permitindo ampla divulgação dos artigos publicados.

  9. Application of the EDYS Model to Evaluate Control Methods for Invasive Plants at Yakima Training Center, Washington

    Science.gov (United States)

    2004-12-01

    native plant species, increase fire frequency, reduce recreational opportunities, and can poison domestic animals. It is imperative to find economical ...A Multiscale Ecological Model for Allocation of Training Activities on US Army Installations. In: Jeffrey M. Klopatek and Robert H. Gardner (eds...Gigon, A. and I. H. Rorison. 1972. The response of some ecologically distinct plant species to nitrate and to ammonium nitrogen. Journal of Ecology

  10. Evaluation of estimated daily intake (EDI) of cadmium and lead for rice (Oryza sativa L.) in calcareous soils.

    Science.gov (United States)

    Chamannejadian, Ali; Sayyad, Gholamabbas; Moezzi, Abdolamir; Jahangiri, Alireza

    2013-04-08

    The excessive amounts of cadmium and lead in food chain can cause health problems for humans and ecosystem. Rice is an important food in human diet. Therefore this study was conducted in order to investigate cadmium and Lead concentrations in seed rice (Oryza saliva) of paddy fields in southwest of Iran. A total of 70 rice seed samples were collected from paddy fields in five regions of Khuzestan province, Southwest Iran, during harvesting time. In the samples cadmium and Lead concentrations were measured. To assess the daily intake of Cadmium and Lead by rice, daily consumption of rice was calculated. The results showed that average concentrations of Cadmium and Lead in rice seeds were 273.6 and 121.8 μg/kg, respectively. Less than 72% of rice seed samples had Cadmium concentrations above 200 μg/kg (i.e. Guide value for cadmium); and less than 3% had Lead concentrations above 150 μg/kg (i.e. Guide value for Lead). The estimated daily intakes of cadmium by the local population was calculated to 0.59 μg/day kg bw, which corresponds to 59% of the tolerable daily intakes (i.e. 1 μg/day kg bw). Eleven out of 70 samples (15.71%) exceed the tolerable daily intakes. The dietary intakes for Lead in the local population ranged from 0.22 to 0.47 μg/day kg bw. Tolerable daily intakes for Lead is 3.6 μg/day kg bw. As a whole, long term consumption of the local rice may bear high risk of heavy metal exposure to the consumer in the study region.

  11. Holding the Reins of the Professional Learning Community: Eight Themes from Research on Principals' Perceptions of Professional Learning Communities

    Science.gov (United States)

    Cranston, Jerome

    2009-01-01

    Using a naturalistic inquiry approach and thematic analysis, this paper outlines the findings of a research study that examined 12 Manitoba principals' conceptions of professional learning communities. The study found that these principals consider the development of professional learning communities to be a normative imperative within the…

  12. The influence of the damaged reinforcing bars on the stress-strain state of the rein-forced concrete beams

    Directory of Open Access Journals (Sweden)

    Zenoviy Blikharskyy

    2017-04-01

    Full Text Available The article is devoted to the overall view of experimental research of reinforced concrete beams with the simultaneous influence of the corrosion environment and loading. The tests have been carried out upon the reinforced concrete specimens considering the corrosion in the acid environment, namely 10 % H2SO4 that have been taken as a model of the aggressive environment. The beams are with span equalling to 1,9m with different series of tensile armature, concrete compressive strength and different length of impact of corrosion (continuous and local. The influence of simultaneous action of the aggressive environment and loading on strength of reinforced-concrete beams has been described. For a detailed study of the effect of individual components there was suggested additional experimental modelling of the only tensile armature damage without concrete damage. It will investigate the influence of this factor irrespective of the concrete.

  13. Kaante vahel on ülevaade pöördeliste aastate parlamendi tegevusest / Rein Järlik

    Index Scriptorium Estoniae

    Järlik, Rein, 1935-

    2013-01-01

    Ülevaade Eesti parlamendile pühendatd statistikast ja tegevusest, konkreetselt kogumikust "Eesti NSV / Eesti Vabariigi Ülemnõukogu XII koosseis 29.03.1990-29.09.1992. Statistikat ja ülevaateid", parlamendiliikme meenutused 1990. aastate algusest.

  14. Lytton Strachey : l’historien intime de deux reines Lytton Strachey’s Intimate Biographies of Two Queens

    Directory of Open Access Journals (Sweden)

    Jeannine Hayat

    2007-01-01

    Full Text Available The British writer Lytton Strachey (1880-1932 wrote biographies of the two most eminent Queens of England: Queen Victoria (1921 and Elizabeth and Essex (1928. The two books made him a very famous historian. However, he would personally have preferred to be admired for his poetry or his plays, for he was a very gifted literary author. Nevertheless many of Strachey’s readers have appreciated his conception of biography, as a means of personal confession while studying the destiny of a public figure. Indeed the Stracheyan way of life, free from Victorian moral standards and guided by the rules of the Bloomsbury group, inspired his story of Victoria and Elizabeth. Both Queens at the end of their lives and at the height of their power carried on strange love affairs: Victoria with her Scottish gillie and Elizabeth with the Earl of Essex, thirty years her younger. In fact, both romances subtly reflect Strachey’s own love affairs. He was himself engaged in a kind of common life with Dora Carrington— the painter, thirteen years younger than him, with whom he was not sexually involved— while he engaged in numerous homosexual love affairs.

  15. Imperiling urban environment through varying air pollution rein in measures and mass transit policies - a case study of Lahore

    International Nuclear Information System (INIS)

    Aziz, A.

    2015-01-01

    Gargantuan expansion of big cities has increased motor vehicular tremendously. Lahore, a primitive green city is now gripped with swelling motor vehicular air pollution. Mass public transport, a back bone of city transportation network, due to erroneous running significantly contributes toward motor vehicular air pollution. Policy initiatives of the Government to curb motor vehicular air pollution are merely focused upon reduction of air pollution at source by the use of technology and clean fuel programmes. The policies for introduction of mass transit remained imprecise which lead to rise in transportation demand and increase in surfeit emission; Half-baked policies normally stem out to get political popularity which imperils urban environment. The paper highlights inconsistent policy measures and unsound air pollution control strategies adopted in big cities of Pakistan. Furthermore it gives guidance for sustainable mass transit policy measures. (author)

  16. Tervisehäirega töötajad Eesti tööturul / Rein Vöörmann

    Index Scriptorium Estoniae

    Vöörmann, Rein, 1953-

    2004-01-01

    Uurimuse aluseks on 2002. aasta Eesti tööjõu-uuringu andmestik. Joonised: Tervisehäirega töötajate keskmise netopalga osa (%) tervete töötajate palgast 2002. a.; Tervisehäirega ja tervete töötajate töötuse kogemine viimase 10 aasta jooksul (%). Lisatud on ka tabelid tervisehäirega ja tervete töötajate hinnangust oma töö ja haridustaseme vastavuse kohta, töökoha kaotuse võimaluse kohta eeloleva aasta jooksul ja tõenäosuse kohta leida uus töökoht

  17. Lootus : [luuletused] / Friedrich Schiller ; tlk. Ain Kaalep, Rein Sepp, Paul Viiding, Eduard Roos, Jaan Kross, Jakob Tamm

    Index Scriptorium Estoniae

    Schiller, Friedrich, 1759-1805

    2006-01-01

    Sisu: Lootus ; Õhtu ; Brutus ja Caesar ; Laura klaveri ees ; Rousseau ; Grupp Tartarosest ; Rõõmule ; Palvekiri ; Hektori lahkumine ; Kunstnikud ; Laulu võim ; Metafüüsik ; Ideaal ja elu ; Maailma jaotamine ; Neiu võõrsilt ; Külvaja ; Odysseus ; Kolumbus ; Antiikkultuur rändurile Põhjast ; Zeus Heraklesele ; Kõrgeim ; Laps hällis ; Surematus ; Võti ; Astronoomilised teosed ; Parim riik ; Minu usk ; Sõber ja vaenlane ; Harv seos ; Nooruse lätted ; Naiste otsus ; Ootus ja täitumine ; Ühine saatus ; Looduseuurijad ja transtsendentaalfilosoofid ; Ohtlik tulemus ; Anonüümne jõgi ; Valgus ja soojus ; Neiu kaebus ; Ühele moralistile ; Goethele ; Pagulane ; Saksa muusa ; Uue sajandi saabumine ; Punshilaul ; Mäelaul ; Polykratese sõrmus ; Rüütel Toggenburg ; Kinnas ; Alpi kütt ; Sõpradele. Eluloolisi andmeid autori kohta lk. 239

  18. 'Taking back the reins' - A qualitative study of the meaning and experience of self-management in bipolar disorder.

    Science.gov (United States)

    Morton, Emma; Michalak, Erin E; Hole, Rachelle; Buzwell, Simone; Murray, Greg

    2018-03-01

    Self-management (SM) is increasingly emphasised as a key aspect of bipolar disorder (BD) treatment. However, little is known about the subjective experience of SM, which might have both positive and negative impacts. The present study aimed to advance this literature through qualitative investigation of the experiences of people with BD who participated in an SM intervention targeting quality of life (QoL). Forty-three individuals with BD engaged with an SM intervention and were later questioned about personal experiences of engagement with the intervention, including attempts to enact self-management strategies. Thematic analysis was used to identify important aspects of the experience of SM in BD. Four themes describing people's experiences of SM were identified: 1) SM for BD is empowering, 2) individual responsibility to self-manage BD, 3) SM strategies lack power to control BD, and 4) the relationship of SM to the healthcare system. Potential limitations to generalisability may occur from self-selection bias in favour of SM and the QoL-focused nature of the present intervention. The findings of this research generate novel insights into ways in which individuals with BD engage with SM interventions. For most people with BD, SM invokes a sense of empowerment and responsibility, although some feel symptoms remain beyond their control. A sense of partnership between consumers and clinicians may emerge from attention to SM, but traditional medical approaches were perceived as neglecting this aspect of care. Considerations from consumer perspectives are presented to assist clinicians and researchers utilising SM interventions in BD. Copyright © 2017 Elsevier B.V. All rights reserved.

  19. Tervislikud vähemlevinud teraviljad / Ilmar Tamm, Ilme Tupits, Reine Koppel, Pille Sooväli

    Index Scriptorium Estoniae

    Tamm, Ilmar, 1961-

    2015-01-01

    ELi 7. raamprogrammi projekti "Tervislikud vähemlevinud teraviljad" eemärk on Euroopas vähemlevinud teraviljade nagu rukki, kaera, spelta ning ühe- ja kahetera nisu geneetilise baasi mitmekesistamine sordiaretuseks, nende stressitaluvuse suurendamine, agrotehnika parandamine ning toiteväärtuse ja toiduviljaks töötlemise kvaliteedi tõstmine. Projekti koordineerib Tšehhi Põllukultuuride Uurimisinstituut, selles osaleb partnerina ka Eesti Taimekasvatuse Instituut

  20. Tähtsad asjad ei pea ainult Tallinnas või Tartus sündima / Rein Raudvere

    Index Scriptorium Estoniae

    Raudvere, Rein, 1955-

    2010-01-01

    SA Eesti Rahvuslik Klaverimuuseum kavast rajada Helme mõisa klaverimuuseum, toetuse saamiseks taotluse esitamisest Ettevõtluse Arendamise Sihtasutusele. Vanemuise kontserdimajas 3. 03. 2010 avatavast klaverite näitusest, millega tähistatakse Aleksander Läte 150. sünniaastapäeva

  1. Night Song Festival "Time to Take Notice" or "The world had never seen such a birthday bash before" / Rein Sikk

    Index Scriptorium Estoniae

    Sikk, Rein, 1961-

    2008-01-01

    Laulvast revolutsioonist 1988. aastal. 19.-20. augustil 2008 Tallinna lauluväljakul toimunud öölaulupeost "Märkamisaeg". Vt. samas: Freedom is not self-evident. Väljavõte president Toomas Hendrik Ilvese kõnest

  2. Eesti põlevkivitööstus peab arvestama üha karmistuvaid keskkonnanõudeid / Rein Talumaa, Anto Raukas

    Index Scriptorium Estoniae

    Talumaa, Rein

    2007-01-01

    "Kütuse- ja energiamajanduse pikaajalisest riiklikust arengukavast aastani 2015" ning eelnõust "Põlevkivi kasutamise riiklik arengukava 2007-2015". Keskkonnakaitsenõuetest põlevkivitööstuses. Tabelid: Ettevõtete soovid põlevkivi kasutamiseks aastail 2007-2015; Eesti põlevkivivajaduse kalkulatsioon aastaks 2015; SO₂ heitkogus põlevkivielektrijaamadest

  3. Reekviem unistusele : Venemaa-Gruusia sõja mõningatest julgeolekupoliitilistest mõjudest Eestile / Rein Tammsaar

    Index Scriptorium Estoniae

    Tammsaar, Rein

    2008-01-01

    Rahvusvahelisest ja rahvuslikust julgeolekust vastavalt Barri Buzani teooriale. Vajadusest tugevdada Eesti riiklikku julgeolekupoliitikat, suurendades ühiskondlikku sidusust erinevate kultuuride ning rahvuste vahel. Venemaa-Gruusia sõjast kui kaudsest õppetunnist Eestile

  4. A broadening debate : is the Estonian society ready for civic initiative? / Rein Ruutsoo, Erle Rikmann, Mikko Lagerspetz

    Index Scriptorium Estoniae

    Ruutsoo, Rein, 1947-

    2004-01-01

    Valitsusväliste organisatsioonide koostöö võimalustest riiklike institutsioonidega, osalemisest poliitiliste otsuste tegemises, ühiskonna suhtumisest kodanikualgatusse. 22. juunist 4. detsembrini 2000. a. läbiviidud küsitlusuuringu tulemustest

  5. SLO Eesti AS-il uus tegevdirektor / Jaanus Laikmaa, Pekka Syrjäkari ; interv. Rein Aro

    Index Scriptorium Estoniae

    Laikmaa, Jaanus, 1970-

    2008-01-01

    Elektritarvikutega seotud hulgimüüjaid koondavasse rahvusvahelisse ettevõtete kooslusesse Sonepar Group kuuluva SLO Eesti AS tegevdirektor Jaanus Laikmaa ja juhatuse esimees Pekka Syrjäkari räägivad oma ettevõtte arengust, tootevalikust, kvaliteedipoliitikast, konkurentsist, elektrikaupade aastamessi SLO Sügispäev korraldamisest, ettevõtte perspektiividest Eesti praeguse majandusseisu taustal

  6. Eesti väike- ja keskmiste tööstusfirmade innovaatilise tegevuse finantseerimine / Rein Lumiste

    Index Scriptorium Estoniae

    Lumiste, Rein

    1999-01-01

    Bibliogr. lk. 16-17. - Kokkuvõte ingl. k. lk. 95. Peamine põhjus, miks pangad ei finantseeri väikeseid ja keskmisi ettevõtteid, on korrektse, regulaarse ja adekvaatse teabe puudumine firmade tegevuse ja nende omanike kohta. Tabel

  7. Abieluakti koostamine EELKs - õigus või kohustus? / Kristjan Luhamets, Rein Schihalejev, Mare Palgi...[jt.] ; interv. Merje Talvik

    Index Scriptorium Estoniae

    2008-01-01

    Vastavalt perekonnaseaduse muudatustele on siseministeeriumi poolt korraldatava koolituse läbinud vaimulikul õigus abielu sõlmimiseks. Vaimulikud vastavad küsimusele, kuidas nad näevad perekonnaseisuametniku ja jumalasulase tööd ühendatuna. Lisatud: [koguduse vaimulikul on õigus keelduda abielu sõlmimisest, kui...

  8. Viimsi keskuse muutumised ajas = Alterations of the Viimsi Centre in Time / Triin Ojari

    Index Scriptorium Estoniae

    Ojari, Triin, 1974-

    2002-01-01

    Viimsi keskusesse on hooneid projekteerinud arhitektid Rein Veber, Ado Eigi, Rein Hansberg, Andres Alver, planeeringu autor on Rein Veber. 2002. a. valmis soomlase Matti Anttila büroo Architecture Workshop 2 koostatud üldplaneeringu ideeprojekt. 1 ill

  9. CULTURA, LAZER E TURISMO A FESTA DO PINHÃO DE SÃO FRANCISCO DE PAULA/RS Edições 2009 e 2010

    Directory of Open Access Journals (Sweden)

    Airton da Silva Negrine

    2011-02-01

    Full Text Available Normal 0 21 false false false PT-BR X-NONE X-NONE /* Style Definitions */ table.MsoNormalTable {mso-style-name:"Tabela normal"; mso-tstyle-rowband-size:0; mso-tstyle-colband-size:0; mso-style-noshow:yes; mso-style-priority:99; mso-style-qformat:yes; mso-style-parent:""; mso-padding-alt:0cm 5.4pt 0cm 5.4pt; mso-para-margin:0cm; mso-para-margin-bottom:.0001pt; mso-pagination:widow-orphan; font-size:11.0pt; font-family:"Calibri","sans-serif"; mso-ascii-font-family:Calibri; mso-ascii-theme-font:minor-latin; mso-fareast-font-family:"Times New Roman"; mso-fareast-theme-font:minor-fareast; mso-hansi-font-family:Calibri; mso-hansi-theme-font:minor-latin; mso-bidi-font-family:"Times New Roman"; mso-bidi-theme-font:minor-bidi;} O artigo é produto de um trabalho acadêmico de investigação realizado por professores, alunos e ex-alunos do Mestrado de Turismo da Universidade de Caxias do Sul tendo como cenário de estudo a XIII e XIV Festa do Pinhão de São Francisco de Paula/RS, nos anos de 209 e 2010 respectivamente.O estudo das festas teve o propósito dar destaque a Araucária e seu fruto, a gastronomia e os valores culturais do pinhão como alimento de diferentes espécies que está em vias de extinção segundo fontes citadas no texto. Como a festa foco do estudo é uma festa temática, artigo o evento como cultura, lazer e turismo.

  10. Colaboração, edição, transparência: desafios e possibilidades de uma “wikificação” do jornalismo

    Directory of Open Access Journals (Sweden)

    Carlos d'Andréa

    2009-06-01

    Full Text Available A fragmentação dos relatos e a pluralidade de vozes são duas características marcantes da dinâmica de produção e publicação de informações, inclusive de caráter jornalístico, na atualidade. O modelo consolidado na era da comunicação de massa, baseado na restrição da produção e disseminação de notícias a poucos veículos e profissionais, responsáveis pela elaboração de produtos “acabados” (jornais, revistas etc., convive cada vez mais perto e é decisivamente influenciado por um fluxo disperso e ininterrupto de informações produzidas para, na e à  revelia das redações jornalísticas.

  11. The effect of childhood adversity on 4-year outcome in individuals at ultra high risk for psychosis in the Dutch Early Detection Intervention Evaluation (EDIE-NL) Trial

    NARCIS (Netherlands)

    Kraan, Tamar C.; Ising, Helga K.; Fokkema, Marjolein; Velthorst, Eva; van den Berg, David P. G.; Kerkhoven, Margot; Veling, Wim; Smit, Filip; Linszen, Don H.; Nieman, Dorien H.; Wunderink, Lex; Boonstra, Nynke; Klaassen, Rianne M. C.; Dragt, Sara; Rietdijk, Judith; de Haan, Lieuwe; van der Gaag, Mark

    2017-01-01

    Childhood adversity is associated with a range of mental disorders, functional impairment and higher health care costs in adulthood. In this study we evaluated if childhood adversity was predictive of adverse clinical and functional outcomes and health care costs in a sample of patients at

  12. Edição Temática “Cidades inteligentes: planejamento e gestão da sustentabilidade”

    Directory of Open Access Journals (Sweden)

    Cláudia Terezinha Kniess

    2016-09-01

    Ressalta-se que a revista GeSeC está inserida em bases indexadoras nacionais e internacionais, a saber:  Redalyc; Cengage Gale Learning; DOAJ; Proquest; Ebsco Host e Web of Science Core Collection.

  13. O estômago de um periódico: edição e circulação da Revista de Antropofagia

    OpenAIRE

    Queiroz, Helaine Nolasco

    2016-01-01

    A Revista de Antropofagia consiste em um periódico literário vanguardista que circula em São Paulo, entre maio de 1928 e agosto de 1929, reunindo dezenas de literatos e artistas sob a liderança do escritor Oswald de Andrade. A Antropofagia propõe a deglutição dos modelos importados, especialmente os europeus, no intuito de absorver o que eles têm de positivo, criando uma cultura brasileira mais forte, livre dos recalques a que se supõe estar submetida no período. Ela traça uma inversão da rel...

  14. DoD Electronic Data Interchange (EDI) Convention: ASC X12 Transaction Set 858 Freight Government Bill of Lading Shipment Information (Version 003010)

    Science.gov (United States)

    1993-02-01

    Segment: BX General Shipment Information Level: A Sequence: 30 Usage: M Max Use: 1 Loop: Purpose: To transmit identification numbers and other basic ...official code as- signed to a city or point (for ratemaking purposes) within a city. 930210 10.7.25 DEPARTM•B•T OF DOOM4N GOVERMET SILL OF LAD#M wDI...development group as the official code as- signed to a city or point (for ratemaking purposes) within a city. 930210 10.7.27 DEPARTMENT OF DG:dEI GOVWERJT

  15. 48 CFR 552.216-72 - Placement of Orders.

    Science.gov (United States)

    2010-10-01

    ...] (b) Orders may be placed through Electronic Data Interchange (EDI) or mailed in paper form. EDI... Data Interchange (EDI) format. (c) If the Contractor agrees, General Services Administration's Federal Acquisition Service (FAS) will place all orders by EDI using computer-to-computer EDI. If computer-to-computer...

  16. 75 FR 41093 - General Services Administration Acquisition Regulation; Rewrite of GSAR Part 516, Types of Contracts

    Science.gov (United States)

    2010-07-15

    ...) will place all orders by EDI using computer-to-computer EDI. If computer-to-computer EDI is not possible, FAS will use an alternative EDI method allowing the Contractor to receive orders by facsimile transmission. Subject to the Contractor's agreement, other agencies may place orders by EDI. * * * * * (g) The...

  17. 77 FR 57090 - Agency Information Collection Activities: Proposed Collection; Comment Request

    Science.gov (United States)

    2012-09-17

    ...: Medicare Electronic Data Interchange (EDI) Registration and Electronic Data Interchange (EDI) Enrollment... Electronic Data Interface (EDI) functions. The EDI Enrollment and the Medicare Registration Forms are... efficient uniform means by which Medicare captures information necessary to drive Medicare EDI security and...

  18. 76 FR 61937 - Practice and Procedure: Rules of General Application, Safeguards, Antidumping and Countervailing...

    Science.gov (United States)

    2011-10-06

    ...; Wiley Rein LLP, on behalf of Nucor Corporation (Wiley Rein); and Williams Mullen. Issues raised in the... on Paper Filing Requirement AMS, the CITBA, Hughes Hubbard, the ITC TLA, Kelley Drye, Wiley Rein, and... electronically and in paper form. Hughes Hubbard, Kelley Drye, and Wiley Rein submit that the Commission will...

  19. 76 FR 40457 - Administrative Simplification: Adoption of Operating Rules for Eligibility for a Health Plan and...

    Science.gov (United States)

    2011-07-08

    ... information. Electronic Data interchange (EDI) enables providers and payers to process financial and... hardware and software to exchange EDI data. Each trading partner, including providers, separately provides...

  20. 75 FR 76426 - Privacy Act of 1974; System of Records

    Science.gov (United States)

    2010-12-08

    ... name, middle initial); unique identifiers including Electronic Data Interchange Person Identifier (EDI... (EDI PI), other unique identifier (not Social Security Number), Federal Agency Smart Credential Number...

  1. Ten-years trends in renal replacement therapy for end-stage renal disease in mainland France: Lessons from the French Renal Epidemiology and Information Network (REIN) registry.

    Science.gov (United States)

    Vigneau, Cécile; Kolko, Anne; Stengel, Bénédicte; Jacquelinet, Christian; Landais, Paul; Rieu, Philippe; Bayat, Sahar; Couchoud, Cécile

    2017-06-01

    The incidence rate of renal replacement therapy (RRT) for end-stage renal disease (ESRD) is decreasing in several countries, but not in France. We studied the RRT trends in mainland France from 2005 to 2014 to understand the reasons for this discrepancy and determine the effects of ESRD management changes. Data were extracted from the French Renal Epidemiology and Information Network registry. Time trends of RRT incidence and prevalence rates, patients' clinical and treatment characteristics were analysed using the Joinpoint regression program and annual percentage changes. Survival within the first year of RRT was analysed using Kaplan-Meier estimates for 4 periods of time. The overall age- and gender-adjusted RRT incidence rate increased from 144 to 159 individuals per million inhabitants (pmi) (+0.8% per year; 95% CI: 0.5-1.2) and the prevalence from 903 to 1141 pmi (+2.4% per year; 95% CI: 2.2-2.7). This increase concerned exclusively ESRD associated with type 2 diabetes (+4.0%; 3.4-4.6) and mostly elderly men. Despite patient aging and increasing comorbidity burden and a persistent 30% rate of emergency dialysis start, the one-year survival rate slightly improved from 82.1% (81.4-82.8) to 83.8% (83.3-84.4). Pre-emptive wait listing for renal transplantation and the percentage of wait-listed patients within one year after dialysis start strongly increased (from 5.6% to 15.5% and from 29% to 39%, respectively). Kidney transplantation and survival significantly improved despite the heavier patient burden. However, the rise in type 2 diabetes-related ESRD and the stable high rate of emergency dialysis start remain major issues. Copyright © 2016 Association Société de néphrologie. Published by Elsevier Masson SAS. All rights reserved.

  2. Kirjanike Liit jätkab tööd Sinijärve käe all / Rein Veidemann

    Index Scriptorium Estoniae

    Veidemann, Rein, 1946-

    2007-01-01

    Kirjanikud valisid eilsel üldkogul järgmiseks kolmeks aastaks end juhtima luuletaja, publitsisti ja saate "OP" juhina tuntud Karl-Martin Sinijärve, kes vahetab sellel ametipostil välja senise esimehe Jan Kausi

  3. Aisopose lood / Aisopos ; tõlkinud ja kommenteerinud Kaarina Rein (96, 27, 119, 126, 143, 303) ja Janika Päll (72)

    Index Scriptorium Estoniae

    Aisopos, 6.saj. e.Kr.

    2006-01-01

    Sissejuhatus lk. 395, kommentaarid lk. 587-588. - Sisu: 96: Reetor Demades ; 27: Kalur, kes vett peksis ; 72: Härjakarjus ja Herakles : [luuletus] ; 119: Zeus ja rebane ; 126: Kohtumõistja Zeus ; 143: Pilliroog ja õlipuu ; 303: Kaks nahkpauna

  4. Tantsuime: märjaks nutetud Märt Agu saab 8000 uut sõpra / Märt Agu ; intervjueerinud Rein Sikk

    Index Scriptorium Estoniae

    Agu, Märt, 1980-

    2011-01-01

    11. Noorte tantsupeo "Maa ja ilm" üldjuht ja Tallinna Tantsuakadeemia kunstiline juht Märt Agu Tallinna lauluväljakul toimuvast tantsupeost, ülevaatustest, eesti meeste rahvatantsust, oma isast Mait Agust, tema tantsust "Põhjamaa", tantsuõpetaja elukutsest, eesti tantsust, Tallinna Tantsuakadeemiast. Andmeid Märt Agu loomingu kohta

  5. Acute chest pain: a purely clinical problem or a question for radiology; Der akute Thoraxschmerz, ein rein klinisches Problem oder radiologische Fragestellung

    Energy Technology Data Exchange (ETDEWEB)

    Loewe, C. [Medizinische Universitaet Wien, Klinische Abteilung fuer Kardiovaskulaere und Interventionelle Radiologie, Universitaetsklinik fuer Radiodiagnostik, Wien (Austria)

    2008-05-15

    Acute chest pain represents a very common clinical occurrence and at the same time poses a severe diagnostic dilemma. It can be due to an acute life-threatening event such as acute cardiac infarct, or a relatively harmless condition of pain and illness (e.g. vertebrogenic pain) under the main symptom category of acute chest pain. This often unclear symptomatic, behind which there can always be a life-threatening disease leads to an exaggerated grouping of patients into emergency cases and to an increased number of inpatients for observation. The diagnosis of acute coronary syndrome with no initial ECG changes typical for ischemia is especially problematic. The availability of modern multidetector computed tomography is becoming increasingly more important for radiologists in the diagnosis and clarification of acute chest pain. In this article the clinical difficulties and radiology options for the diagnosis of patients with acute chest pain will be presented and possible future algorithms for diagnosis will be discussed. (orig.) [German] Der akute Thoraxschmerz repraesentiert ein sehr haeufiges klinisches Beschwerdebild und gleichzeitig ein grosses diagnostisches Dilemma, koennen sich doch sowohl lebensbedrohliche akute Ereignisse (wie der akute Herzinfarkt) als auch mehr oder weniger harmlose Schmerzzustaende und Erkrankungen (wie vertebrogene Schmerzen) unter dem Leitsymptom 'akuter Thoraxschmerz' praesentieren. Diese oft nicht eindeutige Symptomatik, hinter der immer auch ein lebensbedrohliches Krankheitsbild stecken kann, fuehrt zu einer Uebertriagierung der Patienten in Notaufnahmen und zu einer grossen Anzahl an stationaeren 'Absicherungsaufnahmen'. Besonders die Diagnose eines akuten Koronarsyndroms (AKS) bei initial fehlenden ischaemietypischen EKG-Veraenderungen stellt eine spezielle Problematik dar. Durch die Verfuegbarkeit moderner ultraschneller Multidetektorcomputertomographen (MDCT) spielt der Radiologe in der Diagnostik und Abklaerung des akuten Thoraxschmerzes eine zunehmend wichtige Rolle. Im Folgenden sollen die klinischen Schwierigkeiten und radiologischen Moeglichkeiten der Diagnose von Patienten mit akutem Thoraxschmerz vorgestellt und moegliche zukuenftige Diagnosealgorithmen diskutiert werden. (orig.)

  6. Hydronéphrose géante sur rein ectopique pelvien révélée par un ...

    African Journals Online (AJOL)

    R. Yassine

    L'imagerie par résonnance magnétique (MRU magnetic resonance urography) est un excellent examen diagnostic, qui permet une évaluation précise tant morphologique que fonctionnelle [7]. Elle peut-être proposée en première intention; mais dans notre contexte, du fait de sa faible disponibilité, nous n'y recourons qu'en ...

  7. Adavere lihatööstus üritab kolmandat korda turul läbi lüüa / Rein Raudvere

    Index Scriptorium Estoniae

    Raudvere, Rein, 1955-

    2010-01-01

    Vahepeal tühjana seisnud Adavere lihatööstus töötleb taas liha. Jahimeestelt ulukeid kokku ostev ja liha töötlev Eesti-Soome ühisfirma Chef Foods OÜ on aastaga investeerinud 2,5 miljonit krooni. Põhitoodangu moodustab jahutatud ja külmutatud ulukiliha müük

  8. Eri teed tulevikku? : kolmekümneaastaste põlvkonna sissetulekuallikate struktuur ja selle muutused üleminekuperioodil postsotsialistlikes maades / Rein Murakas, Denis Trapido

    Index Scriptorium Estoniae

    Murakas, Rein, 1961-

    2004-01-01

    Järg nr. 8 lk. 1764-1791. Sissetulekuallikate stabiilsuse ja muutlikkuse probleemist Eestis, Sverdlovski ja Harkovi oblastis Ukrainas, Lätis, Moldovas, Valgevenes ja Tadzhikistanis aastatel 1992-1998. Kasutatud on rahvusvahelise longituudse uurimisprojekti "Põlvkonna eluteed" (PE) andmeid. Tabelid: PE riikide sotsiaal-demograafilised ja arengunäitajad siirdeperioodil; valimi maht regiooni ja PE küsitlusetapi lõikes; analüüsis kasutatud tunnused; PE respondentide kuusissetuleku parameetrid regioonide lõikes (sissetulek USA dollarites); sissetulekuallikate esinemissagedus respondentidel (%) ning keskmine sissetulekuallikate arv

  9. Existe-t-il une corrélation entre la taille tumorale au scanner et les caractéristiques anatomopathologiques du cancer du rein?

    Directory of Open Access Journals (Sweden)

    Y. Kharbach

    2015-03-01

    Conclusion: La présente étude réaffirme la précision de la TDM pour prédire la taille des tumeurs rénales mesurée à l’anatomopathologie, d’établir le renal score afin de mieux orienter le choix thérapeutique et de prédire les caractéristiques anatomopathologique du carcinome à cellules rénales.

  10. Lakewoodi Eesti Ühingu juubel kujunes suurpidustuseks : sajad endised lakewoodlased jagasid meenutusi "vanadest aegadest" / Airi Vaga ; fotod: Rein Linask, Maie Currie

    Index Scriptorium Estoniae

    Vaga, Airi, 1940-

    2006-01-01

    ülevaade 1. - 3. sept. kestnud pidustusest. Ettekande eesti kogukonna tekkest esitas Bill Karjane, LEÜ esimees Tõnu Vanderer kinkis juubelialbumi kõikidele endistele ühingu esimeestele, esinesid rahvuskultuuri selts "Kajakas" Pärnust, oli muusikat, ühislaule

  11. 78 FR 12322 - Agency Information Collection Activities: OMB Review; Comment Request

    Science.gov (United States)

    2013-02-22

    ... Interchange (EDI) Registration and Electronic Data Interchange (EDI) Enrollment Form; Use: The purpose of this... identification of Medicare providers/suppliers and authorization of requested Electronic Data Interface (EDI) functions. The EDI Enrollment and the Medicare Registration Forms are completed by Medicare providers...

  12. 75 FR 64737 - Automated Commercial Environment (ACE): Announcement of a National Customs Automation Program...

    Science.gov (United States)

    2010-10-20

    ... interchange (EDI) for submitting advance ocean and rail data and intends to amend the regulations as [email protected] . Please describe in the body of the e-mail any past EDI history with CBP. Written... (EDI). For ocean and rail carriers, the CBP-approved EDI is the Automated Manifest System (AMS). Ocean...

  13. Detecting Fraudulent Erasures at an Aggregate Level

    Science.gov (United States)

    Sinharay, Sandip

    2018-01-01

    Wollack, Cohen, and Eckerly suggested the "erasure detection index" (EDI) to detect fraudulent erasures for individual examinees. Wollack and Eckerly extended the EDI to detect fraudulent erasures at the group level. The EDI at the group level was found to be slightly conservative. This article suggests two modifications of the EDI for…

  14. 77 FR 70708 - VA Acquisition Regulation: Electronic Submission of Payment Requests

    Science.gov (United States)

    2012-11-27

    ... electronic data interchange (EDI) formats; or (3) another electronic form as prescribed by the contract....fsc.va.gov/einvoice.asp .); or, (b) A system that conforms to the X12 electronic data interchange (EDI... Institute (ANSI). The X12 EDI Web site ( http://www.x12.org ) includes additional information on EDI 810 and...

  15. 77 FR 44603 - Petition for Waiver of LG Electronics, Inc. From the Department of Energy Residential...

    Science.gov (United States)

    2012-07-30

    ....com . Of counsel: John A. Hodges, Wiley Rein LLP, 1776 K Street NW., Washington, DC 20006, Phone: 202....com . Of counsel: John A. Hodges, Wiley Rein LLP, 1776 K Street NW., Washington, DC 20006, Phone: 202...

  16. Disease: H00632 [KEGG MEDICUS

    Lifescience Database Archive (English)

    Full Text Available A, Shaag A, Einbinder T, Rein AJ, Elpeleg O ... TITLE ... A human laterality disorder associated with recessi...dson S, Rein AJ, Elpeleg O, Katsanis N ... TITLE ... A human laterality disorder caused by a homozygous delete

  17. Lapsesuu või PR-guru? / Airi Ilisson

    Index Scriptorium Estoniae

    Ilisson, Airi, 1980-

    2007-01-01

    Justiitsminister Rein Lang on autori hinnangul tuntud oma ootamatute arvamustega. CV. Vt. samas: Skandaal: Kuidas Lang politseid ja allilma seostades tormi tekitas. Kommenteerivad: Hans H. Luik, Hannes Astok, Laine Jänes, Rein Kilk ja Ulvi Kuusk

  18. Pöffihunt ulub juba 15. korda / Kaarel Kressa

    Index Scriptorium Estoniae

    Kressa, Kaarel, 1983-

    2011-01-01

    15. Pimedate Ööde Filmifestivali tutvustus. Põhiprogrammist, filmiturust, animafilmide festivalist Animated Dreams, laste- ja noortefilmide festivalist Just Film. Elutööpreemia saavad Rein Raamat, Rein Maran, Aleksandr Sokurov ja Fridrik Thor Fridriksson

  19. Poznámky k edičnímu zpracování rukopisných náčrtů v Kritické hybridní edici

    Czech Academy of Sciences Publication Activity Database

    Kosák, Michal; Flaišman, Jiří

    2017-01-01

    Roč. 2, č. 1 (2017), s. 38-43 ISSN 2453-8507 R&D Projects: GA MK(CZ) DG16P02H033 Keywords : Kritická hybridní edice (Critical Hybrid Editions) * editing * digital editions Subject RIV: AJ - Letters, Mass-media, Audiovision OBOR OECD: Specific literatures

  20. Behaviour at high pressure of Rb7NaGa8Si12O40·3H2O (a zeolite with EDI topology): a combined experimental-computational study

    Science.gov (United States)

    Gatta, G. D.; Tabacchi, G.; Fois, E.; Lee, Y.

    2016-03-01

    The high-pressure behaviour and the P-induced structural evolution of a synthetic zeolite Rb7NaGa8Si12O40·3H2O (with edingtonite-type structure) were investigated both by in situ synchrotron powder diffraction (with a diamond anvil cell and the methanol:ethanol:water = 16:3:1 mixture as pressure-transmitting fluid) up to 3.27 GPa and by ab initio first-principles computational modelling. No evidence of phase transition or penetration of P-fluid molecules was observed within the P-range investigated. The isothermal equation of state was determined; V 0 and K T0 refined with a second-order Birch-Murnaghan equation of state are V 0 = 1311.3(2) Å3 and K T0 = 29.8(7) GPa. The main deformation mechanism (at the atomic scale) in response to the applied pressure is represented by the cooperative rotation of the secondary building units (SBU) about their chain axis (i.e. [001]). The direct consequence of SBU anti-rotation on the zeolitic channels parallel to [001] is the increase in pore ellipticity with pressure, in response to the extension of the major axis and to the contraction of the minor axis of the elliptical channel parallel to [001]. The effect of the applied pressure on the bonding configuration of the extra-framework content is only secondary. A comparison between the P-induced main deformation mechanisms observed in Rb7NaGa8Si12O40·3H2O and those previously found in natural fibrous zeolites is made.

  1. Análise do conteúdo das provas da área de Ciências Contábeis: edições do Provão 2002/2003 e do ENADE de 2006

    Directory of Open Access Journals (Sweden)

    Nálbia de Araújo Santos

    Full Text Available Resumo: Este estudo tem dois objetivos. O primeiro é verificar se as provas da área de Ciências Contábeis do Provão de 2002/2003 e do ENADE/2006 incluíram os itens que representem adequadamente o domínio de conteúdo da área. O segundo objetivo é desenvolver uma análise crítica acerca destes testes de desempenho. Para tanto, empregou-se a técnica do grupo focal. Foram realizadas duas sessões de entrevistas junto a um grupo de especialistas da área, composto por docentes, estudantes de mestrado e doutorado. Os resultados evidenciam que na percepção dos participantes do grupo focal os exames podem ser considerados uma aproximação adequada do nível de conhecimento cognitivo da área, dado que os principais conteúdos foram avaliados pelos testes. Entretanto, na percepção dos participantes as questões dos testes não mensuraram adequadamente as habilidades, atitudes e comportamentos predeterminados pelas comissões de especialistas da área, nomeadas pelo Instituto Nacional de Estudos e Pesquisas Educacionais Anísio Teixeira (INEP. Os participantes apontaram que o baixo desempenho dos estudantes possa estar relacionado à reduzida motivação para resolver a prova.

  2. A single blind randomized controlled trial of cognitive behavioural therapy in a help-seeking population with an At Risk Mental State for psychosis: the Dutch Early Detection and Intervention Evaluation (EDIE-NL) trial

    NARCIS (Netherlands)

    Rietdijk, J.; Dragt, S.; Klaassen, R.; Ising, H; Nieman, D.; Wunderink, L.; Delespaul, P.; Cuijpers, P.; Linszen, D.; van der Gaag, M.

    2010-01-01

    Background: Psychotic disorders are a serious mental health problem. Intervention before the onset of psychosis might result in delaying the onset, reducing the impact or even preventing the first episode of psychosis. This study explores the effectiveness of cognitive behavioural therapy (CBT) in

  3. Tenkostěnný sendvičový systém z vysokohodnotného betonu vyztuženého čedičovými vlákny

    DEFF Research Database (Denmark)

    Hodicky, Kamil; Hulin, Thomas

    2013-01-01

    The paper presents a new thin-walled high performance concrete (HPC) sandwich panel system reinforced with basalt fiber-reinforced plastic (BFRP). System is characteristic with a high structural resistance, thermal resistance and environmental friendliness. The newly developed shear connecting...

  4. 75 FR 7520 - Certain Refrigerators and Components Thereof; Notice of the Commission's Final Determination of...

    Science.gov (United States)

    2010-02-19

    ... for this investigation may be viewed on the Commission's electronic docket (EDIS) at http://edis.usitc... infringe claim 8 of the `130 patent. The Commission also affirms the ALJ's finding that the accused French...

  5. 77 FR 48007 - Administrative Simplification: Adoption of Operating Rules for Health Care Electronic Funds...

    Science.gov (United States)

    2012-08-10

    ... electronic data interchange (EDI). Through the use of electronic funds transfers (EFT) for health care claim... care transactions results in higher use of EDI by health care providers.\\8\\ We expect usage of EFT and...

  6. 75 FR 60782 - Notice of Regulatory Waiver Requests Granted for the Second Quarter of Calendar Year 2010

    Science.gov (United States)

    2010-10-01

    ... Town of Jean Lafitte, LA received an Economic Development Initiative Special Purpose (EDI-SP) grant in... the December 8, 2004 appropriation for the EDI-SP grant, but prior to the completion of a Federal...

  7. 76 FR 37136 - Post-Summary Corrections to Entry Summaries Filed in ACE Pursuant to the ESAR IV Test

    Science.gov (United States)

    2011-06-24

    ... accelerated liquidation request indicator. C. Electronic Data Interface (EDI) Capability Trade participants.../ace_edi_messages/catair_main/abi_catair . Operational documentation addressing PSC may be found in the...

  8. 78 FR 23778 - Notice of Proposed Information Collection: Comment Request: Congressional Earmark Grants

    Science.gov (United States)

    2013-04-22

    ... categories: Economic Development Initiative--Special Project (EDI--SP) grantees and Neighborhood Initiative... generally fall into two categories: Economic Development Initiative--Special Project (EDI--SP) grantees and...

  9. 76 FR 23628 - Agency Information Collection Activities: Submission for the Office of Management and Budget (OMB...

    Science.gov (United States)

    2011-04-27

    ... Form 628, ``Financial EDI Authorization;'' NUREG/BR-0254, Payment Methods; and NRC Form 629... applicable: NRC Form 628, ``Financial EDI Authorization'' and NRC Form 629, ``Authorization for Payment by...

  10. 75 FR 37455 - Mortgage Insurance Termination; Application for Premium Refund or Distributive Share Payment

    Science.gov (United States)

    2010-06-29

    ... EDI and is used to directly pay eligible homeowners. This condition occurs when the form passes the... information is submitted via the Internet or EDI and is used to directly pay eligible homeowners. This...

  11. 75 FR 12777 - Notice of Regulatory Waiver Requests Granted for the Fourth Quarter of Calendar Year 2009

    Science.gov (United States)

    2010-03-17

    ... Development Initiative Special Project (EDI-SP) funds to implement the Pagedale Community Development... are currently vacant. Subsequent to the March 11, 2009 appropriation containing the EDI-SP, but prior...

  12. 77 FR 1555 - Administrative Simplification: Adoption of Standards for Health Care Electronic Funds Transfers...

    Science.gov (United States)

    2012-01-10

    ... interim final rule with comment period. For further information about electronic data interchange (EDI... the accounts payable/receivable system and electronic data interchange (EDI) systems, and the business...

  13. 77 FR 72788 - Reduction of Use of Social Security Numbers in the Department of Defense

    Science.gov (United States)

    2012-12-06

    ... recommended replacing the SSN with the DoD Electronic Data Interchange Personal Identifier (EDI- PI... Number, the common name for the EDI-PI, is identified by both policies as the primary alternative for the...

  14. 76 FR 72210 - Notice of Proposed Information Collection: Comment Request Congressional Earmark Grants

    Science.gov (United States)

    2011-11-22

    ...-Special Project (EDI-SP) and Neighborhood Initiative (NI) grants. DATES: Comments Due Date: January 23... generally fall into two categories: Economic Development Initiative-Special Project (EDI-SP) grantees and...

  15. 75 FR 80854 - Agency Information Collection Activities: Proposed Collection; Comment Request

    Science.gov (United States)

    2010-12-23

    ..., ``Financial EDI Authorization''; NUREG/BR-0254, Payment Methods; and NRC Form 629, ``Authorization for Payment... licensing fees, and inspection fees to the NRC. The NRC Form 628, ``Financial EDI Authorization,'' provides...

  16. ORF Alignment: NC_005090 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available ... succinogenes] ... Length = 120 ... Query: 6 ... FDPLRDLKEIERRFLTPFGEGGEGGAKSNLRGFAPVVNTREEEKGYFIEVD...LPGVQKEDI 65 ... FDPLRDLKEIERRFLTPFGEGGEGGAKSNLRGFAPVVNTREEEKGYFIEVDLPGVQK...EDI Sbjct: 1 ... FDPLRDLKEIERRFLTPFGEGGEGGAKSNLRGFAPVVNTREEEKGYFIEVDLPGVQKEDI 60 ...

  17. Electronic Data Interchange: from its Birth to its New Role in Logistics Information Systems

    OpenAIRE

    Janssens, Gerrit K.

    2011-01-01

    The introduction of internet applications in e-commerce made many adopters think that EDI would soon disappear. But the trend in logistics towards closer collaboration in supply chains made on the other hand the impact of EDI larger. A resultant of those forces will probably lead to a new type of EDI, which integrates with other technologies. Early studies on EDI were promoting its use because of savings in administrative work. But due to intra-corporation management model...

  18. Electronic data intercharge: from its birth to its new role in logistics information systems

    OpenAIRE

    JANSSENS, Gerrit

    2011-01-01

    The introduction of internet applications in e-commerce made many adopters think that EDI would soon disappear. But the trend in logistics towards closer collaboration in supply chains made on the other hand the impact of EDI larger. A resultant of those forces will probably lead to a new type of EDI, which integrates with other technologies. Early studies on EDI were promoting its use because of savings in administrative work. But due to intra-corporation management model changes, to...

  19. Electronic data interchange in the Canadian natural gas industry

    International Nuclear Information System (INIS)

    Sheinfield, J.

    1995-01-01

    The concept of electronic data interchange (EDI) in the gas industry was discussed. EDI as a champion of costumer service and as a powerful management tool was defined, and the process of electronic information transfer was explained. EDI was then placed in the context of the business process, and its benefits in providing efficient service and product improvement were enumerated. North American Gas EDI standards, and industry initiatives were explored in detail

  20. Le processus d’attribution rénale québécois défavorise-t-il les patients en attente d’une greffe combinée rein-pancréas?

    Directory of Open Access Journals (Sweden)

    Stenne, Raphaëlle

    2013-07-01

    Full Text Available In organ transplantation, there is a significant gap between the number of organs available and the number of patients waiting. To better distribute these organs, allocation rules are based on principles of equity and medical utility. In this case study, we will illustrate the difficulties associated with the implementation of an allocation system. The aim is to ensure a fair distribution of kidney transplants while also taking into account the principle of utility, and this for all patients, including those waiting for a combined kidney-pancreas transplant.