WorldWideScience

Sample records for edi kulderknup rein

  1. EDI.

    Science.gov (United States)

    Bluh, Pamela; And Others

    1996-01-01

    This special section on EDI (Electronic Data Interchange) in libraries includes eight articles that discuss experiences in libraries in the United Kingdom, EDI and the acquisitions process in Europe, a Canadian viewpoint, the ILS (Integrated Library Systems) vendor and EDI, public libraries, and EDI in the information services industry. (LRW)

  2. Length and elasticity of side reins affect rein tension at trot.

    Science.gov (United States)

    Clayton, Hilary M; Larson, Britt; Kaiser, LeeAnn J; Lavagnino, Michael

    2011-06-01

    This study investigated the horse's contribution to tension in the reins. The experimental hypotheses were that tension in side reins (1) increases biphasically in each trot stride, (2) changes inversely with rein length, and (3) changes with elasticity of the reins. Eight riding horses trotted in hand at consistent speed in a straight line wearing a bit and bridle and three types of side reins (inelastic, stiff elastic, compliant elastic) were evaluated in random order at long, neutral, and short lengths. Strain gauge transducers (240 Hz) measured minimal, maximal and mean rein tension, rate of loading and impulse. The effects of rein type and length were evaluated using ANOVA with Bonferroni post hoc tests. Rein tension oscillated in a regular pattern with a peak during each diagonal stance phase. Within each rein type, minimal, maximal and mean tensions were higher with shorter reins. At neutral or short lengths, minimal tension increased and maximal tension decreased with elasticity of the reins. Short, inelastic reins had the highest maximal tension and rate of loading. Since the tension variables respond differently to rein elasticity at different lengths, it is recommended that a set of variables representing different aspects of rein tension should be reported. Copyright © 2010 Elsevier Ltd. All rights reserved.

  3. Rein Veidemann elab vana kodulinna provintslusilminguid valusalt läbi / Rein Veidemann ; interv. Rein Hallik

    Index Scriptorium Estoniae

    Veidemann, Rein, 1946-

    2007-01-01

    Pärnust pärit kirjanik-poliitik Rein Veidemann meenutab lapsepõlve, kooliaega, laulvat revolutsiooni. Vt. samas: Rein Veidemann; Kuidas Veidemann okupandiks sattus; Veidemann tegi koos Ojakääruga Rääma kooli hümni; Rein Kask. Meenutus

  4. Rein Maran - Eesti looduse saadik maailmas / Rein Maran ; interv. Andres Laasik

    Index Scriptorium Estoniae

    Maran, Rein, 1931-

    2005-01-01

    Loodusfilmide meistril on esilinastunud uus film "Eesti kotkad". Lisad : "Rein Maran", "Digitaaltehnika muudab looduse elavamaks", "Eesti kõik kotkaliigid on kindlalt purgis", "Üliõpilased on Rein Maranile tänulikud"

  5. Le Valais et ses Reines

    Directory of Open Access Journals (Sweden)

    Alberto Campi

    2012-06-01

    Full Text Available Combat de ReinesAu premier plan (la corde dans la main, un propriétaire de vaches. Dans l'arène se trouve le rabatteur. Les Reines sur la photo sont des reines de première catégorie (ainsi que le montre le « I » sur leur cuisse .Dimanche 6 mai 2012, « Schakira », la vache numéro 42, a gagné, non sans polémique, le titre de Reine. Elle peut donc être considérée comme la Reine des Reines, titre qu’elle a gagné en se battant contre ses rivales dans différents combats, qui ont commencé pour Sch...

  6. Kapital annab Rein Kilgile loominguvabaduse / Nils Niitra

    Index Scriptorium Estoniae

    Niitra, Nils, 1975-

    2004-01-01

    Rein Kilgil on 28 ettevõtet, see võimaldab rakendada ettevõtluses loomingulisust. Vt. samas: Priit Rajalo. Rein Kilk hämmastab oskusega ajast kõik võtta. Lisa: Rein Kilgi enamusosalusega ettevõtted; Rein Kilk on tööandja ligi 1000 inimesele; Rein Kilgi enamusosaluseta ettevõtted; Rein Kilgiga on seotud veel

  7. EDI in the Public Sector

    DEFF Research Database (Denmark)

    Falch, Morten

    1998-01-01

    Introduction of EDI in the public administration is apriority for the Danish Government. EDI is both seen as a catlyst for development towards an information society ans as a means for more efficient use of scarce resources. EDI in the banking sector and the retail sector is reviewed, drivers...

  8. Effects on behaviour and rein tension on horses ridden with or without martingales and rein inserts.

    Science.gov (United States)

    Heleski, C R; McGreevy, P D; Kaiser, L J; Lavagnino, M; Tans, E; Bello, N; Clayton, H M

    2009-07-01

    Unsteady hand position can cause discomfort to the horse, potentially leading to conflict behaviours (CB) such as head tossing or tail lashing. Some instructors feel that martingales or elastic rein inserts can reduce discomfort caused by inexperienced and unsteady hands. Others consider these devices to be inappropriate 'crutches'. Four horses and nine riders were tested under three conditions in random order: plain reins, adjustable training martingales (TM), and elasticised rein inserts (RI). Rein-tension data (7s) and behavioural data (30s) were collected in each direction. Rein-tension data were collected via strain-gauge transducers. Behavioural data were assessed using an ethogram of defined behaviours. No differences in the number of CB were observed. Mean rein tension for TM was higher than that of RI or controls. Relative to the withers, the head was lower for horses ridden with martingales. Carefully fitted martingales may have a place in riding schools that teach novices.

  9. Uskumatult põnev maailm läbi Rein Marani kaamerasilma / Rein Maran ; üles kirjutanud Alo Lõhmus

    Index Scriptorium Estoniae

    Maran, Rein, 1931-

    2011-01-01

    Valitud katkendeid Alo Lõhmuse koostatud peatselt ilmuvast Rein Marani filmilooraamatust "Ööbikut ei tohi reeta". Rein Maran tähistab 13. septembril 80. sünnipäeva. Andmeid Rein Marani elukäigu kohta

  10. Projekt EDI / Priit Põdra

    Index Scriptorium Estoniae

    Põdra, Priit, 1963-

    2000-01-01

    Projekt EDI töötab välja programmisüsteemi rahvusvaheliste kaubavedude korraldamiseks, dokumentide vormistamiseks ja firmade arvutiprogrammide koostöö korraldamiseks. Projekti tutvustab AS-i EDI VEKTOR juhatuse esimees Priit Põdra

  11. Ability of EDI-2 and EDI-3 to correctly identify patients and subjects at risk for eating disorders.

    Science.gov (United States)

    Segura-García, Cristina; Aloi, Matteo; Rania, Marianna; Ciambrone, Paola; Palmieri, Antonella; Pugliese, Valentina; Ruiz Moruno, Antonio José; De Fazio, Pasquale

    2015-12-01

    The prevention and early recognition of eating disorders (EDs) are important topics in public health. This study aims to compare the efficacy of the Eating Disorder Inventory 2 (EDI-2) with the new version, EDI-3 in recognising patients and identifying subjects at risk for EDs. The EDI-2 and EDI-3 were administered to 92 female patients with ED and 265 females from a population at risk for EDs. Experienced psychiatrists in this field held blind interviews with participants by means of the SCID-I to determine the diagnosis. According to the cut-offs suggested by the authors, the EDI-3 correctly identified nearly all of the ED patients (99%), while the EDI-2 divulged less than half (48%). Both versions of the test showed comparable capability to identify participants at risk for EDs but the EDI-3 seemed slightly more reliable than the EDI-2. The EDI-2 remains a valid and very specific test. However, the new EDI-3 seems to be experimentally superior, because it typifies nearly all patients across the ED span, including those with Binge Eating Disorder and Eating Disorder Not Otherwise Specified. In addition, it appears to be more reliable. Copyright © 2015 Elsevier Ltd. All rights reserved.

  12. Kümnendikku riigikogust seovad peresidemed / Rein Sikk

    Index Scriptorium Estoniae

    Sikk, Rein, 1961-

    2007-01-01

    Vastvalitud riigikogus seovad kahtteist liiget perekondlikud sidemed. Vt. samas: Kas onupojapoliitika või juhus? Kommenteerivad: politoloog Rein Toomla, TÜ professor Marju Lauristin, TLÜ professor Rein Ruutsoo, emeriitprofessor Rein Taagepera

  13. Rein tension during canter

    NARCIS (Netherlands)

    Egenvall, Agneta; Eisersiö, Marie; Rhodin, Marie; van Weeren, P.R.; Roepstorff, Lars

    2015-01-01

    Riders generally use reins as a means for communication with the horse. At present, the signalling pattern is poorly understood. The aim of this study was to illustrate and analyse the rein tension patterns in a number of rider/horse combinations across a variety of exercises in the canter gait. Our

  14. Rein Pakk: olen Jumala trumm, aga sina oled ka / Rein Pakk ; intervjueerinud Tiiu Laks

    Index Scriptorium Estoniae

    Pakk, Rein, 1968-

    2010-01-01

    Intervjuu Rein Pakuga, kellel meeldib kirjutada artikleid ja näidendeid, laval ja filmis mängida, teha sisekujunduslahendusi ja karikatuure. 27. augustil esietendus Tallinna Draamateatris tema esimene lavastajatöö, teatri Vanemuine lavastus "Kaos". Andmeid Rein Paku elu ja loomingu kohta

  15. Rein Kilk : tahan saada Eesti suurimaks toiduainetöösturiks / Rein Kilk ; interv. Andres Reimer

    Index Scriptorium Estoniae

    Kilk, Rein, 1953-

    2007-01-01

    Suurärimees Rein Kilk vastab küsimustele, mis puudutavad Pere toiduainetetööstust ja teisi tema omanduses olevaid erinevatesse ärivaldkondadesse kuuluvaid ettevõtteid. Vt. samas: Rein Kilgiga seotud ettevõtted

  16. Rein Maran tähistab juubelit

    Index Scriptorium Estoniae

    2016-01-01

    85. sünnipäev on loodusdokumentalistil, kauaaegsel Tallinna Ülikooli filmiõppejõul ning filmiõppetooli juhil Rein Maranil. Balti filmi- ja meediakooli Supernova kinoülikool pühendab Rein Marani loomingule sügissemestri esimese filmiõhtu. Tallinna Ülikooli Nova maja 4. korruse kinokoridoris avatakse Rein Marani loomingule pühendatud näitus "Loodusfilmi tuhat nägu"

  17. Introduction of EDI in the public sector

    DEFF Research Database (Denmark)

    Falch, Morten

    1997-01-01

    Reviews the status of EDI in the sectors of health, public transport and taxation and public administration. The impact of this on the diffusion of EDI in other sectors is analysed.......Reviews the status of EDI in the sectors of health, public transport and taxation and public administration. The impact of this on the diffusion of EDI in other sectors is analysed....

  18. Rein Einasto : Eestis valitud ameerikalik valitsemise tee viib meid katastroofini / Rein Einasto ; interv. Kristi Leppik

    Index Scriptorium Estoniae

    Einasto, Rein, 1934-

    2008-01-01

    Kodanikuühiskonna edendamisest Eestis. Aasta missiooniinimese kandidaadiks esitatud professor Rein Einasto arvates päästaks meid avar mõtlemine, et viia inimkond tervikuna teisele teele. Praegune vaba turumajandus on pillamisele, raiskamisele ja kulutamisele üles ehitatud ummiktee. Lisa: Rein Einasto

  19. Eesti Panga vaheehitus Tallinnas / Toomas Rein

    Index Scriptorium Estoniae

    Rein, Toomas, 1940-

    1999-01-01

    Arhitektuur, ruumikujundus, tehnilisi näitajaid. Kitsa vaheehituse Estonia pst. 11/13 projekteeris OÜ Arhitektuuribüroo Toomas Rein, arhitekt Toomas Rein. Sisekujundaja AS Stuudio Gadis, sisearhitekt Taevo Gans

  20. Internal control in an EDI environment.

    OpenAIRE

    Bae, Dal Hyeoung

    1991-01-01

    Approved for public release; distribution in unlimited. Electronic Data Interchange(EDI) is the electronic transmission of standard business documents in machine-readable format between parent companies and respective trading partners. As the use of EDI has grown, there have been the associated risks due to an uncontrolled environment. Accordingly, the necessity for effective internal controls in an EDI environment is on the rise. This thesis evaluates and analyzes the feasi...

  1. Rein Pill tegi fantastilise sõidu / Rein Pill

    Index Scriptorium Estoniae

    Pill, Rein

    2008-01-01

    Septembris Chernjahovskis peetud CS14 taseme rahvusvahelistel ratsutamise takistussõiduvõistlustel tegi Rein Pill ajalugu, võites hobusel A Big Boy võistluste Grand Prix 160 cm kõrgusel parkuuril ja täites Euroopa meistrivõistluste kvalifikatsiooninormi

  2. Rein Raamat kunstnikest / Andri Ksenofontov

    Index Scriptorium Estoniae

    Ksenofontov, Andri, 1962-

    2009-01-01

    Dokumentaalfilm skulptor Jaan Varesest "Kahe peaga Jaanus", stsenarist ja režissöör Rein Raamat (Raamat-Film, 2009). Esilinastus 10. septembril Tallinna Kinomajas. Dokumentaalfilm "Siima Škopi muinasjutuline maailm", käsikiri Juta Kivimäe, režissöör Rein Raamat (Raamat-Film, 2009). Esilinastus 21. septembril Kumu auditooriumis

  3. Rein Ratase allkiri paneb rattad käima ; kommenteerinud Rein Ratas, Neeme Reinap, Vilmar Rei...[jt.

    Index Scriptorium Estoniae

    Jakobson, Kadri, 1970-

    2010-01-01

    Riigikogu keskkonnakomisjoni liige Rein Ratas surub läbi firma EcoPro, mille üks omanik on Ratase hea tuttav, arendust Saaremaal Ruhve poolsaarel, mis asub kaitsealal ja ehituskeeluvööndis. Rein Ratas on tuludeklaratsioonis jätnud märkimata firmast Adepte Ekspert saadava tulu

  4. Luulelõunale tuleb Rein Veidemann / Kaja Tammar

    Index Scriptorium Estoniae

    Tammar, Kaja

    2017-01-01

    Rapla Keskraamatukogu suvisel luulelõunal esineb eesti kirjandusteadlane, ajakirjanik, kirjanik ja õppejõud, Tallinna Ülikooli humanitaarteaduste instituudi emeriitprofessor Rein Veidemann. Rein Veidemanni kultuurikriitikast ja ilmunud loomingust

  5. Rein Randver : keskkonnaminister olen nüüd mina, mitte Villu Reiljan / Rein Randver ; interv. Rasmus Kagge

    Index Scriptorium Estoniae

    Randver, Rein, 1956-

    2006-01-01

    Ilmunud ka: Postimees : na russkom jazõke 19. okt. lk. 4. Uus keskkonnaminister Rein Randver räägib talle varem esitatud ministriametite pakkumistest, oma tööplaanidest, avaldab seisukoha looduskaitsealuste maade vahetamise kohta. Lisa: Rein Randveri CV; Viis esimest tööd

  6. 1 küsimus / Rein Raud

    Index Scriptorium Estoniae

    Raud, Rein

    2007-01-01

    Hiljuti andis kirjastus Kegan Paul välja Rein Raua koostatud kogumiku "Japan and Asian Modernities" (Jaapan ja Aasia modernsused), mis koondab teadusartiklid maailma tuntud Aasia uurijatelt Jaapanist, USAst, Prantsusmaalt, Hongkongist jne, sealhulgas on ka Rein Raua uurimus. Mis võiks olla kogumiku tähendus Eesti jaoks?

  7. Rein Veidemann: vabadus on kohustus / Tuuli Jõesaar

    Index Scriptorium Estoniae

    Jõesaar, Tuuli

    2014-01-01

    Balti keti 25. aastapäeva puhul vestlus Eesti kirjanduse ja kultuuriloo professori Rein Veidemanniga vabadusest ning taasavaldatud luuletusest "Palve", mille ta kirjutas Eesti laulva revolutsiooni ajal. Artikkel sisaldab Rein Veidemanni luuletust "Palve"

  8. Isepäine modernist Toomas Rein / Toomas Rein ; intervjueerinud Mait Väljas ja Reet Varblane

    Index Scriptorium Estoniae

    Rein, Toomas, 1940-

    2010-01-01

    23. aprillil avatakse Eesti Arhitektuurimuuseumis arhitekt Toomas Reinu 70. sünnipäevale pühendatud näitus. Kataloogi ja näituse on koostanud Toomas Rein ja Mait Väljas, kujundanud Tiit Jürna. Toomas Rein endast, oma loomingust, eeskujudest, näitusest, nõukogude perioodi hoonete olukorrast, viimase aja töödest, koostööst teiste arhitektidega, teostamata projektidest

  9. Rein tension acceptance in young horses in a voluntary test situation.

    Science.gov (United States)

    Christensen, J W; Zharkikh, T L; Antoine, A; Malmkvist, J

    2011-03-01

    During riding, horses are frequently exposed to pressure from the rider, e.g. through the bit and reins, but few studies have investigated at which point rein tension becomes uncomfortable for the horse. To investigate how much rein tension young inexperienced horses are willing to accept in order to obtain a food reward; whether the tension acceptance changes during 3 consecutive test days; and whether rein tension correlates with the expression of conflict behaviour and heart rate. Pressure-naïve horses will apply only little rein tension in the first voluntary trial, but their acceptance will gradually increase. High levels of rein tension will lead to expression of conflict behaviour and increases in heart rate. Fifteen 2-year-old, bridle-naïve mares were encouraged to stretch their head forward (across a 0.95 m high metal bar) to obtain a food reward in a voluntary test situation. On each test day, each horse was exposed to 2 control sessions (loose reins), an intermediate and a short rein session (1 min/session). Rein tension, heart rate and behaviour were recorded. The horses applied significantly more tension on the first day (mean rein tension: 10.2 N), compared to the second and third test day (Day 2: 6.0 and Day 3: 5.7 N). The horses showed significantly more conflict behaviour in the short rein treatment. There was no treatment effect on heart rate. The horses applied the highest rein tension on the first day, and apparently learned to avoid the tension, rather than habituate to it. Rein tension correlated with expression of conflict behaviour, indicating that the horses found the tension aversive. Further studies should focus on the correlation between rein tension and conflict behaviour in ridden horses. © 2010 EVJ Ltd.

  10. Efficient Processing Of Voluminous EDI Documents

    NARCIS (Netherlands)

    Risse, T.; Wombacher, Andreas; Aberer, K.

    Business data is frequently exchanged between heterogeneous information systems using standard EDI formats like EDIFACT, X12 and in the future also XML/EDI. For inhouse use, data represented in these formats must be converted to inhouse data formats by message converters. With the growing usage of

  11. Ujumismedalite peensepistaja Rein Haljand sätib detailid paika / Jaan Martinson

    Index Scriptorium Estoniae

    Martinson, Jaan, 1960-

    2015-01-01

    Professor Rein Haljandi hoolealused võitsid ujumise MM-il Kaasanis hulga medaleid. Kinesioloogiaprofessorit, ujumistehnika spetsialisti Rein Haljandit seob Rootsi koondisega leping Rio de Janeiro olümpiamängude lõpuni. Rein Haljand jagab selgitusi ujumistehnika ja Rootsi ujumise eduloo kohta

  12. EDIS Investigation Filing Information

    Data.gov (United States)

    US International Trade Commission — This dataset contains investigation, document and attachment metadata from the USITC's Electronic Document Information System (EDIS), as well as access to attached...

  13. Rein tension acceptance in young horses in a voluntary test situation

    DEFF Research Database (Denmark)

    Christensen, Janne Winther; zharkikh, T.L.; Antoine, A.

    2011-01-01

    Reasons for performing the study: During riding, horses are frequently exposed to pressure from the rider, e.g. through the bit and reins, but few studies have investigated at which point rein tension becomes uncomfortable for the horse. Objectives: To investigate how much rein tension young...... inexperienced horses are willing to accept in order to obtain a food reward; whether the tension acceptance changes during 3 consecutive test days; and whether rein tension correlates with the expression of conflict behaviour and heart rate. Hypotheses: Pressure-naïve horses will apply only little rein tension...... in the first voluntary trial, but their acceptance will gradually increase. High levels of rein tension will lead to expression of conflict behaviour and increases in heart rate. Methods: Fifteen 2-year-old, bridle-naïve mares were encouraged to stretch their head forward (across a 0.95 m high metal bar...

  14. Rein Kilk ei loobu Pärnust / Rein Kilk ; interv. Tiiu Leis

    Index Scriptorium Estoniae

    Kilk, Rein, 1953-

    2007-01-01

    Ilmunud ka: Linnaleht : Tartu, 12. okt. 2007, lk. 7-8; Linnaleht : Pärnu, 12. okt. 2007, lk. 7-8. Suurärimees Rein Kilk vastab küsimustele vanade majade taastamisest, plaanidest Pärnus, suhtumisest heidikutesse. Kommenteerivad Peeter Raudsepp ja Elmar Lepp

  15. EDI-The Future.

    Science.gov (United States)

    Rusk, Harriet J.

    1991-01-01

    Considered are standardization efforts of the American National Standards Institute's Accredited Standards Committee X12 concerned with electronic data interchange (EDI). These efforts will effect dentistry first in the transmission of academic records, and then in communications between dental offices and businesses, including major insurance…

  16. Development of the Electron Drift Instrument (EDI) for Cluster

    Science.gov (United States)

    Quinn, Jack; Christensen, John L. (Technical Monitor)

    2001-01-01

    The Electron Drift Instrument (EDI) is a new technique for measuring electric fields in space by detecting the effect on weak beams of test electrons. This U.S. portions of the technique, flight hardware, and flight software were developed for the Cluster mission under this contract. Dr. Goetz Paschmann of the Max Planck Institute in Garching, Germany, was the Principle Investigator for Cluster EDI. Hardware for Cluster was developed in the U.S. at the University of New Hampshire, Lockheed Palo Alto Research Laboratory, and University of California, San Diego. The Cluster satellites carrying the original EDI instruments were lost in the catastrophic launch failure of first flight of the Arianne-V rocket in 1996. Following that loss, NASA and ESA approved a rebuild of the Cluster mission, for which all four satellites were successfully launched in the Summer of 2000. Limited operations of EDI were also obtained on the Equator-S satellite, which was launched in December, 1997. A satellite failure caused a loss of the Equator-S mission after only 5 months, but these operations were extremely valuable in learning about the characteristics and operations of the complex EDI instrument. The Cluster mission, satellites, and instruments underwent an extensive on-orbit commissioning phase in the Fall of 2000, carrying over through January 2001. During this period all elements of the instruments were checked and careful measurements of inter-experiments interferences were made. EDI is currently working exceptionally well in orbit. Initial results verify that all aspects of the instrument are working as planned, and returning highly valuable scientific information. The first two papers describing EDI on-orbit results have been submitted for publication in April, 2001. The principles of the EDI technique, and its implementation on Cluster are described in two papers by Paschmann et al., attached as Appendices A and B. The EDI presentation at the formal Cluster Commissioning

  17. Stride-related rein tension patterns in walk and trot in the ridden horse.

    Science.gov (United States)

    Egenvall, Agneta; Roepstorff, Lars; Eisersiö, Marie; Rhodin, Marie; van Weeren, René

    2015-12-30

    The use of tack (equipment such as saddles and reins) and especially of bits because of rein tension resulting in pressure in the mouth is questioned because of welfare concerns. We hypothesised that rein tension patterns in walk and trot reflect general gait kinematics, but are also determined by individual horse and rider effects. Six professional riders rode three familiar horses in walk and trot. Horses were equipped with rein tension meters logged by inertial measurement unit technique. Left and right rein tension data were synchronized with the gait. Stride split data (0-100 %) were analysed using mixed models technique to elucidate the left/right rein and stride percentage interaction, in relation to the exercises performed. In walk, rein tension was highest at hindlimb stance. Rein tension was highest in the suspension phase at trot, and lowest during the stance phase. In rising trot there was a significant difference between the two midstance phases, but not in sitting trot. When turning in trot there was a significant statistical association with the gait pattern with the tension being highest in the inside rein when the horse was on the outer fore-inner hindlimb diagonal. Substantial between-rider variation was demonstrated in walk and trot and between-horse variation in walk. Biphasic rein tensions patterns during the stride were found mainly in trot.

  18. Rein Raamat tiris eestlased joonisfilmi juurde / Rein Raamat ; interv. Tiit Tuumalu

    Index Scriptorium Estoniae

    Raamat, Rein, 1931-

    2006-01-01

    Kunstnil, anima- ja dokumentaalfilmirežissöör tähistab 75-ndat sünnipäeva. 20. märtsil Kinomajas on autoriõhtu filmidega "Rein Raamat animatsiooni maailmas" ja "Kursi koolkond". Lisatud R. Raamatu loometee lühiandmed ning Priit Pärna kommentaar

  19. Business Process Redesign Using EDI: the BHP steel experience

    Directory of Open Access Journals (Sweden)

    Paula Swatman

    1994-05-01

    Full Text Available EDI should not be seen as a competitive weapon - it does not offer a sustainable competitive advantage to its users as did the earlier inter-organisational systems (such as the various airline reservation systems. Instead EDI provides a standardised infrastructure upon which an adopting organisation can reengineer its business processes and thus confers a long-term, strategic and comparative advantage upon such an adopter. The potential for sustained competitive advantage to be derived from EDI arises from its integration with the organisational structure of its implementor, depending upon the implementing organisation's ability to redesign its business processes appropriately. This paper examines the case of (arguably the most sophisticated EDI-using company in Australia, BHP Steel, demonstrating the advantages obtainable by an organisation using EDI as a foundation for its reengineered organisational structure and business processes and concludes that: • there are real benefits to be obtained from an inter organisational electronic trading strategy founded on EDI as the enabling mechanism - benefits which are considerably more extensive than EDI's comparatively simple technical nature would appear to offer; • organisational gateways utilising an Application Generic approach to system integration and isolating the communications issue by insisting on the use of international data communications standards do offer a realistic and successful solution to the problem of internal and external trade for large and sophisticated organisations; • the majority of these achievements would have been either unlikely or totally impossible without BHP Steel's commitment to organisation-wide Business Process Redesign.

  20. Rein Taagepera : "Euroopa peab muutuma föderatsiooniks" / Rein Taagepera ; interv. Teet Korsten

    Index Scriptorium Estoniae

    Taagepera, Rein, 1933-

    2008-01-01

    Ilmunud ka: Severnoje Poberezhje : Subbota 16. aug. lk. 5. Eesti/USA politoloog muutustest Eestis, Uppsala ülikooli Skytte auhinnast, konverentsist "Diasporaa roll Eesti iseseisvuse taastamisel?". Arvamust avaldab parlamendiliige Peeter Tulviste. Lisa: Rein Taagepera CV

  1. Rein Lang : liitriiki ei tule / Rein Lang ; interv. Sten Hansson

    Index Scriptorium Estoniae

    Lang, Rein, 1957-

    2003-01-01

    Ilmunud ka: Severnoje Poberezhje 16. juuli lk. 2, Lääne Elu 17. juuli lk. 4, Meie Maa 17. juuli lk. 2, Koit 17. juuli lk. 6, Vooremaa 17. juuli lk. 2, Hiiu Leht 22. juuli lk. 2, Nädaline 2. august lk. 4. Intervjuu Euroopa Liidu tulevikukonvendis osalenud Rein Lang'iga EL-i põhiseaduse projektist

  2. Electronic Data Interchange (EDI) for Libraries and Publishers.

    Science.gov (United States)

    Santosuosso, Joe

    1992-01-01

    Defines electronic data interchange (EDI) as the exchange of data between computer systems without human intervention or interpretation. Standards are discussed; and the implementation of EDI in libraries and the serials publishing community in the areas of orders and acquisitions, claims, and invoice processing is described. (LRW)

  3. Rein Aidma: "Ma ei lähe riigikogusse tukkuma" / Rein Aidma ; interv. Erik Gamzejev

    Index Scriptorium Estoniae

    Aidma, Rein, 1950-

    2003-01-01

    Ilmunud ka: Severnoje Poberezhje : Subbota 15. märts lk. 3. Riigikokku valitud Ida-Viru maavanem Rein Aidma astumisest Reformierakonda, möödunud valimiskampaaniast, Ida-Viru arengut pidurdavatest teguritest

  4. The ISO Edi Conceptual Model Activity and Its Relationship to OSI.

    Science.gov (United States)

    Fincher, Judith A.

    1990-01-01

    The edi conceptual model is being developed to define common structures, services, and processes that syntax-specific standards like X12 and EDIFACT could adopt. Open Systems Interconnection (OSI) is of interest to edi because of its potential to help enable global interoperability across Electronic Data Interchange (EDI) functional groups. A…

  5. Binary trading relations and the limits of EDI standards

    DEFF Research Database (Denmark)

    Damsgaard, Jan; Truex, D.

    2000-01-01

    This paper provides a critical examination of electronic data interchange (EDI) standards and their application in different types of trading relationships. It argues that EDI standards are not directly comparable to more stable sets of technical standards in that they are dynamically tested...... and negotiated in use with each trading exchange. It takes the position that EDI standards are an emergent language form and must mean different things at the institutional and local levels. Using the lens of emergent linguistic analysis it shows how the institutional and local levels must always be distinct...... and yet can coexist. EDI standards can never represent the creation of an 'Esperanto of institutional communication'. Instead we believe that standards must be developed such that they support and accommodate general basic grammatical forms that can be customised to individual needs. The analysis...

  6. Cinco translações, 10 edições

    OpenAIRE

    Ângela Tonietto; Bruno Telles; Charles A. Andrade; Claudemir R. Dias Filho; Juliano A. Gomes

    2016-01-01

    Após cinco translações em torno da estrela do Sistema Solar e nove edições publicadas, a Revista Brasileira de Criminalística entrega hoje o terceiro número do seu quinto volume, completando assim cinco anos ininterruptos de publicações com sua décima edição.

  7. Stride-related rein tension patterns in walk and trot in the ridden horse

    NARCIS (Netherlands)

    Egenvall, Agneta; Roepstorff, Lars; Eisersiö, Marie; Rhodin, Marie; van Weeren, René

    2015-01-01

    BACKGROUND: The use of tack (equipment such as saddles and reins) and especially of bits because of rein tension resulting in pressure in the mouth is questioned because of welfare concerns. We hypothesised that rein tension patterns in walk and trot reflect general gait kinematics, but are also

  8. Kas võlad tapavad Kilgi lambakarja? / Rein Raudvere

    Index Scriptorium Estoniae

    Raudvere, Rein, 1955-

    2008-01-01

    Ärimees Rein Kilgile kuuluva lambakasvatusfirma Nurmus Grupp OÜ 4000pealist lambakarja ootab katastroof. Selgitusi lambakasvatusfirma olukorra kohta jagavad Palamuse vallavolikogu liige Enn Kivi, Nurmus Grupi OÜ tegevjuht Hillar Kalda, Jõgevamaa veterinaarkeskuse juhataja Harles Kaup ning juhataja asetäitja Arbo Kepp. Vt. samas: Firma võlausaldajatel on mõõt täis saamas; intervjuud ärimees Rein Kilgiga: Sügiseks saavad lambafirma võlad likvideeritud. Lisa: Loomad võlgade katteks tapamajja

  9. Langi retseptid majanduse restartimiseks / Rein Lang

    Index Scriptorium Estoniae

    Lang, Rein, 1957-

    2008-01-01

    Justiitsminister Rein Lang selgitab Maksumaksjale majanduse taaskäivitamise ideid, millest oli juttu 15. nov. 2008. aasta Reformierakonna majanduskonverentsil Restart ja Äripäev Onlines (15.11.2008)

  10. EDI and the Technical Communicator.

    Science.gov (United States)

    Eiler, Mary Ann

    1994-01-01

    Assesses the role of technical communicators in electronic data interchange (EDI). Argues that, as experts in information design, human factors, instructional theory, and professional writing, technical communicators should be advocates of standard documentation protocols and should rethink the traditional concepts of "document" to…

  11. Rein Veidemanni romaan vene keeles

    Index Scriptorium Estoniae

    2015-01-01

    Kirjastus KPD on välja andnud vene keeles Rein Veidemanni 2012. aastal ilmunud romaani "Tund enne igavikku". Marina Tervoneni tõlkes ilmunud teos kannab vene keeles pealkirja "Вечный университет"

  12. Muuseumisõbra tiitli sai Rein Veidemann

    Index Scriptorium Estoniae

    2017-01-01

    Muuseumiühing andis tänavuse muuseumisõbra tiitli ajakirjanikule ja kirjandusteadlasele Rein Veidemannile kirjanike muuseumide kaitseks meedias välja astumise ning Vilde ja Tammsaare Sõprade Seltsi loomisele kaasa aitamise eest

  13. Pro EDI in BizTalk Server 2006 R2 electronic document interchange solutions

    CERN Document Server

    Beckner, Mark

    2008-01-01

    As business becomes more dependent on working with partners, suppliers, and other organizations in a streamlined way, Electronic Data Interchange (EDI) is one of the next big waves in connected systems. Microsoft BizTalk Server 2006 R2 offers an efficient, integrated way to deploy EDI solutions, and with the help of this book, readers will see how EDI can be used in their business and how best to get it set up with BizTalk. This book offers insights into the brand-new Biztalk 2006 R2--based EDI functionality, including the far greater flexibility in handling interchange. It gives advice coveri

  14. The new Exponential Directional Iterative (EDI) 3-D Sn scheme for parallel adaptive differencing

    International Nuclear Information System (INIS)

    Sjoden, G.E.

    2005-01-01

    The new Exponential Directional Iterative (EDI) discrete ordinates (Sn) scheme for 3-D Cartesian Coordinates is presented. The EDI scheme is a logical extension of the positive, efficient Exponential Directional Weighted (EDW) Sn scheme currently used as the third level of the adaptive spatial differencing algorithm in the PENTRAN parallel discrete ordinates solver. Here, the derivation and advantages of the EDI scheme are presented; EDI uses EDW-rendered exponential coefficients as initial starting values to begin a fixed point iteration of the exponential coefficients. One issue that required evaluation was an iterative cutoff criterion to prevent the application of an unstable fixed point iteration; although this was needed in some cases, it was readily treated with a default to EDW. Iterative refinement of the exponential coefficients in EDI typically converged in fewer than four fixed point iterations. Moreover, EDI yielded more accurate angular fluxes compared to the other schemes tested, particularly in streaming conditions. Overall, it was found that the EDI scheme was up to an order of magnitude more accurate than the EDW scheme on a given mesh interval in streaming cases, and is potentially a good candidate as a fourth-level differencing scheme in the PENTRAN adaptive differencing sequence. The 3-D Cartesian computational cost of EDI was only about 20% more than the EDW scheme, and about 40% more than Diamond Zero (DZ). More evaluation and testing are required to determine suitable upgrade metrics for EDI to be fully integrated into the current adaptive spatial differencing sequence in PENTRAN. (author)

  15. Rein Ruutsoo: Vaenlase tegemine on ikka veel mõnede poliitikute ainus poliitika / Rein Ruutsoo

    Index Scriptorium Estoniae

    Ruutsoo, Rein, 1947-

    2007-01-01

    Nõukogude Eestist saladokumente Läände toimetanud Rein Ruutsoo kommenteerib riiklike teenetemärkide jagamist endistele kommunistidele president Arnold Rüütli ja president Toomas Hendrik Ilvese ajal. T.H. Ilves on arvanud autasustatavate hulka Eestimaa Kommunistliku Partei poolt juhitud ideoloogiatöö võitlejad Eesti Raadios Aarne Rannamäe ja Peeter Kaldre

  16. Avalik pöördumine seoses Kihnu rahvamajaga / Toomas Rein, Leonhard Lapin

    Index Scriptorium Estoniae

    Rein, Toomas, 1940-

    2001-01-01

    Eskiisprojektist, Arhitektuuribüroo Toomas Rein poolt 31. V 2000. a. Kihnu vallavalitsusele üle antud tehnilisest projektist (arhitektid T. Rein, L. Lapin, sisearhitekt Helle Gans), ehitaja riigihankekonkursist, ehitusfirma FKSM tööjooniste ja valmishoone erinevusest tehnilisest projektist, autoriõigusest jm

  17. Rein Raua kuraatoridebüüt

    Index Scriptorium Estoniae

    2001-01-01

    Hausi galeriis Rein Raua kureeritud rahvusvaheline kunstinäitus "KevadSuviSügisTalv. Murdumispunkt". Esinevad Eve Kask, Peeter Laurits, Dainius Lickevicius, Rehka Menon, Mall Nukke, Herkki Merila, Jorma Puranen, Rosita Raud, Ene-Liis Semper, Liina Siib, S. ja P. Stanikas

  18. Ministeerium kangutab Rein Porrot ametist / Mirko Ojakivi

    Index Scriptorium Estoniae

    Ojakivi, Mirko

    2006-01-01

    Ametkondlik juurdlus lennuametis tuvastas, et lennuamet pole rikkunud lennundusseadust. Samas on majandus- ja kommunikatsiooniministeeriumis pooleli lennuameti juhi asetäitja Rein Porro tegevuse suhtes algatatud ametkondlik juurdlus. Lisa: Porro - üks kogenumaid piloote

  19. Mõõtmine ja intelligentsus / Rein Raud

    Index Scriptorium Estoniae

    Raud, Rein, 1961-

    2007-01-01

    Geeniteadlane James Watson leidis, et Aafrikas elavate inimeste intelligentsustase ei ole võrdne valge nahavärviga inimeste omaga. TLÜ professor Rein Raud leiab, et selle väite peamine nõrkus on eeldus, et on vaid üks ja universaalne mõõtmisparameeter

  20. Ilmus Rein Neggo "Vastutuuli. I" / Hannes Oja

    Index Scriptorium Estoniae

    Oja, Hannes

    1999-01-01

    rets. rmt.: Vastutuuli. I : valimik EELK Los Angelese koguduse ajakirjas "Vastutuuli" (1950-1965) avaldatud kirjasõna / koostanud ja toimetanud Rein Neggo. Los Angeles : Eesti Evangeelse Luterliku Kiriku Los Angelese kogudus, 1999. 199 lk. : ill.

  1. Alternatives to conventional evaluation of rideability in horse performance tests: suitability of rein tension and behavioural parameters.

    Science.gov (United States)

    König von Borstel, Uta; Glißman, Chantal

    2014-01-01

    Rideability, i.e. the ease and comfort with which a horse can be ridden, is considered to be one of the most important traits in riding horses. However, at present rideability is evaluated rather subjectively in breeding horse performance tests. The aim of the present study was to evaluate the role horse behaviour as well as degree and quality of rein tension might play in judges' evaluation of horses' rideability. Mares (n=33) and stallions (n=13) from two different mare- and one stallion-testing station were observed twice during their performance test dressage training. During these rides, rein tension was measured continuously, and frequency of behaviour patterns such as head-tossing, tail swishing, and snorting was recorded. Rein tension parameters showed reasonable repeatabilities within horse-rider pairs (e.g. mean rein tension: r(2)=0.61 ± 0.11; variance of rein tension: r(2)=0.52 ± 0.14). Regression analysis revealed that a larger proportion of variance in rideability scores could be explained by maximum (17%), mean (16%) and variance (15%) of rein tension compared to horses' or riders' behavioural parameters (tail-swishing: 5% and rider's use of hands: 5%, respectively). According to mixed model analysis, rideability scores dropped (all Prein tension (e.g. -0.37 ± 0.14 scores per additional 10 Newton in mean tension). However, mean rein tension differed between testing stations (Prein tension is either directly or indirectly an important factor for judges to derive rideability scores. Given the importance of rein tension parameters to both rider comfort and horse welfare, potentially, measurements of rein tension along with behaviour observations assessing the quality of rein contact (e.g. distinguishing a light contact from attempts to evade contact) might be used to make the assessment of rideability more impartial.

  2. Rein Taagepera lahkub Res Publicast / Kristjan Roos

    Index Scriptorium Estoniae

    Roos, Kristjan, 1978-

    2005-01-01

    Res Publica asutaja Rein Taagepera, Jaan Einasto, Mare Taagepera ja Lauri Aaspõllu lahkuvad Res Publicast, kuna erakond on nende väitel muutunud paremtsentrist paremäärmuslikuks. Vt. samas: Erakonnad hoiavad uksed valla

  3. [A German version of the Eating Disorder Inventory EDI-2].

    Science.gov (United States)

    Thiel, A; Jacobi, C; Horstmann, S; Paul, T; Nutzinger, D O; Schüssler, G

    1997-01-01

    The paper presents a German version of the second revised edition of the Eating Disorder Inventory EDI-2 (Garner 1991). The EDI-2 is a self-rating inventory (self-report measure) with 91 items and 11 subscales designed for the assessment of attitudinal and behavioural dimensions relevant to anorexia and bulimia nervosa. It consists of the eight original subscales: drive for thinness, bulimia, body dissatisfaction, ineffectiveness, perfectionism, interpersonal distrust, interoception and maturity fears, and the three new subscales: asceticism, impulse regulation and social insecurity. The German EDI-2 was given to 71 patients with anorexia or bulimia nervosa, 30 patients with binge eating disorder, a control group of 186 women and a further control group of 102 men. In comparison to the female control group, patient groups showed significantly elevated means on all subscales. Item analysis revealed sufficient internal consistencies for all subscales except subscale 9 (asceticism) with Cronbachs alpha ranging from 0.58 to 0.90. Twelve of the 91 items showed poor item total scale correlations below 0.40. Factor analysis supported a six-factor-structure. Hence, the reliability and validity of the three new subscales was confirmed only partially. The use of the EDI-2 in therapy research and clinical practice is critically discussed.

  4. Ediţii ale Clasificării Zecimale Dewey

    Directory of Open Access Journals (Sweden)

    Zenovia Niculescu

    2009-01-01

    Full Text Available Studiul abordează evoluţia ediţiilor C.Z.D. din perspective actualizării terminologiei, realocărilor şi extinderii structurii principale şi auxiliare a limbajului de indexare Dewey. Analiza comparativă a ediţiilor C.Z.D. reflectă amplificarea şi eficientizarea schemei Dewey din punct de vedere al îmbunătăţirii ofertei informaţionale, prin indici de bază revizuiţi şi dezvoltaţi, precum şi a valorizării notaţiilor auxiliare.

  5. Rein Müllerson - rahvusvahelise õiguse doktor / Eimar Rahumaa

    Index Scriptorium Estoniae

    Rahumaa, Eimar, 1948-

    1986-01-01

    1985. a. kaitses Rein Müllerson Moskva Riiklikus Ülikoolis doktoriväitekirja teemal "Rahvusvahelise avaliku, eraõiguse ja rahvusliku õiguse vahekord ning vastastikune mõju (teoreetilis-metodoloogiline uurimus)"

  6. Statistical properties of effective drought index (EDI) for Seoul, Busan, Daegu, Mokpo in South Korea

    Science.gov (United States)

    Park, Jong-Hyeok; Kim, Ki-Beom; Chang, Heon-Young

    2014-08-01

    Time series of drought indices has been considered mostly in view of temporal and spatial distributions of a drought index so far. Here we investigate the statistical properties of a daily Effective Drought Index (EDI) itself for Seoul, Busan, Daegu, Mokpo for the period of 100 years from 1913 to 2012. We have found that both in dry and wet seasons the distribution of EDI as a function of EDI follows the Gaussian function. In dry season the shape of the Gaussian function is characteristically broader than that in wet seasons. The total number of drought days during the period we have analyzed is related both to the mean value and more importantly to the standard deviation. We have also found that according to the distribution of the number of occasions where the EDI values of several consecutive days are all less than a threshold, the distribution follows the exponential distribution. The slope of the best fit becomes steeper not only as the critical EDI value becomes more negative but also as the number of consecutive days increases. The slope of the exponential distribution becomes steeper as the number of the city in which EDI is simultaneously less than a critical EDI in a row increases. Finally, we conclude by pointing out implications of our findings.

  7. Electronic Transcripts--EDI in Academic Administration.

    Science.gov (United States)

    Carson, E. W.

    1991-01-01

    Newly developed electronic data interchange (EDI) standards for exchanging academic records between colleges and universities are explained. It is argued that implementation of the new standards in college registrar and admissions offices can improve speed, costs, and accuracy and provide a prototype for a variety of campus business applications.…

  8. An arithmetic transference proof of a relative Szemer\\'edi theorem

    OpenAIRE

    Zhao, Yufei

    2013-01-01

    Recently Conlon, Fox, and the author gave a new proof of a relative Szemer\\'edi theorem, which was the main novel ingredient in the proof of the celebrated Green-Tao theorem that the primes contain arbitrarily long arithmetic progressions. Roughly speaking, a relative Szemer\\'edi theorem says that if S is a set of integers satisfying certain conditions, and A is a subset of S with positive relative density, then A contains long arithmetic progressions, and our recent results show that S only ...

  9. Reines-Cowan team discovery of the electron neutrino

    International Nuclear Information System (INIS)

    Kruse, Herald W.

    2011-01-01

    Personal perspective and recollections by the author discuss the Reines-Cowan team discovery of the electron neutrino at a Savannah River reactor in 1956. First presented at the Neutrino Santa Fe 2006 Conference.

  10. Magnetic field gradients inferred from multi-point measurements of Cluster FGM and EDI

    Science.gov (United States)

    Teubenbacher, Robert; Nakamura, Rumi; Giner, Lukas; Plaschke, Ferdinand; Baumjohann, Wolfgang; Magnes, Werner; Eichelberger, Hans; Steller, Manfred; Torbert, Roy

    2013-04-01

    We use Cluster data from fluxgate magnetometer (FGM) and electron drift instrument (EDI) to determine the magnetic field gradients in the near-Earth magnetotail. Here we use the magnetic field data from FGM measurements as well as the gyro-time data of electrons determined from the time of flight measurements of EDI. The results are compared with the values estimated from empirical magnetic field models for different magnetospheric conditions. We also estimated the spin axis offset of FGM based on comparison between EDI and FGM data and discuss the possible effect in determining the current sheet characteristics.

  11. 48 minutit pommirühma elust / Rein Kotov

    Index Scriptorium Estoniae

    Kotov, Rein, 1965-

    1997-01-01

    Intervjuu R. Kotoviga, kuna Discovery Channel Europe näitab 30.10. dokumentaalfilmi "Profid. Pommirühm" ("Professionals : Bomb Squad"), stsenarist, režissöör ja operaator Rein Kotov : Inglismaa - Eesti - Taani 1997

  12. Zygmunt Bauman ja Rein Raud vestlesid kultuurist ja poliitikast

    Index Scriptorium Estoniae

    2014-01-01

    TLÜ Kultuuriteaduste ja kunstide doktorikooli kutsel Tallinnas viibinud sotsioloogi, Leedsi ülikooli emeriitprofessori Zygmunt Baumani ja TLÜ juhtivteadur Rein Raua vahel Kirjanike Liidu saalis toimunud avalikust vestlusest

  13. Determinants of EDI (Electronic Data Interchange) Adoption and Integration in the US and Japanese Automobile Suppliers

    OpenAIRE

    Sam Kurokawa; Seiji Manabe

    2002-01-01

    This paper examines determinants of EDI adoption and integration in the US and Japanese automobile suppliers. The paper constructs several hypotheses based on the transaction-cost and resource- dependence approaches, and tests these hypotheses by using data from the automobile suppliers. Our study shows: (1) the resource-dependence approach seemed more effective in explaining EDI adoption, while the transaction-cost approach seemed more effective in explaining EDI integration; (2) the transac...

  14. DOD Electronic Commerce (EC)/Electronic Data Interchange (EDI) in contracting report

    Science.gov (United States)

    1993-12-01

    Use of Electronic Commerce (EC)/Electronic Data Interchange (EDI) to support Department of Defense (DoD) procurement processes has been under consideration for some time. A 1988 Deputy Secretary of Defense memo calls for maximum use of EDI, based on 10 years of DoD EDI investigation and experiments. In 1990, Defense Management Review Decision 941 stated, 'The strategic goal of DoD's current efforts is to provide the department with the capability to initiate, conduct, and maintain its external business related transactions and internal logistics, contracting, and financial activities without requiring the use of hard copy media.' The EC in Contracting PAT membership reflected a broad cross section of Military Services and Defense Agencies working on a full-time basis for 60 days. The diversity of the EC in Contracting PAT ensured that the needs and concerns of all DoD components were addressed during the creation of the report. The resultant plan, therefore, represents a comprehensive approach for implementing EC throughout the DoD.

  15. Reformierakonna "korrapidaja" riigikogus Rein Aidma: "Vajaliku hääletustulemuse saavutamisele eelneb peen mäng" / Rein Aidma ; interv. Erik Gamzejev

    Index Scriptorium Estoniae

    Aidma, Rein, 1950-

    2007-01-01

    Ilmunud ka: Severnoje Poberezhje : Subbota, 28. juuli 2007, lk. 5. Ida-Virumaalt Riigikokku valitud Rein Aidma roll erakonna fraktsiooni aseesimehena, saadikute ja riigiametnike privileegidest, Reformierakonna populaarsusest, riigiraha jagamisest. Arvamust avaldavad Jaanus Rahumägi ja Agu Värimäe

  16. Rein Veidemann: meil oli valida - nüüd või mitte kunagi / Rein Veidemann ; küsitles Tõnu Prei

    Index Scriptorium Estoniae

    Veidemann, Rein, 1946-

    2007-01-01

    Intervjuu Rein Veidemanniga, kes oli üks 1991.a. augustiputši päevil Eesti iseseisvust kinnitava otsuse poolt hääletanud 69 rahvasaadikust. Ülemnõukogu 20. augusti otsust peab ta sama tähtsaks kui Eesti Vabariigi väljakuulutamist 1918. aastal

  17. Telegramme sent on June 14 1956 from physicists Fred Reines and Clyde Cowan to Wolfgang Pauli announcing the detection, for the first time, of neutrinos. The Physics Nobel Prize in 1995 was awarded to Reines for this discovery.

    CERN Document Server

    Maximiliem Brice

    2006-01-01

    Telegramme sent on June 14 1956 from physicists Fred Reines and Clyde Cowan to Wolfgang Pauli announcing the detection, for the first time, of neutrinos. The Physics Nobel Prize in 1995 was awarded to Reines for this discovery.

  18. Measurement Invariance of Early Development Instrument (EDI) Domain Scores across Gender and ESL Status

    Science.gov (United States)

    Mousavi, Amin; Krishnan, Vijaya

    2016-01-01

    The Early Development Instrument (EDI) is a widely used teacher rating tool to assess kindergartners' developmental outcomes in Canada and a number of other countries. This paper examines the measurement invariance of EDI domains across ESL status and gender by means of multi-group confirmatory factor analysis. The results suggest evidence of…

  19. Biometry by ultrasonography of the epaxial and pelvic musculature in equines trained with Pessoa's rein

    Directory of Open Access Journals (Sweden)

    Kátia de Oliveira

    2014-11-01

    Full Text Available This study aimed to evaluate the use of Pessoa's rein in training equine, as a support in exercise training, on biometry by ultrasonography of the epaxial (Longíssimus Dorsi, Gluteus Medius e Musculus Multifidus and pelvic musculature (Biceps Femoris e Semitendinosus. Thereby, eight Quarter Horse mares was used, with eight years on average age, 400kg of body weight, trained with the Pessoa's rein twice a week, for two months. Variables were measured before and after training, consisting of assessment thickness (cm of the Longíssimus Dorsi and cross-sectional area (cm2 of muscles, Gluteus Medius, Biceps Femoris, Semitendinosus and Musculus Multifidus. It observed a significant effect of training with Pessoa's rein, on the Biceps Femoris (P<0.01 and Musculus Multifidus (P<0.01, which the average cross-sectional area at the final evaluation were of 28.66cm2 and 14.29cm2, respectively. Thus it can be conclude that training with Pessoa's rein modifies muscular function, promoting hypertrophy Musculus Multifidus and Biceps Femoris of horses

  20. JST Thesaurus Headwords and Synonyms: EDI [MeCab user dictionary for science technology term[Archive

    Lifescience Database Archive (English)

    Full Text Available MeCab user dictionary for science technology term EDI 名詞 一般 * * * * EDI【情報交換】 EDI イーディーアイ Thesaurus2015 200906091295492920 C EG01 UNKNOWN_1 EDI

  1. TLÜ rektor Rein Raud valiti taas UNICA juhatusse / Maiki Voore

    Index Scriptorium Estoniae

    Voore, Maiki, 1983-

    2009-01-01

    Tallinna Ülikooli rektor Rein Raud valiti taas UNICA (Network of Universities from the Capitals of Europe) uue juhatuse liikmeks. UNICA rektorite 2010. aasta seminar otsustati korraldada Tallinna Ülikoolis

  2. Numerical simulation of the electrodeionization (EDI) process accounting for water dissociation

    International Nuclear Information System (INIS)

    Lu Jun; Wang Yuxin; Zhu Jia

    2010-01-01

    The electrodeionization process (EDI) is usually operated at overlimiting current density, and is thus characterized by water dissociation and concentration polarization. We attempt to study the useful and harmful effects of water dissociation on the EDI process. A numerical steady state model was established to simulate the process of EDI, accounting for the effects of water dissociation. The differences in concentration polarization of membranes were investigated to study the effects of water dissociation on cation and anion membranes. Protons produced by water dissociation caused the resin to transform into the H-form. The H-form resin, which has high conductivity and high transport number, depletes protons in the interstitial solution. This explains the experimentally detected phenomenon that at high current densities, the pH value of the effluency of the dilute compartment (DC) stops decreasing when current increases. We suggest that the useful role of water dissociation in EDI is due to the H-form resin bringing more salt cations of the interstitial solution into the resin phase, thus producing a high conductivity channel for the electro-migration of the salt cations. This mechanism avoids the decrease in salt ion conductivity brought about by concentration polarization. The disadvantageous effect of concentration polarization on the transportation of salt ions in interstitial solution is thus lessened. An intermediate point between the useful and harmful effects of water dissociation was determined by the dependence of current efficiency and removal rate for both cations and anions as a function of current density.

  3. The use of a rein tension device to compare different training methods for neck flexion in base-level trained Warmblood horses at the walk.

    Science.gov (United States)

    Veen, I; Killian, D; Vlaminck, L; Vernooij, J C M; Back, W

    2018-03-08

    Debate surrounds the use of high rein tension for obtaining different head and neck positions in the training of sport horses on account of possible welfare issues. To compare auxiliary rein tension in two methods (Draw Reins and Concord Leader) for obtaining a standardised head and neck position on a hard and a soft surface. Intervention study. Left and right rein tensions were measured in 11 base-level trained client-owned sport horses (mean age ± s.d.; 10 ± 3.2 years) exercised in-hand with, in a random order, conventional draw reins or the newly developed Concord Leader in a standardised head and neck position. Rein tension was measured using a calibrated device operating at 10 Hz during six runs of 15 s in a straight line for each training method on both a hard and a soft surface. A linear mixed model and grouped logistic regression analysis were applied to compare the two methods (Preins than with the Concord Leader. The rein tension (mean sum of the force applied, in N) of the draw reins was 13.8 times higher than that of the Concord Leader. This study was performed on horses exercised in-hand; however, these auxiliary aids are normally used when lungeing. Possible redirection of rein tension towards the poll was not measured. We showed that when using the Concord Leader a similar head and neck position is achieved with a much lower rein tension than with the draw reins and, more importantly, with a much greater likelihood of 0 N. It is unnecessary to use high auxiliary rein tension to obtain a standard, flexed head and neck position. © 2018 The Authors. Equine Veterinary Journal published by John Wiley & Sons Ltd on behalf of EVJ Ltd.

  4. EdiPy: a resource to simulate the evolution of plant mitochondrial genes under the RNA editing.

    Science.gov (United States)

    Picardi, Ernesto; Quagliariello, Carla

    2006-02-01

    EdiPy is an online resource appropriately designed to simulate the evolution of plant mitochondrial genes in a biologically realistic fashion. EdiPy takes into account the presence of sites subjected to RNA editing and provides multiple artificial alignments corresponding to both genomic and cDNA sequences. Each artificial data set can successively be submitted to main and widespread evolutionary and phylogenetic software packages such as PAUP, Phyml, PAML and Phylip. As an online bioinformatic resource, EdiPy is available at the following web page: http://biologia.unical.it/py_script/index.html.

  5. 41 CFR 102-118.550 - How does a TSP file an administrative claim using EDI or other electronic means?

    Science.gov (United States)

    2010-07-01

    ... administrative claim using EDI or other electronic means? 102-118.550 Section 102-118.550 Public Contracts and... EDI or other electronic means? The medium and precise format of data for an administrative claim filed electronically must be approved in advance by the GSA Audit Division. GSA will use an authenticating EDI...

  6. Vajame uut suhtumist sisejulgeolekusse / Rein Lang

    Index Scriptorium Estoniae

    Lang, Rein, 1957-

    2006-01-01

    Ilmunud ka: Hiiu Leht 31. märts lk. 2, Elva Postipoiss 1. apr. lk. 4, Harjumaa, Vooremaa 4. apr. lk. 2, Sakala, Põhjarannik, Severnoje Poberezhje, Võrumaa Teataja 6. apr. lk. 2, Koit 8. apr. lk. 6, Valgamaalane 18. apr. lk. 2, Pärnu Postimees 21. apr. lk. 11. Justiitsminister Rein Langi hinnangul ei seisne sisejulgeoleku arendamine üksnes politseinike ja päästjate palkade tõstmises, sisejulgeolek jaguneb vähemalt nelja ministeeriumi haldusalasse

  7. Riigikogulased ongi teistmoodi asendis. Aga mitte nii teistmoodi, kui nad hetkel arvavad / Rein Taagepera ; interv. Urmo Soonvald

    Index Scriptorium Estoniae

    Taagepera, Rein, 1933-

    2007-01-01

    Politoloog Rein Taagepera vastab Riigikogu suurust, tööd ning seaduseelnõu, mis vabastab parlamendiliikmed kuluhüvitiste avalikustamisest, puudutavatele küsimustele. Lisa: Soome parlamendist õpitakse kulutamist, mitte tööl käimist; Rein Taagepera: teadlane, presidendikandidaat, Res Publica looja

  8. Does the EDI Equivalently Measure Facets of School Readiness for Aboriginal and Non-Aboriginal Children?

    Science.gov (United States)

    Muhajarine, Nazeem; Puchala, Chassidy; Janus, Magdalena

    2011-01-01

    The aim of the current paper was to examine the equivalence of the Early Development Instrument (EDI), a teacher rating measure of school readiness, for Aboriginal and non-Aboriginal children. The current study used an approach, which analyzes the structure and properties of the EDI at the subdomain level. Similar subdomain score distributions…

  9. The EDIE method – towards an approach to collaboration-based persuasive design

    DEFF Research Database (Denmark)

    Hansen, Sandra Burri Gram

    2016-01-01

    This paper presents the initial steps towards a collaboration-based method for persuasive design – the EDIE method (Explore, Design, Implement, Evaluate). The method is inspired by Design-Based Research, but developed to combine different design approaches that have dominated the persuasive...... technology field over the past decade. The rhetorical notion of Kairos is considered a key element in the EDIE method, resulting in a distinct focus on participatory design and constructive ethics. The method is explained through a practical example of developing persuasive learning designs in collaboration...

  10. Kuidas suhtute erakooli? / Andrus Kuusmann, Rein Rebane, Tiiu Kuurme ... [jt.

    Index Scriptorium Estoniae

    2012-01-01

    Küsimusele vastavad Tartu erakooli nõukogu esimees Andrus Kuusmann, Rocca al Mare Kooli AS-i juhataja Rein Rebane, TLÜ õppejõud Tiiu Kuurme, Viljandi Waldorfkooli õpetaja Sulev Ojap ja TLÜ õppejõud Tõnu Ploompuu

  11. De ontwikkelingsgeschiedenis van Rein van Bemmelens (1904-1983 undatietheorie: veertig jaar Nederlandse geologie

    Directory of Open Access Journals (Sweden)

    Willemjan Barzilay

    2009-03-01

    Full Text Available The development of Rein van Bemmelens (1904-1983 undation theory: Forty years of Dutch geology The Dutch geologist Rein van Bemmelen was the greatest opponent of plate tectonics in the Netherlands. He lived and worked during an important period in the history of earth sciences. He had studied geology when Wegeners theory was introduced and enthusiastically received in the Netherlands and he worked as a geologists during the period in which, after Wegeners theory was rejected in the Netherlands, several Dutch geologists came with their own theories to explain the origin of continents and oceans and in which plate tectonics was introduced in the Netherlands. He had proposed his own theory, the undation theory, at the beginning of the 1930s and kept on developing it during the following years. He continued to do so until his death in 1983. The history of the undation theory thus sheds light on the history of geology in the Netherlands. I will trace the history of geology in the Netherlands using Rein van Bemmelen and his undation theory as a lense.

  12. Rein Veidemann ja Erkki Bahovski tulevad lugejale külla

    Index Scriptorium Estoniae

    2016-01-01

    Emeriitprofessor Rein Veidemann esitleb Pärnu keskraamatukogus oma uusi raamatuid: luuleantoloogiat "Sada hetke Eesti luules" ja debüütluulekogu "Lausungid ja pausid". Ajakirjanik Erkki Bahovski räägib huvilistele päevapoliitikast, Eesti ajaloost ja rahvusvahelistest suhetest

  13. Rein Tammik : Pidu katku ajal = Feast during the plague / Anneli Porri

    Index Scriptorium Estoniae

    Epner, Eero, 1978-

    2007-01-01

    Rein Tammiku fotorealistlik pildimaailm on iseseisev organism, mis ajuti genereerib ootamatuid tähenduslikke lühiühendusi. Erinevalt loodusmaalijatest, portreemaalijatest, meremaalijatest ja teistest maalib Rein Tammik pilte. Ta on pildimaalija. Tammikut huvitavad eelkõige visuaalsed paradoksid. Tammik asus juba 1970. aastail ajastuid ühte pilti kokku keevitama. Rembrandti grupiportreele «Kangrute gildi eesistujaist» ilmusid «Visarite» näod, Manet’ «Eine murul» leidis järsku aseme punaruudulisel linal jne. Historitsistlik eklektika - postmodernismi peamisi strateegiaid - on Tammiku loomingus täiesti selgelt loetav, teda on nimetatud esimeseks nõukogude postmodernistiks. Teatav nõukogude ajastu traumaatiline tajumine ilmneb tema töödes suuresti igatsusest kestvuse, jätkuvuse ja üldkehtivuse järele, mida 1970-1980-ndad aastad ei võimaldanud. 1992. aastast resideerub Prantsusmaal

  14. Preemiad said Rein Raud, fs, Mart Kivastik

    Index Scriptorium Estoniae

    2005-01-01

    Eesti Kultuurkapitali 2004. aasta kirjanduse aastapreemia laureaadid on: Rein Raud ("Hector ja Bernard"), fs (luulekogu "2004"), Mart Kivastik (näidend "Külmetava kunstniku portree"), Jaan Rannap ("Nelja nimega koer"), Toomas Haug ("Troojamäe tõotus"), Harald Rajamets (tõlkeluule kogumik "Pegasos ja peegel"), Antoine Chalvin ("Kalevipoja" tõlge prantsuse keelde"), Ilmar Talve ("Eesti kultuurilugu"), Lauri Sommer (artikkel Uku Masingu käsikirja "Saadik Magellani pilvest" vaimne, ajalis-ruumiline ja elulooline taust), Boris Tuch ("Gorjatshaja desjatka estonskihh pisatelei")

  15. Investigation of the effect of heated ethanol fuel on combustion and emissions of an ethanol direct injection plus gasoline port injection (EDI + GPI) engine

    International Nuclear Information System (INIS)

    Huang, Yuhan; Hong, Guang

    2016-01-01

    Highlights: • Effect of EDI heating on the EDI + GPI engine performance was investigated. • CO and HC were significantly reduced and NO was slightly increased by EDI heating. • IMEP and combustion speed were slightly reduced by EDI heating. • EDI heating is effective to address the evaporation and over-cooling issues of EDI + GPI engine. - Abstract: Ethanol direct injection plus gasoline port injection (EDI + GPI) is a new technology to utilise ethanol fuel more efficiently and flexibly in spark ignition engines. One issue needs to be addressed in the development of EDI + GPI is the ethanol fuel’s low vapour pressure and large latent heat which slow down the ethanol’s evaporation and result in the mixture unready for combustion by the time of spark ignition and the consequent increase of CO and HC emissions. Heating the ethanol fuel to be directly injected (EDI heating) has been proposed to address this issue. This paper reports the investigation of the effect of EDI heating on the combustion and emissions of a research engine equipped with EDI + GPI. The results showed that EDI heating effectively reduced the CO and HC emissions of the engine due to the increase of evaporation rate and reduced fuel impingement and local over-cooling. The reduction of CO and HC became more significant with the increase of ethanol ratio. When the temperature of the ethanol fuel was increased by 40 °C, the CO and HC were reduced by as much as 43% and 51% respectively in EDI only condition at the original spark timing of 15 CAD BTDC, and 15% and 47% respectively at the minimum spark advance for best torque (MBT) timing of 19 CAD BTDC. On the other hand, the NO emission was slightly increased, but still much smaller than that in GPI only condition due to the strong cooling effect and low combustion temperature of EDI. The IMEP and combustion speed were slightly reduced by EDI heating due to the decrease of injector fuel flow rate and spray collapse of flash-boiling. The

  16. High-temperature thermopower of some REIn3 compounds

    International Nuclear Information System (INIS)

    Kletowski, Z.; Resel, R.

    1995-01-01

    The temperature dependences of the thermopower of six REIn 3 compounds (RE=La, Pr, Gd, Dy, Er and Lu) were measured in the temperature range up to 1000 K. The observed changes in the slopes of the temperature versus thermopower curves for all the investigated compounds are interpreted as originating from a special shape of the density of states (DOS) near the Fermi energy, E F . ((orig.))

  17. Majanduse struktuur kujuneb isevoolu / Tiit Made, Rein Kask ; interv. Ester Shank

    Index Scriptorium Estoniae

    Made, Tiit, 1940-

    1999-01-01

    Riigikogu majanduskomisjoni esimees Tiit Made ja tema asetäitja Rein Kask nentisid Maailmakaubanduskeskuse klubi kokkutulekul, et kaheksa aasta jooksul ei ole Eesti valitsused suutnud ette näha, millise struktuuriga majandus peaks meie riigis kujunema

  18. Optomechanical fabrication of EDiFiSE spectrometer

    Science.gov (United States)

    Arredondo-Vega, Luis; Pérez-Santos, Carlos; Pompa-Carrera, Octavio; Ruiz-Márquez, Armando; Hurtado-Ortega, José; Paez, Gonzalo

    2011-09-01

    The purpose of this work is to describe some optical and mechanical issues relating to the fabrication of the camera and the collimator of the Equalized and Diffraction-Limited Field Spectrograph Experiment (EDiFiSE), an instrument which forms part of a bigger project of the Instituto de Astrofísica de Canarias (IAC), Spain, and that was designed and manufactured within the facilities of Centro de Investigaciones en Óptica in León, México.

  19. Rein: Taming Tail Latency in Key-Value Stores via Multiget Scheduling

    KAUST Repository

    Reda, Waleed; Canini, Marco; Suresh, Lalith; Kostić, Dejan; Braithwaite, Sean

    2017-01-01

    the composition of aggregate requests and by carefully scheduling bottleneck operations that can otherwise create excessive queues. We design and implement a system called Rein, which reduces latency via inter-multiget scheduling using low overhead techniques. We

  20. Edição Especial: 6 V-EEGAM

    OpenAIRE

    João Cândido André da Silva Neto; Thiago Oliveira Neto

    2017-01-01

    A sexta edição especial da Revista Geonorte acaba de ser publicada, contemplando os trabalhos submetidos e aceitos ao V Encontro dos Estudantes de Geografia do Amazonas-EEGAM com o tema: Geografia da Circulação, realizado nas dependências do Instituto de Ciências Humanas e Letras-ICHL entre 29 e 30 de novembro e 01 e 02 de dezembro de 2016.

  1. Tavatu juhtum / Toomas Rein, Helle Gans, Leonhard Lapin ; interv. Reet Varblane

    Index Scriptorium Estoniae

    Rein, Toomas, 1940-

    2007-01-01

    Arhitektid Toomas Rein ja Leonhard Lapin ning sisearhitekt Helle Gans meenutavad Valgevene näidiskolhoosile Rassvet projekteeritud lasteaeda, mis valmis 1987. aastal. Kompleks pälvis 1987. a. NSVL Arhitektide Liidu preemia ja üleliidulise ametiühingupreemia

  2. Rancang Bangun Aplikasi Transaksi Elektronik Ritel Pupuk Dengan Metode Electronic Data Interchange (EDI

    Directory of Open Access Journals (Sweden)

    Nelly Oktavia Adiwijaya

    2015-03-01

    Full Text Available Fertilizer distribution from distributor to agents, are required to be responsive in addressing the demand for fertilizers. Distributors are also required to be able to manage inventory in the warehouse, to avoid overstocking of fertilizer. Design and implementation of a fertilizer retail electronic commerce applications using electronic data interchange (EDI method is applied in this study. The system is built to help distributors to control the existence of the stock of fertilizer so no excess stock. In addition, the use of EDI can provide information quickly (real-time without having to go directly to the warehouse locations.

  3. System overview of the fully implantable destination therapy--ReinHeart-total artificial heart.

    Science.gov (United States)

    Pelletier, Benedikt; Spiliopoulos, Sotirios; Finocchiaro, Thomas; Graef, Felix; Kuipers, Kristin; Laumen, Marco; Guersoy, Dilek; Steinseifer, Ulrich; Koerfer, Reiner; Tenderich, Gero

    2015-01-01

    Owing to the lack of suitable allografts, the demand for long-term mechanical circulatory support in patients with biventricular end-stage heart failure is rising. Currently available Total Artificial Heart (TAH) systems consist of pump units with only limited durability, percutaneous tubes and bulky external equipment that limit the quality of life. Therefore we are focusing on the development of a fully implantable, highly durable destination therapy total artificial heart. The ReinHeart-TAH system consists of a passively filling pump unit driven by a low-wear linear drive between two artificial ventricles, an implantable control unit and a compliance chamber. The TAH is powered by a transcutaneous energy transmission system. The flow distribution inside the ventricles was analysed by fluid structure interaction simulation and particle image velocimetry measurements. Along with durability tests, the hydrodynamic performance and flow balance capability were evaluated in a mock circulation loop. Animal trials are ongoing. Based on fluid structure interaction simulation and particle image velocimetry, blood stagnation areas have been significantly reduced. In the mock circulation loop the ReinHeart-TAH generated a cardiac output of 5 l/min at an operating frequency of 120 bpm and an aortic pressure of 120/80 mmHg. The highly effective preload sensitivity of the passively filling ventricles allowed the sensorless integration of the Frank Starling mechanism. The ReinHeart-TAH effectively replaced the native heart's function in animals for up to 2 days. In vitro and in vivo testing showed a safe and effective function of the ReinHeart-TAH system. This has the potential to become an alternative to transplantation. However, before a first-in-man implant, chronic animal trials still have to be completed. © The Author 2014. Published by Oxford University Press on behalf of the European Association for Cardio-Thoracic Surgery. All rights reserved.

  4. Edição Especial: 6 V-EEGAM

    Directory of Open Access Journals (Sweden)

    João Cândido André da Silva Neto

    2017-05-01

    Full Text Available A sexta edição especial da Revista Geonorte acaba de ser publicada, contemplando os trabalhos submetidos e aceitos ao V Encontro dos Estudantes de Geografia do Amazonas-EEGAM com o tema: Geografia da Circulação, realizado nas dependências do Instituto de Ciências Humanas e Letras-ICHL entre 29 e 30 de novembro e 01 e 02 de dezembro de 2016.

  5. The lateral crural rein flap: a novel technique for management of tip rotation in primary rhinoplasty.

    Science.gov (United States)

    Kuran, Ismail; Öreroğlu, Ali Rıza; Efendioğlu, Kamran

    2014-09-01

    An important consideration in rhinoplasty is maintenance of the applied tip rotation. Different techniques have been proposed to accomplish this. Loss of rotation after surgery not only results in a derotated tip but also can create a supratip deformity. As a supplement to dorsal reconstruction, the authors introduced and applied the lateral crural rein flap technique, whereby cartilage flaps are created from the cephalic portion of the lateral crura to control and stabilize tip rotation. Eleven patients underwent primary open-approach rhinoplasty that included the lateral crural rein technique; the mean follow-up time was 18 months. Excess cephalic portions of the lateral crura were prepared as medial crura-based cartilaginous flaps and were incorporated into the nasal dorsum (similar to spreader grafts) and stabilized to achieve the desired tip rotation. The lateral crural rein flap technique provided stability to the nasal tip while minimizing derotation in the postoperative period. Long-term follow-up revealed maintenance of the nasal tip rotation and symmetric dorsal aesthetic lines. The lateral crural rein flap technique is effective for controlling nasal tip rotation while reducing lateral crural cephalic excess. Longevity of the applied tip rotation is reinforced by secure attachment of the lower nasal cartilage complex to the midvault structures. 4. © 2014 The American Society for Aesthetic Plastic Surgery, Inc.

  6. Rein: Taming Tail Latency in Key-Value Stores via Multiget Scheduling

    KAUST Repository

    Reda, Waleed

    2017-04-17

    We tackle the problem of reducing tail latencies in distributed key-value stores, such as the popular Cassandra database.We focus on workloads of multiget requests, which batch together access to several data elements and parallelize read operations across the data store machines. We first analyze a production trace of a real system and quantify the skew due to multiget sizes, key popularity, and other factors. We then proceed to identify opportunities for reduction of tail latencies by recognizing the composition of aggregate requests and by carefully scheduling bottleneck operations that can otherwise create excessive queues. We design and implement a system called Rein, which reduces latency via inter-multiget scheduling using low overhead techniques. We extensively evaluate Rein via experiments in Amazon Web Services (AWS) and simulations. Our scheduling algorithms reduce the median, 95, and 99 percentile latencies by factors of 1.5, 1.5, and 1.9, respectively.

  7. Rein Pilli hobusel on hüppamine sisse kodeeritud / Maarja Värv

    Index Scriptorium Estoniae

    Värv, Maarja

    2008-01-01

    Tänavusest aastast A Big Boyga ratsutav takistussõitja Rein Pill võitis septembri alguses Venemaal kõrgetasemelise maailmakarikaetapi ning püüab saavutust korrata ka Tallinn International Horse Show'l. Lisa: Takistussõidu grand prix' rajaskeem

  8. On description of Δ(1232) region in the Rein-Sehgal model

    International Nuclear Information System (INIS)

    Graczyk, Krzysztof M.; Sobczyk, Jan T.

    2007-01-01

    New vector and axial form factors in the Rein-Sehgal model are proposed. The vector part is constructed after experimental fits of the helicity amplitudes for electroproduction of Δ(1232) resonance. The axial part is calculated after Q 2 distribution of events in the ANL experiment

  9. Rein Pill võitis Venemaal kõrgetasemelise võistluse / Maarja Värv

    Index Scriptorium Estoniae

    Värv, Maarja

    2008-01-01

    Ratsutaja Rein Pill tegi Venemaal Tsherjahovskis CS14* taseme rahvusvahelistel ratsutamise takistussõiduvõistlustel ajalugu, võites hobusel A Big Boy võistluste Grand Prix' 160 cm kõrgusel parkuuril ja täites seega Euroopa meistrivõistluste kvalifikatsiooninormi

  10. Numerical investigation to the dual-fuel spray combustion process in an ethanol direct injection plus gasoline port injection (EDI + GPI) engine

    International Nuclear Information System (INIS)

    Huang, Yuhan; Hong, Guang; Huang, Ronghua

    2015-01-01

    Highlights: • A 5D PDF table was used to model the dual-fuel turbulence–chemistry interactions. • The cooling effect of ethanol direct injection (EDI) was examined. • The higher flame speed of ethanol in EDI + GPI increased the thermal efficiency. • The partially premixed combustion in EDI + GPI reduced the combustion temperature. • Ethanol’s low evaporation rate in low temperature led to incomplete combustion. - Abstract: Ethanol direct injection plus gasoline port injection (EDI + GPI) is a new technology to make the use of ethanol fuel more effective and efficient in spark ignition engines. Multi-dimensional computational fluid dynamics modelling was conducted on an EDI + GPI engine in both single and dual fuelled conditions. The in-cylinder flow field was solved in the realizable k−ε turbulence model with detailed engine geometry. The temporal and spatial distributions of the liquid and vapour fuels were simulated with the spray breakup and evaporation models. The combustion process was modelled with the partially premixed combustion concept in which both mixture fraction and progress variable were solved. The three-dimensional and five-dimensional presumed Probability Density Function (PDF) look-up tables were used to model the single-fraction-mixture and two-fraction-mixture turbulence–chemistry interactions respectively. The model was verified by comparing the numerical and experimental results of spray pattern and cylinder pressure. The simulation results showed that the combustion process of EDI + GPI dual-fuelled condition was partially premixed combustion because of the low evaporation rate of ethanol spray in low temperature environment before combustion. Compared with GPI only, the higher flame speed of ethanol fuel contributed to the greater pressure rise rate and maximum cylinder pressure in EDI + GPI condition, which consequently resulted in higher power output and thermal efficiency. The lower adiabatic flame temperature of

  11. Rein and Zheng Elected to American Academy of Microbiology | Poster

    Science.gov (United States)

    By Nancy Parrish, Staff Writer Earlier this year, Alan Rein, Ph.D., and Zhi-Ming (Thomas) Zheng, M.D., Ph.D., were elected to fellowship in the American Academy of Microbiology, the honorific leadership group within the American Society for Microbiology (ASM). They were among 88 microbiologists who were elected to the academy “through a highly selective, peer-review process,

  12. Transfer of Air Force technical procurement bid set data to small businesses, using CALS and EDI: Test report

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    1994-08-15

    This report documents a test transfer of three Air Force technical procurement bid sets to one large and twelve small businesses, using the Department of Defense (DoD) Continuous Acquisition and Life-cycle Support (CALS) and ANSI ASC X12 Electronic Data Interchange (EDI) standards. The main goal of the test was to evaluate the effectiveness of using CALS technical data within the context of the DoD`s EDI-based standard approach to electronic commerce in procurement, with particular emphasis on receipt and use of the data by small contractors. Air Force procurement data was provided by the Sacramento Air Logistics Center at McClellan Air Force Base; the manufacturing participants were selected from among McClellan`s ``Blue Ribbon`` contractors, located throughout the US. The test was sponsored by the Air Force CALS Test Network, headquartered at Wright-Patterson Air Force Base. The test successfully demonstrated the technical feasibility of including CALS MIL-R-28002 (Raster) engineering data in an EDI Specification/Technical Information transaction set (ANSI ASC X12 841) when issuing electronic requests for quotation to small businesses. In many cases, the data was complete enough for the contractor participant to feel comfortable generating a quote. Lessons learned from the test are being fed back to the CALS and EDI standards organizations, and to future implementors of CALS-EDI based acquisition or contracting systems, which require the transfer of technical information, such as engineering data, manufacturing process data, quality test data, and other product or process data, in the form of a CALS or other digital datafile.

  13. A little rein on addiction.

    Science.gov (United States)

    Mathuru, Ajay S

    2018-06-01

    Rewarding and aversive experiences influence emotions, motivate specific behaviors, and modify future action in animals. Multiple conserved vertebrate neural circuits have been discovered that act in a species-specific manner to reinforce behaviors that are rewarding, while attenuating those with an adverse outcome. A growing body of research now suggests that malfunction of the same circuits is an underlying cause for many human disorders and mental ailments. The habenula (Latin for "little rein") complex, an epithalamic structure that regulates midbrain monoaminergic activity has emerged in recent years as one such region in the vertebrate brain that modulates behavior. Its dysfunction, on the other hand, is implicated in a spectrum of psychiatric disorders in humans such as schizophrenia, depression and addiction. Here, I review the progress in identification of potential mechanisms involving the habenula in addiction. Copyright © 2017. Published by Elsevier Ltd.

  14. Direct Observations of ULF and Whistler-Mode Chorus Modulation of 500eV EDI Electrons by MMS

    Science.gov (United States)

    Paulson, K. W.; Argall, M. R.; Ahmadi, N.; Torbert, R. B.; Le Contel, O.; Ergun, R.; Khotyaintsev, Y. V.; Strangeway, R. J.; Magnes, W.; Russell, C. T.

    2016-12-01

    We present here direct observations of chorus-wave modulated field-aligned 500 eV electrons using the Electron Drift Instrument (EDI) on board the Magnetospheric Multiscale mission. These periods of wave activity were additionally observed to be modulated by Pc5-frequency magnetic perturbations, some of which have been identified as drifting mirror-mode structures. The spacecraft encountered these mirror-mode structures just inside of the duskside magnetopause. Using the high sampling rate provided by EDI in burst sampling mode, we are able to observe the individual count fluctuations of field-aligned electrons in this region up to 512 Hz. We use the multiple look directions of EDI to generate both pitch angle and gyrophase plots of the fluctuating counts. Our observations often show unidirectional flow of these modulated electrons along the background field, and in some cases demonstrate gyrophase bunching in the wave region.

  15. Neutrinos and other matters collected works of Frederic Reines

    CERN Document Server

    Reines, Frederick; Moe, Michael; Price, LeRoy R; Schultz, J; Sobel, H

    This volume is a collection of the scientific papers of Frederick Reines. Its publication is to commemorate the 70th birthday, in 1988, of this distinguished scientist. The selected papers here cover many aspects of his work in neutrino physics, astrophysics and conservation law tests. They have been divided into logical groupings, each introduced by a leading authority in that field, who helps the reader to see the reprinted articles with a better historical and scientific perspective.

  16. Thermal conductivity of REIn3 compounds

    International Nuclear Information System (INIS)

    Mucha, J

    2006-01-01

    The results of measurements of the thermal conductivity of REIn 3 (RE Pr, Nd, Dy, Ho, Tm) compounds as a function of the temperature in the interval 4-300 K in the absence and in the presence of an external magnetic field of 8 T are presented. Except for PRIn 3 all the compounds are antiferromagnetic. YIn 3 was also measured as a reference compound. The results were analysed in the paramagnetic phase, where an influence of the crystalline electric field on the thermal conductivity was found. Drastic changes in the thermal conductivity were observed and analysed in the vicinity of the Neel temperature and in the antiferromagnetic phases of the compounds. Below the Neel temperature an additional magnon contribution to the thermal conductivity was separated out

  17. Une reine entre ombres et lumières ou le pouvoir au féminin : le cas d’Isabelle Bourbon, reine d’Espagne, première femme de Philippe IV (1603-1644

    Directory of Open Access Journals (Sweden)

    Frédérique Sicard

    2009-09-01

    Full Text Available Le rôle de la Reine et sa relation au pouvoir sont strictement réglementés, mais son influence politique est paradoxalement difficile à apprécier car elle s’exerce à l’ombre de ce qui est permis. Isabelle de Bourbon, née Princesse de France, épouse en 1615 le Prince héritier Philippe d’Espagne et fait partie de ces Reines de l’ombre, peu étudiées. Elevée dans une certaine liberté, le contraste avec la cour d’Espagne et la surveillance de l’omniprésent Favori, le Comte-Duc d’Olivares, lui pèsent d’autant plus. Quel éclairage le cas de la Reine Isabelle permet-il d’apporter à la relation entre genre et pouvoir au Siècle d’Or ? Trois points seront abordés : les tensions et dominations qui se jouent autour du Roi Philippe IV, le poids de la famille, au sens large, indissociable des relations entretenues entre genre et pouvoir. Enfin, nous nous intéresserons à l’activité politique de la Reine Isabelle.The role of French queens and their relation to power were strictly regulated, but their political influence is difficult to assess given the shadows within which they worked. In 1615, Isabelle of Bourbon, born Princess of France, married Philip of Spain and became one of these seldom-studied Queens of the shadows. What illumination does Queen Isabelle’s case bring to the gender-power relationship during the Golden Age? Three points are addressed in the article: the tensions and power dynamics around Philip IV; the weight of the family, in a broad sense, which necessarily affected relations between gender and power. Finally, we will focus on the political activity of Queen Isabelle; her example constitutes a concrete example of women’s power in the Golden Age.

  18. Analysis of Dream in Gholamhossein Sa'edi's Short Stories: A Model for Dream Analysis in Literary Works

    Science.gov (United States)

    Veskari, Hassan; Pouralkhas, Shokrollah; Moharrami, Ramin; Ranjbar, Ebrahim

    2017-01-01

    Gholam Hussein Sa'edi is one of the greatest Iranian writers of short stories in the present era. Sa'edi's stories are based on the existence of fanciful and dreamlike settings in which he attempts to establish the endings of the stories to be the direct result of the characters' psychological reaction against their dreams. The linguistic and…

  19. Validation of Multilevel Constructs: Validation Methods and Empirical Findings for the EDI

    Science.gov (United States)

    Forer, Barry; Zumbo, Bruno D.

    2011-01-01

    The purposes of this paper are to highlight the foundations of multilevel construct validation, describe two methodological approaches and associated analytic techniques, and then apply these approaches and techniques to the multilevel construct validation of a widely-used school readiness measure called the Early Development Instrument (EDI;…

  20. Luuleline lõuna Rein Veidemanni moodi: õnn olla koos oma põlvkonnaga / Juune Holvandus

    Index Scriptorium Estoniae

    Holvandus, Juune

    2017-01-01

    Rapla keskraamatukogus toimus luulehuviliste kohtumine, kuhu oli lubanud tulla mitmekülgne inimene - kirjandusteadlane, poliitik, ühiskonnategelane, üliõpilastele alati mõistev ja pühendunud õpetaja, nüüd Tallinna Ülikooli prof emeritus, vastne ringhäälingunõukogu esimees Rein Veidemann

  1. Conventional resin cation exchangers versus EDI for CACE measurement in power plants. Feasibility and practical field results

    Energy Technology Data Exchange (ETDEWEB)

    Sigrist, Manuel [Swan Systeme AG, Hinwil (Switzerland)

    2017-10-15

    The conductivity measurement after a cation exchanger in power plants with steam turbines was introduced soon after 1950 by Larson and Lane. Due to the simple measuring principle, the sensitivity to ionic contaminations and to its high reliability, the conductivity measurement after a cation exchanger (CACE) has become the most commonly used online analytical method in power plants with steam generators. Swan has investigated electro deionisation (EDI) as substitution of the conventional cation exchange resin and has developed a new conductivity instrument using this principle. This paper provides a description of the conventional method for cation conductivity measurements as well as of the new AMI CACE using EDI method.

  2. Conventional resin cation exchangers versus EDI for CACE measurement in power plants. Feasibility and practical field results

    International Nuclear Information System (INIS)

    Sigrist, Manuel

    2017-01-01

    The conductivity measurement after a cation exchanger in power plants with steam turbines was introduced soon after 1950 by Larson and Lane. Due to the simple measuring principle, the sensitivity to ionic contaminations and to its high reliability, the conductivity measurement after a cation exchanger (CACE) has become the most commonly used online analytical method in power plants with steam generators. Swan has investigated electro deionisation (EDI) as substitution of the conventional cation exchange resin and has developed a new conductivity instrument using this principle. This paper provides a description of the conventional method for cation conductivity measurements as well as of the new AMI CACE using EDI method.

  3. Identification of Disciplines and Fields. Edis Task I Report, Work Unit 1.4.

    Science.gov (United States)

    Howard Research Co., Arlington, VA.

    This report presents the identification and definitions of subject oriented engineering and scientific disciplines and fields which are included in the EDIS Subject Categories. The discussion is extended to include the mix of subjects with other orientations, such as Item, Mission-Project, Expertise and Data Bank Categories. Sample queries are…

  4. Rein Taaramäe virutas protestiks liidrisärgi porri ja katkestas / Jaan Martinson

    Index Scriptorium Estoniae

    Martinson, Jaan, 1960-

    2007-01-01

    Velotuuri Tour de Le Pays Roannaisþ finishis jäi Rein Taaramäe koos klubikaaslaste Tanel Kangerti ja Kalle Kriidiga enne joont seisma, võttis seljast liidrisärgi ja viskas selle protestiks porri. Eestlased olid viimasel etapil suunatud valele teele, kuid kohtunik sõitu ei peatanud

  5. Rein Lang: Eesti kõige väärtuslikum ressurss on mõistus / Rein Lang ; interv. Peep Lillemägi ; komment. Siim Kallas, Jüri Pihl, Väino Linde

    Index Scriptorium Estoniae

    Lang, Rein, 1957-

    2009-01-01

    Justiitsminister Rein Lang vastab küsimustele, mis puudutavad Ameerika Ühendriike kui vabaduse kantsi, ettevõtlusvabadust Ameerika Ühendriikides ja Eestis, tööd justiitsministrina, varasemat karjääri, Eesti põhiseaduse loomist, Euroopa Liidu aluslepingu välja töötamist, avaliku võimu rolli tänapäeva maailmas ning Eesti jõudmist Euroopa rikkamate riikide hulka

  6. Assisted editing od SensorML with EDI. A bottom-up scenario towards the definition of sensor profiles.

    Science.gov (United States)

    Oggioni, Alessandro; Tagliolato, Paolo; Fugazza, Cristiano; Bastianini, Mauro; Pavesi, Fabio; Pepe, Monica; Menegon, Stefano; Basoni, Anna; Carrara, Paola

    2015-04-01

    Sensor observation systems for environmental data have become increasingly important in the last years. The EGU's Informatics in Oceanography and Ocean Science track stressed the importance of management tools and solutions for marine infrastructures. We think that full interoperability among sensor systems is still an open issue and that the solution to this involves providing appropriate metadata. Several open source applications implement the SWE specification and, particularly, the Sensor Observation Services (SOS) standard. These applications allow for the exchange of data and metadata in XML format between computer systems. However, there is a lack of metadata editing tools supporting end users in this activity. Generally speaking, it is hard for users to provide sensor metadata in the SensorML format without dedicated tools. In particular, such a tool should ease metadata editing by providing, for standard sensors, all the invariant information to be included in sensor metadata, thus allowing the user to concentrate on the metadata items that are related to the specific deployment. RITMARE, the Italian flagship project on marine research, envisages a subproject, SP7, for the set-up of the project's spatial data infrastructure. SP7 developed EDI, a general purpose, template-driven metadata editor that is composed of a backend web service and an HTML5/javascript client. EDI can be customized for managing the creation of generic metadata encoded as XML. Once tailored to a specific metadata format, EDI presents the users a web form with advanced auto completion and validation capabilities. In the case of sensor metadata (SensorML versions 1.0.1 and 2.0), the EDI client is instructed to send an "insert sensor" request to an SOS endpoint in order to save the metadata in an SOS server. In the first phase of project RITMARE, EDI has been used to simplify the creation from scratch of SensorML metadata by the involved researchers and data managers. An interesting by

  7. [The development of Rein van Bemmelens (1904-1983) undation theory: forty years of Dutch geology].

    Science.gov (United States)

    Barzilay, Willemjan

    2009-01-01

    The Dutch geologist Rein van Bemmelen was the greatest opponent of plate tectonics in The Netherlands. He lived and worked during an important period in the history of earth sciences. He had studied geology when Wegeners theory was introduced and enthusiastically received in the Netherlands and he worked as a geologists during the period in which, after Wegeners theory was rejected in The Netherlands, several Dutch geologists came with their own theories to explain the origin of continents and oceans and in which plate tectonics was introduced in The Netherlands. He had proposed his own theory, the undation theory, at the beginning of the 1930s and kept on developing it during the following years. He continued to do so until his death in 1983. The history of the undation theory thus sheds light on the history of geology in The Netherlands. I will trace the history of geology in The Netherlands using Rein van Bemmelen and his undation theory as a lens.

  8. Feng shui väärtus on vaimujõus / Marika Tomberg ; komment. Lea Eermann, komment. Rein Weber

    Index Scriptorium Estoniae

    Tomberg, Marika

    1999-01-01

    Feng shui järgi korraldatud Lea Eermanni kodust Nõmmel. Feng shui- ja geobioloogia-alase nõustamisega tegelev arhitekt Rein Weber keskkonna mõjust tervisele, magamistoast. Enda ja maja kaitsmisest halbade mõjude eest. 10 illustratsiooni

  9. Ex uno plures´est e pluribus unum´ini? / Rein Müllerson ; inglise keelest tõlkinud Marek Laane

    Index Scriptorium Estoniae

    Müllerson, Rein, 1944-

    2010-01-01

    Õigusteadlane Rein Müllerson ühiskondliku mitmekesisuse ja homogeensuse arengutest, dissimilatsiooni asendumisest assimilatsiooniga, Ida ja Lääne ühiskondade ühildumisest üleilmastumise protsessis

  10. Prise en charge des traumatismes graves du rein

    Science.gov (United States)

    Lakmichi, Mohamed Amine; Jarir, Redouane; Sadiki, Bader; Zehraoui; Bentani; Wakrim, Bader; Dahami, Zakaria; Moudouni; Sarf, Ismail

    2015-01-01

    Les traumatismes graves du rein de grade III, IV et V selon la classification de l'Amercan Society for Surgery For Trauma (ASST) sont plus rares et se retrouvent dans 5% des cas en moyenne. Leur prise en charge est souvent délicate, nécessitant alors des centres expérimentés dotés de moyen adéquats d'imagerie (scanner spiralé). Cependant, durant ces dernières années, la prise en charge de ces traumatismes a évolué vers une attitude de moins en moins chirurgicale grâce à l’évolution des techniques de la radiologie interventionnelle, de l'endourologie et des moyens de surveillance aux urgences et de réanimation. L'objectif de cette étude est d’évaluer notre expérience dans la prise en charge des traumatismes rénaux de haut grade. Notre étude rétrospective porte sur 25 cas de traumatismes grave du rein de grade III, IV et V selon la classification de l'ASST, colligés entre Janvier 2002 et Juin 2009 au service d'urologie du centre Hospitalier Universitaire Mohammed VI, Université Cadi Ayyad de Marrakech, Maroc. Nous avons étudié les données épidémiologiques, les signes cliniques et biologiques à l'admission (état de choc hémorragique, taux d'hémoglobine), les données radiologiques (échographie et scanner), les lésions associées, la prise en charge thérapeutique et les complications. L’âge moyen de nos patients était de 24,9 ans 15 et 58 ans, avec une prédominance masculine (sex-ratio = 7, 3). Le rein droit était intéressé dans 15 cas (60%). Le traumatisme rénal était fermé dans 15 cas, et ouvert par arme blanche dans 10 cas. Huit patients se sont présentés en état de choc hémorragique (32%). Une anémie inférieur à 10g /100ml a été observée dans 10 cas (40%). L'uroscanner fait systématiquement à l'admission a retrouvé un grade III (10 cas), grade IV (13 cas) et grade V (2 cas). La prise en charge a consisté en une exploration chirurgicale avec néphrectomie chez 2 cas de Grade IV pour une instabilité h

  11. Le kyste hydatique du rein fistulisé dans les voies urinaires, prise en ...

    African Journals Online (AJOL)

    Les suites ont été marquées par une fistule stercorale colique chez un patient et deux cas d'infection de paroi. Conclusion: Tout kyste hydatique du rein doit avoir un bilan d'imagerie comportant un uroscanner avec des clichés tardifs à la recherche d'une fistulisation dans la voie excrétrice urinaire. Il est conseillé de mettre ...

  12. Research-Based Teacher Education and Professional Development. Achievements and Contributions of EDiTE

    Directory of Open Access Journals (Sweden)

    Rozalia Małgorzata Ligus

    2013-12-01

    Full Text Available This article’s aim is to describe some of the sources of the European debate over the third cycle studies in teacher education in Europe. Then it will introduce the international Project EDiTE as one of the collaborative initiatives concerning the European scientific proposal of the teachers’ lifelong learning development. Next, some good practices of promoting the doctoral research based teacher education on national levels will be presented. Finally, in the article, there will be revealed selected findings of the EDiTE team that are focused on the current needs in teacher education that have been pointed by different stakeholders of five European countries represented by the project consortium, while interviewing them in 2013 y. The main goal of this article is to involve the stakeholders in a thought provoking debate for future roles of teachers in Europe, but not through looking for a ‘standardized teacher model’ or to create a ‘European super teacher’, but to see the dilemmas that should be shared while questioning ‘What makes a teacher European?,’ as Michael Schratz underlines, in a diversity of national identities and in the face of challenges of 21st century.

  13. Transfer of Air Force technical procurement bid set data to small businesses, using CALS and EDI. Summary report. Revision 1

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    1995-01-10

    This report provides a summary of the Air Force CALS Test Network (AFCTN) Test Report Transfer of Air Force Technical Procurement Bid Set Data to Small Businesses, Using CALS and EDI (AFCTN Test Report 94-034, UCRL-ID-118619). It represents a synthesis of the results, conclusions, and recommendations, as well as a more concise presentation of the issues and strategies as viewed from AFCTN`s perspective. This report documents a test transfer of three Air Force technical procurement bid sets to one large and twelve small businesses, using the Department of Defense (DoD) Continuous Acquisition and Life-cycle Support (CALS) and ANSI ASC X12 Electronic Data Interchange (EDI) standards. The main goal of the test was to evaluate the effectiveness of using CALS technical data within the context of the DoD`s EDI-based standard approach to electronic commerce in procurement, with particular emphasis on receipt and use of the data by small contractors. Air Force procurement data was provided by the Sacramento Air Logistics Center at McClellan Air Force Base; the manufacturing participants were selected from among McClellan`s {open_quote}Blue Ribbon{close_quote} contractors, located throughout the United States. The test was sponsored by the Air Force CALS Test Network, headquartered at Wright-Patterson Air Force Base. The test successfully demonstrated the technical feasibility of including CALS MIL-R-28002 (Raster) engineering data in an EDI Specification/Technical Information transaction set (ANSI ASC X12 841) when issuing electronic requests for quotation to small businesses. In many cases, the data was complete enough for the contractor participant to feel comfortable generating a quote.

  14. Calibrating MMS Electron Drift Instrument (EDI) Ambient Electron Flux Measurements and Characterizing 3D Electric Field Signatures of Magnetic Reconnection

    Science.gov (United States)

    Shuster, J. R.; Torbert, R. B.; Vaith, H.; Argall, M. R.; Li, G.; Chen, L. J.; Ergun, R. E.; Lindqvist, P. A.; Marklund, G. T.; Khotyaintsev, Y. V.; Russell, C. T.; Magnes, W.; Le Contel, O.; Pollock, C. J.; Giles, B. L.

    2015-12-01

    The electron drift instruments (EDIs) onboard each MMS spacecraft are designed with large geometric factors (~0.01cm2 str) to facilitate detection of weak (~100 nA) electron beams fired and received by the two gun-detector units (GDUs) when EDI is in its "electric field mode" to determine the local electric and magnetic fields. A consequence of the large geometric factor is that "ambient mode" electron flux measurements (500 eV electrons having 0°, 90°, or 180° pitch angle) can vary depending on the orientation of the EDI instrument with respect to the magnetic field, a nonphysical effect that requires a correction. Here, we present determinations of the θ- and ø-dependent correction factors for the eight EDI GDUs, where θ (ø) is the polar (azimuthal) angle between the GDU symmetry axis and the local magnetic field direction, and compare the corrected fluxes with those measured by the fast plasma instrument (FPI). Using these corrected, high time resolution (~1,000 samples per second) ambient electron fluxes, combined with the unprecedentedly high resolution 3D electric field measurements taken by the spin-plane and axial double probes (SDP and ADP), we are equipped to accurately detect electron-scale current layers and electric field waves associated with the non-Maxwellian (anisotropic and agyrotropic) particle distribution functions predicted to exist in the reconnection diffusion region. We compare initial observations of the diffusion region with distributions and wave analysis from PIC simulations of asymmetric reconnection applicable for modeling reconnection at the Earth's magnetopause, where MMS will begin Science Phase 1 as of September 1, 2015.

  15. A novel PSB-EDI system for high ammonia wastewater treatment, biomass production and nitrogen resource recovery: PSB system.

    Science.gov (United States)

    Wang, Hangyao; Zhou, Qin; Zhang, Guangming; Yan, Guokai; Lu, Haifeng; Sun, Liyan

    A novel process coupling photosynthetic bacteria (PSB) with electrodeionization (EDI) treatment was proposed to treat high ammonia wastewater and recover bio-resources and nitrogen. The first stage (PSB treatment) was used to degrade organic pollutants and accumulate biomass, while the second stage (EDI) was for nitrogen removal and recovery. The first stage was the focus in this study. The results showed that using PSB to transform organic pollutants in wastewater into biomass was practical. PSB could acclimatize to wastewater with a chemical oxygen demand (COD) of 2,300 mg/L and an ammonia nitrogen (NH4(+)-N) concentration of 288-4,600 mg/L. The suitable pH was 6.0-9.0, the average COD removal reached 80%, and the biomass increased by an average of 9.16 times. The wastewater COD removal was independent of the NH4(+)-N concentration. Moreover, the PSB functioned effectively when the inoculum size was only 10 mg/L. The PSB-treated wastewater was then further handled in an EDI system. More than 90% of the NH4(+)-N was removed from the wastewater and condensed in the concentrate, which could be used to produce nitrogen fertilizer. In the whole system, the average NH4(+)-N removal was 94%, and the average NH4(+)-N condensing ratio was 10.0.

  16. Choroidal Thickness Analysis in Patients with Usher Syndrome Type 2 Using EDI OCT

    OpenAIRE

    Colombo, L.; Sala, B.; Montesano, G.; Pierrottet, C.; De Cillà, S.; Maltese, P.; Bertelli, M.; Rossetti, L.

    2015-01-01

    To portray Usher Syndrome type 2, analyzing choroidal thickness and comparing data reported in published literature on RP and healthy subjects. Methods. 20 eyes of 10 patients with clinical signs and genetic diagnosis of Usher Syndrome type 2. Each patient underwent a complete ophthalmologic examination including Best Corrected Visual Acuity (BCVA), intraocular pressure (IOP), axial length (AL), automated visual field (VF), and EDI OCT. Both retinal and choroidal measures were measured. Stati...

  17. L'adénome métanéphrique bilatéral du rein

    African Journals Online (AJOL)

    ra

    L'adénome métanéphrique du rein est une tumeur épithéliale bénigne rare. Son diagnostic est exclusivement histologique. Le diagnostic différentiel se fait essentiellement avec le néphroblastome et le carcinome papillaire à cellules rénales. L'étude cytogénétique apporte des éléments importants pour différencier entre ...

  18. Mining inter-organizational business process models from EDI messages : a case study from the automotive sector

    NARCIS (Netherlands)

    Engel, R.; Aalst, van der W.M.P.; Zapletal, M.; Pichler, C.; Werthner, H.; Ralyté, J.; Franch, X.; Brinkkemper, S.; Wrycza, S.

    2012-01-01

    Traditional standards for Electronic Data Interchange (EDI), such as EDIFACT and ANSI X12, have been employed in Business-to-Business (B2B) e-commerce for decades. Due to their wide industry coverage and long-standing establishment, they will presumably continue to play an important role for some

  19. Eesti Päevaleht palus erinevate elualade esindajatel hinnata presidendikandidaatide ametissesobivust / Aivar Voog, Rein Ruutsoo, Kaur Hanson ; küsis Kai Kalamees

    Index Scriptorium Estoniae

    Voog, Aivar

    2001-01-01

    Presidendikandidaatide Toomas Savi, Andres Tarandi, Tunne Kelami, Peeter Kreitzbergi ja Peeter Tulviste kohta avaldavad arvamust Aivar Voog, Rein Ruutsoo, Kaur Hanson, Ivo Rull, Tarmu Tammerk, Mart Helme, Pavel Ivanov ja Jaan Kaplinski

  20. Inter-Organizational Trust in EDI Adoption: The Case of Ford Motor Company and PBR Limited in Australia.

    Science.gov (United States)

    Ratnasingam, Pauline

    2001-01-01

    This study examines behavioral dimensions of trading partner trust in EDI (electronic data interchange) adoption via a qualitative interpretative case study conducted between an automotive manufacturer (Ford Motor Company) in Australia and their first tier supplier, PBR Limited. Findings suggest that trust is important for cooperative long-term…

  1. Variantes textuais no Livro do Desassossego: edição, codificação e interpretação

    Directory of Open Access Journals (Sweden)

    Diego Giménez

    2016-09-01

    Full Text Available http://dx.doi.org/10.5007/1807-9288.2016v12n1p54 Em 1988, Ivo Castro, responsável pela edição crítica da obra de Fernando Pessoa para a Imprensa Nacional Casa da Moeda, perguntava, numa comunicação intitulada “Edição Crítica de Pessoa: O Modelo Editorial Adoptado”: “como negar ao leitor o máximo de conhecimento sobre o que está escrito por Pessoa nos manuscritos, quando sabemos que dentro de uma geração, provavelmente, nem o leitor, nem nós, seremos ainda capazes de decifrar a tinta sumida dos papéis?”. Neste artigo mantenho que a codificação das fases de escrita no Livro do Desassossego permite representar o processo de composição textual que é interpretado de maneira diferente pelos especialistas. A especificidade da escrita pessoana presenta uma série de dificuldades que os especialistas enfrentam de forma diferente. Desta forma, a comparação entre o trabalho realizado com a edição crítica e o trabalho realizado com a codificação informática permite pôr em paralelo os problemas e soluções adotados em dois momentos diferenciados dos estudos pessoanos e dos estudos humanísticos em geral.

  2. Inter-instrument calibration using magnetic field data from Flux Gate Magnetometer (FGM) and Electron Drift Instrument (EDI) onboard Cluster

    Science.gov (United States)

    Nakamura, R.; Plaschke, F.; Teubenbacher, R.; Giner, L.; Baumjohann, W.; Magnes, W.; Steller, M.; Torbert, R. B.; Vaith, H.; Chutter, M.; Fornaçon, K.-H.; Glassmeier, K.-H.; Carr, C.

    2013-07-01

    We compare the magnetic field data obtained from the Flux-Gate Magnetometer (FGM) and the magnetic field data deduced from the gyration time of electrons measured by the Electron Drift Instrument (EDI) onboard Cluster to determine the spin axis offset of the FGM measurements. Data are used from orbits with their apogees in the magnetotail, when the magnetic field magnitude was between about 20 nT and 500 nT. Offset determination with the EDI-FGM comparison method is of particular interest for these orbits, because no data from solar wind are available in such orbits to apply the usual calibration methods using the Alfvén waves. In this paper, we examine the effects of the different measurement conditions, such as direction of the magnetic field relative to the spin plane and field magnitude in determining the FGM spin-axis offset, and also take into account the time-of-flight offset of the EDI measurements. It is shown that the method works best when the magnetic field magnitude is less than about 128 nT and when the magnetic field is aligned near the spin-axis direction. A remaining spin-axis offset of about 0.4 ~ 0.6 nT was observed between July and October 2003. Using multi-point multi-instrument measurements by Cluster we further demonstrate the importance of the accurate determination of the spin-axis offset when estimating the magnetic field gradient.

  3. Interinstrument calibration using magnetic field data from the flux-gate magnetometer (FGM) and electron drift instrument (EDI) onboard Cluster

    Science.gov (United States)

    Nakamura, R.; Plaschke, F.; Teubenbacher, R.; Giner, L.; Baumjohann, W.; Magnes, W.; Steller, M.; Torbert, R. B.; Vaith, H.; Chutter, M.; Fornaçon, K.-H.; Glassmeier, K.-H.; Carr, C.

    2014-01-01

    We compare the magnetic field data obtained from the flux-gate magnetometer (FGM) and the magnetic field data deduced from the gyration time of electrons measured by the electron drift instrument (EDI) onboard Cluster to determine the spin-axis offset of the FGM measurements. Data are used from orbits with their apogees in the magnetotail, when the magnetic field magnitude was between about 20 and 500 nT. Offset determination with the EDI-FGM comparison method is of particular interest for these orbits, because no data from solar wind are available in such orbits to apply the usual calibration methods using the Alfvén waves. In this paper, we examine the effects of the different measurement conditions, such as direction of the magnetic field relative to the spin plane and field magnitude in determining the FGM spin-axis offset, and also take into account the time-of-flight offset of the EDI measurements. It is shown that the method works best when the magnetic field magnitude is less than about 128 nT and when the magnetic field is aligned near the spin-axis direction. A remaining spin-axis offset of about 0.4 ∼ 0.6 nT was observed for Cluster 1 between July and October 2003. Using multipoint multi-instrument measurements by Cluster we further demonstrate the importance of the accurate determination of the spin-axis offset when estimating the magnetic field gradient.

  4. Tulevast aastast alustab tööd elektrooniline andmevahetussüsteem EDI : piiriületus muutub kiiremaks / Margo Kokerov

    Index Scriptorium Estoniae

    Kokerov, Margo, 1978-

    2001-01-01

    Eesti kaubaveo logistika elektroonilise andmevahetussüsteemi EDI (Electronic Data Interchange) projekti esimese etapina käivitub piiriületuse dokumentatsiooni ja kaubadeklaratsioonide elektroonilise esitamise võimalus. Toivo Jürgenson ja Jaan Pillesaar e-piiriületuse eelistest

  5. Livros do Brasil e a edição de romances brasileiros em Portugal nos anos 1940

    Directory of Open Access Journals (Sweden)

    Thiago Mio Salla

    2017-12-01

    Full Text Available Enquanto esforço de historiografia literária e editorial, o presente artigo tem como objetivo lançar luz sobre as edições portuguesas de romances brasileiros realizadas pela editora Livros do Brasil, casa fundada em Lisboa, em 1944, por António de Sousa Pinto. A partir da recuperação de fontes primárias (com destaque para cartas e contratos, examinam-se, sobretudo, as negociações travadas entre Sousa Pinto e José Olympio no que diz respeito à edição, em Portugal, de títulos de dois importantes autores de nossa chamada geração de 1930: José Lins do Rego e Rachel de Queiroz. Mais especificamente, recupera-se o embate travado entre a atitude interventiva do editor luso, que defendia a necessidade de se ajustar o texto das obras de ambos os escritores à variante europeia do idioma, de modo a aproximá-las do leitorado português, e a recusa inicial dos romancistas, que exigiam o respeito estrito aos “brasileirismos” por eles empregados.

  6. «Dos benefícios de Deus»: três edições de um capítulo do tratado medieval português

    Directory of Open Access Journals (Sweden)

    Rita de Cássia Ribeiro Queiroz

    2010-12-01

    Full Text Available Resumo: O tratado “Dos benefícios de Deus” integra a obra da literatura medieval portuguesa intitulada Castelo perigoso, a qual é uma adaptação do texto francês escrito por Frère Robert, monge cartuxo, à sua prima Soeur Rose, da Ordem Fontevrault. A versão em língua portuguesa foi realizada no Mosteiro de Alcobaça, provavelmente no século XV, existindo dois códices (ALC 197 e ALC 214, os quais se encontram na Biblioteca Nacional de Portugal. O tratado “Dos benefícios de Deus” é o segundo na ordem dos textos que compõem a obra Castelo perigoso. Propõem-se, neste trabalho, três edições de um capítulo do tratado“Dos benefícios de Deus”, a saber: uma edição conservadora ou semidiplomática; uma edição crítica, executada a partir da collatio entre os códices ALC 197 e ALC 214 e a edição realizada por Augusto Magne na década de 1940; e, por último, uma edição modernizada. Palavras-chave: Crítica textual; edição; português medieval.  Résumé: Le traité “Dos benefícios de Deus” intègre l’oeuvre de la littérature médiévale potugaise Chastel périlleux, qui est une adaptation du texte français écrit par Robert Frère, moine chartreux, à sa cousine Soeur Rose, de l’Ordre Fontevrault. La version en langue portugaise a été réalisée au Monastère d’Alcobaça, probablement au XVe siècle: il y a deux codex (ALC 197 et ALC 214, qui sont à la Bibliothèque Nationale du Portugal. Le traité “Dos benefícios de Deus” est le deuxième dans l’ordre des textes qui constituent l’oeuvre Chastel périlleux. Sont proposées dans le présent travail trois éditions d’un chapitre du traité “Dos benefícios de Deus”, à savoir: une édition conservatrice ou semidiplomatique; une édition critique, faite à partir de la collation des manuscrits entre les codex 197 et 214 et l’édition faite par Augusto Magne en 1940; et, enfin, une édition modernisée. Mots-clés: Critique textuelle

  7. O Encheirídion de Epicteto: Edição Bilíngue

    Directory of Open Access Journals (Sweden)

    Aldo Lopes Dinucci

    2012-02-01

    Full Text Available Edição bilíngue do Encheirídion de Epicteto, obra do aluno de Epicteto (55-135 e cidadão romano de origem grega Lúcio Flávio Arriano de Nicomédia (86-160. Tal tradução, produzida por Aldo Dinucci (doutor em filosofia pela PUC-RJ e professor associado do Departamento de Filosofia da UFS e Alfredo Julien (doutor em história pela USP e professor adjunto do Departamento de História da UFS, foi financiada pelo CNPq (edital MCT/CNPq 02/2009 - Ciências Humanas, Sociais e Sociais Aplicadas.

  8. A gripe suína na Wikipédia em português: análise da dinâmica de edições e qualificação do conteúdo de dois artigos

    OpenAIRE

    Bernardo Esteves Gonçalves da Costa; Carlos Frederico de Brito d'Andréa

    2011-01-01

    Este artigo tem como objetivo analisar e comparar a edição colaborativa de dois artigos sobre pandemia de gripe A (H1N1) — ou gripe suína — na Wikipédia em português. Monitoramos as edições feitas nos dois artigos ao longo de um mês após a criação de ambos, em 25 de abril de 2009. Caracterizamos o processo de edição dos textos e a dinâmica de interações entre os editores e, de forma complementar, analisamos seu conteúdo a partir de três critérios: autoridade, verificabilidade e atualidade....

  9. A ansiedade da unidade: uma teoria da edição / L’ansia di unità: Una teoria dell’edizione

    Directory of Open Access Journals (Sweden)

    Jerónimo Pizarro

    2016-12-01

    Full Text Available Em 1973 Harold Bloom publicou o livro The Anxiety of Influence: A Theory of Poetry. Uma variação sobre este título poderá ser-nos hoje útil para abordar um outro tipo de ansiedade: o da unidade. Os campos da edição e da interpretação vivem imersos nesse outro tipo de ansiedade. Tanto a interpretação, preocupada com a intenção do autor, da obra ou do leitor, como a edição, angustiada com as intenções finais do autor e o estabelecimento do copy-text, parecem, por vezes, pouco capazes de se libertarem desse ensejo de unidade e de se adaptarem à existência da multiplicidade. Neste artigo, procuro fazer um novo apelo a uma necessária mudança de paradigma, atendendo, em especial, às novas e libertadoras possibilidades potenciadas pela edição electrónica. In 1973 Harold Bloom published his book The Anxiety of Influence: A Theory of Poetry. A variation on this title might be useful for us today to refer to another kind of anxiety: the anxiety of unity. The fields of editing and interpretation lie within this other kind of anxiety. Interpretation, concerned with the author’s, the reader’s or the work’s intention, and editing, worried about the author’s final intentions and the setting up of the copy-text, seem, at times, unable to free themselves from the need to attain unity and adapt to the existence of multiplicity. In this article I intend to make a new appeal on behalf of a change of paradigm, addressing, especially, the new and liberating possibilities of electronic editing

  10. Drought severity in intensive agricultural areas by means of the EDI index

    Science.gov (United States)

    Procházková, Petra; Chuchma, Filip; Středa, Tomáš

    2016-12-01

    The aim of this work was the evaluation of drought severity development in the Czech Republic for the period 1971-2015 by the means of the Effective Drought Index (EDI). Annual values of the EDI index were determined using the method of effective precipitation for 14 localities spread throughout the Czech Republic (Central Europe). The seven categories were created according to obtained index values for the drought conditions determination for years during the period 1971-2015 through the percentile method. The annual index values were compared with acquired 2nd, 15th, 45th, 55th, 85th and 98th percentiles. Both the years with precipitation unfavourable conditions: 1972, 1973, 1984, 1990, 1991, 1992, 1993 and 2015 and the years with precipitation favourable conditions: 1977, 1987, 1995, 2001, 2002 and 2010 were determined. Precipitation conditions in the growing season from 61st to 180th day of the year were also analysed. This evaluation was conducted during the period 1971-2015 through the ten-day index values which were compared with acquired 2nd, 15th, 45th, 55th, 85th and 98th percentiles. Dry growing seasons occurred in 1973, 1974, 1976 and 1993. Wet growing seasons occurred in 1987, 2006 and 2010. Trend analysis of annual index values was performed through the Mann-Kendall test. Highly statistically significant increasing linear trends (P < 0.01) were found for four localities (Uherský Ostroh, Vysoká, Znojmo-Oblekovice and Žatec); statistically significant increasing trends (P < 0.05) were found for three localities (Brno-Chrlice, Lednice and Lípa). Based on the extrapolation of the trend, a slightly higher effective precipitation can be expected during the year in a substantial part of the country. However, these findings do not necessarily mean an optimal supply of agricultural land with water. Precipitation exhibits considerable unevenness of distribution through time. Given the increasing evapotranspiration demands of the environment their

  11. Omnidirectional Internal Fixation by Double Approaches for Treating Rüedi-Allgöwer Type III Pilon Fractures.

    Science.gov (United States)

    Dai, Chong-Hua; Sun, Jun; Chen, Kun-Quan; Zhang, Hui-Bo

    In the present study, we explored the effectiveness and complications of omnidirectional internal fixation using a double approach for treating Rüedi-Allgöwer type III pilon fractures. A retrospective analysis was performed of 19 cases of Rüedi-Allgöwer type III unilateral closed pilon fracture. With preoperative preparation and correct surgical timing, the reduction was performed using anteromedial and posterolateral approaches, and the fracture fragments were fixed by omnidirectional internal fixation. Imaging evaluation was performed using the Burwell-Charnley scoring system. The Johner-Wruhs scoring system was used to assess the functional status of the patients. A comprehensive evaluation of efficacy was performed using a 5-point Likert score. The complications were also recorded and analyzed. All patients were followed up for an average of 16.2 months. The operative incisions of 15 cases healed by primary intent and with delayed healing in 4. All patients had achieved bony union at an average of 16 weeks postoperatively. No deep infection, broken nail or withdrawn nail, exposed plate, or skin flap necrosis occurred. The Burwell-Charnley imaging evaluation showed that 14 patients had anatomic reduction of the articular surface and 5 had acceptable reduction. Using the Johner-Wruhs scoring system, the results were excellent for 8, good for 7, fair for 2, and poor for 2 patients; the combined rate of excellent and good results was 78.9%. The Likert score of efficacy self-reported by the patients was 3 to 4 points for 12 patients, 2 points for 4 patients, and 0 to 1 point for 3 patients. The Likert score of therapeutic efficacy reported by the physicians was 3 to 4 points for 10 patients, 2 points for 5 patients, and 0 to 1 point for 4 patients. Omnidirectional internal fixation using double approaches was an effective method to treat Rüedi-Allgöwer type III pilon fractures with satisfactory reduction and rigid fixation, good joint function recovery, and

  12. Hydronéphrose géante sur rein ectopique pelvien révélée par un ...

    African Journals Online (AJOL)

    Les auteurs rapportent un cas d'hydronéphrose majeure sur un rein gauche ectopique en position pelvienne, chez un patient de 17 ans, révélé par une occlusion intestinale aigüe. Un drainage premier par néphrostomie per-cutanée écho-guidée a permis de soulager la patient. Le traitement définitif a consisté en une ...

  13. Millisecond resolution electron fluxes from the Cluster satellites: Calibrated EDI ambient electron data

    Science.gov (United States)

    Förster, Matthias; Rashev, Mikhail; Haaland, Stein

    2017-04-01

    The Electron Drift Instrument (EDI) onboard Cluster can measure 500 eV and 1 keV electron fluxes with high time resolution during passive operation phases in its Ambient Electron (AE) mode. Data from this mode is available in the Cluster Science Archive since October 2004 with a cadence of 16 Hz in the normal mode or 128 Hz for burst mode telemetry intervals. The fluxes are recorded at pitch angles of 0, 90, and 180 degrees. This paper describes the calibration and validation of these measurements. The high resolution AE data allow precise temporal and spatial diagnostics of magnetospheric boundaries and will be used for case studies and statistical studies of low energy electron fluxes in the near-Earth space. We show examples of applications.

  14. A new method used in laparoscopic hysterectomy for uterine manipulation: uterine rein technique.

    Science.gov (United States)

    Boztosun, Abdullah; Atılgan, Remzi; Pala, Şehmus; Olgan, Şafak

    2018-03-22

    The aim of this study is to define a new method of manipulating the uterus during laparoscopic hysterectomy. A total laparoscopic hysterectomy (TLH) with the newly defined technique was performed in 29 patients between July 2016 and July 2017. In this new technique, the uterus was bound from uterine corpus and fundus like a bridle with polyester tape, to allow abdominal manipulation. The technique was successfully performed at the first attempt in 93.1% of cases. It was repeated in two cases (6.9%) since the polyester tape departed away from the uterus at the first attempt. The mean application time was 11.2 min. The vaginal manipulator was not required in any of the cases. There were no intraoperative complications. In conclusion, this method has the advantages of not requiring any vaginal manipulator, reducing the number of people required during operation, permitting a near maximum manipulation of the uterus in all three dimensions, and giving the control of these manipulations directly to the surgeon. On the other hand, the technique also has some inadequacies which should be discussed and improved on in the future. Impact of statement What is already known on this subject? In a laparoscopic hysterectomy, manipulation of the uterus is essential for anatomical dissection of the regions and completion of the operation without complications. An ideal uterine manipulator is defined as inexpensive, as convenient, fast and suitable for injecting solutions, removing the need for an assistant and most importantly offering the most suitable range of motion. In this study, we describe a new and different technique (rein technique) allowing the abdominal manipulation of the uterus in a laparoscopic hysterectomy and discuss the advantages and disadvantages of this method. What do the results of this study add? The procedure was easily accomplished in most patients. We did not need to use an extra uterine manipulator in any of the cases. What are the implications of these

  15. Risk profile, quality of life and care of patients with moderate and advanced CKD : The French CKD-REIN Cohort Study.

    Science.gov (United States)

    Stengel, Bénédicte; Metzger, Marie; Combe, Christian; Jacquelinet, Christian; Briançon, Serge; Ayav, Carole; Fouque, Denis; Laville, Maurice; Frimat, Luc; Pascal, Christophe; Herpe, Yves-Edouard; Morel, Pascal; Deleuze, Jean-François; Schanstra, Joost P; Lange, Céline; Legrand, Karine; Speyer, Elodie; Liabeuf, Sophie; Robinson, Bruce M; Massy, Ziad A

    2018-04-09

    The French Chronic Kidney Disease-Renal Epidemiology and Information Network (CKD-REIN) cohort study was designed to investigate the determinants of prognosis and care of patients referred to nephrologists with moderate and advanced chronic kidney disease (CKD). We examined their baseline risk profile and experience. We collected bioclinical and patient-reported information from 3033 outpatients with CKD and estimated glomerular filtration rates (eGFRs) of 15-60 mL/min/1.73 m2 treated at 40 nationally representative public and private facilities. The patients' median age was 69 (60-76) years, 65% were men, their mean eGFR was 33 mL/min/1.73 m2, 43% had diabetes, 24% had a history of acute kidney injury (AKI) and 57% had uncontrolled blood pressure (BP; >140/90 mmHg). Men had worse risk profiles than women and were more likely to be past or current smokers (73% versus 34%) and have cardiovascular disease (59% versus 42%), albuminuria >30 mg/mmol (or proteinuria > 50) (40% versus 30%) (all P REIN study highlights high-risk profiles of cohort members and identifies several priorities, including improving BP control and dietary counselling and increasing doctors' awareness of AKI, polypharmacy and QoL. ClinicalTrials.gov identifier: NCT03381950.

  16. Interhemispheric differences in ionospheric convection: Cluster EDI observations revisited

    Science.gov (United States)

    Förster, M.; Haaland, S.

    2015-07-01

    The interaction between the interplanetary magnetic field and the geomagnetic field sets up a large-scale circulation in the magnetosphere. This circulation is also reflected in the magnetically connected ionosphere. In this paper, we present a study of ionospheric convection based on Cluster Electron Drift Instrument (EDI) satellite measurements covering both hemispheres and obtained over a full solar cycle. The results from this study show that average flow patterns and polar cap potentials for a given orientation of the interplanetary magnetic field can be very different in the two hemispheres. In particular during southward directed interplanetary magnetic field conditions, and thus enhanced energy input from the solar wind, the measurements show that the southern polar cap has a higher cross polar cap potential. There are persistent north-south asymmetries, which cannot easily be explained by the influence of external drivers. These persistent asymmetries are primarily a result of the significant differences in the strength and configuration of the geomagnetic field between the Northern and Southern Hemispheres. Since the ionosphere is magnetically connected to the magnetosphere, this difference will also be reflected in the magnetosphere in the form of different feedback from the two hemispheres. Consequently, local ionospheric conditions and the geomagnetic field configuration are important for north-south asymmetries in large regions of geospace.

  17. Edição Temática “Cidades inteligentes: planejamento e gestão da sustentabilidade”

    OpenAIRE

    Cláudia Terezinha Kniess

    2016-01-01

    É com satisfação que apresentamos a edição temática da revista Gestão e Secretariado – Revista GeSec - com foco em “Cidades inteligentes: planejamento e gestão da sustentabilidade”. Os estudos nesta temática respondem a uma forte demanda da sociedade para o enfrentamento dos desafios atuais relacionados à crescente concentração da população nos centros urbanos e à diversidade de problemas técnicos e políticos relacionados a esta dinâmica.   A revista GeSeC é classificada como Qualis B...

  18. Determination of endogenous and exogenous corticosteroids in bovine urine and effect of fighting stress during the "Batailles des Reines" on their biosynthesis.

    Science.gov (United States)

    Leporati, Marta; Nobile, Maria; Capra, Pierluigi; Alladio, Eugenio; Vincenti, Marco

    2017-10-01

    Natural corticosteroids include two families of substances: mineralocorticoids and glucocorticoids. Several drugs of similar structure and biological activity have been synthesized and are currently used in the clinical practice. Beside legal pharmacological treatments, these drugs have been consistently misused in animal breeding. One of the most abused corticosteroids is prednisolone. For many years, prednisolone has been considered of exclusive synthetic origin, but nowadays a debate about its possible endogenous production is under way. Several studies have been addressed to ascertain the potential relationship between stressful conditions, such as transportation and slaughtering, and endogenous production of prednisolone. In order to verify further the effect of stressful conditions, our laboratory analysed urine samples collected from the cows participating to the "Batailles des Reines" (a traditional contest based on ritual and spontaneous fights of pregnant cows), to verify if an endogenous prednisolone production may occur in these animals. We developed and validated a LC-MS/MS method for the simultaneous determination of cortisol, cortisone, prednisolone and five of its metabolites. The method was applied to the analysis of urine samples collected from "Batailles des Reines" competitions in 2012 and 2013. All these samples had been previously analysed within an anti-doping control program and tested compliant to all screenings. Copyright © 2017 Elsevier Ltd. All rights reserved.

  19. Um 13 de maio antecipado: edições temáticas, atualidade e memória no circuito TRIP e TPM

    Directory of Open Access Journals (Sweden)

    Frederico de Mello Brandão Tavares

    2016-05-01

    Full Text Available Em abril de 2014, as revistas brasileiras TRIP e TPM publicaram uma edição temática, sob o mesmo título base – “Ser negro/negra no Brasil é f*da”, e estabeleceram um diálogo editorial a partir de um gancho temporal: o dia 13 de maio, quando se comemora a abolição da escravatura no país. Com um mês de antecedência e a partir de coberturas estruturadas por conteúdos específicos, em contato ou não, as publicações anteciparam o acontecimento, previsto, encerrando-o em uma “totalidade” de pautas, acionada por seções e provocadora de um circuito que, antes do “acontecer do acontecimento”, atualizou-o como temática, indicando seus sentidos. Neste contexto, o presente artigo observa relações existentes em acionamentos acontecimentais no jornalismo, mesmo quando estes não partem de uma cobertura factual. Tendo como objeto as edições de TRIP e TPM indicadas, busca-se percorrer a transversalidade originada pela tematização das revistas e compreender as afetações e/ou “determinações” que nela aparecem.

  20. Hommikuti peab sul olema suurim soov teatrisse tulla ja tööpäeva lõpus peab sul olema suurim soov koju minna / Rein Neimar ; intervjueerinud Triin Sinissaar

    Index Scriptorium Estoniae

    Neimar, Rein

    2011-01-01

    Intervjuu Tallinna Linnateatri asedirektori Rein Neimariga, kes tähistas 24. märtsil oma 60. sünnipäeva. Leningradi õppima minekust, teatritööst kui kollektiivsest tööst, teatriimest, sellest, mida teater on talle andnud jm.

  1. Integrating effective drought index (EDI) and remote sensing derived parameters for agricultural drought assessment and prediction in Bundelkhand region of India

    Science.gov (United States)

    Padhee, S. K.; Nikam, B. R.; Aggarwal, S. P.; Garg, V.

    2014-11-01

    Drought is an extreme condition due to moisture deficiency and has adverse effect on society. Agricultural drought occurs when restraining soil moisture produces serious crop stress and affects the crop productivity. The soil moisture regime of rain-fed agriculture and irrigated agriculture behaves differently on both temporal and spatial scale, which means the impact of meteorologically and/or hydrological induced agriculture drought will be different in rain-fed and irrigated areas. However, there is a lack of agricultural drought assessment system in Indian conditions, which considers irrigated and rain-fed agriculture spheres as separate entities. On the other hand recent advancements in the field of earth observation through different satellite based remote sensing have provided researchers a continuous monitoring of soil moisture, land surface temperature and vegetation indices at global scale, which can aid in agricultural drought assessment/monitoring. Keeping this in mind, the present study has been envisaged with the objective to develop agricultural drought assessment and prediction technique by spatially and temporally assimilating effective drought index (EDI) with remote sensing derived parameters. The proposed technique takes in to account the difference in response of rain-fed and irrigated agricultural system towards agricultural drought in the Bundelkhand region (The study area). The key idea was to achieve the goal by utilizing the integrated scenarios from meteorological observations and soil moisture distribution. EDI condition maps were prepared from daily precipitation data recorded by Indian Meteorological Department (IMD), distributed within the study area. With the aid of frequent MODIS products viz. vegetation indices (VIs), and land surface temperature (LST), the coarse resolution soil moisture product from European Space Agency (ESA) were downscaled using linking model based on Triangle method to a finer resolution soil moisture product

  2. Choroidal Thickness Analysis in Patients with Usher Syndrome Type 2 Using EDI OCT.

    Science.gov (United States)

    Colombo, L; Sala, B; Montesano, G; Pierrottet, C; De Cillà, S; Maltese, P; Bertelli, M; Rossetti, L

    2015-01-01

    To portray Usher Syndrome type 2, analyzing choroidal thickness and comparing data reported in published literature on RP and healthy subjects. Methods. 20 eyes of 10 patients with clinical signs and genetic diagnosis of Usher Syndrome type 2. Each patient underwent a complete ophthalmologic examination including Best Corrected Visual Acuity (BCVA), intraocular pressure (IOP), axial length (AL), automated visual field (VF), and EDI OCT. Both retinal and choroidal measures were measured. Statistical analysis was performed to correlate choroidal thickness with age, BCVA, IOP, AL, VF, and RT. Comparison with data about healthy people and nonsyndromic RP patients was performed. Results. Mean subfoveal choroidal thickness (SFCT) was 248.21 ± 79.88 microns. SFCT was statistically significant correlated with age (correlation coefficient -0.7248179, p patients (p = 0.2138). Conclusions. Our study demonstrated in vivo choroidal thickness reduction in patients with Usher Syndrome type 2. These data are important for the comprehension of mechanisms of disease and for the evaluation of therapeutic approaches.

  3. The French Chronic Kidney Disease-Renal Epidemiology and Information Network (CKD-REIN) cohort study.

    Science.gov (United States)

    Stengel, Bénédicte; Combe, Christian; Jacquelinet, Christian; Briançon, Serge; Fouque, Denis; Laville, Maurice; Frimat, Luc; Pascal, Christophe; Herpe, Yves-Edouard; Deleuze, Jean-François; Schanstra, Joost; Pisoni, Ron L; Robinson, Bruce M; Massy, Ziad A

    2014-08-01

    While much has been learned about the epidemiology and treatment of end-stage renal disease (ESRD) in the last 30 years, chronic kidney disease (CKD) before the end-stage has been less investigated. Not enough is known about factors associated with CKD progression and complications, as well as its transition to ESRD. We designed the CKD-renal epidemiology and information network (REIN) cohort to provide a research platform to address these key questions and to assess clinical practices and costs in patients with moderate or advanced CKD. A total of 46 clinic sites and 4 renal care networks participate in the cohort. A stratified selection of clinic sites yields a sample that represents a diversity of settings, e.g. geographic region, and public versus for-profit and non-for-profit private clinics. In each site, 60-90 patients with CKD are enrolled at a routine clinic visit during a 12-month enrolment phase: 3600 total, including 1800 with Stage 3 and 1800 with Stage 4 CKD. Follow-up will continue for 5 years, including after initiation of renal replacement therapy. Data will be collected from medical records at inclusion and at yearly intervals, as well as from self-administered patient questionnaires and provider-level questionnaires. Patients will also be interviewed at baseline, and at 1, 3 and 5 years. Healthcare costs will also be determined. Blood and urine samples will be collected and stored for future studies on all patients at enrolment and at study end, and at 1 and 3 years in a subsample of 1200. The CKD-REIN cohort will serve to improve our understanding of the biological, clinical and healthcare system determinants associated with CKD progression and adverse outcomes as well as of international variations in collaboration with the CKD Outcome and Practice Pattern Study (CKDopps). It will foster CKD epidemiology and outcomes research and provide evidence to improve the health and quality of life of patients with CKD and the performances of the

  4. [The French Chronic Kidney Disease-Renal Epidemiology and Information Network (CKD-REIN) cohort study: To better understand chronic kidney disease].

    Science.gov (United States)

    Stengel, Bénédicte; Combe, Christian; Jacquelinet, Christian; Briançon, Serge; Fouque, Denis; Laville, Maurice; Frimat, Luc; Pascal, Christophe; Herpe, Yves-Édouard; Morel, Pascal; Deleuze, Jean-François; Schanstra, Joost P; Pisoni, Ron L; Robinson, Bruce M; Massy, Ziad A

    2016-04-01

    Preserving kidney function and improving the transition from chronic kidney disease to end stage is a research and healthcare challenge. The national Chronic Kidney Disease-Renal Epidemiology and Information Network (CKD-REIN) cohort was established to identify the determinants, biomarkers and practice patterns associated with chronic kidney disease outcomes. The study will include more than 3000 adult patients with moderate to advanced chronic kidney disease from a representative sample of 40 nephrology clinics with respect to regions and legal status, public or private. Patients are recruited during a routine visit and followed for 5 years, before and after starting renal replacement therapy. Patient-level clinical, biological, and lifestyle data are collected annually, as well as provider-level data on clinical practices, coordinated with the International Chronic Kidney Disease Outcomes and Practice Pattern Study. Blood and urine samples are stored in a biobank. Major studied outcomes include survival, patient-reported outcomes, disease progression and hospitalizations. More than 13,000 eligible patients with chronic kidney disease were identified, 60% with stage 3 and 40% with stage 4. Their median age is 72 years [interquartile range, 62-80 years], 60% are men and 38% have diabetes. By the end of December 2015, 2885 patients were included. The CKD-REIN cohort will serve to improve our understanding of chronic kidney disease and provide evidence to improve patient survival and quality of life as well as health care system performances. Copyright © 2016 Association Société de néphrologie. All rights reserved.

  5. Arhitektuurselt põnev, kuid muuseumina saamatu võidutöö : ERM / Rein Murula ; interv. Reet Varblane

    Index Scriptorium Estoniae

    Murula, Rein, 1955-

    2006-01-01

    Intervjuu Eesti Rahva Muuseumi hoone arhitektuurivõistluse žüriiliikme arhitekt Rein Murulaga. Konkursist, kaasaegsest muuseumihoonest, võidutööst "Memory Field" (autorid itaalia arhitekt Dan Dorell, liibanoni arhitekt Lina Ghotmeh, jaapani arhitekt Tsuyoshi Tane), II preemia saanud tööst "Gems" (autorid soome arhitektid Juho Grönholm, Antti Nousjoki, Janne Teräsvirta, Samuli Woolston), III preemia saanud tööst "Estonia is on the verge of a new millennium" (autorid austria arhitektid Alfred Bramberger, Thomas Pucher, Heidrun Steinhauser, Martin Mathy, Christa Pucher), ostupreemia pälvinud töödest "Crochet" (AB Kosmos: Ott Kadarik, Villem Tomiste, Mihkel Tüür, Krista Saluveer, Urmas Oja) ja "Lake Whisper" (autorid šveitsi arhitektid Manuel Bieler, Marco de Francesco, Antoine Robert-Grandpierre, Laurent Saurer)

  6. (Desmetaforizando significados na pós-edição: um estudo exploratório do esforço despendido por estudantes de tradução

    Directory of Open Access Journals (Sweden)

    Adriana Silvina Pagano

    2014-03-01

    Full Text Available Este artigo examina dados de um experimento-piloto e tem por objetivo investigar o esforço despendido por estudantes de tradução em uma tarefa de pós-edição, a partir da análise de pausas e movimentos recursivos registrados durante a produção textual em tempo real para instâncias gramaticalmente metafóricas (cf. HALLIDAY,1998. O estudo contempla o processo e o produto da pós-edição de três alunos de pós-graduação em tradução. Para se proceder à análise, foram observados os registros de uso de teclado e movimentos de cursor mapeados pelo programa Translog 2006 para a produção textual em tempo real. Como resultado, verificou-se um grande esforço para se processar algumas instâncias gramaticalmente metafóricas, sendo que esse esforço não resultou em uma maior adequação dos significados produzidos.

  7. Avaliação da anotação semântica do PALAVRAS e sua pós-edição manual para o Corpus Summ-it

    Directory of Open Access Journals (Sweden)

    Élen Cátia Tomazela

    2011-01-01

    Full Text Available Este artigo apresenta uma avaliação da anotação semântica automática do parser PALAVRAS e sua pós-edição manual para um corpus de textos em português – o Corpus Summ-it. Essa pós-edição visou ao aprimoramento de um modelo linguístico para a sumarização automática de textos e buscou atribuir  etiquetas semânticas mais adequadas aos itens lexicais, comparadas às empregadas pelo parser. Essa tarefa foi realizada por linguistas e os casos problemáticos são apresentados neste artigo, os quais levam a considerações sobre o próprio modelo de etiquetagem do PALAVRAS. O corpus revisado estará disponível para a comunidade e poderá ser útil para várias aplicações de Processamento de Línguas Naturais.

  8. Avaliação da anotação semântica do PALAVRAS e sua pós-edição manual para o Corpus Summ-it

    Directory of Open Access Journals (Sweden)

    Élen Cátia Tomazela

    2011-01-01

    Full Text Available Este artigo apresenta uma avaliação da anotação semântica automática do parser PALAVRAS e sua pós-edição manual para um corpus de textos em português – o Corpus Summ-it. Essa pós-edição visou ao aprimoramento de um modelo linguístico para a sumarização automática de textos e buscou atribuir  etiquetas semânticas mais adequadas aos itens lexicais, comparadas às empregadas pelo parser. Essa tarefa foi realizada por linguistas e os casos problemáticos são apresentados neste artigo, os quais levam a considerações sobre o próprio modelo de etiquetagem do PALAVRAS. O corpus revisado estará disponível para a comunidade e poderá ser útil para várias aplicações de Processamento de Línguas Naturais.

  9. [Tiit-Rein Viitso. Līvõkīel-estikīel-leţkīel sõnārōntõz] / Eberhard Winkler

    Index Scriptorium Estoniae

    Winkler, Eberhard, 1955-

    2013-01-01

    Arvustus: Līvõkīel-estikīel-leţkīel sõnārōntõz = Liivi-eesti-läti sõnaraamat = Lībiešu-igauņu-latviešu vārdnīca / [koostamine:] Tiit-Rein Viitso, [toimetamine ja läti vasted:] Valts Ernštreits. Riga : Latviešu valodas aģentūra ; Tartu : Tartu Ülikool, 2012

  10. Sarcome à cellules claires du rein : À propos d’un cas chez un jeune de 17 ans

    Science.gov (United States)

    Mazdar, Adil; Sakel, Adil Ait; Essatara, Younes; Beddouche, Ali; Elsayegh, Hachem; Iken, Ali; Benslimane, Lounis; Nouini, Yassine

    2014-01-01

    Résumé Le sarcome à cellules claires du rein (SCCR) se voit très rarement chez les jeunes. Il est caractérisé par une évolution agressive marquée par un taux élevé de récidive et de mortalité. Nous rapportons le cas d’un SCCR chez un patient de 17 ans et nous discutons de son apport et de son intérêt médical en vue d’une bonne prise en charge thérapeutique. L’agressivité du SCCR et la prolifération de métastases surtout osseuses impliquent qu’il ne faut pas méconnaître ce diagnostic afin de mettre en place un traitement adapté. PMID:24940474

  11. In Order to Translate the Pāli Canon: Reine Sprache on the Other Side of the Möbius Strip

    Directory of Open Access Journals (Sweden)

    Nils Goran Skare

    2018-05-01

    Full Text Available The present study proposes to analyze some potentialities in the translation of the pāli canon, language in which are the writings of Theravāda buddhism. In order to do this, we use the concept of pure language (reine Sprache as formulated by Benjamin. After this, we proceed to a reading of the concept under the light of buddhist doctrine. Thus, we defend a Revelation without Creator, which brings us to the idea of pure language as a karmic parameter. In our discussion, we point to translating as a practice. In our conclusion, we translate some verses from the Dhammapada and we discuss them, and we respond to some possible objections.

  12. Plasma convection in the magnetotail lobes: statistical results from Cluster EDI measurements

    Directory of Open Access Journals (Sweden)

    S. Haaland

    2008-08-01

    Full Text Available A major part of the plasma in the Earth's magnetotail is populated through transport of plasma from the solar wind via the magnetotail lobes. In this paper, we present a statistical study of plasma convection in the lobes for different directions of the interplanetary magnetic field and for different geomagnetic disturbance levels. The data set used in this study consists of roughly 340 000 one-minute vector measurements of the plasma convection from the Cluster Electron Drift Instrument (EDI obtained during the period February 2001 to June 2007. The results show that both convection magnitude and direction are largely controlled by the interplanetary magnetic field (IMF. For a southward IMF, there is a strong convection towards the central plasma sheet with convection velocities around 10 km s−1. During periods of northward IMF, the lobe convection is almost stagnant. A By dominated IMF causes a rotation of the convection patterns in the tail with an oppositely directed dawn-dusk component of the convection for the northern and southern lobe. Our results also show that there is an overall persistent duskward component, which is most likely a result of conductivity gradients in the footpoints of the magnetic field lines in the ionosphere.

  13. The Psychology of Music, editado por Diana Deutsch, 3ª edição: resenha dos capítulos 10 a 13

    Directory of Open Access Journals (Sweden)

    Ricieri Carlini Zorzal

    2016-03-01

    Full Text Available O presente texto traz uma resenha de quatro capítulos da terceira edição do livro The Psychology of Music, editado por Diana Deutsch. Nominalmente, são analisados os seguintes capítulos: 10 Performance musical: movimento e coordenação, de autoria de Caroline Palmer; 11 Desenvolvimento musical, de autoria de Laurel Trainor e Erin Hannon; 12 Música e habilidades cognitivas, de autoria de Glenn Schellenberg e Michael Weiss; e 13 As fundações biológicas da música: insights da amusia congênita, de autoria de Isabelle Peretz.

  14. Choroidal Thickness Analysis in Patients with Usher Syndrome Type 2 Using EDI OCT

    Directory of Open Access Journals (Sweden)

    L. Colombo

    2015-01-01

    Full Text Available To portray Usher Syndrome type 2, analyzing choroidal thickness and comparing data reported in published literature on RP and healthy subjects. Methods. 20 eyes of 10 patients with clinical signs and genetic diagnosis of Usher Syndrome type 2. Each patient underwent a complete ophthalmologic examination including Best Corrected Visual Acuity (BCVA, intraocular pressure (IOP, axial length (AL, automated visual field (VF, and EDI OCT. Both retinal and choroidal measures were measured. Statistical analysis was performed to correlate choroidal thickness with age, BCVA, IOP, AL, VF, and RT. Comparison with data about healthy people and nonsyndromic RP patients was performed. Results. Mean subfoveal choroidal thickness (SFCT was 248.21±79.88 microns. SFCT was statistically significant correlated with age (correlation coefficient −0.7248179, p<0.01. No statistically significant correlation was found between SFCT and BCVA, IOP, AL, VF, and RT. SFCT was reduced if compared to healthy subjects (p<0.01. No difference was found when compared to choroidal thickness from nonsyndromic RP patients (p=0.2138. Conclusions. Our study demonstrated in vivo choroidal thickness reduction in patients with Usher Syndrome type 2. These data are important for the comprehension of mechanisms of disease and for the evaluation of therapeutic approaches.

  15. High-latitude plasma convection during Northward IMF as derived from in-situ magnetospheric Cluster EDI measurements

    Directory of Open Access Journals (Sweden)

    M. Förster

    2008-09-01

    Full Text Available In this study, we investigate statistical, systematic variations of the high-latitude convection cell structure during northward IMF. Using 1-min-averages of Cluster/EDI electron drift observations above the Northern and Southern polar cap areas for six and a half years (February 2001 till July 2007, and mapping the spatially distributed measurements to a common reference plane at ionospheric level in a magnetic latitude/MLT grid, we obtained regular drift patterns according to the various IMF conditions. We focus on the particular conditions during northward IMF, where lobe cells at magnetic latitudes >80° with opposite (sunward convection over the central polar cap are a permanent feature in addition to the main convection cells at lower latitudes. They are due to reconnection processes at the magnetopause boundary poleward of the cusp regions. Mapped EDI data have a particular good coverage within the central part of the polar cap, so that these patterns and their dependence on various solar wind conditions are well verified in a statistical sense. On average, 4-cell convection pattern are shown as regular structures during periods of nearly northward IMF with the tendency of a small shift toward negative clock angles. The positions of these high-latitude convection foci are within 79° to 85° magnetic latitude and 09:00–15:00 MLT. The MLT positions are approximately symmetric ±2 h about 11:30 MLT, i.e. slightly offset from midday toward prenoon hours, while the maximum (minimum potential of the high-latitude cells is at higher magnetic latitudes near their maximum potential difference at ≈−10° to −15° clock angle for the North (South Hemisphere. With increasing clock angle distances from ≈IMFBz+, a gradual transition occurs from the 4-cell pattern via a 3-cell to the common 2-cell convection pattern, in the course of which one of the medium-scale high-latitude dayside cells diminishes and disappears while the

  16. O, 5 mm: a nova edição brasileira de Problemas da poética de Dostoiévski/0.5 mm: The New Brazilian Edition of Problems of Dostoevsky’s Poetics

    Directory of Open Access Journals (Sweden)

    Adriana Pucci Penteado de Faria e Silva

    2011-11-01

    Full Text Available RESUMO: Neste artigo, retomo brevemente a história da recepção de Problemas da poética de Dostoiévski, de Mikhail Bakhtin, no Brasil, estabelecendo alguns paralelos com aspectos da recepção da obra na Itália, na França e nos Estados Unidos, para, então, descrever os acréscimos da nova edição brasileira e analisar, considerando a relevância da obra para os estudos da linguagem, algumas modificações efetuadas pelo tradutor Paulo Bezerra na quarta edição da obra, lançada em 2008. ABSTRACT: In this article I briefly review the history of the Brazilian reception of Mikhail Bakhtin’s Problems of Dostoevsky’s Poetics, establishing a few parallels with aspects of this work’s reception in Italy, France, and the United States in order to describe the additions made to the new Brazilian edition and, considering the relevance of this work to Language Studies, analyze some changes proposed by translator Paulo Bezerra in its

  17. Využití možností IoT pro reinženýring podnikových procesů

    OpenAIRE

    Hujňák, Vilém

    2017-01-01

    Bakalářská práce se zabývá problematikou reinženýringu podnikových procesů s využitím možností Internetu věcí. V práci je navržena metoda implementace IoT procesním způsobem a ověřena na případové studii procesu zajištění pohybu oprávněných osob ve firemních prostorách s vyžitím vícefaktorové autentizace. The bachelor's thesis deals with the issue of Business Process Reengineering using possibilities of the Internet of Things. The thesis describes a method for implementing IoT solutions in...

  18. A construção sociológica de uma posição regionalista: Reflexões sobre a edição e recepção de Casa-grande & senzala de Gilberto Freyre

    Directory of Open Access Journals (Sweden)

    Sorá Gustavo

    1998-01-01

    Full Text Available Este artigo analisa disputas e momentos de inflexão no processo de autonomização das ciências sociais e das estruturas de produção e circulação de mensagens escritas sobre o Brasil, a partir da análise da edição e recepção de Casa-grande & senzala, de Gilberto Freyre. Entre os sucessivos prefácios do livro, da 1ª à 14ª edições, e a consagração de autores como Florestan Fernandes, desenvolve-se uma prolongada e violenta batalha simbólica para universalizar as formas legítimas (estilos narrativos, projetos institucionais, fórmulas editoriais, invenção e representação de comunidades de leitores para pensar o Brasil. Seguindo este percurso, o artigo mostra como as representações que pesam sobre Freyre e seu livro de estréia, como regionalista, derivam tanto das posições e concepções que Freyre foi assumindo em sua trajetória, quanto das posições que foram se impondo no campo intelectual a partir dos anos 40 em São Paulo, com o objetivo de consolidar a "Sociologia científica e nacional". Somando à interpretação dos discursos os princípios de sua dispersão, como a edição e a institucionalização dos saberes universitários, o artigo busca compreender como livro e autor chegaram a ser o que são hoje em dia à luz de mudanças nos mecanismos de seleção do panteão dos intérpretes do Brasil.

  19. Grupo escolar de Alfarnate (Málaga: colegio y casas para maestros de José María Santos Rein

    Directory of Open Access Journals (Sweden)

    Sergio Romero Bueno

    2015-01-01

    Full Text Available Este artículo estudia y destaca el valor arquitectónico del grupo escolar de Alfarnate (un colegio y once viviendas para maestros, por su singularidad constructiva de claro tinte racionalista y por desarrollar un funcionalismo propio del Movimiento Moderno. Su atrevida modernidad, para un lugar alejado del núcleo urbano de Málaga, trascendió la arquitectura popular y tradicional para establecer su prevalencia como solución a los problemas de escolarización y de habitabilidad en la zona rural en los años sesenta del siglo XX. Documentamos y analizamos las vicisitudes que el arquitecto José María Santos Rein consiguió superar para realizar la obra y aportamos un estudio formal para dejar constancia de su existencia tras la inevitable demolición de las once casas en el año 2011.

  20. Estudo comparativo sobre as atividades experimentais em coleções de Física coincidentes recomendados nas edições 2012 e 2015 do PNLD

    Directory of Open Access Journals (Sweden)

    Wendel Fajardo Reis

    2016-09-01

    Full Text Available http://dx.doi.org/10.5007/2175-7941.2016v33n2p462   O Ensino Médio pressupõe uma aprendizagem abrangente e significativa dos conteúdos, em que o professor deve valer-se de recursos didáticos disponíveis e adequados à sua prática. Nessa perspectiva, a atividade experimental torna-se um importante instrumento de ensino a ser explorado no estudo da Física, que também pode ser vivenciado pelos alunos por meio do livro didático (LD. Nesta pesquisa, realiza-se uma análise comparativa das atividades experimentais nas coleções de Física coincidentes nas edições de 2012 e 2015 do Programa Nacional do Livro Didático (PNLD. Para isso, aplica-se a classificação proposta por Barros (2009, fundamentada em competências e habilidades dos Parâmetros Curriculares Nacionais para o Ensino Médio (PCNEM (BRASIL, 1999 e nos temas estruturadores de suas orientações educacionais complementares (PCN+ (BRASIL, 2002. Os resultados mostram uma distribuição não uniforme dos experimentos nos temas da Física, em que ainda prevalecem os arranjos relacionados aos movimentos dos corpos. Para as categorias e dimensões de análise, verifica-se que os autores procuram evidenciar as competências e habilidades do PCNEM, entretanto os aspectos históricos sociais continuam pouco contemplados nas duas edições do Programa. Por fim, espera-se que as informações apresentadas nesse trabalho possam contribuir para a prática docente, com foco nas atividades experimentais dos livros didáticos de Física.

  1. JAMSTEC E-library of Deep-sea Images (J-EDI) Realizes a Virtual Journey to the Earth's Unexplored Deep Ocean

    Science.gov (United States)

    Sasaki, T.; Azuma, S.; Matsuda, S.; Nagayama, A.; Ogido, M.; Saito, H.; Hanafusa, Y.

    2016-12-01

    The Japan Agency for Marine-Earth Science and Technology (JAMSTEC) archives a large amount of deep-sea research videos and photos obtained by JAMSTEC's research submersibles and vehicles with cameras. The web site "JAMSTEC E-library of Deep-sea Images : J-EDI" (http://www.godac.jamstec.go.jp/jedi/e/) has made videos and photos available to the public via the Internet since 2011. Users can search for target videos and photos by keywords, easy-to-understand icons, and dive information at J-EDI because operating staffs classify videos and photos as to contents, e.g. living organism and geological environment, and add comments to them.Dive survey data including videos and photos are not only valiant academically but also helpful for education and outreach activities. With the aim of the improvement of visibility for broader communities, we added new functions of 3-dimensional display synchronized various dive survey data with videos in this year.New Functions Users can search for dive survey data by 3D maps with plotted dive points using the WebGL virtual map engine "Cesium". By selecting a dive point, users can watch deep-sea videos and photos and associated environmental data, e.g. water temperature, salinity, rock and biological sample photos, obtained by the dive survey. Users can browse a dive track visualized in 3D virtual spaces using the WebGL JavaScript library. By synchronizing this virtual dive track with videos, users can watch deep-sea videos recorded at a point on a dive track. Users can play an animation which a submersible-shaped polygon automatically traces a 3D virtual dive track and displays of dive survey data are synchronized with tracing a dive track. Users can directly refer to additional information of other JAMSTEC data sites such as marine biodiversity database, marine biological sample database, rock sample database, and cruise and dive information database, on each page which a 3D virtual dive track is displayed. A 3D visualization of a dive

  2. O objecto dúctil: a emergência de uma sociologia histórica da edição The ductile object: emergency a historical sociology of publishing

    Directory of Open Access Journals (Sweden)

    Nuno Medeiros

    2010-12-01

    Full Text Available Localizada, desde o início das diligências explicativas para a apreender, numa matriz temática e disciplinar em que se multiplicam os cruzamentos, a edição de livros foi sendo construída como objeto para cuja captura e definição convergiu e converge sinuosamente um feixe de tradições e perspectivas, tanto na sociologia como na história. Este artigo procura estabelecer um percurso sistematizado que se possa constituir para o leitor interessado como baliza de entendimento de um campo de pesquisa teórica e empírica em construção, que aqui se denomina "sociologia histórica da edição". Projeto necessariamente parcelar, o propósito apresentado concretiza-se seletivamente, tentando proceder a uma exploração do tema a partir especificamente de duas tradições, a francesa e a anglo-saxônica, com enfoque particular na produção do último meio século.Since the first attempts to apprehend and explain the phenomenon, book publishing has been apprehended within a disciplinary and thematic context formed by a constellation of traditions and approaches in both sociology and history with multiple interconnections. This article looks to provide a systematic framework for the reader interested in gaining an understanding of one particular field of theoretical and empirical research, what I call here a historical sociology of publishing. A necessarily incomplete project, the approach is purposefully selective, examining the theme through the exploration of two specific traditions, French and Anglo-Saxon, with a particular focus on the last half century.

  3. [Case-control study on effects of external fixation combined with limited internal fixation for the treatment of Pilon fractures of Rüedi-Allgower type III].

    Science.gov (United States)

    Duan, Da-Peng; You, Wu-Lin; Ji, Le; Zhang, Yong-Tao; Dang, Xiao-Qian; Wang, Kun-Zheng

    2014-01-01

    To analyze the effects of three surgical operations in the treatment of Pilon fracture of Rüedi-Allgower type III, and put forward the best therapeutic method. The clinical data of 33 patients with Pilon fracture who received surgical operations (plaster immobilization group, 10 cases; distal tibia anatomical plate group, 11 cases; external fixation with limited internal fixation group, 12 cases) from October 2009 to January 2012 were analyzed. There were 5 males and 5 females, ranging in age from 24 to 61 years in the plaster immobilization group. There were 7 males and 4 females, ranging in age from 21 to 64 years in the distal tibia anatomical plate group. There were 7 males and 5 females, ranging in age from 23 to 67 years in the external fixation with limited internal fixation group. The Ankle X-ray of Pilon fracture after operation, ankle score, early and late complications were collected. Bourne system was used to evaluate ankle joint function. After 8 months to 3 years follow-up, it was found that three kinds of treatment had significant differences in the outcomes and complications (P external fixation with limited internal fixation group got the best results. The number of anatomic reduction cases in the external fixation with limited internal fixation group (7 cases) and the distal tibia anatomical plate group (8 cases) was more than the plaster immobilization group (2 cases). According to the ankle score, 8 patients got an excellent result, 3 good and 1 poor in the limited internal fixation group ,which was better than those of distal tibia anatomical plate group (5 excellent, 4 good and 2 poor) and the plaster immobilization group (3 excellent, 4 good and 3 poor). The number of early and late complications in the external fixation with limited internal fixation group was more than those in the plaster immobilization group and the distal tibia anatomical plate group (Pexternal fixation with limited internal fixation in the treatment of Pilon fracture

  4. Um estudo das edições de Ou isto ou aquilo, de Cecília Meireles A study of Cecília Meirelles' Ou isto ou aquilo editions

    Directory of Open Access Journals (Sweden)

    Norma Sandra de Almeida Ferreira

    2009-08-01

    Full Text Available Localizar em sua materialidade a obra Ou isto ou aquilo, de Cecília Meireles, em suas edições - 1964; 1969; 1977; 1987; 1990; 2002 -; cotejá-las para compreender as formas pelas quais os textos são apresentados aos seus leitores, em diferentes tempos; e indagar como e por que essas formas são pensadas e concretizadas são desafios deste artigo. Esta pesquisa de cunho exploratório, à luz, principalmente, dos estudos da História Cultural, privilegia, no exame das diferentes edições, as partes externas que envolvem os poemas (o texto propriamente dito e suas ilustrações. Identifica e discute a produção de sentidos e valores ligados à educação do leitor, ao reconhecimento de uma escritora consagrada pela tradição literária, à singularidade da linguagem, à importância de uma prática prazerosa da leitura.This article brings the challenges of locating Cecília Meireles' book Ou isto ou aquilo (Either this or that in its materialness, with considerations on its 1964, 1969, 1977, 1987, 1990 and 2002 editions, as well as comparing these editions in order to understand the forms in which texts are presented to their readers at different times, and questioning how and why these forms are conceived and put into practice. In the light of studies on cultural history, in the analysis of the different editions, this exploratory research prioritizes the external parts that involve poems (the texts themselves and their illustrations. It provides identification and a discussion on the production of senses and values related to readers' education, the recognition of a writer who is consecrated by literary tradition, the uniqueness of the language used, and the importance of pleasant reading practice.

  5. "Economia e sociedade": a herança de Max Weber à luz da edição de sua Obra completa (MWG "Economy and society": Max Weber's legacy following the publication of his Complete works (MWG

    Directory of Open Access Journals (Sweden)

    M. Rainer Lepsius

    2012-01-01

    Full Text Available O artigo relata o entendimento atual do conjunto de textos conhecido como Economia e sociedade, procurando esclarecer em que consistia originalmente; como foi organizado nas edições anteriores por Marianne Weber e Johannes Winckelmann; como foi tratado no âmbito da nova edição da MWG. Para tanto, procura indicar como Max Weber situava os diversos textos, as diversas versões e fases de concepção e composição desses escritos. A partir daí, sistematiza os principais aspectos dos textos evidenciados na MWG, assim como os principais campos de discussão que se abrem para a pesquisa, em especial a sociologia econômica.The article reviews the current understanding of the set of texts known as Economy and Society, looking to identify the original content, how these texts were edited in previous editions by Marianne Weber and Johannes Winckelmann, and how they have been dealt with in the new edition of the MWG. These aims in mind, the text looks to show how Max Weber himself situated the various texts, including the different versions and phases of conception and composition of the writings. The article then summarizes the main aspects of the works, as evinced in the MWG, as well as the principal fields of discussion opened up for research, especially in economic sociology.

  6. Proua direktor ohjas ka kineaste / Sigrid Saarep

    Index Scriptorium Estoniae

    Saarep, Sigrid

    2008-01-01

    Dokumentaalfilm "Inge Tederi maailm". Stsenarist Juta Kivimäe, režissöör Rein Raamat, operaatorid Arvo Vilu ja Rein Raamat, montaaž Rein Raamat, produtsendid Helvi ja Rein Raamat. Raamat-Film OÜ, 2007

  7. Impacto da tecnologia de informação no Supply Chain Management: um estudo multicaso sobre a adoção de EDI entre varejo e indústria agroalimentar The impact of information technology on the Supply Chain Management: a multicase study in EDI adoption between the agrifood industry and retailers

    Directory of Open Access Journals (Sweden)

    Andrea Lago da Silva

    1999-12-01

    Full Text Available As tecnologias de informação têm alterado as formas de coordenação entre os diferentes elos da cadeia de suprimentos. A coordenação pode ser entendida como a habilidade de transmitir informação, estímulos e controles ao longo das etapas seqüenciais que integram o conjunto de atividades necessárias para atender o mercado (FARINA & ZYLBERSZTAJN, 1994. O conjunto destas etapas é o que tem sido chamado de Supply Chain ou Cadeia de Suprimentos. Neste artigo, discute-se alguns casos de adoção de uma tecnologia de informação, o EDI (troca eletrônica de dados como ferramenta de coordenação entre varejistas e indústrias agroalimentares. Conclui-se que o processo de adoção é relativamente recente para que se possa mensurar resultados quantitativos e qualitativos significativos, mas já se observa alterações na freqüência de desabastecimento, em estoques melhor dimensionados e vendas maiores em decorrência da maior disponibilidade de mercadorias. Sinalizam-se também mudanças qualitativas, como alteração na função do vendedor tradicional, maior interação entre as áreas técnicas, com um aprendizado comum das novas formas de usar a tecnologia e o importante papel da confiança nos relacionamentos interorganizações.Information technology has changed the patterns of coordination among the different linkages of supply-chains. Coordination can be understood as the ability to transfer information, incentives and controls throughout the sequential stages which integrate the set of activities indispensable to serve the market (FARINA & ZYLBERSZTAJN, 1994. The sum of these stages is currently known as Supply-Chains. This paper discusses cases of adopting a specific information technology, EDI (Electronic Data Interchange, as an integration tool between the food industry and retailers. It was found that the adoption process is too recent to measure significative quantitative results, but it is possible to observe changes in the

  8. 76 FR 61937 - Practice and Procedure: Rules of General Application, Safeguards, Antidumping and Countervailing...

    Science.gov (United States)

    2011-10-06

    ...; Wiley Rein LLP, on behalf of Nucor Corporation (Wiley Rein); and Williams Mullen. Issues raised in the... on Paper Filing Requirement AMS, the CITBA, Hughes Hubbard, the ITC TLA, Kelley Drye, Wiley Rein, and... electronically and in paper form. Hughes Hubbard, Kelley Drye, and Wiley Rein submit that the Commission will...

  9. Carta do editor de edições especiais da Encontros Bibli 10.5007/1518-2924.2011v16nesp1piv

    Directory of Open Access Journals (Sweden)

    Francisco das Chagas de Souza

    2011-06-01

    Full Text Available Dos horizontes arquivísticos e de seu sentido É significativo observar que a discussão sobre Arquivologia e sobre as práticas profissionais arquivisticas tem avançado muito nos últimos anos no Brasil, e as razões são claramente apontadas pelos organizadores desta edição especial de Encontros Bibli em seu texto editorial. Contendo sete artigos, esta edição temática traz o título Horizontes Arquivísticos.Para dar vida a este número, foi desenvolvido um trabalho de quase dois anos, liderado pelo pesquisador José Maria Jardim e colaboração de Renata Silva Borges. Aqui estão reunidos nove autores e seis avaliadores, todos vinculados a instituições de ensino e de pesquisa ligadas ao Serviço Público Federal, com sede nas cidades de Brasilia, Rio de Janeiro, Niteroi e Florianópolis: UNB, UNIRIO, UFF, UFRJ, UFSC, Arquivo Nacional e FIOCRUZ.Neste momento da história brasileira ─ em que se anunciam políticas governamentais em prol da cidadania, em que se diz da disposição de resgate da verdade sobre os fatos políticos acontecidos na gestão do estado brasileiro dos anos de 1964 a 1989 ─ os arquivos e seus profissionais passam a divisar um relevante protagonismo. Pode-se dizer que, de certa maneira, deu-se um movimento de preparação deste protagonismo e que, simultaneamente, essa preparação alicerçou a percepção de segmentos importantes do setor público para oferecer essa perspectiva para a sociedade nacional.Nesse sentido, tem peso relevante a instalação de novos cursos de bacharelado na área, totalizando, em 2011, o número de 14 universidades que os oferecem: UNIRIO, UFF, UFSM, UFES, UNB, UEL, UFBA ,UNESP/MARÍLIA, UFRGS, UEPB, UFAM, FURG, UFMG, UFSC. Uma nota marcante é que todas essas Instituições de Ensino Superior têm vínculos governamentais, sendo onze federais e três estaduais. Esse movimento não se faz por outro caminho senão o da pesquisa histórica e social. Em áreas como a História, Educa

  10. Rein Maran soovitab / Rein Maran

    Index Scriptorium Estoniae

    Maran, Rein, 1931-

    2007-01-01

    Silmas pidades 19. septembril avatavat 5. Matsalu rahvusvahelist loodusfilmide festivali kirjutab autor loodusfilmi rollist ja olemusest ning tutvustab Gay ja Anita Chaumette'i filmi "Räägime kaladega" ("Talking with Fishes") : Suurbritannia 2003

  11. End stage renal disease in French Guiana (data from R.E.I.N registry): South American or French?

    Science.gov (United States)

    Rochemont, Dévi Rita; Meddeb, Mohamed; Roura, Raoul; Couchoud, Cécile; Nacher, Mathieu; Basurko, Célia

    2017-06-30

    End-Stage renal disease (ESRD) causes considerable morbidity and mortality, and significantly alters patients' quality of life. There are very few published data on this problem in the French Overseas territories. The development of a registry on end stage renal disease in French Guiana in 2011 allowed to describe the magnitude of this problem in the region for the first time. Using data from the French Renal Epidemiology and Information Network registry (R.E.I.N). Descriptive statistics on quantitative and qualitative variables in the registry were performed on prevalent cases and incident cases in 2011, 2012 and 2013. French Guiana has one of the highest ESRD prevalence and incidence in France. The two main causes of ESRD were hypertensive and diabetic nephropathies. The French Guianese population had a different demographic profile (younger, more women, more migrants) than in mainland France. Most patients had at least one comorbidity, predominantly (95.3%) hypertension. In French Guiana dialysis was initiated in emergency for 71.3% of patients versus 33% in France (p < 0.001). These first results give important public health information: i) End stage renal disease has a very high prevalence relative to mainland France ii) Patients have a different demographic profile and enter care late in the course of their renal disease. These data are closer to what is observed in the Caribbean or in Latin America than in Mainland France.

  12. Water excretion mechanisms of the kidney studied in the rabbit using tritiated water during the stop-flow assay; Les mecanismes d'excretion de l'eau par le rein etudies a l'aide d'eau tritiee chez le lapin au cours de l'epreuve de diurese interrompue

    Energy Technology Data Exchange (ETDEWEB)

    Morel, F.; Amiel, CI.; Falbriard, A. [Commissariat a l' energie atomique et aux energies alternatives - CEA, Service de Biologie (France)

    1960-07-01

    The pattern of water turnover in the kidney and the mechanisms of water transfer into the urine have been studied in the rabbit using tritiated water as a tracer and the stop-flow technique. The experiments have given the following results: a) During the interruption of the diuresis, the injected tritiated water is completely exchanged with the water of the renal cortex, but the tracer does not reach the deep regions of the kidney, despite the fact that the blood circulation is maintained in these regions; this suggests that the vascular loops of the vasa recta function as a mechanism of water exchange by countercurrent. b) During the osmotic polyuria following the stop-flow period, the concentration gradient of tritiated water inside the kidney diminishes progressively. The concentration of the tracer in the urine is at all time similar to that existing in the deep medulla and the renal papilla and markedly different from that of the cortex or arterial blood. This fact shows that the molecules of water in the urine excreted do not come from either the glomerular filtrate or the convoluted tubules but from the water contained in the deep regions of the kidney. Also these results indicate that the walls of the collecting ducts have a very high permeability to water diffusion. Reprint of a paper published in Revue francaise d'etudes cliniques et biologiques, Vol. IV, no. 8, p. 773-779, 1959 [French] Les modalites du renouvellement de l'eau dans le rein et les mecanismes de son passage dans l'urine ont ete etudies chez le lapin a l'aide d'eau tritiee, employee comme indicateur au cours de l'epreuve de 'diurese interrompue' (stop flow). Les experiences effectuees montrent que: a) pendant l'interruption de la diurese, l'eau tritiee injectee s'echange completement avec l'eau contenue dans le cortex renal, mais elle n'atteint pratiquement pas les regions profondes du rein, bien que la circulation sanguine y soit maintenue; cette observation suggere que les anses

  13. Study, with the help of nuclear indicators (HTO, Urea {sup 14}C and {sup 24}Na), of the renewal of water, urea and sodium in different parts of the rat kidney in aqueous diuresis and of the gerbil kidney in osmotic diuresis or in oliguria; Etude, a l'aide d'indicateurs nucleaires (HTO, UREE {sup 14}C et {sup 24}Na), du renouvellement de l'eau, de l'uree et du sodium dans les differentes regions du rein de rat en diurese aqueuse et de merion en diurese osmotique ou en oligurie

    Energy Technology Data Exchange (ETDEWEB)

    Lechene, C P [Commissariat a l' Energie Atomique, Saclay (France). Centre d' Etudes Nucleaires

    1965-06-01

    In the kidney of the gerbil in oliguria there exists a cortico-papillary gradient in the concentration of the sodium and of the urea; this gradient disappears in the gerbil kidney in osmotic diuresis or in the rat kidney in aqueous diuresis; in these three states of diuresis there is no significant difference in the potassium concentration between the surface and interior regions of the kidneys. Kinetic studies using tritiated water, urea {sup 14}C and {sup 24}Na show that water and urea in the interior regions of the kidney are only renewed very slowly (1 h) whereas the sodium is rapidly changed (1 mn). These results can be explained using WIRZ's theory concerning the mechanism of the counter-current concentration of urine. Furthermore, the evolution of the specific radioactivity of urea {sup 14}C is favorable for a cortical synthesis of urea. (author) [French] II existe dans le rein de Merions en oligurie un gradient cortico papillaire de la concentration du sodium et de l'uree; ce gradient est aboli dans le rein de Merions en diurese osmotique ou de rats en diurese aqueuse; dans ces 3 etats de diurese il n'y a pas de difference significative de la concentration du potassium entre les regions superficielles et profondes des reins. Des etudes cinetiques a l'aide d'eau tritiee, d'uree {sup 14}C et de {sup 24}Na montrent que l'eau et l'uree des regions profondes des reins ne sont renouveles que tres lentement (1 h), alors que le sodium est tres vite renouvele (1 mn). Ces resultats s'expliquent par la theorie de WIRZ sur le mecanisme de la concentration de l'urine par contre-courant. En outre, l'evolution renale de la radioactivite specifique de l'uree {sup 14}C est en faveur d'une synthese corticale de l'uree. (auteur)

  14. 77 FR 57090 - Agency Information Collection Activities: Proposed Collection; Comment Request

    Science.gov (United States)

    2012-09-17

    ...: Medicare Electronic Data Interchange (EDI) Registration and Electronic Data Interchange (EDI) Enrollment... Electronic Data Interface (EDI) functions. The EDI Enrollment and the Medicare Registration Forms are... efficient uniform means by which Medicare captures information necessary to drive Medicare EDI security and...

  15. Viimsi keskuse muutumised ajas = Alterations of the Viimsi Centre in Time / Triin Ojari

    Index Scriptorium Estoniae

    Ojari, Triin, 1974-

    2002-01-01

    Viimsi keskusesse on hooneid projekteerinud arhitektid Rein Veber, Ado Eigi, Rein Hansberg, Andres Alver, planeeringu autor on Rein Veber. 2002. a. valmis soomlase Matti Anttila büroo Architecture Workshop 2 koostatud üldplaneeringu ideeprojekt. 1 ill

  16. Interhemispheric differences and solar cycle effects of the high-latitude ionospheric convection patterns deduced from Cluster EDI observations

    Science.gov (United States)

    Förster, Matthias; Haaland, Stein

    2015-04-01

    Here, we present a study of ionospheric convection at high latitudes that is based on satellite measurements of the Electron Drift Instrument (EDI) on-board the Cluster satellites, which were obtained over a full solar cycle (2001-2013). The mapped drift measurements are covering both hemispheres and a variety of different solar wind and interplanetary magnetic field (IMF) conditions. The large amount of data allows us to perform more detailed statistical studies. We show that flow patterns and polar cap potentials can differ between the two hemispheres on statistical average for a given IMF orientation. In particular, during southward directed IMF conditions, and thus enhanced energy input from the solar wind, we find that the southern polar cap has a higher cross polar cap potential. We also find persistent north-south asymmetries which cannot be explained by external drivers alone. Much of these asymmetries can probably be explained by significant differences in the strength and configuration of the geomagnetic field between the Northern and Southern Hemisphere. Since the ionosphere is magnetically connected to the magnetosphere, this difference will also be reflected in the magnetosphere in the form of different feedback from the two hemispheres. Consequently, local ionospheric conditions and the geomagnetic field configuration are important for north-south asymmetries in large regions of geospace. The average convection is higher during periods with high solar activity. Although local ionospheric conditions may play a role, we mainly attribute this to higher geomagnetic activity due to enhanced solar wind - magnetosphere interactions.

  17. 48 CFR 552.216-72 - Placement of Orders.

    Science.gov (United States)

    2010-10-01

    ...] (b) Orders may be placed through Electronic Data Interchange (EDI) or mailed in paper form. EDI... Data Interchange (EDI) format. (c) If the Contractor agrees, General Services Administration's Federal Acquisition Service (FAS) will place all orders by EDI using computer-to-computer EDI. If computer-to-computer...

  18. 75 FR 41093 - General Services Administration Acquisition Regulation; Rewrite of GSAR Part 516, Types of Contracts

    Science.gov (United States)

    2010-07-15

    ...) will place all orders by EDI using computer-to-computer EDI. If computer-to-computer EDI is not possible, FAS will use an alternative EDI method allowing the Contractor to receive orders by facsimile transmission. Subject to the Contractor's agreement, other agencies may place orders by EDI. * * * * * (g) The...

  19. Demand and withdraw behaviors in couples with a history of infidelity.

    Science.gov (United States)

    Balderrama-Durbin, Christina M; Allen, Elizabeth S; Rhoades, Galena K

    2012-02-01

    Although relationship distress and dissolution are common consequences of sexual involvement outside a committed relationship, there is little empirical information regarding communication behaviors of couples who have experienced extradyadic involvement (EDI). This study examined male and female demand and withdraw behaviors in videotaped conflict discussions among 170 married or seriously dating couples categorized into 3 groups: those without a history of sexual EDI, those with a history of sexual EDI that was known to the other partner, and those with a history of "unknown" (undisclosed or undiscovered) sexual EDI. Both men and women in a relationship where there was at least one unknown EDI demonstrated the highest levels of demand behaviors. Furthermore, demand behaviors were higher for participating partners (those engaging in an outside sexual relationship) in relationships with an unknown EDI compared with participating partners in relationships with a known EDI. Conversely, demand behaviors were higher among nonparticipating partners in relationships with known EDI, compared to with nonparticipating partners in relationships with unknown EDI. Withdraw behaviors demonstrated a less pronounced and less consistent pattern of elevation by EDI group, and role within EDI, compared with demand behaviors. Clinical and relational implications for these findings are discussed.

  20. Digital TV: the aparattus and the representation of real on image edition in news casting TV Digital: o aparelho e a representação do real na edição de imagens no telejornalismo

    Directory of Open Access Journals (Sweden)

    Fernanda Aiex Boni

    2011-08-01

    Full Text Available This study investigates some changes on image edition due to the transfer of Analogic to Digital Television in Brazil. Beginning with Vilém Flusser’s Media Theory and its concept of “apparatus”, it develops a theoretical analysis of the new relationship between journalists and digital editing instruments, taking into account the concept of hyperreality proposed by Jean Baudrillard. Retrieving the philosophical discourse of “real” throughout History and also the positivist concepts, base of the journalistic activity, it discusses how digital image manipulation and the construction of graphic universes meddle with the new representation of real presented by television news casting. From interviews with Rede Globo editors in São Paulo, Rio de Janeiro and Curitiba (cities where digital television has already been implemented, it analyses how this new technology can hinder the main commitment of journalism, which is reporting facts as faithfully as possible. The discussion proposes an engagement of professionals and society regarding digital images in the search of greater critical conscience towards digital images in news casting, with an ethic view of the use of manipulation resources and scene construction on news editing. Este trabalho investiga algumas mudanças na edição de imagens com a passagem da TV Analógica para a Digital no Brasil. A partir da teoria da mídia de Vilém Flusser e seu conceito de “aparelho” desenvolve-se uma análise teórica da nova relação entre os jornalistas e os equipamentos digitais de edição, levando-se em conta o conceito de hiper-realidade, proposto por Jean Baudrillard. Retomando o percurso filosófico do real ao longo da história e ainda os conceitos positivistas, que embasam a atividade jornalística, discute-se de que maneira a manipulação das imagens digitais e a construção deuniversos gráficos interferem na nova representação do real apresentada pelo telejornalismo. Com base em

  1. 78 FR 12322 - Agency Information Collection Activities: OMB Review; Comment Request

    Science.gov (United States)

    2013-02-22

    ... Interchange (EDI) Registration and Electronic Data Interchange (EDI) Enrollment Form; Use: The purpose of this... identification of Medicare providers/suppliers and authorization of requested Electronic Data Interface (EDI) functions. The EDI Enrollment and the Medicare Registration Forms are completed by Medicare providers...

  2. Examining the extreme 2017 spring drought event in South Korea using a suite of drought indices (SPI, SC-PDSI, SPEI, EDI)

    Science.gov (United States)

    Nam, W. H.; Hayes, M. J.; Svoboda, M. D.; Fuchs, B.; Tadesse, T.; Wilhite, D. A.; Hong, E. M.; Kim, T.

    2017-12-01

    South Korea has experienced extreme droughts in 1994-1995, 2000-2001, 2012, 2015, and 2016-2017. The 2017 spring drought (with especially low winter precipitation recorded in winter 2016) affected a large portion of central and western South Korea, and was one of the most severe droughts in the region since the 2000-2001 drought. The spring drought of 2017 was characterized by exceptionally low precipitation with total precipitation from January to June being 50% lower than the mean normal precipitation record (1981-2010) over most of western South Korea. It was the climatologically driest spring over the 1961-2016 record period. Effective drought monitoring and management depends on which drought indices are selected because each drought index has different drought criteria or levels of drought severity, associated with drought responses. In this study, for the quantitative analysis of the spring 2017 drought event in South Korea, four widely-used drought indices, including the Standardized Precipitation Index (SPI), the Standardized Precipitation Evapotranspiration Index (SPEI), the Self-Calibrated Palmer Drought Severity Index (SC-PDSI), and the Effective Drought Index (EDI) are compared with observed drought damaged areas in the context of agricultural drought impacts. The South Korean government (Ministry of Agriculture, Food and Rural Affairs (MAFRA) and Korea Rural Community Corporation (KRC)) has been operating a government-level drought monitoring system since 2016. Results from this study can be used to improve the drought monitoring applications, as well as drought planning and preparedness in South Korea.

  3. Étude anatomique d'une espèce de lémurien (Eulemur fulvus) : coupes topographiques et tomodensitométriques du thorax, de l'abdomen et du bassin. Application à la pratique de l'échographie du cœur et des reins

    OpenAIRE

    Raharison, Fidiniaina

    2008-01-01

    L'objectif de notre étude est d'élaborer un document de référence mettant en relation l'anatomie, l'imagerie et la clinique du lémurien brun (Eulemur fulvus) et débouchant sur des mesures échographiques normales des reins et du cœur. Les études anatomique et tomodensitométrique ont été effectuées sur deux lémuriens et l'étude échographique sous différents modes sur 16 animaux après anesthésie. Les coupes anatomiques et tomodensitométriques nous ont permis de préciser la position et la conform...

  4. Study, with the help of nuclear indicators (HTO, Urea {sup 14}C and {sup 24}Na), of the renewal of water, urea and sodium in different parts of the rat kidney in aqueous diuresis and of the gerbil kidney in osmotic diuresis or in oliguria; Etude, a l'aide d'indicateurs nucleaires (HTO, UREE {sup 14}C et {sup 24}Na), du renouvellement de l'eau, de l'uree et du sodium dans les differentes regions du rein de rat en diurese aqueuse et de merion en diurese osmotique ou en oligurie

    Energy Technology Data Exchange (ETDEWEB)

    Lechene, C.P. [Commissariat a l' Energie Atomique, Saclay (France). Centre d' Etudes Nucleaires

    1965-06-01

    In the kidney of the gerbil in oliguria there exists a cortico-papillary gradient in the concentration of the sodium and of the urea; this gradient disappears in the gerbil kidney in osmotic diuresis or in the rat kidney in aqueous diuresis; in these three states of diuresis there is no significant difference in the potassium concentration between the surface and interior regions of the kidneys. Kinetic studies using tritiated water, urea {sup 14}C and {sup 24}Na show that water and urea in the interior regions of the kidney are only renewed very slowly (1 h) whereas the sodium is rapidly changed (1 mn). These results can be explained using WIRZ's theory concerning the mechanism of the counter-current concentration of urine. Furthermore, the evolution of the specific radioactivity of urea {sup 14}C is favorable for a cortical synthesis of urea. (author) [French] II existe dans le rein de Merions en oligurie un gradient cortico papillaire de la concentration du sodium et de l'uree; ce gradient est aboli dans le rein de Merions en diurese osmotique ou de rats en diurese aqueuse; dans ces 3 etats de diurese il n'y a pas de difference significative de la concentration du potassium entre les regions superficielles et profondes des reins. Des etudes cinetiques a l'aide d'eau tritiee, d'uree {sup 14}C et de {sup 24}Na montrent que l'eau et l'uree des regions profondes des reins ne sont renouveles que tres lentement (1 h), alors que le sodium est tres vite renouvele (1 mn). Ces resultats s'expliquent par la theorie de WIRZ sur le mecanisme de la concentration de l'urine par contre-courant. En outre, l'evolution renale de la radioactivite specifique de l'uree {sup 14}C est en faveur d'une synthese corticale de l'uree. (auteur)

  5. 75 FR 64737 - Automated Commercial Environment (ACE): Announcement of a National Customs Automation Program...

    Science.gov (United States)

    2010-10-20

    ... interchange (EDI) for submitting advance ocean and rail data and intends to amend the regulations as [email protected] . Please describe in the body of the e-mail any past EDI history with CBP. Written... (EDI). For ocean and rail carriers, the CBP-approved EDI is the Automated Manifest System (AMS). Ocean...

  6. Detecting Fraudulent Erasures at an Aggregate Level

    Science.gov (United States)

    Sinharay, Sandip

    2018-01-01

    Wollack, Cohen, and Eckerly suggested the "erasure detection index" (EDI) to detect fraudulent erasures for individual examinees. Wollack and Eckerly extended the EDI to detect fraudulent erasures at the group level. The EDI at the group level was found to be slightly conservative. This article suggests two modifications of the EDI for…

  7. Merirahu elamurajoon Tallinnas = Merirahu Residential Community in Tallinn / Triin Ojari

    Index Scriptorium Estoniae

    Ojari, Triin, 1974-

    2008-01-01

    Projekteerija: Rein Murula Arhitektuuribüroo OÜ. Autorid: Rein Murula, Marti Kahu, Karl Koosa. Konstruktor: Pikoprojekt OÜ. Projekt: 2005-2006, valmis: I etapp 2006, II etapp 2007. Rein Murula korterelamute ehitamisest algselt ühepereelamute ehitamiseks mõeldud alale, majatüüpidest, lodzhadest, korteritest. I ja II majatüübi I-IV korruse plaan, 4 värv. välisvaadet

  8. 77 FR 70708 - VA Acquisition Regulation: Electronic Submission of Payment Requests

    Science.gov (United States)

    2012-11-27

    ... electronic data interchange (EDI) formats; or (3) another electronic form as prescribed by the contract....fsc.va.gov/einvoice.asp .); or, (b) A system that conforms to the X12 electronic data interchange (EDI... Institute (ANSI). The X12 EDI Web site ( http://www.x12.org ) includes additional information on EDI 810 and...

  9. Employee-Driven Innovation: A Brave New World in the Build Environment’s Project Organisations

    DEFF Research Database (Denmark)

    Sørensen, Henrik; Wandahl, Søren

    2013-01-01

    -driven innovation (EDI) could be such a methodology to implicate the spoken and tacit knowledge of the employees that would strengthen the innovative capabilities of the project organisations. To investigate the theoretical field around EDI a literature study was conducted. The overall objective was to develop...... a theoretical framework based on the field of EDI and related methodologies. This research resulted in two main findings. First; identification of the overall themes of the EDI field of research. Second; definition of an overall framework of methodologies to conduct EDI in project organisations. Furthermore...

  10. [Is cancer incidence different between type 2 diabetes patients compared to non-diabetics in hemodialysis? A study from the REIN registry].

    Science.gov (United States)

    Le Guillou, Aurélie; Pladys, Adelaide; Kihal, Wahida; Siebert, Muriel; Haddj-Elmrabet, Atman; Cernon, Charlotte; Bernard, Anne; Charasse, Christophe; Mandart, Lise; Hamel, Didier; Tanquerel, Tugdual; Strullu, Bernard; Richer, Christine; Siohan, Pascale; Sawadogo, Théophile; Baleynaud, Juliette; Baluta, Simona; Bayat, Sahar; Vigneau, Cécile

    2018-05-01

    In France, diabetes mellitus is now the second cause of end stage renal disease. In a large previous French national study, we observed that dialyzed diabetics have a significant lower risk of death by cancer. This first study was focused on cancer death but did not investigate cancer incidence. In this context, the aim of this second study was to compare the incidence of cancer in diabetic dialyzed patients compared to non-diabetic dialyzed patients in a French region. This epidemiologic multicentric study included 588 diabetic and non-diabetic patients starting hemodialysis between 2002 and 2007 in Bretagne. Data were issued from REIN registry and cancer incidence were individually collected from medical records. Diabetics and non-diabetics were matched one by one on age, sex and year of dialysis initiation. During the follow-up, we observed 28 cancers (9.4%) in diabetic patients and 26 cancers (8.9%) in non-diabetics patients. The cumulative incidence to develop a cancer 2 years after the dialysis start was approximately 6% in both diabetics and non-diabetics patients. In univariate Fine and Gray analysis, BMI, hemoglobin, statin use had P-value<0.2. However, in the adjusted model, these variables were not significantly associated with cancer incidence. This study lead on a little number of dialyzed patients did not show any significant difference on cancer incidence between diabetic and non-diabetic patients after hemodialysis start. Copyright © 2017 Société francophone de néphrologie, dialyse et transplantation. Published by Elsevier Masson SAS. All rights reserved.

  11. The essential of 2012 results from the French Renal Epidemiology and Information Network (REIN) ESRD registry.

    Science.gov (United States)

    Lassalle, Mathilde; Ayav, Carole; Frimat, Luc; Jacquelinet, Christian; Couchoud, Cécile

    2015-04-01

    The French Renal Epidemiology and Information Network (REIN) registry began in 2002 to provide a tool for public health decision support, evaluation and research related to renal replacement therapies (RRT) for end-stage renal disease (ESRD). It is relying on a network of nephrologists, epidemiologists, patients and public health representatives. Continuous registration covers all dialysis and transplanted patients. In 2012, in France, 10,048 patients started a RRT (154 per million inhabitants). Elders provided majority of new patients (median age at RRT start: 70 years old). New patients had a high and age increasing rate of comorbidities, especially diabetes (42% of the new patients) and cardiovascular comorbidities (>50% of the new patients). Like previous years, incidence is stabilized. On December 31, 2012, 73,491 patients were receiving a RRT in France (1127 per million inhabitants, 56% on dialysis and 44% living with a functional renal transplant). More than 50% of patients were undergoing in-center hemodialysis with significant variations among regions. An increase in medical satellite unit hemodialysis but a decrease in self-care unit hemodialysis rates were noticed across the time, whereas peritoneal dialysis remained stable at 7%. Five years after starting RRT, the overall survival rate was 51% but only 16% among patients over 85 years. Mortality rate was highly dependent on treatment and age; transplanted patients aged 60-69 had a 27/1000 patients-year mortality rate versus 133 for a dialysis patient. Patients who started dialysis had a probability of first wait-listing of 4.8% at the start of dialysis (pre-emptive registrations) and 27% at 72 months. Whatever their diabetes status was, patients older than 60 had poor access to the waiting list. Seventeen percent of the patients received a first renal transplant within 15.4 month median time; 3% had received a pre-emptive graft. Ten years after the start of the French ESRD registry, this report provides

  12. Employee-driven innovation in large project organisations

    DEFF Research Database (Denmark)

    Sørensen, Henrik; Wandahl, Søren; Christensen, Randi Muff

    2014-01-01

    (EDI). The case was a group of employees in a large governmental client organisation. The EDI framework was based on a theoretical approach to conduct EDI, derived from a previous literature study. The case study was conducted as an exploratory case study with outset in a gaming approach...... that challenged the participants with discussions on obstacles and solutions for EDI. The game approach was undertaken to facilitate discussions on specific EDI topics carefully selected to stimulate both group and plenum discussions. The themes of the theoretical framework were challenged through...... the participants’ discussions and perceptions of the applicability in the organisation. The findings were discussed in relation to the theoretical approach and findings from a comparable case study. It identified overall methods that had the higher robustness and applicability to incorporate in a practical EDI...

  13. A queda da bancada e as mudanças na cena de apresentação dos telejornais: em busca da identidade e aproximação com o telespectador – uma análise do MGTV Primeira Edição

    OpenAIRE

    Pereira, Renata Venise Vargas

    2013-01-01

    Este trabalho teve como proposta investigar como as alterações na cena de apresentação do telejornal, que incluem a retirada da bancada como o principal elemento cênico e a circulação e posicionamento do apresentador no estúdio, constituem tentativas de aproximação com o telespectador, estabelecer vínculos de pertencimento e relações identitárias com seu público. Na pesquisa empírica avaliou-se as alterações adotadas pelo MGTV 1ª Edição, veiculado pela TV Integração de Juiz de Fora, emissora ...

  14. Comparison of peripapillary choroidal thickness measurements via spectral domain optical coherence tomography with and without enhanced depth imaging.

    Science.gov (United States)

    Ayyildiz, Onder; Kucukevcilioglu, Murat; Ozge, Gokhan; Koylu, Mehmet Talay; Ozgonul, Cem; Gokce, Gokcen; Mumcuoglu, Tarkan; Durukan, Ali Hakan; Mutlu, Fatih Mehmet

    2016-05-01

    To compare peripapillary choroidal thickness (PP-CT) measurements using a spectral domain optical coherence tomography (SD-OCT) device with and without enhanced depth imaging (EDI). Sixty healthy subjects aged from 18 to 40 years were included in this study. PP-CTs were measured in the right eyes by manual segmentation via SD-OCT both with and without EDI. The intraclass correlation coefficient (ICC) for each technique and comparison of PP-CT measurements between two techniques were evaluated. The correlation between retinal nerve fiber layer (RNFL) thickness and PP-CT was also explored on images of SD-OCT without EDI. The PP-CT measurements of 55 subjects were evaluated. The ICC was 0.999 (95% CI: 0.998-1.0, p  0.05). Additionally, there was no correlation between RNFL thickness and PP-CT (r = -0.109; p = 0.335). The PP-CT measurements via SD-OCT without EDI were consistent with the measurements via SD-OCT with EDI. Ophthalmologists who do not have access to EDI technology can use images of SD-OCT without EDI to measure the peripapillary choroid for research purposes. However, thicker peripapillary choroids cannot be measured using this technique and require further modifications or newer technologies, such as SD-OCT with EDI.

  15. Hemodiafiltration Versus Hemodialysis and Survival in Patients With ESRD: The French Renal Epidemiology and Information Network (REIN) Registry.

    Science.gov (United States)

    Mercadal, Lucile; Franck, Jeanna-Eve; Metzger, Marie; Urena Torres, Pablo; de Cornelissen, François; Edet, Stéphane; Béchade, Clémence; Vigneau, Cécile; Drüeke, Tilman; Jacquelinet, Christian; Stengel, Bénédicte

    2016-08-01

    Recent randomized trials report that mortality is lower with high-convection-volume hemodiafiltration (HDF) than with hemodialysis (HD). We used data from the French national Renal Epidemiology and Information Network (REIN) registry to investigate trends in HDF use and its relationship with mortality in the total population of incident dialysis patients. The study included those who initiated HD therapy from January 1, 2008, through December 31, 2011, and were dialyzed for more than 3 months; follow-up extended to the end of 2012. HDF use at the patient and facility level. All-cause and cardiovascular mortality, using Cox models to estimate HRs of HDF as time-dependent covariate at the patient level, with age as time scale and fully adjusted for comorbid conditions and laboratory data at baseline, catheter use, and facility type as time-dependent covariates. Analyses completed by Cox models for HRs of the facility-level exposure to HDF updated yearly. Of 28,407 HD patients, 5,526 used HDF for a median of 1.2 (IQR, 0.9-1.9) years; 2,254 of them used HDF exclusively. HRs for all-cause and cardiovascular mortality associated with HDF use were 0.84 (95% CI, 0.77-0.91) and 0.73 (95% CI, 0.61-0.88), respectively. In patients treated exclusively with HDF, these HRs were 0.77 (95% CI, 0.67-0.87) and 0.66 (95% CI, 0.50-0.86). At the facility level, increasing the percentage of patients using HDF from 0% to 100% was associated with HRs for all-cause and cardiovascular mortality of 0.87 (95% CI, 0.77-0.99) and 0.72 (95% CI, 0.54-0.96), respectively. Observational study. Whether analyzed as a patient- or facility-level predictor, HDF treatment was associated with better survival. Copyright © 2015 National Kidney Foundation, Inc. Published by Elsevier Inc. All rights reserved.

  16. Electronic data interchange in the Canadian natural gas industry

    International Nuclear Information System (INIS)

    Sheinfield, J.

    1995-01-01

    The concept of electronic data interchange (EDI) in the gas industry was discussed. EDI as a champion of costumer service and as a powerful management tool was defined, and the process of electronic information transfer was explained. EDI was then placed in the context of the business process, and its benefits in providing efficient service and product improvement were enumerated. North American Gas EDI standards, and industry initiatives were explored in detail

  17. Edição e tradução, entre a cultura e a política: Argentina e Brasil na Feira do Livro de Frankfurt

    Directory of Open Access Journals (Sweden)

    José de Souza Muniz Jr.

    Full Text Available Resumo Este artigo analisa a participação da Argentina e do Brasil como países convidados de honra (em 2010 e 2013, respectivamente na Feira do Livro de Frankfurt. Remetemos tais presenças à história recente da feira e ao seu papel na estrutura dos fluxos e circuitos de edição e tradução em nível mundial, estrutura esta regulada pelas relações desiguais entre distintos países e mercados linguísticos. Analisamos as negociações entre entidades do poder público e da política setorial que deram origem a tais participações; as ênfases temáticas escolhidas para compor os estandes; e as características socioprofissionais dos autores de cada delegação. A conclusão é que tais casos permitem observar relações específicas entre intelectuais e Estado em cada contexto, na medida em que fazem emergir não apenas as tensões entre cultura e economia, mas também os modos específicos como cada país “traduz” questões locais para um âmbito de trocas simbólicas transnacionais.

  18. Stepping Up: Burden Sharing by NATO’s Newest Members

    Science.gov (United States)

    2014-11-01

    trustworthiness as a partner in Bosnia and Herzegovina, Kosovo, Af- ghanistan, and also in Iraq. Now, as a full member of the Alliance, our responsibility in...Rein Lang at the celebrating of the first anniversary of Estonia’s NATO accession,” Tallinn, Estonia, April 4, 2005, available from www.vm.ee/eng...Lang, Rein (Estonian Foreign Minister). “Address by Foreign Minister Rein Lang at the celebration of the first anniversary of Estonia’s NATO accession

  19. Electronic Data Interchange: from its Birth to its New Role in Logistics Information Systems

    OpenAIRE

    Janssens, Gerrit K.

    2011-01-01

    The introduction of internet applications in e-commerce made many adopters think that EDI would soon disappear. But the trend in logistics towards closer collaboration in supply chains made on the other hand the impact of EDI larger. A resultant of those forces will probably lead to a new type of EDI, which integrates with other technologies. Early studies on EDI were promoting its use because of savings in administrative work. But due to intra-corporation management model...

  20. The photographic edition as a visual narrative construction A edição fotográfica como construção de uma narrativa visual

    Directory of Open Access Journals (Sweden)

    Fernanda Jansen Mira Catanho

    2007-01-01

    Full Text Available This article, based on the concept of intellectual montage, developed by russian movie director Sergei Eisenstein, works in the premises that the photographic edition may be responsible for the construction of a visual narrative. Thus, it adopts a photographic essay composed of 26 pictures and sends it to three specialists for edition. The results are three different narratives. With this, it becomes evident that the photographic message may undergo a creative rearrange and compose distinctive enunciation discourses. At the end, the work shows that the differences between the discourses elaborated by the editors are captured by the receiver of the photographic message. Este artigo, baseado no conceito de montagem intelectual, desenvolvido pelo cineasta russo Sergei Eisenstein, trabalha com a premissa de que a edição fotográfica pode ser responsável pela construção de uma narrativa visual. Para tanto, adota um ensaio fotográfico composto por 26 fotografias e o passa para três especialistas editá-lo. O resultado são três narrativas diferentes. Com isso, torna-se evidente que a mensagem fotográfica pode passar por uma re-elaboração criativa e formar discursos enunciativos distintos. Ao final, o trabalho mostra que as diferenças entre os discursos elaborados pelos editores são apreendidos pelo receptor da mensagem fotográfica.

  1. 48 CFR 552.232-25 - Prompt Payment.

    Science.gov (United States)

    2010-10-01

    ... electronic data interchange (EDI) purchase orders (transaction set 850). (ii) The Contractor must generate and submit to the Government valid EDI invoices (transaction set 810) or submit invoices through the... of the Contractor, EFT payments through the Automated Clearing House (ACH) system. (iv) The EDI...

  2. 77 FR 20835 - National Customs Automation Program (NCAP) Test Concerning Automated Commercial Environment (ACE...

    Science.gov (United States)

    2012-04-06

    ... Interchange (EDI). This notice also describes test particulars including commencement date, eligibility... Electronic Data Interchange (EDI) as part of the Document Image System (DIS) test. DIS is currently a stand... with supporting information via EDI in an Extensible Markup Language (XML) format, in lieu of...

  3. 77 FR 34846 - Inspection, Repair, and Maintenance; Driver-Vehicle Inspection Report for Intermodal Equipment

    Science.gov (United States)

    2012-06-12

    ... report EDI Electronic data interchange FHWA Federal Highway Administration FMCSRs Federal Motor Carrier...-copy paperwork to unassisted electronic data interchange (EDI) transmissions. IANA added that the... system, or EDI and transmittals of files in various formats. IANA noted that its program offers IEPs and...

  4. Renal Scintiscanning with Hg{sup 209}-Neohydrin in Urologic Diseases; Scintigraphy du Rein dans les Maladies des Voies Urin Aires au Moyen de Neohydrine Marquee avec {sup 203}Hg; Stsintillyatsionnoe skennirovanie pochek s pomoshch'yu neogidrina,mechennogo Rtut'yu-203, pri urologicheskikh zabolevaniyakh; Exploracion Centelleografica del Rinon con Neohydrina - {sup 203}hg en las Afecciones Urologicas

    Energy Technology Data Exchange (ETDEWEB)

    Bollini, V.; Tori, G. [Radiology Institute of the University of Bologna (Italy)

    1964-10-15

    which point to a compensatory hypertrophy should be distinguished from the dishomogeneous and irregular ones. These last pictures suggest the presence of large hydronephroses, tumours or multiple cysts. In renal vascular disease, the character of the uptake in the two kidneys can be of significant value in assessing the reduced function and in differentiating unilateral from bilateral diseases. Renal scintiscanning thus shows promise of proving a useful clinical technique, particularly if combined with radiological examination of the kidneys by traditional means (urography, ascending pyelography, retropneumoperitoneum, tomography, aortography, etc.). (author) [French] Les auteurs ont procede a des scintigraphies du rein au moyen de neohydrine marquee avec {sup 203}Hg. Ils ont utilise le dispositif de scintigraphie 'NuclearChicago', type 1700, a cristal de 5 x 5 cm et collimateur alveolaire de 7 cm de distance focale. En general, les scintigrammes sont enregistres a la fois sur papier et sur film photographique; la neohydrine marquee avec {sup 203}Hg est administree en doses de 120 a 160 {mu}c (environ 2 {mu}c/kg). L'examen scintigraphique commence deux heures environ apres l'injection et dure de 40 a 50 min. Le fait que la neohydrine marquee se fixe selectivement au niveau du cortex renal permet d'obtenir une representation graphique des deux reins et de determiner leur position, leur orientation et leur forme, ainsi que le degre d'homogeneite du parenchyme normal. Dans certains cas, des examens autobiographiques ont ete effectues sur des reins malades, apres ablation. Cette methode permet de determiner les anomalies, congenitales ou acquises, dans la position et l'orientation des reins. En ce qui concerne la forme de l'organe, les contours de l'image du rein sont d'autant plus nets que la fonction renale est meilleure. Des caracteristiques techniques telles que la largeur du cristal, le type.de collimateur (dont le plan focal doit couper le plan median transversal des

  5. Pöffihunt ulub juba 15. korda / Kaarel Kressa

    Index Scriptorium Estoniae

    Kressa, Kaarel, 1983-

    2011-01-01

    15. Pimedate Ööde Filmifestivali tutvustus. Põhiprogrammist, filmiturust, animafilmide festivalist Animated Dreams, laste- ja noortefilmide festivalist Just Film. Elutööpreemia saavad Rein Raamat, Rein Maran, Aleksandr Sokurov ja Fridrik Thor Fridriksson

  6. Electronic data intercharge: from its birth to its new role in logistics information systems

    OpenAIRE

    JANSSENS, Gerrit

    2011-01-01

    The introduction of internet applications in e-commerce made many adopters think that EDI would soon disappear. But the trend in logistics towards closer collaboration in supply chains made on the other hand the impact of EDI larger. A resultant of those forces will probably lead to a new type of EDI, which integrates with other technologies. Early studies on EDI were promoting its use because of savings in administrative work. But due to intra-corporation management model changes, to...

  7. 76 FR 42721 - Automated Commercial Environment (ACE): Announcement of a New Start Date for the National Customs...

    Science.gov (United States)

    2011-07-19

    ... the e-mail any past electronic data interchange (EDI) history with CBP. Written comments concerning... be transmitted in advance of arrival through a CBP-approved electronic data interchange (EDI).The..., 2008).\\1\\ Currently, the Automated Commercial System (ACS) is the CBP-approved EDI through which this...

  8. 76 FR 51324 - Hazardous Materials: Incorporating Rail Special Permits Into the Hazardous Materials Regulations

    Science.gov (United States)

    2011-08-18

    ... through use of electronic data interchange (EDI). The IVOHMA states ``differences in hazard communication... and on the possible effects EDI may have on distributing hazardous materials shipping paper... consider the use of EDI in other modes of transport in a future rulemaking. Petition No. P-1567 PHMSA...

  9. 77 FR 19030 - Automated Commercial Environment Required for the Transmission of Advance Ocean and Rail Cargo...

    Science.gov (United States)

    2012-03-29

    ... electronic data interchange (EDI) system. CBP recently completed the testing of the Automated Commercial..., after a six month transition period, ACE will be the only CBP-approved EDI for submitting required...-approved EDI for transmitting to CBP required advance information for ocean and rail cargo. FOR FURTHER...

  10. 77 FR 37961 - Hazardous Materials: Incorporating Rail Special Permits Into the Hazardous Materials Regulations

    Science.gov (United States)

    2012-06-25

    ...'' are added to Sec. 171.8. Requirements for electronic shipping papers, electronic data interchange (EDI... electronic shipping paper information transmitted by EDI for the development of shipping papers used to... shipping papers by carriers. Most of the commenters support amending the HMR to permit EDI transmission of...

  11. Design management of electronic data interchange systems

    NARCIS (Netherlands)

    Heck, van H.W.G.M.

    1993-01-01

    This study deals with the management of the design process of Electronic Data Interchange (EDI) systems. Its objectives are (1) to investigate the design process of EDI systems from a practical and theoretical perspective; (2) to develop a model to describe factors relevant to EDI

  12. 77 FR 44603 - Petition for Waiver of LG Electronics, Inc. From the Department of Energy Residential...

    Science.gov (United States)

    2012-07-30

    ....com . Of counsel: John A. Hodges, Wiley Rein LLP, 1776 K Street NW., Washington, DC 20006, Phone: 202....com . Of counsel: John A. Hodges, Wiley Rein LLP, 1776 K Street NW., Washington, DC 20006, Phone: 202...

  13. Lapsesuu või PR-guru? / Airi Ilisson

    Index Scriptorium Estoniae

    Ilisson, Airi, 1980-

    2007-01-01

    Justiitsminister Rein Lang on autori hinnangul tuntud oma ootamatute arvamustega. CV. Vt. samas: Skandaal: Kuidas Lang politseid ja allilma seostades tormi tekitas. Kommenteerivad: Hans H. Luik, Hannes Astok, Laine Jänes, Rein Kilk ja Ulvi Kuusk

  14. 75 FR 40729 - Residues of Quaternary Ammonium Compounds, N-Alkyl (C12-14

    Science.gov (United States)

    2010-07-14

    ... the Daily Dietary Dose (DDD) and the Estimated Daily Intake (EDI) using modified Food and Drug... survey days. The Estimated Daily Intake (EDI) calculations presented in this assessment for treated... is 0.0103 lbs a.i per gallon of treatment solution. EDI values were calculated using an approach...

  15. 78 FR 52958 - Announcement of Test Concerning Manifesting and Entry of Residue Found in Instruments of...

    Science.gov (United States)

    2013-08-27

    ... Commercial Environment (ACE) will be the only CBP-approved electronic data interchange (EDI) system for... submitted electronically via EDI process at the master or simple bill level. (2) Qualifiers for IIT with... Regular Bill should be submitted electronically via EDI process. (b) Qualifiers for IIT with Residue (TBD...

  16. 77 FR 50613 - Didecyl Dimethyl Ammonium Carbonate and Didecyl Dimethyl Ammonium Bicarbonate; Exemption From the...

    Science.gov (United States)

    2012-08-22

    ...) and the Estimated Daily Intake (EDI) using modified Food and Drug Administration (FDA) methodologies for utensils and the Indirect Dietary Residential Exposure Model (IDREAM) for countertops. The EDI... for DDACB for bottling/packing of food is 0.0033 lbs a.i. per gallon of treatment solution. EDI values...

  17. 48 CFR 552.216-73 - Ordering Information.

    Science.gov (United States)

    2010-10-01

    ... transmission or □ computer-to-computer Electronic Data Interchange (EDI). (b) An offeror electing to receive computer-to-computer EDI is requested to indicate below the name, address, and telephone number of the representative to be contacted regarding establishment of an EDI interface. (c) An offeror electing to receive...

  18. Baixa prevalência de discromatopsia, pela 4ª edição do teste pseudoisocromático HRR (Hardy, Rand e Rittler), da população indígena de etnia terena da aldeia lalima na região de Miranda: Mato Grosso do Sul

    OpenAIRE

    Piccinin,Marcos Rogério Mistro; Cunha,Juliana Ferrari; Almeida,Herbert Paulo de; Bach,Cleiton Cassio; Dossa,Andréa Cristina Grubits Gonçalves de Oliveira; Silva,Reinaldo Ferreira da; Pessoa,Valdir Filgueiras

    2007-01-01

    OBJETIVO: Avaliar a freqüência de discromatopsias através da 4ª edição do teste pseudoisocromático HRR (Hardy, Rand and Rittler) entre a população indígena masculina da aldeia Lalima, etnia Terena, na região de Miranda-MS. MÉTODOS: Foram realizadas viagens à aldeia Lalima em Miranda-MS, nos meses de janeiro e fevereiro de 2005. As viagens para realizar os exames só foram iniciadas após o projeto ter sido avaliado e aprovado pelos Comitê de Ética e Pesquisa da UFMS, Comitê Nacional de Ética e ...

  19. 77 FR 10621 - Changes to the In-Bond Process

    Science.gov (United States)

    2012-02-22

    ... submit in-bond applications electronically using a CBP-approved electronic data interchange (EDI) system... electronically submit the in-bond application to CBP via a CBP-approved EDI system. \\6\\ Due to the unique... as the CBP-approved EDI system for submitting the in-bond application and other information that is...

  20. Extradyadic Involvement, Narcissism, and Callousness in College Students

    Science.gov (United States)

    Crass, Suzanne L.; Terranova, Andrew M.

    2018-01-01

    The relationship between narcissism, callousness, and extradyadic involvement (EDI), has been understudied. It was anticipated that callousness and narcissism would be associated with increased likelihood of engaging in an EDI and less distress about having engaged in the EDI. Participants (268 college students; 75% female; mean age of 20 years…

  1. 77 FR 65006 - Air Cargo Advance Screening (ACAS) Pilot Program

    Science.gov (United States)

    2012-10-24

    ... electronic cargo information by way of a CBP-approved electronic data interchange (EDI) system before the... electronically receive certain information regarding that cargo through a CBP-approved EDI system no later than... the above information regarding that cargo through a CBP-approved EDI system no later than the time of...

  2. 78 FR 35115 - Listing of Color Additives Exempt From Certification; Mica-Based Pearlescent Pigments

    Science.gov (United States)

    2013-06-12

    ... (EDI) of the additive from all sources for both the mean and high- intake consumer to an acceptable daily intake (ADI) level established by toxicological data. The EDI is determined by projections based... the issuance of Sec. 73.350 we calculated a cumulative EDI (CEDI) for the use of mica-based...

  3. 76 FR 54470 - Proposed Data Collections Submitted for Public Comment and Recommendations

    Science.gov (United States)

    2011-09-01

    ..., patient name, patient ID number, and cost. Pharmacies utilize Electronic Data Interchange (EDI) processing at the point-of-sale to transmit claims to the World Trade Center Health Program (WTC-HP). The EDI... the point-of-sale. The EDI transmission occurs in real-time as the prescription transaction is made...

  4. Free Rein

    Science.gov (United States)

    Galley, Michelle

    2004-01-01

    This article presents Fairhaven School, located in a still-bucolic area near Washington, which operates in a way that would baffle many educators, much less the public. Known as a "free school," Fairhaven offers students a radical alternative to the demands of traditional education since it was founded in 1998. In this article, the author…

  5. Disease: H00632 [KEGG MEDICUS

    Lifescience Database Archive (English)

    Full Text Available A, Shaag A, Einbinder T, Rein AJ, Elpeleg O ... TITLE ... A human laterality disorder associated with recessi...dson S, Rein AJ, Elpeleg O, Katsanis N ... TITLE ... A human laterality disorder caused by a homozygous delete

  6. Criticism over justice minister's Hitler party

    Index Scriptorium Estoniae

    2007-01-01

    Justiitsminister Rein Lang tähistas 4. juulil Tartus Püssirohu keldris oma sünnipäeva, kus etendati monotükki "Adolf" Hitleri viimastest elutundidest. Venemaa reageering ja süüdistused, Rein Langi vastus kriitikale

  7. 78 FR 49117 - Listing of Color Additives Exempt From Certification; Spirulina Extract

    Science.gov (United States)

    2013-08-13

    .... We compare an individual's estimated daily intake (EDI) of the additive from all food sources to an acceptable intake level established by toxicological data. The EDI is determined by projections based on the... from all food sources of the additive. We commonly use the EDI for the 90th percentile consumer of a...

  8. Koidu tänava elamu = Residential building in Koidu street / Margit Mutso

    Index Scriptorium Estoniae

    Mutso, Margit, 1966-

    2010-01-01

    Tallinnas Koidu 62/Komeedi 14 asuva kahest maa peal eraldi seisvast mahust koosneva sisehooviga korterelamu arhitektuursest lahendusest. Arhitekt Rein Murula, kaasautor Karl Kroosa (Rein Murula Arhitektuuribüroo). Žürii liikme Kalle Komissarovi hinnang kultuurkapitali aastapreemiale esitatud hoonele

  9. Enhanced-Depth Imaging Optical Coherence Tomography of the Human Choroid In Vivo Compared With Histology After Enucleation

    DEFF Research Database (Denmark)

    Li, Xiao Qiang; Heegaard, Steffen; Kiilgaard, Jens Folke

    2016-01-01

    PURPOSE: This study compared in vivo enhanced-depth imaging optical coherence tomography (EDI-OCT) with ex vivo histology of the choroid in human eyes. METHODS: Three eyes in three patients with advanced iris melanoma without posterior segment involvement underwent EDI-OCT less than 24 hours prior...... to enucleation and, in one eye, immediately after enucleation. Following fixation in 4% buffered formaldehyde and paraffin embedding, serial sections of the whole eye were cut horizontally, mounted, stained with hematoxylin-eosin and digitized. Alignment between histology and EDI-OCT was made on landmarks...... and subfoveal choroid thickness reduced to 56%, 45%, and 56%, respectively, of its in vivo thickness on EDI-OCT. CONCLUSIONS: There were no identifiable discrepancies in choroidal structural patterns between clinical EDI-OCT and histologic sections except that after enucleation and histologic fixation choroidal...

  10. Sotsiaalmaja Tallinnas Ankru 1 = Social Housing in Tallinn at 1 Ankru Street / Karin Hallas

    Index Scriptorium Estoniae

    Hallas, Karin, 1957-

    2001-01-01

    Projekteerija Rein Murula Arhitektuuribüroo. Arhitekt Rein Murula, kaasa töötanud Martin Aunin, Margus Maiste, Karl Koosa. Konstruktsioonid: insener Tõnu Rausberg. Vanuritemaja I korrusel invakorterid. Projekt 1999, valmis 2000. 5 ill.: I korruse plaan, välisvaated

  11. EDI Performance Statistics

    Data.gov (United States)

    U.S. Department of Health & Human Services — This section contains statistical information and reports related to the percentage of electronic transactions being sent to Medicare contractors in the formats...

  12. Energy upcycle in anaerobic treatment: Ammonium, methane, and carbon dioxide reformation through a hybrid electrodeionization–solid oxide fuel cell system

    International Nuclear Information System (INIS)

    Xu, Linji; Dong, Feifei; Zhuang, Huichuan; He, Wei; Ni, Meng; Feng, Shien-Ping; Lee, Po-Heng

    2017-01-01

    Highlights: • EDI-SOFC integrated with AD is introduced for energy extraction from C and N pollutants. • NH_4"+ dissociation to NH_3 and H_2 in EDI avoids C deposition in SOFC. • EDI exhibits nutrient and heavy metal recovery. • SOFCs display its adaptability with NH_3, H_2, and biogas. • Energy balance ratio boosts from 1.11 to 1.75 by EDI-SOFC in a HK landfill plant. - Abstract: To create possibilities for a more sustainable wastewater management, a novel system consisting of electrodeionization (EDI) and solid oxide fuel cells (SOFCs) is proposed in this study. This system is integrated with anaerobic digestion/landfills to capture energy from carbonaceous and nitrogenous pollutants. Both EDI and SOFCs showed good performances. EDI removed 95% and 76% ammonium-nitrogen (NH_4"+-N) from diluted (0.025 M) to concentrated (0.5 M) synthetic ammonium wastewaters, respectively, accompanied by hydrogen production. SOFCs converted the recovered fuels, biogas mixtures of methane and carbon dioxide, to electricity. Under the optimal conditions of EDI (3.0 V applied voltage and 7.5 mm internal electrode distance (IED), and SOFCs (750 °C operating temperature), the system achieved 60% higher net energy output as compared to conventional systems. The estimated energy benefit of this proposed system showed that the net energy balance ratio is enhanced from 1.11 (existing system) to 1.75 (this study) for a local Hong Kong active landfill facility with 10.0 g L"−"1 chemical oxygen demand (COD) and 0.21 M NH_4"+-N. Additionally, an average of 80% inorganic ions (heavy metals and nutrient elements) can be removed from the raw landfill leachate by EDI cell. The results are successful demonstrations of the upgrades of anaerobic processes for energy extraction from wastewater streams.

  13. Improving the Procurement of Information Technology Commodities

    Science.gov (United States)

    1994-04-12

    and 0 the federal government. Apply Electronic Data Interchange (EDI) to order processing at AVC. Implementing EDI at AVC and throughout the Air Force...ordering process by approximately 2 weeks. 4. Centralize the Central Order Processing Offices. By consolidating AVC and SSCs order processing responsibilities...Im plem entation ..................................................................................... 21 5. ORDER PROCESSING WITH EDI

  14. Alberta Learning: Early Development Instrument Pilot Project Evaluation.

    Science.gov (United States)

    Meaney, Wanda; Harris-Lorenze, Elayne

    The Early Development Instrument (EDI) was designed by McMaster University to measure the outcomes of childrens early years as they influence their readiness to learn at school. The EDI was piloted in several Canadian cities in recent years through two national initiatives. Building on these initiatives, Alberta Learning piloted the EDI as a…

  15. 75 FR 37827 - Notice of Regulatory Waiver Requests Granted for the First Quarter of Calendar Year 2010

    Science.gov (United States)

    2010-06-30

    ... Development Initiative Special Purpose (EDI-SP) grant in the amount of $745,575 for the Poverty Point restoration project in Delhi, LA. The State of Louisiana will use the EDI-SP funds to build a new visitor... site. Subsequent to the January 23, 2004 appropriation for the EDI-SP grant, but prior to the...

  16. The occurrence, exposure and risk assessment of perfluoroalkyl acids in food from mainland, China.

    Science.gov (United States)

    Wang, Xinxuan; Zhang, Ruobing; Zhang, Hong; Wang, Yanping

    2017-11-01

    To study the contamination of perfluoroalkyl acids (PFAAs) in Chinese food and the risk of dietary exposure for the Chinese population, the data of 17 PFAAs covering 38 cities throughout China in 15 groups of foods were collected for meta-analysis from published and available research literature. Using food consumption and body weight parameters, estimated dietary intakes (EDIs) were calculated for evaluation using the Scenario-Based Risk Assessment (SceBRA) modelling. Among food groups, the highest ΣPFAAs concentrations and EDI contributions were both found in poultry (363 ng/g), fish and shrimp (313 ng/g), dark vegetables (309 ng/g), fruits (116 ng/g) and pork (25 ng/g). The EDI of adults in the high-exposure scenario was about twice that of the intermediate-exposure scenario, while the EDI of children was about twice that of adults' EDI in the intermediate-exposure scenario. In addition, the PFOS EDI for children under high exposure approached its tolerable daily intake (TDI). Therefore high dietary exposure to PFAAs is giving rise to an increased health risk, especially for children.

  17. 76 FR 71389 - Agency Forms Submitted for OMB Review, Request for Comments

    Science.gov (United States)

    2011-11-17

    ... Interchange (EDI) version of the Form Letter ID-4K notice, or an Internet equivalent ID-4K, which is... electronically via EDI or ERS. Completion is voluntary. Once the RRB determines to pay a claim post-payment Form...-4E paper notice and the EDI and Internet equivalent versions are transmitted on a daily basis...

  18. 76 FR 55719 - Proposed Collection; Comment Request

    Science.gov (United States)

    2011-09-08

    ...-4K paper notice, an Electronic Data Interchange (EDI) version of the Form Letter ID-4K notice, or an... completed ID-4K back to the RRB, or electronically via EDI or ERS. Completion is voluntary. No changes are...-4E paper notice and the EDI and Internet equivalent versions are transmitted on a daily basis...

  19. Kriitikast / Leelo Kõlar

    Index Scriptorium Estoniae

    Kõlar, Leelo, 1927-

    1999-01-01

    Vestlus Rein Rannapiga pärast sooloesinemist 29.11.1976 Estonia kontserdisaalis. - Rein Metsa esinemisest kontserdil 02.12.1976 Estonia kontserdisaalis, kavas Bartoki 1. klaverikontsert. - Kalle Randalu klaveriõhtust. - Eesti pianistide esinemistest. - Vestlus Kalle Randaluga. - Roger Woodward esinemisest Estonia kontserdisaalis 1994. a. juunis

  20. Preparing organisations for employee-driven open innovation

    Directory of Open Access Journals (Sweden)

    Amundsen, O.

    2014-07-01

    Full Text Available The present study addresses the need to prepare organisations, small or large, for open innovation approaches, including the development of capacity to exploit the potential benefits of such principles through Employee-Driven Innovation (EDI. Based on interviews in 20 Norwegian enterprises, we propose that EDI is an under-explored opportunity in many organisations, and that the systematic introduction of EDI practices increases organisations' ability to exploit open innovation principles and favourably impacts the capacity for innovation. Specifically, EDI results in a more general interest in improvement among employees, increased engagement in innovation processes, and reduced opposition to change.

  1. Munitsipaalmaja : Tallinn, Erika t. 9 = Municipal Housing : Tallinn, Erika St. 9 / Liina Jänes

    Index Scriptorium Estoniae

    Jänes, Liina, 1977-

    2003-01-01

    120 korteriga munitsipaalelamu on 1953. a. pärineva stalinistliku lagunenud kasarmuhoone rekonstruktsioon. Projekteerija: Rein Murula Arhitektuuribüroo. Autorid: Rein Murula, Marti Kahu, Karl Koosa. Konstruktor Tõnu Rausberg (TA-Konsult). Projekt ja hoone valmis: 2002. I, IV ja katusekorruse plaan, 4 välisvaadet

  2. 2008 Maneuver Support Science and Technology Conference and Exhibition

    Science.gov (United States)

    2008-07-30

    BPT SBF O/O RFL 1 O/O RFL 2 6 3 IAF 25 1 1 IIF 36 CDO SSF 4 1 IIF 1 IIF IIF 2 1 5 3 IAF IIF 2 1 IIF 2 1 SSF (Rein) 12 BCT x (-) 3 (-)(Rein) scc (Rein...Wild Fires, CA 11/2003 Garfield Hgts, OH, Magnesium Fire 12/2003 State of the Union – 1/2004 Baltimore, MD, Rad Survey 1/2004 Alpharetta, GA...Detector • LISA Manportable: UV- Raman Sensor Advantages: UV- Raman for stand-off detection – no need to collect/transfer analyte to spectrometer for

  3. Shallow surface etching of organic and inorganic compounds by electrospray droplet impact

    International Nuclear Information System (INIS)

    Hiraoka, Kenzo; Sakai, Yuji; Iijima, Yoshitoki; Asakawa, Daiki; Mori, Kunihiko

    2009-01-01

    The electrospray droplet impact (EDI) was applied to bradykinin, polyethylene terephthalate (PET), SiO 2 /Si, and indium phosphide (InP). It was found that bradykinin deposited on the stainless steel substrate was ionized/desorbed without the accumulation of radiation products. The film thickness desorbed by a single collisional event was found to be less than 10 monolayers. In the EDI mass spectra for PET, several fragment ions were observed but the XPS spectra did not change with prolonged cluster irradiation. The etching rate for SiO 2 by EDI was measured to be ∼0.2 nm/min. The surface roughness of InP etched by EDI was found to be one order of magnitude smaller than that etched by 3 keV Ar + for about the same etching depths. EDI is capable of shallow surface etching with little damage left on the etched surface.

  4. Ring peale kultuurkapitali kirjanduslaureaatidele

    Index Scriptorium Estoniae

    2005-01-01

    Eesti Kultuurkapitali 2004. aasta kirjanduse aastapreemia laureaatide teoste tutvustused: André Trinity (Rein Raud "Hector ja Bernard"), Mart Velsker (fs - luulekogu "2004"), Katrin Ruus (Mart Kivastik -näidend "Külmetava kunstniku portree"), Krista Kumberg (Jaan Rannap "Nelja nimega koer"), Rein Veidemann (Toomas Haug "Troojamäe tõotus")

  5. Ajalooteaduses pole absoluutset tõde olemas / Ralf R. Parve

    Index Scriptorium Estoniae

    Parve, Ralf R., 1946-2008

    2007-01-01

    4. oktoobril Tallinna Ülikoolis toimunud ümarlauast "Alternatiivsetest ajalookäsitlustest", kus ajaloo uurimise üle arutlesid ajaloolane Mart Laar, TLÜ Eesti Humanitaarinstituudi kultuuriteooria lektor Marek Tamm, TLÜ Ajaloo Instituudi direktor Magnus Ilmjärv ja TLÜ poliitikateooria professor Rein Ruutsoo. Ümarlauda juhtis rektor Rein Raud

  6. Partsi otsus Langi kohta määrab valitsuse saatuse / Tuuli Koch

    Index Scriptorium Estoniae

    Koch, Tuuli

    2005-01-01

    Peaministri otsus, kas esitada Rein Lang välisministri kandidaadiks või mitte, osutub valitsuskriisi võtmeküsimuseks. Peaminister peab vajalikuks veel kord kandidaadiga kohtuda. Vt. samas lühiintervjuud Rein Langiga. Kommenteerivad politoloog Kaido Jaanson, MK Estonija peatoimetaja Pavel Ivanov ja Euroopa Parlamendi liige Marianne Mikko

  7. Exposure assessment of synthetic colours approved in Korea.

    Science.gov (United States)

    Ha, M-S; Ha, S-D; Choi, S-H; Bae, D-H

    2013-01-01

    The dietary intakes of nine synthetic food colours--amaranth, erythrosine, Allura Red, Ponceau 4R, tartrazine, Sunset Yellow FCF, Fast Green FCF, Brilliant Blue FCF and indigo carmine--permitted in Korea were estimated based on food consumption data for consumers and their concentrations in processed foods. The estimated daily intakes (EDIs) by Korean consumers were compared with the acceptable daily intakes (ADIs) of the colours. Among 704 foods sampled, 471 contained synthetic colours. The most highly consumed synthetic colours were Allura Red and tartrazine; the highest EDI/ADI ratios were found for amaranth, erythrosine and Allura Red. The EDIs of infants and children were higher than those of adults. The main food categories containing colours were beverages and liquor for adults, and beverages, chocolate and ice cream for infants and children. For average Korean consumers, the EDIs were not greater than 2.5% of their corresponding ADIs, although the EDI of a conservative consumer in the upper 95th percentile reached 37% of the ADI.

  8. Comparison Study of Water Demineralization System for the OPR 1000 and AP 1000 Nuclear Power Plant

    International Nuclear Information System (INIS)

    Dedy Priambodo; Siti Alimah; Erlan Dewita

    2009-01-01

    OPR 1000 adopts demineralization method based on ion exchanger resin and AP 1000 adopt the method that based on Reverse Osmosis (RO)-Electrodeionization (EDI). The Ion exchange process is a reversible chemical reaction of a solution and an insoluble solid. Ion exchanger use resin as polluter ions capture and will be regenerated after its saturated. RO is method using pressure to force a solution through a membrane, retaining the solute on one side and allowing the pure solvent to pass to the other side. Whereas, EDI is a combination of ion exchange and electrodialysis. The ions is taken by ion exchange resin, and then it is discharged utilizing electric potential difference. Due to water splitting phenomena in EDI, make resin will never be saturated, so the RO-EDI process is water demineralization system that use little chemical, more simple installation, capable to maintain demineralization water product quality and environmental friendly. Thereby, The RO-EDI water demineralization system is more advance then ion exchange technology. (author)

  9. Assessment of Korean consumer exposure to sodium saccharin, aspartame and stevioside.

    Science.gov (United States)

    Ha, Mi-Sun; Ha, Sang-Do; Choi, Sung-Hee; Bae, Dong-Ho

    2013-01-01

    The dietary intakes of sodium saccharin, aspartame and stevioside were estimated on the basis of food consumption data of the Korean consumer and the concentration of sweeteners in processed foods. Results were compared with the acceptable daily intake (ADI) of sweeteners. Among the 28 food categories for which the application of sodium saccharin, aspartame and stevioside is permitted in Korea, they were detected in 5, 12 and 13 categories, respectively. The estimated daily intake (EDI) of sodium saccharin and aspartame were high in infants and children, whereas the EDI of stevioside was high in adolescents and adults. The most highly consumed sweetener was aspartame, and the highest EDI/ADI ratio was found for sodium saccharin. The main food categories contributing to sweetener consumption were beverages, including alcoholic beverages. For most Korean consumers, the EDIs were no greater than 20% of their corresponding ADI; however, the EDI of sodium saccharin for conservative consumers aged 1-2 years reached 60% of their ADI.

  10. Effects of cyclosporine A pretreatment of deceased organ donors on kidney graft function (Cis-A-rein): study protocol for a randomized controlled trial.

    Science.gov (United States)

    Orban, Jean-Christophe; Fontaine, Eric; Cassuto, Elisabeth; Baumstarck, Karine; Leone, Marc; Constantin, Jean-Michel; Ichai, Carole

    2018-04-17

    Renal transplantation represents the treatment of choice of end-stage kidney disease. Delayed graft function (DGF) remains the most frequent complication after this procedure, reaching more than 30%. Its prevention is essential as it impedes early- and long-term prognosis of transplantation. Numerous pharmacological interventions aiming to prevent ischemia-reperfusion injuries failed to reduce the rate of DGF. We hypothesize that cyclosporine as an early preconditioning procedure in donors would be associated with decreased DGF. The Cis-A-rein study is an investigator-initiated, prospective, multicenter, double-blind, randomized, controlled study performed to assess the effects of a donor preconditioning with cyclosporine A on kidney grafts function in transplanted patients. After randomization, a brain dead donor will receive 2.5 mg kg -1 of cyclosporine A or the same volume of 5% glucose solution. The primary objective is to compare the rate of DGF, defined as the need for at least one dialysis session within the 7 days following transplantation, between both groups. The secondary objectives include rate of slow graft function, mild and severe DGF, urine output and serum creatinine during the first week after transplantation, rate of primary graft dysfunction, renal function and mortality at 1 year. The sample size (n = 648) was determined to obtain 80% power to detect a 10% difference for rate of DGF at day 7 between the two groups (30% of the patients in the placebo group and 20% of the patients in the intervention group). Delayed graft function is a major issue after renal transplantation, impeding long-term prognosis. Cyclosporine A pretreatment in deceased donors could improve the outcome of patients after renal transplantation. ClinicalTrials.gov, ID: NCT02907554 Registered on 20 September 2016.

  11. Case report

    African Journals Online (AJOL)

    ebutamanya

    , subdivisant les TNE urologiques en bas et haut grade [3]. Les carcinoïdes du rein se développent préférentiellement sur une uropathie malformative dont la plus fréquente est représentée par les reins en fer à cheval, ou sur.

  12. Phases of Violent Extremism: Targeting the Evolution of Al-Shabaab

    Science.gov (United States)

    2015-12-01

    Edi Rama, prime minister of Albania suggests, “The threat from the radicalization of ideologies and particularly from violent jihadist extremism will...Killed Al-Shabab Leader,” BBC News Africa, Accessed October 10, 2015, http://www.bbc.com/news/world-africa-29034409. 219 Edi Rama, To Defeat Extremism...Balasubramaniyan. “Organizational and Structural Evolution- Lessons from Al-Qaeda.” Indian Defense Review, November 21, 2013. Rama, Edi . To Defeat

  13. Evidence for the electromagnetic decay instability driven by two plasmon decay

    International Nuclear Information System (INIS)

    Baker, K.L.; Afeyan, B.B.; Estabrook, K.G.; Drake, R.P.

    1997-01-01

    This paper examines the electromagnetic decay instability (EDI) and its role in laser-produced plasmas. The electromagnetic decay instability provides another channel through which parametric instabilities involving Langmuir waves can saturate. In the case where EDI is pumped by the Langmuir waves associated with two plasmon decay, EDI is shown to present an explanation for ω o /2 emission from laser-produced plasmas which is consistent with experimental observations

  14. 75 FR 76426 - Privacy Act of 1974; System of Records

    Science.gov (United States)

    2010-12-08

    ... name, middle initial); unique identifiers including Electronic Data Interchange Person Identifier (EDI... (EDI PI), other unique identifier (not Social Security Number), Federal Agency Smart Credential Number...

  15. 78 FR 23778 - Notice of Proposed Information Collection: Comment Request: Congressional Earmark Grants

    Science.gov (United States)

    2013-04-22

    ... categories: Economic Development Initiative--Special Project (EDI--SP) grantees and Neighborhood Initiative... generally fall into two categories: Economic Development Initiative--Special Project (EDI--SP) grantees and...

  16. Esta tenzon fezeron Pero da Ponte e Afonso Anes do Coton. Edição e estudo do debate B969/V556

    Directory of Open Access Journals (Sweden)

    Déborah González Martínez

    2013-07-01

    Full Text Available Pero da Ponte e Afonso Eanes do Coton são dois destacados autores de cantigas transmitidas nos cancioneiros galego-portugueses: o Cancioneiro da Ajuda, o Cancioneiro da Biblioteca Nacional (Cód. 10991 e o Cancioneiro da Biblioteca Vaticana (Vat. Lat. 4803. A estreita relação entre estes dois trovadores confirma-se pelas menções a ambos no interior de vários textos de natureza satírica e pela interação em duas cantigas dialogadas. O presente trabalho consiste numa nova edição crítica da tenção entre Afonso Eanes do Coton e Pero da Ponte (Pero da Pont’, e[n] un vosso cantar, B969 / V556, oferecendo novas respostas a velhas dificuldades ecdóticas. O texto vai acompanhado de anotação e estudo, pois o diálogo desenvolve vários temas de especial interesse para os estudos trovadorescos: a classe social e a atividade profissional dos interlocutores.Pero da Ponte and Afonso Eanes do Coton are two renowned authors of cantigas contained in the galician-portuguese songbooks: the Cancioneiro da Ajuda, the Cancioneiro da Biblioteca Nacional (Cód. 10991 and the Cancioneiro da Biblioteca Vaticana (Vat. Lat. 4803. The close relationship between these troubadours is confirmed by some references in satirical texts and, mainly, by the dialogued song Pero da Pont’, e[n] un vosso cantar (B969 / V556. This work offers a new critical edition of this tenção with notes and literary study. The dialogue develops several topics of interest for the studies about troubadours: social class and professional activity of the interlocutors.  

  17. Embodied Design Ideation

    DEFF Research Database (Denmark)

    Wilde, Danielle; Vallgårda, Anna; Tomico, Oscar

    Embodied design ideation (EDI) practices work with relationships between body, material and context to enliven design and research potential. Methods are often idiosyncratic and – due to their physical nature – not easily transferred. As independent researchers, and as collaborators, we have been...... engaging with this problematic for some time. At CHI2017 we will present a framework that enables designers to understand, describe and contextualise EDI practices in ways that can be understood by peers, as well as those new to embodied ideation. Our framework affords discussion of embodied design actions...... individual approaches to EDI, developed over many years of research practice and (3) an inspirational catalogue demonstrating the diversity of ideas that EDI methods can foster....

  18. 76 FR 40457 - Administrative Simplification: Adoption of Operating Rules for Eligibility for a Health Plan and...

    Science.gov (United States)

    2011-07-08

    ... information. Electronic Data interchange (EDI) enables providers and payers to process financial and... hardware and software to exchange EDI data. Each trading partner, including providers, separately provides...

  19. In vitro digestion and DGT techniques for estimating cadmium and lead bioavailability in contaminated soils: Influence of gastric juice pH

    International Nuclear Information System (INIS)

    Pelfrene, Aurelie; Waterlot, Christophe; Douay, Francis

    2011-01-01

    A sensitivity analysis was conducted on an in vitro gastrointestinal digestion test (i) to investigate the influence of a low variation of gastric juice pH on the bioaccessibility of Cd and Pb in smelter-contaminated soils (F B , using the unified bioaccessibility method UBM) and fractions of metals that may be transported across the intestinal epithelium (F A , using the diffusive gradient in thin film technique), and (ii) to provide a better understanding of the significance of pH in health risk assessment through ingestion of soil by children. The risk of metal exposure to children (hazard quotient, HQ) was determined for conditions that represent a worst-case scenario (i.e., ingestion rate of 200 mg day -1 ) using three separate calculations of metal daily intake: estimated daily intake (EDI), bioaccessible EDI (EDI-F B ), and oral bioavailable EDI (EDI-F A ). The increasing pH from 1.2 to 1.7 resulted in: (i) no significant variation in Cd-F B in the gastric phase but a decrease in the gastrointestinal phase; (ii) a decrease in soluble Pb in the gastric phase and a significant variation in Pb-F B in the gastrointestinal phase; (iii) a significant decrease in Cd-F A and no variation in Pb-F A ; (iv) no change in EDI-F B and EDI-F A HQs for Cd; (v) a significant decrease in EDI-F B HQs and no significant variation in EDI-F A HQ for Pb. In the analytical conditions, these results show that risk to children decreases when the bioavailability of Pb in soils is taken into account and that the studied pH values do not affect the EDI-F A HQs. The present results provide evidence that the inclusion of bioavailability analysis during health risk assessment could provide a more realistic estimate of Cd and Pb exposure, and opens a wide field of practical research on this topic (e.g., in contaminated site management). - Highlights: → Sensitivity analysis on an in vitro gastrointestinal digestion test. → Influence of gastric juice pH on metal bioaccessibility

  20. In vitro digestion and DGT techniques for estimating cadmium and lead bioavailability in contaminated soils: Influence of gastric juice pH

    Energy Technology Data Exchange (ETDEWEB)

    Pelfrene, Aurelie, E-mail: aurelie.pelfrene@isa-lille.fr [Universite Lille Nord de France, Lille (France); Groupe ISA, Equipe Sols et Environnement, Laboratoire Genie Civil et geo-Environnement (LGCgE) Lille Nord de France (EA 4515), 48 boulevard Vauban, 59046 Lille cedex (France); Waterlot, Christophe; Douay, Francis [Universite Lille Nord de France, Lille (France); Groupe ISA, Equipe Sols et Environnement, Laboratoire Genie Civil et geo-Environnement (LGCgE) Lille Nord de France (EA 4515), 48 boulevard Vauban, 59046 Lille cedex (France)

    2011-11-01

    A sensitivity analysis was conducted on an in vitro gastrointestinal digestion test (i) to investigate the influence of a low variation of gastric juice pH on the bioaccessibility of Cd and Pb in smelter-contaminated soils (F{sub B}, using the unified bioaccessibility method UBM) and fractions of metals that may be transported across the intestinal epithelium (F{sub A}, using the diffusive gradient in thin film technique), and (ii) to provide a better understanding of the significance of pH in health risk assessment through ingestion of soil by children. The risk of metal exposure to children (hazard quotient, HQ) was determined for conditions that represent a worst-case scenario (i.e., ingestion rate of 200 mg day{sup -1}) using three separate calculations of metal daily intake: estimated daily intake (EDI), bioaccessible EDI (EDI-F{sub B}), and oral bioavailable EDI (EDI-F{sub A}). The increasing pH from 1.2 to 1.7 resulted in: (i) no significant variation in Cd-F{sub B} in the gastric phase but a decrease in the gastrointestinal phase; (ii) a decrease in soluble Pb in the gastric phase and a significant variation in Pb-F{sub B} in the gastrointestinal phase; (iii) a significant decrease in Cd-F{sub A} and no variation in Pb-F{sub A}; (iv) no change in EDI-F{sub B} and EDI-F{sub A} HQs for Cd; (v) a significant decrease in EDI-F{sub B} HQs and no significant variation in EDI-F{sub A} HQ for Pb. In the analytical conditions, these results show that risk to children decreases when the bioavailability of Pb in soils is taken into account and that the studied pH values do not affect the EDI-F{sub A} HQs. The present results provide evidence that the inclusion of bioavailability analysis during health risk assessment could provide a more realistic estimate of Cd and Pb exposure, and opens a wide field of practical research on this topic (e.g., in contaminated site management). - Highlights: {yields} Sensitivity analysis on an in vitro gastrointestinal digestion test

  1. 76 FR 37136 - Post-Summary Corrections to Entry Summaries Filed in ACE Pursuant to the ESAR IV Test

    Science.gov (United States)

    2011-06-24

    ... accelerated liquidation request indicator. C. Electronic Data Interface (EDI) Capability Trade participants.../ace_edi_messages/catair_main/abi_catair . Operational documentation addressing PSC may be found in the...

  2. 77 FR 1555 - Administrative Simplification: Adoption of Standards for Health Care Electronic Funds Transfers...

    Science.gov (United States)

    2012-01-10

    ... interim final rule with comment period. For further information about electronic data interchange (EDI... the accounts payable/receivable system and electronic data interchange (EDI) systems, and the business...

  3. Highly-sensitive aptasensor based on fluorescence resonance energy transfer between l-cysteine capped ZnS quantum dots and graphene oxide sheets for the determination of edifenphos fungicide.

    Science.gov (United States)

    Arvand, Majid; Mirroshandel, Aazam A

    2017-10-15

    With the advantages of excellent optical properties and biocompatibility, single-strand DNA-functionalized quantum dots have been widely applied in biosensing and bioimaging. A new aptasensor with easy operation, high sensitivity, and high selectivity was developed by immobilizing the aptamer on water soluble l-cysteine capped ZnS quantum dots (QDs). Graphene oxide (GO) sheets are mixed with the aptamer-QDs. Consequently, the aptamer-conjugated QDs bind to the GO sheets to form a GO/aptamer-QDs ensemble. This aptasensor enables the energy transfer based on a fluorescence resonance energy transfer (FRET) from the QDs to the GO sheets, quenching the fluorescence of QDs. The GO/aptamer-QDs ensemble assay acts as a "turn-on'' fluorescent sensor for edifenphos (EDI) detection. When GO was replaced by EDI, the fluorescence of QDs was restored and its intensity was proportional to the EDI concentration. This GO-based aptasensor under the optimum conditions exhibited excellent analytical performance for EDI determination, ranging from 5×10 -4 to 6×10 -3 mg L -1 with the detection limit of 1.3×10 -4 mgL -1 . Furthermore, the designed aptasensor exhibited excellent selectivity toward EDI compared to other pesticides and herbicides with similar structures such as diazinon, heptachlor, endrin, dieldrin, butachlor and chlordane. Good reproducibility and precision (RSD =3.9%, n =10) of the assay indicates the high potential of the aptasensor for quantitative trace analysis of EDI. Moreover, the results demonstrate the applicability of the aptasensor for monitoring EDI fungicide in spiked real samples. Copyright © 2017 Elsevier B.V. All rights reserved.

  4. 76 FR 23628 - Agency Information Collection Activities: Submission for the Office of Management and Budget (OMB...

    Science.gov (United States)

    2011-04-27

    ... Form 628, ``Financial EDI Authorization;'' NUREG/BR-0254, Payment Methods; and NRC Form 629... applicable: NRC Form 628, ``Financial EDI Authorization'' and NRC Form 629, ``Authorization for Payment by...

  5. 75 FR 12777 - Notice of Regulatory Waiver Requests Granted for the Fourth Quarter of Calendar Year 2009

    Science.gov (United States)

    2010-03-17

    ... Development Initiative Special Project (EDI-SP) funds to implement the Pagedale Community Development... are currently vacant. Subsequent to the March 11, 2009 appropriation containing the EDI-SP, but prior...

  6. 76 FR 72210 - Notice of Proposed Information Collection: Comment Request Congressional Earmark Grants

    Science.gov (United States)

    2011-11-22

    ...-Special Project (EDI-SP) and Neighborhood Initiative (NI) grants. DATES: Comments Due Date: January 23... generally fall into two categories: Economic Development Initiative-Special Project (EDI-SP) grantees and...

  7. Eesti esimesed naisskulptorid

    Index Scriptorium Estoniae

    2004-01-01

    15. aprillist Adamson-Ericu muuseumis Juta Kivimäe koostatud näitus "Eesti esimesi naisskulptoreid". Näeb režissöör Rein Raamatu portreefilmi "Maire Männik, 54 Rue du Montparnasse" (2000). 12. V teabepäeval esinevad J. Kivimäe, Isabel Aaso, Mari-Liis Tammi, Reet Varblane, Rein Raamat

  8. Realistic interpretation of quantum mechanics and encounter-delayed-choice experiment

    Science.gov (United States)

    Long, GuiLu; Qin, Wei; Yang, Zhe; Li, Jun-Lin

    2018-03-01

    In this paper, a realistic interpretation (REIN) of the wave function in quantum mechanics is briefly presented. We demonstrate that in the REIN, the wave function of a microscopic object is its real existence rather than a mere mathematical description. Specifically, the quantum object can exist in disjointed regions of space just as the wave function is distributed, travels at a finite speed, and collapses instantly upon a measurement. Furthermore, we analyze the single-photon interference in a Mach-Zehnder interferometer (MZI) using the REIN. Based on this, we propose and experimentally implement a generalized delayed-choice experiment, called the encounter-delayed-choice experiment, where the second beam splitter is decided whether or not to insert at the encounter of two sub-waves along the arms of the MZI. In such an experiment, the parts of the sub-waves, which do not travel through the beam splitter, show a particle nature, whereas the remaining parts interfere and thus show a wave nature. The predicted phenomenon is clearly demonstrated in the experiment, thus supporting the REIN idea.

  9. O Brasil através dos Para-brisas: O Turismo na Primeira Edição da Revista Quatro Rodas

    Directory of Open Access Journals (Sweden)

    Maria Henriqueta S. Garcia Gimenes-Minasse

    2014-07-01

    Full Text Available É grande a importância dos guias turísticos na construção da imagem de destinos turísticos, pois auxiliam a organização de viagens, selecionando o que merece ser visto e visitado. No Brasil, um dos mais respeitados pelos turistas domésticos é o Guia Quatro Rodas, publicado anualmente pela Editora Abril, desde setembro de 1965. Contudo, já em 1960 a revista Quatro Rodas, criada nesse ano, e da qual o Guia nasceu, já vinha desempenhando o papel de informar e orientar o leitor sobre passeios e roteiros que poderiam ser feitos de automóvel. Este artigo tem o objetivo de analisar o conteúdo relacionado ao Turismo da primeira edição da Revista Quatro Rodas. Os principais resultados encontrados evidenciam a transformação social do Brasil com o advento de uma matriz econômica pautada na indústria do automóvel e com a incorporação das viagens de lazer como uma forma de descoberta desse ‘novo’ país.  Brazil through the Windshield: Tourism in the First Edition of Quatro Rodas Magazine - Tour guides are very important in building the image of touristic attractions, as they help with travel arrangements and selection of attractions to be seen and visited. In Brazil Guia Quatro Rodas is one of the guides most respected by domestic tourists. It is annually published by Editora Abril, since September 1965. Nevertheless, since 1960 the newly formed Quatro Rodas magazine, and from which the Guia Quatro Rodas was borne, was already playing the role of informing and guiding its readers in relation to tours that could be made by car. The scope of this article is to analyze the first edition of Quatro Rodas magazine with respect to its tourism-related content. The main results show the social transformation of Brazil with the advent of an economic matrix based on the automotive industry and the incorporation of leisure travel as a way to discover the ‘new’ country.

  10. Measurements and Clinical Findings on Thorotrast Deposits in the Kidney; Mesures et Observations Cliniques Faites sur des Depots de Thorotrast dans le Rein; 0418 0417 041c 0414 ; Determinaciones y Datos Clinicos Relativos a los Depositos Renales de Torotrasto

    Energy Technology Data Exchange (ETDEWEB)

    Oberhausen, E.; Muth, H.; Grillmaier, R. [Institut Fuer Biophysik der Universitaet des Saarlandes, Homburg (Saar), Federal Republic of Germany (Germany)

    1964-11-15

    thorotrast dans le rein. Il n'en faut pas moins s'attendre a trouver de nombreux malades dont les reins contiennent des depots de thorotrast car le thorotrast a ete utilise tres souvent comme substance opaque dans les pyelographies retrogrades. Dans les conditions normales, tout le thorotrast aurait du etre emporte par l'urine. Cependant, si l'application a ete faite sous forte pression ou qu'il y eut a l'epoque une infection renale, il se peut qu'une partie du thorotrast se soit deposee dans les tissus. Il est possible qu'un nombre important de ces depots ne puisse etre identifie sur les radiographies, car ils ressemblent beaucoup a des depots de calcium dans le rein et il faut une certaine experience pour distinguer les depots de calcium des depots de thorotrast. Au cours des dernieres annees, les auteurs, en collaboration avec des urologues, ont pu reperer sept cas de ce genre. Lorsqu'il n'y avait de depot que dans un seul'rein, ce qui etait le- cas chez six sujets, on a procede a l'ablation de l'organe. L'examen histol ogique a'revele cinq carcinomes ainsi'qu'une degenerescence tres poussee d'un rein. D'apres les observations des auteurs, il faut entre 20 et 25 annees pour qu'un carcinome se developpe. Dans deux cas, il a ete possible d'examiner le sujet dans l'anthropogamraametre et de doser les{sup r}adionucleides contenus dans l'urine et le thoron contenu dans l'air exhale. Ces dosages ont ete effectues avant et apres la nephrectomie. On a egalement mesure les rayons gamma emis par l'organe isole. Ces diverses mesures ont permis de proceder a une evaluation de la dose de rayonnements. (author) [Spanish] Los trabajos publicados acerca de los depositos de torotrasto en el sistema reticuloendotelial y de los datos clinicos obtenidos son bastante abundantes. En cambio, son contados los casos de depositos renales de toro- trasto descritos en la bibliografia. Sin embargo, es de suponer que hay muchos pacientes con estos ultimos depositos, ya que el torotrasto se utilizo con

  11. Self Assembly and Pyroelectric Poling for Organics

    Science.gov (United States)

    2015-07-06

    These “static” charges are the origin of electric field ( Edi ) creation inside the dielectric medium. If the loss of pyroelectric charges is...negligibly small, it would yield Edi = γΔT/[ε0(εdi + εcrLdi/Lcr)] (1) where ε0, εcr, and εdi are the dielectric permittivities of free space, the pyroelectric...field ( Edi ) in the dielectric thin film, and the small open arrows at the thin layer of dielectrics represent the direction of electric fields. The

  12. 75 FR 80854 - Agency Information Collection Activities: Proposed Collection; Comment Request

    Science.gov (United States)

    2010-12-23

    ..., ``Financial EDI Authorization''; NUREG/BR-0254, Payment Methods; and NRC Form 629, ``Authorization for Payment... licensing fees, and inspection fees to the NRC. The NRC Form 628, ``Financial EDI Authorization,'' provides...

  13. Kujundusideid / Ketlin Priilinn

    Index Scriptorium Estoniae

    Priilinn, Ketlin, 1982-

    2006-01-01

    Eesti sisearhitektide Annes Arro, Jorma Holmi, Kaire Kemp-Tishleri (kamina sepised Heigo Jelle), Andro Kööbi, Rein Lauri (seintel Anne Parmasto ja Rein Kelpmanni maalid), Taso Mähari (eramu arhitekt Emil Urbel, seinal Lemming Nageli maal "Punane joon all - Burn Out"), Eerik Olle, Meelis Pressi ja Anu Vainomäe kujundatud elutoad. 33 värv. ill

  14. Torontos peeti eesti dokfilmifestivali "Estdoc's" / Olev Remsu

    Index Scriptorium Estoniae

    Remsu, Olev, 1947-

    2006-01-01

    Toronto eesti dokumentaalfilmide festival "Estdoc's". Demonstreeriti filme: "Sinimäed" (Raimo Jõerand), "Tiim" (Peep Puks), "Mikk" (Rein Raamat, Peeter Brambat), "6 tundi" (Rein Kotov), "Erna retk" (Vaado Sarapuu), "Tõrjutud mälestused" (Imbi Paju), "Middendorfi jälgedes" (Riho Västrik), "Mehed unustatud armeest" (Indrek Treufeldt), "Nagu noor jumal" ja "Orjus Eestis" (mõlema autor Olev Remsu)

  15. Effects of pre-conditioning on behavior and physiology of horses during a standardised learning task.

    Directory of Open Access Journals (Sweden)

    Kate Fenner

    Full Text Available Rein tension is used to apply pressure to control both ridden and unridden horses. The pressure is delivered by equipment such as the bit, which may restrict voluntary movement and cause changes in behavior and physiology. Managing the effects of such pressure on arousal level and behavioral indicators will optimise horse learning outcomes. This study examined the effect of training horses to turn away from bit pressure on cardiac outcomes and behavior (including responsiveness over the course of eight trials in a standardised learning task. The experimental procedure consisted of a resting phase, treatment/control phase, standardised learning trials requiring the horses (n = 68 to step backwards in response to bit pressure and a recovery phase. As expected, heart rate increased (P = 0.028 when the handler applied rein tension during the treatment phase. The amount of rein tension required to elicit a response during treatment was higher on the left than the right rein (P = 0.009. Total rein tension required for trials reduced (P < 0.001 as they progressed, as did time taken (P < 0.001 and steps taken (P < 0.001. The incidence of head tossing decreased (P = 0.015 with the progression of the trials and was higher (P = 0.018 for the control horses than the treated horses. These results suggest that preparing the horses for the lesson and slightly raising their arousal levels, improved learning outcomes.

  16. Cost-effectiveness of using small vertebrates as indicators of disturbance.

    Science.gov (United States)

    Peck, Mika Robert; Maddock, Simon T; Morales, Jorge Noe; Oñate, Hugolino; Mafla-Endara, Paola; Peñafiel, Vanessa Aguirre; Torres-Carvajal, Omar; Pozo-Rivera, Wilmer E; Cueva-Arroyo, Xavier A; Tolhurst, Bryony A

    2014-10-01

    In species-rich tropical forests, effective biodiversity management demands measures of progress, yet budgetary limitations typically constrain capacity of decision makers to assess response of biological communities to habitat change. One approach is to identify ecological-disturbance indicator species (EDIS) whose monitoring is also monetarily cost-effective. These species can be identified by determining individual species' responses to disturbance across a gradient; however, such responses may be confounded by factors other than disturbance. For example, in mountain environments the effects of anthropogenic habitat alteration are commonly confounded by elevation. EDIS have been identified with the indicator value (IndVal) metric, but there are weaknesses in the application of this approach in complex montane systems. We surveyed birds, small mammals, bats, and leaf-litter lizards in differentially disturbed cloud forest of the Ecuadorian Andes. We then incorporated elevation in generalized linear (mixed) models (GL(M)M) to screen for EDIS in the data set. Finally, we used rarefaction of species accumulation data to compare relative monetary costs of identifying and monitoring EDIS at equal sampling effort, based on species richness. Our GL(M)M generated greater numbers of EDIS but fewer characteristic species relative to IndVal. In absolute terms birds were the most cost-effective of the 4 taxa surveyed. We found one low-cost bird EDIS. In terms of the number of indicators generated as a proportion of species richness, EDIS of small mammals were the most cost-effective. Our approach has the potential to be a useful tool for facilitating more sustainable management of Andean forest systems. © 2014 Society for Conservation Biology.

  17. Grabbing the Air Force by the Tail: Applying Strategic Cost Analytics to Understand and Manage Indirect Cost Behavior

    Science.gov (United States)

    2015-09-17

    sector   age Technology Impact  that  significant  technology  adoption  (RFID,  ERP,   EDI ,  etc)  has  on  supply  chain... EDI  capabilities   Complexity Impact  of  a  wide  product/service  line  on  the  supply  chain,  cost  of  serving...can incorporate measurements of the number of EDI transactions in the purchasing function, the age of the technology in the production process, the

  18. 75 FR 7520 - Certain Refrigerators and Components Thereof; Notice of the Commission's Final Determination of...

    Science.gov (United States)

    2010-02-19

    ... for this investigation may be viewed on the Commission's electronic docket (EDIS) at http://edis.usitc... infringe claim 8 of the `130 patent. The Commission also affirms the ALJ's finding that the accused French...

  19. 75 FR 60782 - Notice of Regulatory Waiver Requests Granted for the Second Quarter of Calendar Year 2010

    Science.gov (United States)

    2010-10-01

    ... Town of Jean Lafitte, LA received an Economic Development Initiative Special Purpose (EDI-SP) grant in... the December 8, 2004 appropriation for the EDI-SP grant, but prior to the completion of a Federal...

  20. 75 FR 37455 - Mortgage Insurance Termination; Application for Premium Refund or Distributive Share Payment

    Science.gov (United States)

    2010-06-29

    ... EDI and is used to directly pay eligible homeowners. This condition occurs when the form passes the... information is submitted via the Internet or EDI and is used to directly pay eligible homeowners. This...

  1. 77 FR 72788 - Reduction of Use of Social Security Numbers in the Department of Defense

    Science.gov (United States)

    2012-12-06

    ... recommended replacing the SSN with the DoD Electronic Data Interchange Personal Identifier (EDI- PI... Number, the common name for the EDI-PI, is identified by both policies as the primary alternative for the...

  2. Raamatututvustus / Rein Põder

    Index Scriptorium Estoniae

    Põder, Rein, 1943-

    1995-01-01

    Rousseau, Jean-Jacques. Üksildase uitaja mõtisklused; Hill, Susan. Proua de Winter; Kõrvemaast põhjarannani : Kuusalu kihelkonna kirjanduslik-kodulooline antoloogia / Koost. Helmut Elstrok; Tead.toim. Oskar Kuningas

  3. Arvustused / Rein Vader

    Index Scriptorium Estoniae

    Vader, Rein

    2000-01-01

    Uute plaatide AC/DC "Stiff Upper Lip", Alex Attias "Hi-Fi Jazz", Asian Dub Foundation "Community Music", Beastie Boys "Anthology: The Sounds Of Sciense", Blind "Jolly Good", Charlotte Church "Charlotte Church", Crazy Town "The Gift of Game", Cure "Bloodflowers", Tracy Chapman "Telling Stories", "Bringing Out The Dead" arvustused

  4. Plaadid / Rein Vader

    Index Scriptorium Estoniae

    Vader, Rein

    2006-01-01

    Uutest heliplaatidest Deftones "Saturday Night Wrist", Robb Scott "Afro Adyssey", Zucchero "Fly", Agoria "The Green Armchair", "Back To The Bus ئ Babyshambes", Fratellis "Costello Music", Rod Stewart "Still The Same..."

  5. Uus-Maailma uued kortermajad

    Index Scriptorium Estoniae

    2008-01-01

    Korter endises büroohoones Luha 16 - rekonstrueerimisprojekt Tormi Sooväljalt, korter uues galeriimajas Koidu 60-62/ Komeedi 14 - arhitektid Rein Murula ja Karl Koosa (Rein Murula Arhitektuuribüroo OÜ) ja korter uues büroo- ja kortermajas Villardi 22 - Humana Grupp Arhitektuuri- ja Inseneribüroolt. Kommenteerivad arhitektid Peeter Tambu ja Eve Arpo ning kinnisvara maakler Rando Vanaveski

  6. The sloan lens ACS survey. VI. Discovery and analysis of a double Einstein ring

    NARCIS (Netherlands)

    Gavazzi, Raphael; Treu, Tommaso; Koopmans, Leon V. E.; Bolton, Adam S.; Moustakas, Leonidas A.; Burles, Scott; Marshall, Philip J.

    2008-01-01

    We report the discovery of two concentric Einstein rings around the gravitational lens SDSS J0946+ 1006. The main lens is at redshift z(l) = 0.222, while the inner ring ( 1) is at redshift z(s1) 0.609 (R-Ein1 = 1.43 '' +/- 0.01 ''). The wider image separation ( R-Ein2 = 2.07 '' +/- 0.02 '') of the

  7. Eesti täispikad dokumentaalfilmid 2005. aastal / Marianne Kõrver

    Index Scriptorium Estoniae

    Kõrver, Marianne, 1980-

    2006-01-01

    Portreefilmid : Priit Pärnast "Pärnograafia" (Hardi Volmer), Ivar Heinmaast "Kutse" (Peep Puks), Veljo Tormisest "Tormise regi" (Sulev Keedus), Rein Tammikust "Teekond ruudulisel laudlinal" (Peeter Urbla), "Afanassi" (Liina Trishkina) ; probleemfilmid : "Parema elu nimel" (Märt Sildvee), "Piisa torn" (Arko Okk) ; sõjateemalised dokumentaalid : "Afganistani armid" (Ivar Heinmaa), "Hauka grupp" (Rene Vilbre), "Tõrjutud mälestused" (Imbi Paju) ; loodusfilm "Eesti kotkad" (Rein Maran)

  8. Res Publica jäi järjekordselt ilma mitmest nimekast liikmest / Tuuli Koch, Kärt Anvelt

    Index Scriptorium Estoniae

    Koch, Tuuli

    2005-01-01

    Oma lahkumiset Res Publicast teatasid erakonna esimene esimees Rein Taagepera, tema abikaasa Mare Taagepera, akadeemik Jaan Einasto ja 2002. aastal erakonna esimeheks kandideerinud Lauri Aaspõllu. Rein Taagepera põhjendas otsust Res Publica liikumisega paremtsentrist paremäärmusse. Lisa: Tuntud inimesi, kes seni Res Publicast lahkunud. Vt. samas lühiintervjuud Jaan Einastoga: Res Publica peab tegema koostööd

  9. 77 FR 48007 - Administrative Simplification: Adoption of Operating Rules for Health Care Electronic Funds...

    Science.gov (United States)

    2012-08-10

    ... electronic data interchange (EDI). Through the use of electronic funds transfers (EFT) for health care claim... care transactions results in higher use of EDI by health care providers.\\8\\ We expect usage of EFT and...

  10. Employee-Driven Innovation (EDI)

    DEFF Research Database (Denmark)

    Kesting, Peter; Ulhøi, John Parm

      The responsibility to be innovative and think of useful ideas and the privilege of making decisions in processes of innovation are typically restricted to specifically assigned R&D functions and/or upper echelon managers. Given the importance of innovation to most organizations, it may seem...

  11. Mapping key antecedents of employee-driven innovations

    DEFF Research Database (Denmark)

    Smith, Pernille; Ulhøi, John Parm; Kesting, Peter

    2012-01-01

    Research on employee-driven innovation (EDI) is still in its infancy, and as yet there is no independent body of literature on the topic. The aim of this paper is to review existing insights into the key antecedents of EDI in other research contexts. In particular, we focus on: leader support......, autonomy, collaboration, and organisational norms of exploration. The main contribution of this paper is to discuss how these key antecedents apply to the specific case of EDI and to identify an agenda for new research....

  12. Quality and safety implications of emergency department information systems.

    Science.gov (United States)

    Farley, Heather L; Baumlin, Kevin M; Hamedani, Azita G; Cheung, Dickson S; Edwards, Michael R; Fuller, Drew C; Genes, Nicholas; Griffey, Richard T; Kelly, John J; McClay, James C; Nielson, Jeff; Phelan, Michael P; Shapiro, Jason S; Stone-Griffith, Suzanne; Pines, Jesse M

    2013-10-01

    The Health Information Technology for Economic and Clinical Health Act of 2009 and the Centers for Medicare & Medicaid Services "meaningful use" incentive programs, in tandem with the boundless additional requirements for detailed reporting of quality metrics, have galvanized hospital efforts to implement hospital-based electronic health records. As such, emergency department information systems (EDISs) are an important and unique component of most hospitals' electronic health records. System functionality varies greatly and affects physician decisionmaking, clinician workflow, communication, and, ultimately, the overall quality of care and patient safety. This article is a joint effort by members of the Quality Improvement and Patient Safety Section and the Informatics Section of the American College of Emergency Physicians. The aim of this effort is to examine the benefits and potential threats to quality and patient safety that could result from the choice of a particular EDIS, its implementation and optimization, and the hospital's or physician group's approach to continuous improvement of the EDIS. Specifically, we explored the following areas of potential EDIS safety concerns: communication failure, wrong order-wrong patient errors, poor data display, and alert fatigue. Case studies are presented that illustrate the potential harm that could befall patients from an inferior EDIS product or suboptimal execution of such a product in the clinical environment. The authors have developed 7 recommendations to improve patient safety with respect to the deployment of EDISs. These include ensuring that emergency providers actively participate in selection of the EDIS product, in the design of processes related to EDIS implementation and optimization, and in the monitoring of the system's ongoing success or failure. Our recommendations apply to emergency departments using any type of EDIS: custom-developed systems, best-of-breed vendor systems, or enterprise systems

  13. Evaluation of Potential Biological Threats in Ukraine

    International Nuclear Information System (INIS)

    Pozdnyakova, L.; Slavina, N.; Pozdnyakov, S.

    2007-01-01

    Dilating of biological threats spectrum, EDI diffusion opportunities and routes, unpredictability of outbreaks connected with connatural, technogenic, terrorist factors determines constant monitoring and readiness for operative BPA indication and identification. Scientific analytical approach of existing and probable regional bio-threats evaluation is necessary for adequate readiness system creation and maintenance of medical counteraction tactics to probable biological threats. Basing on the international experience, we carry out analysis of a situation present in Ukraine and routes for the decisions. The basic directions are: - Evaluation of a reality for EDI penetration from abroad and presence of conditions for their further diffusion inside the country. - Revealing of presence and definition of connatural EDI foci biocenoses features and BPAs. - Appropriate level of biological safety and physical protection of bio-laboratories and pathogens collections maintenance. - Gene/molecular and phenotypical definition of EDI circulating strains. - Creation of the circulating EDI gene/ phenotypic characteristics regional data bank. - Ranging of EDI actual for area. - Introduction of GPT, mathematical modeling and forecasting for tactics development in case of technogenic accidents and connatural outbreaks. - Methodical basis and equipment improvement for BPA system indication for well-timed identification of natural, or modified agent. - Education and training The international cooperation in maintenance of biosafety and bioprotection within the framework of scientific programs, grants, exchange of experience, introduction of international standards and rules are among basic factors in the decision for creating system national biosafety for countries not included in EU and the NATO. (author)

  14. 75 FR 62522 - Combined Notice of Filings No. 3

    Science.gov (United States)

    2010-10-12

    ... filing per 154.203: NAESB EDI Form Filing to be effective 11/1/ 2010. Filed Date: 09/30/2010. Accession....9 EDI Form to be effective 11/1/2010. Filed Date: 09/30/2010. Accession Number: 20100930-5348...

  15. Intervention Framework to Support Employee-Driven Innovation Between R&D and Manufacturing Department

    DEFF Research Database (Denmark)

    Jensen, Christian Schou; Jensen, Anna Rose Vagn; Broberg, Ole

    2016-01-01

    This paper is exploring the area of employee-driven innovation (EDI) and describes how we in ourresearch project have developed and tested a framework for initiating employee participation between R&D and manufacturing department. EDI refers to the generation and implementation of significant new...... [Kesting andUlhøi 2010]. It is argued that companies should not restrict themselves to relying exclusively on R&D employees, but also recognize that manufacturing employees possess abilities for innovation [Høyrup2010]. Several other theories, such as high-involvement innovation share the conviction...... et al. 2013]. • It can generate a flow of additional information and tacit knowledge from employees to point out opportunities that management cannot [Kesting and Ulhøi 2010].With a long list of known benefits from EDI, one might wonder why it is not implemented everywhere? The list of EDI obstacles...

  16. A nova edição de Why Suyá Sing, de Anthony Seeger, e alguns estudos recentes sobre música indígena nas terras baixas da América do Sul

    Directory of Open Access Journals (Sweden)

    Luís Fernando Hering Coelho

    2007-04-01

    Full Text Available Lançado originalmente em 1987, Why Suya Sing? ganhou uma nova edição norte-americana em 2004. Apesar de constituir um marco teórico e etnográfico importante nos campos da etnologia indígena e da antropologia da música, o livro ainda não conta com uma tradução para o português. Neste ensaio, oferece-se uma leitura da obra, buscando resumir alguns de seus pontos principais, junto a uma contextualização geral sumária dos estudos sobre povos Gê, e uma nota breve sobre alguns desenvolvimentos recentes nas pesquisas sobre música indígena nas terras baixas da América do Sul.Originally published in 1987, Why Suyá Sing? acquired a new US edition in 2004. Despite constituting a theoretical and ethnographic landmark in the fields of indigenous ethnology and anthropology of music, Seeger’s book has yet to be translated into Portuguese. This essay offers a reading of the work, looking to resume some of its key points, along with a brief overall contextualization of the studies on Gê peoples, and a short note on some of the recent developments in the research on indigenous music in the South American lowlands.

  17. Eesti räpane sisepoliitika võtab Gaudeamuselt ühe salmi / Tuuli Koch

    Index Scriptorium Estoniae

    Koch, Tuuli

    2006-01-01

    Nördimust presidendivalimiste ja poliitikas toimuva suhtes näitab Tallinna Ülikool õppeaasta pidulikul avaaktusel sellega, et jätab riigile tänu avaldava salmi Gaudeamusest laulmata. Selgitab rektor Rein Raud. Lisa: Ärajääv salm. Foto allkiri: President Arnold Rüütel pani ametiraha Tallinna Ülikooli värske rektori Rein Raua kaela tänavu 15. mail

  18. Der Einfluss von Mixed Emotions auf die Werbewirkung : eine experimentelle Studie

    OpenAIRE

    Bauer, Hans H.; Donnevert, Tobias; Exler, Stefanie; Hobusch, Sonja

    2007-01-01

    Emotionale Appelle haben heutzutage einen festen Platz in der Werbung. Neben rein positiven sowie rein negativen Emotionen werden auch Mixed Emotions verstärkt eingesetzt. Die Erforschung der konsumentenverhaltensrelevanten Wirkungen von Mixed Emotions, die das gleichzeitige oder sequentielle Erleben gegensätzlicher Emotionen bezeichnen, steckt jedoch noch in den Kinderschuhen. In der vorliegenden Studie wird daher der Einfluss von Mixed Emotions auf zentrale psychographische Werbewirku...

  19. 78 FR 76655 - Notice of Receipt of Complaint; Solicitation of Comments Relating to the Public Interest

    Science.gov (United States)

    2013-12-18

    ... Trade Commission (USITC): http://edis.usitc.gov . \\3\\ Electronic Document Information System (EDIS... INTERNATIONAL TRADE COMMISSION Notice of Receipt of Complaint; Solicitation of Comments Relating to the Public Interest AGENCY: U.S. International Trade Commission. ACTION: Notice. SUMMARY: Notice...

  20. HÉNAUX, Victor. De l’amour des femmes pour les sots / Queda que as mulheres têm para os tolos. Tradução de Machado de Assis. Edição Bilíngue. Organização: Ana Cláudia Suriani da Silva e Eliane Fernanda Cunha Ferreira. Campinas: Editora Unicamp. 2008.

    Directory of Open Access Journals (Sweden)

    Kall Lyws Barroso Sales

    2015-06-01

    Full Text Available Em 2008, em comemoração ao centenário de Machado, as professoras Ana Cláudia Suriani da Silva e Eliane Fernanda Cunha Ferreira retomam as discussões sobre autoria, plágio e tradução, propondo uma edição bilíngue na qual cotejam a obra de Hénaux, De l'amour des femmes pour les sots de 1858 e a tradução de Machado Queda que as mulheres têm para os tolos de 1861. Assim, esta resenha analisa a tradução de Machado de Assis, cuja autoria da obra, durante muito tempo, foi atríbuida ao escritor brasileiro.

  1. 78 FR 16707 - Certain Electronic Devices Having Placeshifting or Display Replication Functionality and Products...

    Science.gov (United States)

    2013-03-18

    ... INTERNATIONAL TRADE COMMISSION [Docket No. 2943] Certain Electronic Devices Having Placeshifting... International Trade Commission (USITC): http://edis.usitc.gov . \\3\\ Electronic Document Information System (EDIS...; Solicitation of Comments Relating to the Public Interest AGENCY: U.S. International Trade Commission. ACTION...

  2. 78 FR 56737 - Certain Portable Electronic Communications Devices, Including Mobile Phones and Components...

    Science.gov (United States)

    2013-09-13

    ... INTERNATIONAL TRADE COMMISSION [Investigation No. 337-TA-885] Certain Portable Electronic Communications Devices, Including Mobile Phones and Components Thereof; Commission Determination Not To Review an... on the Commission's electronic docket (EDIS) at http://edis.usitc.gov . Hearing-impaired persons are...

  3. 78 FR 49764 - Certain Portable Electronic Communications Devices, Including Mobile Phones and Components...

    Science.gov (United States)

    2013-08-15

    ... INTERNATIONAL TRADE COMMISSION [Investigation No. 337-TA-885] Certain Portable Electronic Communications Devices, Including Mobile Phones and Components Thereof; Commission Determination Not To Review n... for this investigation may be viewed on the Commission's electronic docket (EDIS) at http://edis.usitc...

  4. 78 FR 72712 - Certain Portable Electronic Communications Devices, Including Mobile Phones and Components...

    Science.gov (United States)

    2013-12-03

    ... INTERNATIONAL TRADE COMMISSION [Investigation No. 337-TA-885] Certain Portable Electronic Communications Devices, Including Mobile Phones and Components Thereof; Commission Determination Not To Review an... this investigation may be viewed on the Commission's electronic docket (EDIS) at http://edis.usitc.gov...

  5. The Environmental Data Initiative: A broad-use data repository for environmental and ecological data that strives to balance data quality and ease of submission

    Science.gov (United States)

    Servilla, M. S.; Brunt, J.; Costa, D.; Gries, C.; Grossman-Clarke, S.; Hanson, P. C.; O'Brien, M.; Smith, C.; Vanderbilt, K.; Waide, R.

    2017-12-01

    In the world of data repositories, there seems to be a never ending struggle between the generation of high-quality data documentation and the ease of archiving a data product in a repository - the higher the documentation standards, the greater effort required by the scientist, and the less likely the data will be archived. The Environmental Data Initiative (EDI) attempts to balance the rigor of data documentation to the amount of effort required by a scientist to upload and archive data. As an outgrowth of the LTER Network Information System, the EDI is funded by the US NSF Division of Environmental Biology, to support the LTER, LTREB, OBFS, and MSB programs, in addition to providing an open data archive for environmental scientists without a viable archive. EDI uses the PASTA repository software, developed originally by the LTER. PASTA is metadata driven and documents data with the Ecological Metadata Language (EML), a high-fidelity standard that can describe all types of data in great detail. PASTA incorporates a series of data quality tests to ensure that data are correctly documented with EML in a process that is termed "metadata and data congruence", and incongruent data packages are forbidden in the repository. EDI reduces the burden of data documentation on scientists in two ways: first, EDI provides hands-on assistance in data documentation best practices using R and being developed in Python, for generating EML. These tools obscure the details of EML generation and syntax by providing a more natural and contextual setting for describing data. Second, EDI works closely with community information managers in defining rules used in PASTA quality tests. Rules deemed too strict can be turned off completely or just issue a warning, while the community learns to best handle the situation and improve their documentation practices. Rules can also be added or refined over time to improve overall quality of archived data. The outcome of quality tests are stored as

  6. Multi-zone modelling of PCCI combustion

    NARCIS (Netherlands)

    Egüz, U.; Somers, L.M.T.; Leermakers, C.A.J.; Goey, de L.P.H.

    2011-01-01

    Early Direct Injection Premixed Charge Compression Ignition (EDI PCCI) combustion is a promising concept for the diesel combustion. Although EDI PCCI assures very low soot and NO xemission levels, the injection is uncoupled from combustion, which narrows down the operating conditions. The main

  7. Process mining for electronic data interchange

    NARCIS (Netherlands)

    Engel, R.; Krathu, W.; Zapletal, M.; Pichler, C.; Aalst, van der W.M.P.; Werthner, H.; Huemer, C.; Setzer, T.

    2011-01-01

    Choreography modeling and service integration received a lot of attention in the last decade. However, most real-world implementations of inter-organizational systems are still realized by traditional Electronic Data Interchange (EDI) standards. In traditional EDI standards, the notion of process or

  8. Cas Clinique

    African Journals Online (AJOL)

    du rein droit un volumineux AMLR polaire inférieur de 7 cm sans signe hémorragique ... anatomopathologique définitif a confirmé le diagnostic d'AMLR hémorragique sans signes .... du rein gauche aurait pu être proposée le lendemain de l'admission pour mettre la patiente à l'abri. (relatif) d'une récidive hémorragique et ...

  9. 32 CFR Appendix C to Part 57 - Procedures for the Provision of Related Services by the Military Medical Departments to DoDDS...

    Science.gov (United States)

    2010-07-01

    ... EDIS shall ensure that a qualified medical authority conducts or verifies a medical evaluation for use... to the questions posed in the original referral. The written report shall include: (i) Demographic... initial parental permission, EDIS must: (i) Obtain parental permission for the additional activities. (ii...

  10. Multi-Sensor Image Fusion for Target Recognition in the Environment of Network Decision Support Systems

    Science.gov (United States)

    2015-12-01

    Classification Problem Adapted from E. Alpaydin, “Introduction to Machine Learning,” Thrird Edi . MIT Press, 2014. Table 7. Performance Measures for...Binary Classification Problem Adapted from E. Alpaydin, “Introduction to Machine Learning,” Thrird Edi . MIT Press, 2014. ROC curves give us a

  11. Carta Editorial

    Directory of Open Access Journals (Sweden)

    Pedro Vitor Lemos Cravo

    2016-06-01

    Full Text Available A primeira edição de 2016 da revista Fronteiras: Journal of Social, Technological and Environmental Science, está no ar com a notícia que a partir desse volume todos os artigos contarão com os registros no DOI (Digital Object Identifier. O Doi é uma ferramenta que associa os artigos existentes nas plataformas digitais a um endereço eletrônico. As edições de 2105 já foram incluídas e até o final deste mês as demais edições receberão o registro DOI.

  12. The role of employee participation in generating and commercializing innovations in China

    DEFF Research Database (Denmark)

    Kesting, Peter; Qin, Zhihua; Song, Jiwen Lynda

    2013-01-01

    In this paper we are investigating the effect of different forms of employee participation on innovation generation and commercialization in China. To date, the concept of employee-driven innovation (EDI) finds very little recognition in China, in research as well as in management practice....... It seems to fundamentally contradict traditional values in Chinese culture. On the other hand, work realities change rapidly in China. Research suggests that EDI might be particularly relevant for innovations in skilled labour contexts. Based on a survey of 620 medium-sized and large companies in China we...... underpin that EDI is also relevant for China....

  13. Neighborhood Poverty Impacts Children's Physical Health and Well-Being over Time: Evidence from the Early Development Instrument

    Science.gov (United States)

    Cushon, Jennifer A.; Vu, Lan T. H.; Janzen, Bonnie L.; Muhajarine, Nazeem

    2011-01-01

    Research Findings: The purpose of this study was to investigate how neighborhoods and neighborhood socioeconomic disadvantage impact school readiness over time. School readiness was measured using the Early Development Instrument (EDI) for 3 populations of kindergartners in 2001, 2003, and 2005 in Saskatoon, Saskatchewan, Canada. EDI results…

  14. Seks korraks kõik: 15. PÖFF sai läbi, "Eesti film 100" ootab ees

    Index Scriptorium Estoniae

    2011-01-01

    15. Pimedate Ööde Filmifestivali võitjatest. Parim Euraasia film "Lihtne elu" (režissöör Ann Hui, Hiina), parim režissöör Lynne Ramsay "Me peame Kevinist rääkima" (Suurbritannia), parim meeesnäitleja Sven Nordin filmist "Norra pojad", parim naisnäitleja Deanie Ip filmist "Lihne elu". Elutööauhinnad said Rein Raamat, Rein Maran, Fridrik Thor Fridriksson ja Aleksandr Sokurov

  15. Psychometric Properties of the Dutch Version of the Eating Disorder Inventory–3

    Directory of Open Access Journals (Sweden)

    Vicky Lehmann

    2013-10-01

    Full Text Available The psychometric properties of the Dutch version of the Eating Disorder Inventory–3 (EDI-3 were tested in eating disordered patients (N = 514 using confirmatory factor analyses, variance decomposition, reliabilities, and receiver operating characteristic (ROC curve analyses. Factorial validity results supported the 12 subscales, but model fit was impaired by correlated item errors, misallocated items, and redundant subscales. At the composite level, the Bulimia subscale was identified as a largely specific source of information that did not contribute much to its overarching composite. Reliabilities for subscales and composites ranged from .6 to .9. ROC curve analysis indicated good to excellent discriminative ability of the EDI-3 identifying clinical subjects against a reference group. In conclusion, further revisions of the EDI-3 might target the item allocation and (over-differentiation of subscales and composites to further clarify its structure. For the clinical practice, we advise the careful use of the EDI-3, although it might serve as a good screening tool.

  16. Rein Porro : ma ei kavatse lennuametist lahkuda / Rein Porro ; interv. Mirko Ojakivi

    Index Scriptorium Estoniae

    Porro, Rein, 1943-

    2006-01-01

    Lennuameti peadirektori asetäitja vastab küsimustele, kas ta rikkus lennundusseadust, väljastades lennuloa ettevõttele Pakker Avio, kas ta on läinud tülli lennuõnnetustega tuntuks saanud lennufirmaga ning seepärast püütakse temast vabaneda. Lisa: Uurimine rikkumisi ei tuvastanud

  17. 77 FR 58101 - Proposed Collection; Comment Request

    Science.gov (United States)

    2012-09-19

    ... from members of the public is to make these submissions available for public viewing on the Internet at... Educational and Developmental Intervention Services (EDIS) clinics. The system's remote function allows EDIS... clearance, which allows them access to basic functions of SNPMIS (i.e., data querying, viewing, and printing...

  18. An Empirical Study of Logistics Organization, Electronic Linkage, and Performance

    Science.gov (United States)

    1993-01-01

    Anvari, M., "Electronic Data Interchange and Inventories," International Journal of Production Economics , 26, 1-3 (1992), 135-143. Baker, R. H., EDI: What...Electronic Data Interchange -- A Study of Norwegian Freight Forwarders Using EDI," International Journal of Production Economics , 24 (1991), 91-101. Henry, G

  19. Are You Experienced The Case for Acquisition Professional Qualification Standards

    Science.gov (United States)

    2015-10-01

    1, DAU 236), featuring a cover story on micro machines used in defense systems. The winners for Defense AT&L were managing edi - tor/senior editor of...Gonzalez, copy edi - tor and circulation manager; and Noelia Gamboa, editorial support. Defense AT&L’s sister DAU publication, the Defense Acquisition

  20. Validation of the Korean Version of the Eating Disorder Inventory-2: Psychometric Properties and Cross-Cultural Comparison

    Science.gov (United States)

    Lee, Jung-Hyun; Shin, Mi-Yeon; Jo, Hye-Hyeon; Jung, Young-Chul; Kim, Joon-Ki

    2012-01-01

    Purpose The purpose of the present study was to examine the validity and reliability of the Korean version of the Eating Disorder Inventory-2 (EDI-2) in Korean patients with eating disorders and healthy controls, and to investigate cultural differences of EDI-2 between a Korean group and a North American standardization sample. Materials and Methods The Korean version of the EDI-2 was prepared after comprehensive clinical assessment of Korean patients with eating disorders (n=327) as well as female undergraduates (n=176). Results were compared between eating disorder subgroups (anorexia nervosa, bulimia nervosa and eating disorders not otherwise specified) and those of a North American standardization sample and healthy controls. Results The results showed that the Korean EDI-2 had adequate internal consistency (0.77-0.93) and discriminated well between patients with eating disorders and healthy controls on all subscales. Significant differences in EDI-2 subscale scores between the eating disorder groups and the healthy control group were observed; however, there was no discernible difference among the eating disorder subgroups. When compared with a North American standardization sample, the Korean control group showed significantly higher scores for drive for thinness and asceticism. When patient groups were compared, the Korean group showed significantly lower scores for perfectionism. Conclusion As expected, the results accurately reflected psychometric properties of the Korean version of EDI-2 for eating disorder patients in Korea. These findings also suggest that common characteristics for the eating disorder exist as a whole rather than with significant difference between each subgroup. In addition, significant differences between the Korean and the North American groups for both patients and controls also demonstrated specific cultural differences. PMID:23074108

  1. Validation of the Korean version of the Eating Disorder Inventory-2: psychometric properties and cross-cultural comparison.

    Science.gov (United States)

    Lee, Jung-Hyun; Shin, Mi-Yeon; Jo, Hye-Hyeon; Jung, Young-Chul; Kim, Joon-Ki; Kim, Kyung Ran

    2012-11-01

    The purpose of the present study was to examine the validity and reliability of the Korean version of the Eating Disorder Inventory-2 (EDI-2) in Korean patients with eating disorders and healthy controls, and to investigate cultural differences of EDI-2 between a Korean group and a North American standardization sample. The Korean version of the EDI-2 was prepared after comprehensive clinical assessment of Korean patients with eating disorders (n=327) as well as female undergraduates (n=176). Results were compared between eating disorder subgroups (anorexia nervosa, bulimia nervosa and eating disorders not otherwise specified) and those of a North American standardization sample and healthy controls. The results showed that the Korean EDI-2 had adequate internal consistency (0.77-0.93) and discriminated well between patients with eating disorders and healthy controls on all subscales. Significant differences in EDI-2 subscale scores between the eating disorder groups and the healthy control group were observed; however, there was no discernible difference among the eating disorder subgroups. When compared with a North American standardization sample, the Korean control group showed significantly higher scores for drive for thinness and asceticism. When patient groups were compared, the Korean group showed significantly lower scores for perfectionism. As expected, the results accurately reflected psychometric properties of the Korean version of EDI-2 for eating disorder patients in Korea. These findings also suggest that common characteristics for the eating disorder exist as a whole rather than with significant difference between each subgroup. In addition, significant differences between the Korean and the North American groups for both patients and controls also demonstrated specific cultural differences.

  2. Editorial

    OpenAIRE

    André Luis Calado Araújo

    2007-01-01

    O CEFET-RN apresenta a segunda edição da Holos de 2008. A revista se consolida com multidisciplinar com 8 artigos. Com esta edição completamos cinco anos no formato online e a décima quarta edição, mostrando que o periódico se consolida como alternativa à publicação de trabalhos científicos. O primeiro artigo intitulado “O façonismo no espaço urbano de Americana-SP”, discute o espaço urbano, a diversidade cultural e sua dinamicidade. O objetivo deste trabalho foi fazer uma análise da ativ...

  3. 76 FR 31632 - Notice of Receipt of Complaint; Solicitation of Comments Relating to the Public Interest

    Science.gov (United States)

    2011-06-01

    ... docket (EDIS) at http://edis.usitc.gov , and will be available for inspection during official business... Co. Ltd. of Shenzhen, China; Cellairis Franchise, Inc. of Alpharetta, GA; Cellet Products of Santa Fe... be filed no later than by close of business, five business days after the date of publication of this...

  4. Tubin: The Parson of Reigi / Robert Layton

    Index Scriptorium Estoniae

    Layton, Robert

    1993-01-01

    Uuest heliplaadist "Tubin: The Parson of Reigi. Teo Maiste, Marika Eensalu, Ivo Kuusk, Annika Tõnuri, Urve Tauts, Leili Tammel, Tiit Tralla, Arvo Laid. Estonia Opera Company / Paul Mägi; Requiem for Fallen Soldiers. Urve Tauts, Talevaldis Deksnis, Urmas Leiten, Rein Tiido, Rein Roos. Estonian National Male Choir / Eri Klas. Ondine CD ODE 783-2 (2 discs: 116 min.). Recorded in association with the Estonian Cultural Foundation. Requiem - comparative version: Lund. Choral Soc., Järvi (9/88) CD 297

  5. Thermodynamics analysis of the rare earth metals and their alloys with indium in solid state

    International Nuclear Information System (INIS)

    Vassiliev, V.P.; Benaissa, Ablazeze; Taldrik, A.F.

    2013-01-01

    Graphical abstract: Gibbs energies of formation vs. RE atomic numbers in REIn 3 . Highlights: •Set of experimental values was collected for REIn 3 phases. •Thermodynamic functions of formation were calculated at 298 K and 775 K. •Experimental and calculated values were compared. -- Abstract: Nonlinear correlative analyses between thermodynamic and some physico-chemical properties of rare-earth metals (RE) and their alloys with indium are performed for the isostructural phases RE and REIn 3 . The thermodynamics values (Gibbs energies of formation, enthalpies of formation, and entropies of formation at 298 K and 775 K and standard entropies) of LnIn 3 phases are calculated on the basis of calorimetry and potentiometry results. The proposed correlation between physico-chemical and thermodynamic properties agrees for all the isostructural phases REX (X are others elements of the periodic table). The resulting thermodynamic data are recommended for metallurgical handbook

  6. 'I can't accept that feeling': Relationships between interoceptive awareness, mindfulness and eating disorder symptoms in females with, and at-risk of an eating disorder.

    Science.gov (United States)

    Lattimore, Paul; Mead, Bethan R; Irwin, Leanne; Grice, Lorna; Carson, Ruth; Malinowski, Peter

    2017-01-01

    Mindfulness based therapies (MBTs) for eating disorders show potential benefit for outcomes yet evidence is scarce regarding the mechanisms by which they influence remission from symptoms. One way that mindfulness approaches create positive outcomes is through enhancement of emotion regulation skills. Maladaptive emotion regulation is a key psychological feature of all eating disorders. The aim of the current study was to identify facets of emotion regulation involved in the relationship between mindfulness and maladaptive eating behaviours. In three cross-sectional studies, clinical (n=39) and non-clinical (n=137 and 119) female participants completed: 1) the Eating Disorder Inventory (EDI) eating specific scales (drive-for-thinness and bulimia) and the EDI psychological symptom scales (emotion dysregulation and interoceptive deficits); and 2) mindfulness, impulsivity, and emotion regulation questionnaires. In all samples mindfulness was significantly and inversely associated with EDI eating and psychological symptom scales, and impulsivity. In non-clinical samples interoceptive deficits mediated the relationship between mindfulness and EDI eating specific scales. Non-acceptance of emotional experience, a facet of interoceptive awareness, mediated the relationship between mindfulness and eating specific EDI scores. Further investigations could verify relationships identified so that mindfulness based approaches can be optimised to enhance emotion regulation skills in sufferers, and those at-risk, of eating disorders. Crown Copyright © 2016. Published by Elsevier Ireland Ltd. All rights reserved.

  7. HÉNAUX, Victor. De l’amour des femmes pour les sots / Queda que as mulheres têm para os tolos. Tradução de Machado de Assis. Edição Bilíngue. Organização: Ana Cláudia Suriani da Silva e Eliane Fernanda Cunha Ferreira. Campinas: Editora Unicamp. 2008.

    Directory of Open Access Journals (Sweden)

    Kall Lyws Barroso Sales

    2014-11-01

    Full Text Available http://dx.doi.org/10.5007/2175-7968.2015v35n1p313   Em 2008, em comemoração ao centenário de Machado, as professoras Ana Cláudia Suriani da Silva e Eliane Fernanda Cunha Ferreira retomam as discussões sobre autoria, plágio e tradução, propondo uma edição bilíngue na qual cotejam a obra de Hénaux, De l'amour des femmes pour les sots de 1858 e a tradução de Machado Queda que as mulheres têm para os tolos de 1861. Assim, esta resenha analisa a tradução de Machado de Assis, cuja autoria da obra, durante muito tempo, foi atríbuida ao escritor brasileiro.

  8. President Ilves sarjas hoogtöö korras seaduste tegemist / Tuuli Koch

    Index Scriptorium Estoniae

    Koch, Tuuli

    2010-01-01

    President Toomas Hendrik Ilvese kõnest iseseisvuspäeval. Arvamust avaldavad justiitsminister Rein Lang, Riigikogu põhiseaduskomisjoni esimees Väino Linde ja komisjoni aseesimees Evelyn Sepp, sotsiaalminister Hanno Pevkur ning haridus- ja teadusminister Tõnis Lukas. Presidendi vastuvõtu kujundust ja kontserti hindavad lilleseadja Taivo Piller, muusikakriitik Margus Haav ja Rakvere teatri peanäitejuht Üllar Saaremäe. Küsimustele vastab presidendi vastuvõtu teleülekande produtsent Margus Saar. Juuresoleval fotol justiitsminister Rein Lang presidendi kätlemistseremoonial

  9. Eerosest valgustatud / Rein Veidemann

    Index Scriptorium Estoniae

    Veidemann, Rein, 1946-

    2002-01-01

    Arvustus: Saarsen, Karin. Lõvi ja orhidee : [luuletused]. Tallinn : Eesti Raamat, 2002 ; Under, Marie. Under armastusest : [luuletused ja katkendid kirjadest] / valik ja järelsõna: Sirje Olesk. Tallinn : Tänapäev, 2002

  10. Kolmekordne kupar / Rein Saluri

    Index Scriptorium Estoniae

    Saluri, Rein

    1998-01-01

    Arvustus: Kristof, Agota. Kaustik; Katsumus; Kolmas vale / prantsuse k. tlk. Urmas Rattus. Tallinn : Varrak, 1997. (Moodne klassika); Oz, Amos. Ära ütle, et öö / heebrea k. tlk. Kalle Kasemaa. Tallinn : Kupar, 1998; Weldon, Fay. Kuu Minneapolise kohal / inglise k. tlk. Faina Laksberg. Tallinn : Kupar, 1997

  11. Kriitika kriis / Rein Veidemann

    Index Scriptorium Estoniae

    Veidemann, Rein, 1946-

    2003-01-01

    Eesti Filmiajakirjanike Ühing andis auhinna Aasta film 2002 mängufilmile "Agent Sinikael" : režissöör Marko Raat. Autor jagab auhinna rahastajate Ene ja Tõnis Kase rahuloematust seoses filmi "Nimed marmortahvlil" väljajätmisega isegi nominentide hulgast

  12. Estlinki merekaabel / Rein Aro

    Index Scriptorium Estoniae

    Aro, Rein, 1942-

    2006-01-01

    Järg. nr. 6 lk. 20-21. Eesti ja Soome vahelise elektrilise ühenduse loomisest. Kaabelliini haldab ühisettevõte Nordic Energy Link. Ehitaja leidmiseks kuulutatud hanke võitis Šveitsi-Rootsi kontsern ABB

  13. Neighbourhood ethnic diversity buffers school readiness impact in ESL children.

    Science.gov (United States)

    Puchala, Chassidy; Vu, Lan T H; Muhajarine, Nazeem

    2010-01-01

    Contextual factors, as measured by neighbourhood characteristics, shape the experiences children have and affect their "school readiness", i.e., whether they are well or poorly prepared for the transition from home to kindergarten. This study assessed the independent effects of individual and neighbourhood factors on school readiness; specifically, it examined whether and to what degree neighbourhood factors modified children's language ability and thus their school readiness in a population of children in Saskatoon, Saskatchewan. The study included all children attending kindergarten in 2001, 2003 and 2005 in Saskatoon. School readiness and child characteristics were measured by the Early Development Instrument (EDI). The EDI measures child development at school commencement in five domains: physical health and well-being, social competence, emotional maturity, cognitive and language development, and communication skills and general knowledge. Data from the 2001 Census were used to characterize Saskatoon's neighbourhoods. Multilevel modeling examined the independent and buffering or exacerbating effects of individual and neighbourhood factors on the relation between English as a Second Language (ESL) status in children and EDI domain scores. ESL children had significantly lower scores on all EDI domains compared with non-ESL children. Certain factors (e.g., younger age, male, Aboriginal status, having special needs) were significantly related to lower readiness in terms of the emotional maturity, and communication skills and general knowledge domains. Importantly, children who lived in neighbourhoods that were highly transient (with a higher proportion of residents who had moved in the previous year) had lower EDI scores on both domains, and those in neighbourhoods with lower rates of employment had lower EDI scores on communication skills and general knowledge. Neighbourhood ethnic diversity mitigated the negative impact of ESL status on school readiness for both

  14. The emotion dysregulation inventory: Psychometric properties and item response theory calibration in an autism spectrum disorder sample.

    Science.gov (United States)

    Mazefsky, Carla A; Yu, Lan; White, Susan W; Siegel, Matthew; Pilkonis, Paul A

    2018-04-06

    Individuals with autism spectrum disorder (ASD) often present with prominent emotion dysregulation that requires treatment but can be difficult to measure. The Emotion Dysregulation Inventory (EDI) was created using methods developed by the Patient-Reported Outcomes Measurement Information System (PROMIS ® ) to capture observable indicators of poor emotion regulation. Caregivers of 1,755 youth with ASD completed 66 candidate EDI items, and the final 30 items were selected based on classical test theory and item response theory (IRT) analyses. The analyses identified two factors: (a) Reactivity, characterized by intense, rapidly escalating, sustained, and poorly regulated negative emotional reactions, and (b) Dysphoria, characterized by anhedonia, sadness, and nervousness. The final items did not show differential item functioning (DIF) based on gender, age, intellectual ability, or verbal ability. Because the final items were calibrated using IRT, even a small number of items offers high precision, minimizing respondent burden. IRT co-calibration of the EDI with related measures demonstrated its superiority in assessing the severity of emotion dysregulation with as few as seven items. Validity of the EDI was supported by expert review, its association with related constructs (e.g., anxiety and depression symptoms, aggression), higher scores in psychiatric inpatients with ASD compared to a community ASD sample, and demonstration of test-retest stability and sensitivity to change. In sum, the EDI provides an efficient and sensitive method to measure emotion dysregulation for clinical assessment, monitoring, and research in youth with ASD of any level of cognitive or verbal ability. Autism Res 2018. © 2018 International Society for Autism Research, Wiley Periodicals, Inc. This paper describes a new measure of poor emotional control called the Emotion Dysregulation Inventory (EDI). Caregivers of 1,755 youth with ASD completed candidate items, and advanced statistical

  15. Optimizing visualization in enhanced depth imaging OCT in healthy subjects and patients with retinal pigment epithelial detachment

    Directory of Open Access Journals (Sweden)

    Kampik A

    2012-11-01

    Full Text Available Lukas Reznicek, Efstathios Vounotrypidis, Florian Seidensticker, Karsten Kortuem, Anselm Kampik, Aljoscha S Neubauer, Armin WolfDepartment of Ophthalmology, Ludwig Maximilians University Muenchen, Munich, GermanyBackground: This study’s objective was to optimize the visualization of three different spectral-domain optical coherence tomography (SD-OCT display modalities and evaluate enhanced depth imaging (EDI by comparing the maximum depth of assessment in conventional versus inverted cross-sectional OCT images in healthy subjects and in patients with retinal pigment epithelial detachment (PED.Methods: Cross-sectional SD-OCT conventional and inverted images were obtained with the HRA2 (Heidelberg Retina Angiograph II, Heidelberg Engineering, Heidelberg, Germany. Horizontal as well as vertical sections in three different display modes were blinded for evaluation by three independent, experienced graders for maximal imaging depth of the deep ocular fundus layers.Results: The mean imaging depth as measured from the inner segment/outer segment (IS/OS to the outer choroid of all 14 healthy subjects was 197 ± 44 µm vs 263 ± 56 µm for conventional vs EDI scans: in black/white mode, it was significantly lower (P < 0.001 than in white/black mode (249 ± 42 µm vs 337 ± 71 µm and color/heat mode (254 ± 48 µm vs 354 ± 73 µm. The mean imaging depth of all 14 study eyes with PED was 240 ± 78 µm vs 345 ± 100 µm for conventional vs EDI scans in black/white mode, and was significantly lower (P < 0.001 than in white/black mode (393 ± 104 µm vs 464 ± 126 µm and in color/heat mode (373 ± 106 µm vs 453 ± 114 µm. In each display modality of healthy subjects and of patients with PED, EDI scans showed a significantly higher imaging depth than the corresponding conventional scans.Conclusion: White/black and color/heat modes allow increased imaging depth, compared to black/white mode using both conventional or EDI OCT scans in healthy subjects or

  16. Edição Inspiradora

    Directory of Open Access Journals (Sweden)

    Luciana Di Leone

    2012-12-01

    Full Text Available Embriaguez e engajamento (“Une ivresse belle m’engage” raramente se associam talvez por isso, quando a associação acontece a imagem que gera pode parecer imprevisível, fragmentada, inaudita com uma exceção discutida longamente desde a antiguidade: a do poeta ou artista inspirado. O poeta, para ser poeta, deve estar embriagado, deve ter bebido o elixir da musa. Inclusive, no seio da própria modernidade – que por todos os meios tentou afastar a arte de qualquer relação com o incompreensível – Mallarmé retoma, em “Brinde”, o gesto da inspiração, levanta a taça para beber, colocar o elemento estonteante dentro de si: e entusiasmar-se. Esse gesto complexo, pelo qual se interpenetram o eu e o outro, o poeta e os deuses, o dentro e o fora, sob diversos pontos de vistas e através de diversos objetos, é o foco da instigante coletânea organizada pelo professor de filosofia da Universidade Federal Fluminense, Fernando Muniz.

  17. Edição Inspiradora

    Directory of Open Access Journals (Sweden)

    Luciana Di Leone

    2012-03-01

    Full Text Available http://dx.doi.org/10.5007/1984-784X.2012v12n17p120 Embriaguez e engajamento (“Une ivresse belle m’engage” raramente se associam talvez por isso, quando a associação acontece a imagem que gera pode parecer imprevisível, fragmentada, inaudita com uma exceção discutida longamente desde a antiguidade: a do poeta ou artista inspirado. O poeta, para ser poeta, deve estar embriagado, deve ter bebido o elixir da musa. Inclusive, no seio da própria modernidade – que por todos os meios tentou afastar a arte de qualquer relação com o incompreensível – Mallarmé retoma, em “Brinde”, o gesto da inspiração, levanta a taça para beber, colocar o elemento estonteante dentro de si: e entusiasmar-se. Esse gesto complexo, pelo qual se interpenetram o eu e o outro, o poeta e os deuses, o dentro e o fora, sob diversos pontos de vistas e através de diversos objetos, é o foco da instigante coletânea organizada pelo professor de filosofia da Universidade Federal Fluminense, Fernando Muniz.

  18. Technical feasibility of the electrode ionization process for the makeup water treatment system of the thermal cycle of the CAREM-25 nuclear power plant

    International Nuclear Information System (INIS)

    Ramilo, Lucia B.; Chocron, Mauricio

    2003-01-01

    In thermal cycles of PWRs nuclear power plants with once-through steam generators as the CAREM-25, makeup water of very high purity is required to minimizing the induction of corrosion phenomena, fundamentally in the steam generators and other thermal cycle components. The makeup water treatment systems include several stages, of which the demineralization is the purification stage. The required makeup water purity is obtained in this stage. Historically, ultrapure water systems were based completely on ion exchange technology. Now, the electrode ionization process (EDI) has replaced the ion exchange technology used traditionally in the demineralization stage. Continuous demineralization in an EDI stack consists of three coupled processes: ion exchange, continuous ion removal by transport through the ion exchange resin and membranes into the concentrate stream, continuous regeneration by hydrogen and hydroxyl ions derived from the water splitting reaction and driven by the applied direct current. EDI process allows to obtain ultrapure water, with practically no use of chemical reagents and with technologies of continuous process. The objective of this work is the analysis of the electrode ionization process (EDI) for its implementation in the makeup water treatment system of the thermal cycle of the CAREM-25 nuclear power plant. The obtained results allow to assure the technical feasibility of implementation of the electrode ionization process, EDI, in the makeup water treatment system of the thermal cycle of this Argentinean nuclear power plant. (author)

  19. The Impact of Impulsivity on Weight Loss Four Years after Bariatric Surgery

    Directory of Open Access Journals (Sweden)

    Kathrin Schag

    2016-11-01

    Full Text Available Bariatric surgery has serious implications on metabolic health. The reasons for a failure of bariatric surgery, i.e., limited weight loss, are multifactorial and include psychological factors. We established a theoretical model of how impulsivity is related to weight loss outcome. We propose that depressive symptoms act as a mediator between impulsivity and pathological eating behavior, and that pathological eating behavior has a direct impact on weight loss outcome. We calculated excessive weight loss (%EWL and assessed self-reported impulsivity (using the Baratt Impulsiveness Scale (BIS-15 total score, depressive symptoms (the Patient Health Questionnaire (PHQ-9 score, and pathological eating behavior (the Eating Disorder Inventory 2 (EDI-2 total score in 65 patients four years after laparoscopic sleeve gastrectomy. Regression and mediation analyses were computed to validate the theoretical model. The BIS-15, PHQ-9, and EDI-2 have medium to high correlations between each other, and EDI-2 correlated with %EWL. The mediation analysis yielded that the PHQ-9 represents a significant mediator between BIS-15 and EDI-2. The regression model between EDI-2 and %EWL was also significant. These results support our theoretical model, i.e., suggest that impulsivity has an indirect impact on weight loss outcome after bariatric surgery, mediated by depression and transferred through pathological eating behavior. Thus, the underlying psychological factors should be addressed in post-operative care to optimize weight loss outcome.

  20. Baixa prevalência de discromatopsia, pela 4ª edição do teste pseudoisocromático HRR (Hardy, Rand e Rittler), da população indígena de etnia terena da aldeia lalima na região de Miranda: Mato Grosso do Sul Low prevalence of dyschromatopsia using the fourth edition of HRR (Hardy, Rand and Rittler) pseudoisochromatic plate test among the Indian population of Lalima village, Terena

    OpenAIRE

    Marcos Rogério Mistro Piccinin; Juliana Ferrari Cunha; Herbert Paulo de Almeida; Cleiton Cassio Bach; Andréa Cristina Grubits Gonçalves de Oliveira Dossa; Reinaldo Ferreira da Silva; Valdir Filgueiras Pessoa

    2007-01-01

    OBJETIVO: Avaliar a freqüência de discromatopsias através da 4ª edição do teste pseudoisocromático HRR (Hardy, Rand and Rittler) entre a população indígena masculina da aldeia Lalima, etnia Terena, na região de Miranda-MS. MÉTODOS: Foram realizadas viagens à aldeia Lalima em Miranda-MS, nos meses de janeiro e fevereiro de 2005. As viagens para realizar os exames só foram iniciadas após o projeto ter sido avaliado e aprovado pelos Comitê de Ética e Pesquisa da UFMS, Comitê Nacional de Ética e ...

  1. Final report for EDI energy conservation with diode light; Slutrapport for EDI energibesparelser med diodelys

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    2006-07-01

    The aim of this project has been to develop technological knowledge and a competence platform for utilization of new light emitting diode technology for general lighting purposes. Furthermore the project has aimed at developing a 3 W light diode bulb to replace 15-20 W filament bulbs and halogen spotlights, and thereby demonstrating a large energy conservation potential in the use of LED technology for lighting purposes. (BA)

  2. Methane production using resin-wafer electrodeionization

    Science.gov (United States)

    Snyder, Seth W; Lin, YuPo; Urgun-Demirtas, Meltem

    2014-03-25

    The present invention provides an efficient method for creating natural gas including the anaerobic digestion of biomass to form biogas, and the electrodeionization of biogas to form natural gas and carbon dioxide using a resin-wafer deionization (RW-EDI) system. The method may be further modified to include a wastewater treatment system and can include a chemical conditioning/dewatering system after the anaerobic digestion system. The RW-EDI system, which includes a cathode and an anode, can either comprise at least one pair of wafers, each a basic and acidic wafer, or at least one wafer comprising of a basic portion and an acidic portion. A final embodiment of the RW-EDI system can include only one basic wafer for creating natural gas.

  3. Surface characterization of polymethylmetacrylate bombarded by charged water droplets

    International Nuclear Information System (INIS)

    Hiraoka, Kenzo; Takaishi, Riou; Asakawa, Daiki; Sakai, Yuji; Iijima, Yoshitoki

    2009-01-01

    The electrospray droplet impact (EDI), in which the charged electrospray water droplets are introduced in vacuum, accelerated, and allowed to impact the sample, is applied to polymethylmetacrylate (PMMA). The secondary ions generated were measured by an orthogonal time-of-flight mass spectrometer. In EDI mass spectra for PMMA, fragment ions originating from PMMA could not be detected. This is due to the fact that the proton affinities of fragments formed from PMMA are smaller than those from acetic acid contained in the charged droplet. The x-ray photoelectron spectroscopy spectra of PMMA irradiated by water droplets did not change with prolonged cluster irradiation, i.e., EDI is capable of shallow surface etching for PMMA with a little damage of the sample underneath the surface.

  4. “En-Face” Spectral-Domain Optical Coherence Tomography Findings in Multiple Evanescent White Dot Syndrome

    Directory of Open Access Journals (Sweden)

    Flore De bats

    2014-01-01

    Full Text Available Purpose. The recent use of “en-face” enhanced-depth imaging spectral-domain optical coherence tomography (EDI SD-OCT helps distinguish the retinal layers involved in the physiopathology of multiple evanescent white dot syndrome (MEWDS. Methods. Four patients presenting with MEWDS underwent a comprehensive ocular examination including C-scan (“en-face” EDI SD-OCT at the initial visit and during follow-up. Results. C-scans combined with the other multimodal imaging enabled the visualization of retinal damage. Acute lesions appeared as diffuse and focal disruptions occurring in the ellipsoid and interdigitation zones. The match between autofluorescence imaging, indocyanine green angiography, and “en-face” OCT helped identify the acute microstructural damages in the outer retina further than the choroid. Follow-up using “en-face” EDI-OCT revealed progressive and complete recovery of the central outer retinal layers. Conclusion. “En-face” EDI SD-OCT identified the site of initial damage in MEWDS as the photoreceptors and the interdigitation layers rather than the choroid. Moreover, “en-face” OCT is helpful in the follow-up of these lesions by being able to show the recovery of the outer retinal layers.

  5. De Paris a Buenos Aires: imprensa, ideias e intelectuais no Le Monde Diplomatique

    Directory of Open Access Journals (Sweden)

    Juliana Sayuri Ogassawara

    2016-03-01

    Full Text Available Este artigo pretende expor as relações entre os intelectuais e jornalistas imbricados nas edições latino-americanas e a edição francesa do periódico Le Monde Diplomatique. Fundado em maio de 1954, em Paris, por Hubert Beuve-Méry, Le Monde Diplomatique viu suas páginas e suas ideias se alastrarem mundo afora – em 2013, o magazine tinha 47 edições internacionais, considerado um fenômeno único na imprensa mundial. Ao longo de sua trajetória, Le Monde Diplomatique teve sua linha editorial marcada por diretrizes politizadas, declaradamente antiimperialistas e antineoliberais. A tese desenvolvida focou a versão publicada em Buenos Aires, considerada a principal edição latino-americana, fundada por iniciativa do argentino Carlos Gabetta, diretor de Le Monde Diplomatique Edición Cono Sur entre 1999 e 2011. Ancorado na história dos intelectuais e na história do tempo presente, este artigo aborda as relações entre intelectuais franceses e argentinos na consolidação de uma experiência singular da imprensa.

  6. Flux-gate magnetometer spin axis offset calibration using the electron drift instrument

    International Nuclear Information System (INIS)

    Plaschke, Ferdinand; Nakamura, Rumi; Baumjohann, Wolfgang; Steller, Manfred; Magnes, Werner; Leinweber, Hannes K; Chutter, Mark; Vaith, Hans

    2014-01-01

    Spin-stabilization of spacecraft immensely supports the in-flight calibration of on-board flux-gate magnetometers (FGMs). From 12 calibration parameters in total, 8 can be easily obtained by spectral analysis. From the remaining 4, the spin axis offset is known to be particularly variable. It is usually determined by analysis of Alfvénic fluctuations that are embedded in the solar wind. In the absence of solar wind observations, the spin axis offset may be obtained by comparison of FGM and electron drift instrument (EDI) measurements. The aim of our study is to develop methods that are readily usable for routine FGM spin axis offset calibration with EDI. This paper represents a major step forward in this direction. We improve an existing method to determine FGM spin axis offsets from EDI time-of-flight measurements by providing it with a comprehensive error analysis. In addition, we introduce a new, complementary method that uses EDI beam direction data instead of time-of-flight data. Using Cluster data, we show that both methods yield similarly accurate results, which are comparable yet more stable than those from a commonly used solar wind-based method. (paper)

  7. Choroidal vasculature characteristics based choroid segmentation for enhanced depth imaging optical coherence tomography images

    Energy Technology Data Exchange (ETDEWEB)

    Chen, Qiang; Niu, Sijie [School of Computer Science and Engineering, Nanjing University of Science and Technology, Nanjing 210094 (China); Yuan, Songtao; Fan, Wen, E-mail: fanwen1029@163.com; Liu, Qinghuai [Department of Ophthalmology, The First Affiliated Hospital with Nanjing Medical University, Nanjing 210029 (China)

    2016-04-15

    Purpose: In clinical research, it is important to measure choroidal thickness when eyes are affected by various diseases. The main purpose is to automatically segment choroid for enhanced depth imaging optical coherence tomography (EDI-OCT) images with five B-scans averaging. Methods: The authors present an automated choroid segmentation method based on choroidal vasculature characteristics for EDI-OCT images with five B-scans averaging. By considering the large vascular of the Haller’s layer neighbor with the choroid-sclera junction (CSJ), the authors measured the intensity ascending distance and a maximum intensity image in the axial direction from a smoothed and normalized EDI-OCT image. Then, based on generated choroidal vessel image, the authors constructed the CSJ cost and constrain the CSJ search neighborhood. Finally, graph search with smooth constraints was utilized to obtain the CSJ boundary. Results: Experimental results with 49 images from 10 eyes in 8 normal persons and 270 images from 57 eyes in 44 patients with several stages of diabetic retinopathy and age-related macular degeneration demonstrate that the proposed method can accurately segment the choroid of EDI-OCT images with five B-scans averaging. The mean choroid thickness difference and overlap ratio between the authors’ proposed method and manual segmentation drawn by experts were −11.43 μm and 86.29%, respectively. Conclusions: Good performance was achieved for normal and pathologic eyes, which proves that the authors’ method is effective for the automated choroid segmentation of the EDI-OCT images with five B-scans averaging.

  8. Choroidal vasculature characteristics based choroid segmentation for enhanced depth imaging optical coherence tomography images

    International Nuclear Information System (INIS)

    Chen, Qiang; Niu, Sijie; Yuan, Songtao; Fan, Wen; Liu, Qinghuai

    2016-01-01

    Purpose: In clinical research, it is important to measure choroidal thickness when eyes are affected by various diseases. The main purpose is to automatically segment choroid for enhanced depth imaging optical coherence tomography (EDI-OCT) images with five B-scans averaging. Methods: The authors present an automated choroid segmentation method based on choroidal vasculature characteristics for EDI-OCT images with five B-scans averaging. By considering the large vascular of the Haller’s layer neighbor with the choroid-sclera junction (CSJ), the authors measured the intensity ascending distance and a maximum intensity image in the axial direction from a smoothed and normalized EDI-OCT image. Then, based on generated choroidal vessel image, the authors constructed the CSJ cost and constrain the CSJ search neighborhood. Finally, graph search with smooth constraints was utilized to obtain the CSJ boundary. Results: Experimental results with 49 images from 10 eyes in 8 normal persons and 270 images from 57 eyes in 44 patients with several stages of diabetic retinopathy and age-related macular degeneration demonstrate that the proposed method can accurately segment the choroid of EDI-OCT images with five B-scans averaging. The mean choroid thickness difference and overlap ratio between the authors’ proposed method and manual segmentation drawn by experts were −11.43 μm and 86.29%, respectively. Conclusions: Good performance was achieved for normal and pathologic eyes, which proves that the authors’ method is effective for the automated choroid segmentation of the EDI-OCT images with five B-scans averaging.

  9. Editorial

    Directory of Open Access Journals (Sweden)

    José Aparecido

    2011-05-01

    Full Text Available A presente edição da Revista Tecer traz para a comunidade acadêmica os resultados da terceira edição do Congresso Internacional de Dislexia (CID, que reúne bianualmente profissionais das áreas da Psicologia, Fonoaudiologia, Psicopedagogia, Pedagogia e Neurociências para discutir pesquisas realizadas no contexto nacional e internacional em torno da temática dislexia.

  10. Human exposure to per- and polyfluoroalkyl substances (PFASs) via house dust in Korea: Implication to exposure pathway.

    Science.gov (United States)

    Tian, Zhexi; Kim, Seung-Kyu; Shoeib, Mahiba; Oh, Jeong-Eun; Park, Jong-Eun

    2016-05-15

    A wide range of per- and polyfluoroalkyl substances (PFASs), including fluorotelomer alcohols (FTOHs), perfluorooctane sulfonamidoethanols (FOSEs), perfluoroalkyl carboxylic acids (PFCAs), and perfluoroalkane sulfonic acids (PFSAs), were measured in fifteen house dust and two nonresidential indoor dust of Korea. Total concentrations of PFASs in house dust ranged from 29.9 to 97.6 ng g(-1), with a dominance of perfluorooctane sulfonic acid (PFOS), followed by 8:2 FTOH, N-Ethyl perfluorooctane sulfonamidoethanol (EtFOSE), perfluoroctanoic acid (PFOA). In a typical exposure scenario, the estimated daily intakes (EDIs) of total PFASs via house dust ingestion were 2.83 ng d(-1) for toddlers and 1.13 ng d(-1) for adults, which were within the range of the mean EDIs reported from several countries. For PFOA and PFOS exposure via house dust ingestion, indirect exposure (via precursors) was a minor contributor, accounting for 5% and 12%, respectively. An aggregated exposure (hereafter, overall-EDIs) of PFOA and PFOS occurring via all pathways, estimated using data compiled from the literature, were 53.6 and 14.8 ng d(-1) for toddlers, and 20.5 and 40.6 ng d(-1) for adults, respectively, in a typical scenario. These overall-EDIs corresponded to 82% (PFOA) and 92% (PFOS) of a pharmacokinetic model-based EDIs estimated from adults' serum data. Direct dietary exposure was a major contributor (>89% of overall-EDI) to PFOS in both toddlers and adults, and PFOA in toddlers. As for PFOA exposure of adults, however direct exposure via tap water drinking (37%) and indirect exposure via inhalation (22%) were as important as direct dietary exposure (41%). House dust-ingested exposure (direct+indirect) was responsible for 5% (PFOS in toddlers) and house-dust ingestion was a minor contributor in this study, but should not be ignored for toddlers' PFOS exposure due to its significance in the worst-case scenario. Copyright © 2016 Elsevier B.V. All rights reserved.

  11. Real-time in vivo micromorphology and histopathology of choroidal osteoma using enhanced depth imaging

    Directory of Open Access Journals (Sweden)

    Rameez Hussain

    2015-01-01

    Full Text Available Choroidal osteoma is a usually unilateral benign tumor of the choroid composed of mature bone. Optical coherence tomography (OCT has been used to image osteoma for several years. With the advent of enhanced depth imaging (EDI feature of spectral-domain OCT (SD-OCT, better visualization of the morphology of choroidal lesions has been possible. Herein we present a case of choroidal osteoma in a 45-year-old woman, wherein in vivo morphology of the choroidal osteoma had been visualized using EDI technique of SD-OCT before and after performing photodynamic therapy. EDI OCT has proven to be a valuable noninvasive imaging modality, almost comparable to histopathological examination, for diagnosing choroidal osteomas and for providing an insight into the in vivo micromorphological changes occurring during the course of the disease.

  12. Validating Advanced Supply-Chain Technology (VAST)

    Science.gov (United States)

    2004-06-01

    Use philosophy that is so important in today’s procurement environment. Electronic Data Interchange (EDI) and eCommerce is proving to be a major...the STEPwise methodology are particularly encouraging. These new EDI and eCommerce technologies are becoming more important with the customers who...critical assumption is based upon the 55 fact that eCommerce is growing throughout the commercial and military sector and those who are not

  13. Misjoniseminar Tartus / Rein Kalmus, Janos Kovacs Biro, Rein Käsk...[jt.] ; interv. Mare Pihlak

    Index Scriptorium Estoniae

    2007-01-01

    Vestlus osalejatega Pereraadio saates "Elupuu," mis valmis märtsis Trans-Euroopa Divisjoni väikegruppide ja misjonitöö juhi Janos Kovacs-Biro Tartu Ülikooli Ajaloomuuseumis peetud loengusarja "Ela oma elu täiel määral" põhjal

  14. Effects of hyperflexion on acute stress responses in ridden dressage horses

    DEFF Research Database (Denmark)

    Christensen, Janne Winther; Beekmans, M.; van Dalum, M.

    2014-01-01

    dressage programme in either the competition frame (CF), hyperflexion (“Low-Deep-and-Round”; LDR) or a looser frame (LF) in a balanced order on three separate test days. Heart rate (HR), heart rate variability parameters (HRV), behaviour and rein tension were recorded during the test. Salivary cortisol...... concentrations were measured 60 min before and 0, 5, 15 and 30 min after the test. Rein tension was significantly lower in LF and did not differ between CF and LDR; however approx. 15% of recordings in CF and LDR were above the sensor detection limit of 5 kg. The horses had significantly higher cortisol...

  15. Impact of sex and glucose-lowering treatments on hypoglycaemic symptoms in people with type 2 diabetes and chronic kidney disease. The French Chronic Kidney Disease - Renal Epidemiology and Information Network (CKD-REIN) Study.

    Science.gov (United States)

    Balkau, B; Metzger, M; Andreelli, F; Frimat, L; Speyer, E; Combe, C; Laville, M; Jacquelinet, C; Briançon, S; Ayav, C; Massy, Z; Pisoni, R L; Stengel, B; Fouque, D

    2018-04-06

    To describe current practices of glucose-lowering treatments in people with diabetes and chronic kidney disease (CKD), the associated glucose control and hypoglycaemic symptoms, with an emphasis on sex differences. Among the 3033 patients with CKD stages 3-5 recruited into the French CKD-REIN study, 645 men and 288 women had type 2 diabetes and were treated by glucose-lowering drugs. Overall, 31% were treated only with insulin, 28% with combinations of insulin and another drug, 42% with non-insulin glucose-lowering drugs. In CKD stage 3, 40% of patients used metformin, 12% at stages 4&5, similar for men and women; in CKD stage 3, 53% used insulin, similar for men and women, but at stages 4&5, 59% of men and 77% of women used insulin. Patients were reasonably well controlled, with a median HbA1c of 7.1% (54mmol/mol) in men, 7.4% (57mmol/mol) in women (P=0.0003). Hypoglycaemic symptoms were reported by 40% of men and 59% of women; they were not associated with the estimated glomerular filtration rate, nor with albuminuria or with HbA1c in multivariable analyses, but they were more frequent in people treated with insulin, particularly with fast-acting and pre-mixed insulins. Glucose-lowering treatment, HbA1c and hypoglycaemic symptoms were sex dependent. Metformin use was similar in men and women, but unexpectedly low in CKD stage 3; its use could be encouraged rather than resorting to insulin. Hypoglycaemic symptoms were frequent and need to be more closely monitored, with appropriate patient-education, especially in women. Copyright © 2018 Elsevier Masson SAS. All rights reserved.

  16. Drought over Seoul and Its Association with Solar Cycles

    Directory of Open Access Journals (Sweden)

    Jong-Hyeok Park

    2013-12-01

    Full Text Available We have investigated drought periodicities occurred in Seoul to find out any indication of relationship between drought in Korea and solar activities. It is motivated, in view of solar-terrestrial connection, to search for an example of extreme weather condition controlled by solar activity. The periodicity of drought in Seoul has been re-examined using the wavelet transform technique as the consensus is not achieved yet. The reason we have chosen Seoul is because daily precipitation was recorded for longer than 200 years, which meets our requirement that analyses of drought frequency demand long-term historical data to ensure reliable estimates. We have examined three types of time series of the Effective Drought Index (EDI. We have directly analyzed EDI time series in the first place. And we have constructed and analyzed time series of histogram in which the number of days whose EDI is less than -1.5 for a given month of the year is given as a function of time, and one in which the number of occasions where EDI values of three consecutive days are all less than -1.5 is given as a function of time. All the time series data sets we analyzed are periodic. Apart from the annual cycle due to seasonal variations, periodicities shorter than the 11 year sunspot cycle, ~ 3, ~ 4, ~ 6 years, have been confirmed. Periodicities to which theses short periodicities (shorter than Hale period may be corresponding are not yet known. Longer periodicities possibly related to Gleissberg cycles, ~ 55, ~ 120 years, can be also seen. However, periodicity comparable to the 11 year solar cycle seems absent in both EDI and the constructed data sets.

  17. A change of course: The importance to DoD of international standards for electronic commerce

    Science.gov (United States)

    Payne, Judith E.

    1991-12-01

    The U.S. Department of Defense (DoD) is committed to using electronic commerce in the future with the over 300,000 vendors interested in doing business with DoD. Electronic commerce will move DoD from a paper-based world to one based on electronic transactions enabled by the exchange of formatted, electronic messages referred to as electronic data interchange (EDI). With electronic commerce, DoD plans to reduce costs, increase effectiveness, and make it easier for vendors to deal with DoD. Benefits from electronic commerce are enhanced when many businesses use the same standards for EDI messages themselves and their transmission. The fewer standards used, the less time and resources must be spent translating messages and agreeing on how to use different standards. To enhance benefits and smooth the transition to electronic commerce for itself and its vendors, DoD has chosen to use the widely accepted American National Standards Institute (ANSI) X12 standards for EDI messages, coupled with international standards for delivering messages and organizing addresses. In the past 18 months, EDI standards sponsored by a United Nations body and serving the same purpose as ANSI X12 message standards have begun to gain wider acceptance internationally.

  18. WEB Services Networks and Technological Hybrids — The Integration Challenges of WAN Distributed Computing for ASP Providers

    Science.gov (United States)

    Mroczkiewicz, Pawel

    A necessity of integration of both information systems and office software existing in organizations has had a long history. The beginning of this kind of solutions reaches back to the old generation of network protocols called EDI (Electronic Data Interchange) and EDIFACT standard, which was initiated in 1988 and has dynamically evolved ever since (S. Michalski, M. Suskiewicz, 1995). The mentioned protocol was usually used for converting documents into natural formats processed by applications. It caused problems with binary files and, furthermore, the communication mechanisms had to be modified each time new documents or applications were added. When we compare EDI with the previously used communication mechanisms, EDI was a great step forward as it was the first, big scale attempt to define standards of data interchange between the applications in business transactions (V. Leyland, 1995, p. 47).

  19. The Influence of Volume and Anatomic Location of Optic Disc Drusen on the Sensitivity of Autofluorescence

    DEFF Research Database (Denmark)

    Loft, Frederik Cornelius; Malmqvist, Lasse; Lindberg, Anne-Sofie Wessel

    2018-01-01

    Optic disc drusen (ODD) are acellular deposits in the optic nerve head. ODD can be diagnosed using different imaging modalities, including enhanced depth imaging optical coherence tomography (EDI-OCT) and autofluorescence (AF). It is unknown which factors determine the sensitivity of AF. The aim...... of this study was to investigate the effect of volume and anatomic location of ODD on the sensitivity of AF. Cross-sectional study. A total of 38 patients (75 eyes) with ODD were included. In 12 of 75 eyes (16%) and in 11 of 38 patients (29%), EDI-OCT detected ODD that were not detected by AF. In 24 distinctly...... solitary ODD, both increase in ODD volume (P = 0.0388) and a more superficial ODD location (P EDI-OCT is superior to AF in the diagnosis of ODD. Volume and anatomic location of ODD have a significant impact...

  20. Psycholinguistic factors in testing children’s theory of mind: false belief in their own words

    DEFF Research Database (Denmark)

    Hansen, Mikkel

    Symposium presented by Nathalie Nader-Grosbois, Valerie Plumet, Edy Veneziano, Koviljka Barisnikov, discussant: Koviljka Barisnikov. How does Theory of mind explain social skills? What is the impact of communicative and linguistic factors on Theory of mind?......Symposium presented by Nathalie Nader-Grosbois, Valerie Plumet, Edy Veneziano, Koviljka Barisnikov, discussant: Koviljka Barisnikov. How does Theory of mind explain social skills? What is the impact of communicative and linguistic factors on Theory of mind?...

  1. Improving the sensitivity of J coupling measurements in solids with application to disordered materials

    International Nuclear Information System (INIS)

    Guerry, Paul; Brown, Steven P.; Smith, Mark E.

    2016-01-01

    It has been shown previously that for magic angle spinning (MAS) solid state NMR the refocused INADEQUATE spin-echo (REINE) experiment can usefully quantify scalar (J) couplings in disordered solids. This paper focuses on the two z filter components in the original REINE pulse sequence, and investigates by means of a product operator analysis and fits to density matrix simulations the effects that their removal has on the sensitivity of the experiment and on the accuracy of the extracted J couplings. The first z filter proves unnecessary in all the cases investigated here and removing it increases the sensitivity of the experiment by a factor ∼1.1–2.0. Furthermore, for systems with broad isotropic chemical shift distributions (namely whose full widths at half maximum are greater than 30 times the mean J coupling strength), the second z filter can also be removed, thus allowing whole-echo acquisition and providing an additional √2 gain in sensitivity. Considering both random and systematic errors in the values obtained, J couplings determined by fitting the intensity modulations of REINE experiments carry an uncertainty of 0.2–1.0 Hz (∼1−10 %).

  2. 全膜分离技术及其在电厂化学水处理中的应用%Whole Membrane Separation Technology and Its Application in Chemical Water Treatment of Power Plant

    Institute of Scientific and Technical Information of China (English)

    马福刚

    2011-01-01

    This paper introduces the definition, types and characteristics of membrane separation technology, and application instance of whole membrane separation treatment process (UF-RO-EDI) in power plant boiler feed water treatment.%介绍了膜分离技术的定义、种类、特点以及全膜分离处理工艺(UF-RO-EDI)在电厂锅炉补给水处理中的应用实例.

  3. Plaadid : Pop & rock / Rein Vader

    Index Scriptorium Estoniae

    Vader, Rein

    2002-01-01

    Uutest plaatidest Cypress Hill "Stoned raiders", Anastacia "Freak Of Nature", Alicia Keys "Songs In A Minor", Robbie Williams "Swing When You're Winning", "Royal House Dance", Yoko Ono "Blueprint For A Sunrise"

  4. Seaduslikkus taktikaliste eranditeta / Rein Org

    Index Scriptorium Estoniae

    Org, Rein

    2005-01-01

    Sotsiaaldemokraatliku Erakonna peasekretär kritiseerib Reformierakonna ja Keskerakonna poolt sõnavabaduse kaitsmiseks algatatud välireklaamikampaaniat, millega püütakse mõjutada õiguskantsleri hinnangut poliitilist välireklaami keelustavale seadusemuudatusele

  5. Taotlused ja tulemus / Rein Tootmaa

    Index Scriptorium Estoniae

    Tootmaa, Rein

    2002-01-01

    Helle Karise kavandatava portreefilmide sarja "Contra mortem" esimene film "Dr. Andres Ellamaa" : operaatorid Peter Murdmaa ja Marko Piirsoo : monteerija Eero Karis : produtsendid Helle Karis ja Maret Hirtentreu : kasutatud Carl Orffi muusikat : Myth Film 2002

  6. Kiire, mugav, odav? / Rein Raud

    Index Scriptorium Estoniae

    Raud, Rein, 1961-

    2006-01-01

    Ilmunud ka: Infopress 18. aug. nr. 33 lk. 151. TLÜ rektor viitab, et bakalaureusetase on vaid vahefaas, kus inimene on saanud spetsialiseerumiseks ettevalmistuse. Talle tundub, et Eesti praegune jõukusetase võimaldaks tagada vähemasti koha tasuta magistriõppes kõigile neile ülikoolilõpetajatele, kelle bakalaureuseõpingute tulemus on ületanud mingi teatava künnise, ning loobuda õpingute nominaalaja fetišeerimisest

  7. Seitse miljardit veemajandusele / Rein Randver

    Index Scriptorium Estoniae

    Randver, Rein, 1956-

    2007-01-01

    Ilmunud ka: Sakala, 3. apr. 2007, lk. 2; Võrumaa Teataja, 3. apr. 2007, lk. 2; Vooremaa, 3. apr. 2007, lk. 2; Vali Uudised, 4. apr. 2007, lk. 2; Meie Maa, 4. apr. 2007, lk. 2; Põhjarannik, 4. apr. 2007, lk. 2; Severnoje Poberezhje, 4. apr. 2007, lk. 2; Harju Ekspress, 5. apr. 2007, lk. 8; Harjumaa, 5. apr. 2007, lk. 4; Lääne Elu, 10. apr. 2007, lk. 2; Oma Saar, 13. apr. 2007, lk. 5. Ametist lahkuv keskkonnaminister peab kõige olulisemaks ja rahaliselt suuremahulisemaks tegevusvaldkonnaks veemajandust

  8. Inimesed ja mesilased / Rein Tootmaa

    Index Scriptorium Estoniae

    Tootmaa, Rein

    2005-01-01

    Nukufilm "Gene+ratio" : stsenarist, kunstnik ja režissöör Mait Laas : konsultant Paavo Matsin : operaatorid Ragnar Neljandi, Raivo Möllits : helilooja Tiit Kikas : Nukufilm OÜ - Icon Film (Saksamaa) 2005

  9. Taking the reins of power

    International Nuclear Information System (INIS)

    Cavenagh, Andrew.

    1997-01-01

    The growing contract energy management business in the United Kingdom is examined. At the top end, established electricity generators are supplying combined heat and power plants of over 20MW or so to meet the steam, power and heating requirements of large industrial sites on contracts of, typically, 15-20 years. These are very much the province of companies such as National Power and PowerGen familiar with linking into the high voltage transmission system and hence able to sell surplus power from these projects into the National Grid. A much wider range of services is on offer by other more specialised companies. These range from the supply and operation of combined heat and power plants to smaller companies, to fuel purchasing contracts and the monitoring of energy consumption of existing facilities in public buildings. Cost cutting is the driving attraction of contract energy management for the purchasers, but there are other advantages. The view of one company, for example, is that it enables them to focus on their core business while leaving energy production and management to a third party whose core business that is. Energy costs become totally forecastable and expertise is always at hand. (UK)

  10. Terrorism muutuvas maailmas / Rein Tammsaar

    Index Scriptorium Estoniae

    Tammsaar, Rein

    2003-01-01

    Tulevikuperspektiivis tagab tõhusa terrorismivastase tegevuse otsese sõjalise sekkumise kõrval laiaulatuslik rahvusvaheliselt koordineeritud tegevus, leiab autor. Skeem: Terrorismi ennetamine ja terrorismivastase tegevuse üldine koordineerimine Eestis. Tabel: Terrorismi ohtlikumad valdkonnad. Vt. samas Sven Sakkovi retsensiooni artiklile lk. 201

  11. USSR reins-in nuclear plans

    International Nuclear Information System (INIS)

    Perera, Judith.

    1989-01-01

    The USSR had hoped to double its nuclear capacity by the year 2000 to provide 20 per cent of its electricity. But this may no longer be possible in the face of the growing anti-nuclear movement allowed by Glasnost and given a focus by Chernobyl. Local protest has forced Moscow to drop its plans to build one of the world's biggest nuclear power plants at Ignalina in Lithuania. Although two 1,500 MW units are operating, there is national opposition to two more being built there. A year ago the Government had to scrap plans to build a 1,000MW VVER (pressurised water reactor) at Krasnador near the Black Sea, because of high seismic activity in the area. In the Ukraine, building has also stopped at the Chigirin plant. Plans to build nuclear heat and power plants at Odessa and Kharkov were cancelled last July. Construction of a nuclear power and heat plant at Minsk has been suspended and the Byelorussian government has proposed to Moscow that it should be redesigned to run on gas. A planned nuclear power and heat plant in Gorky and a plant being built in the Crimea are in doubt. Armenia's two reactors in the Ararat valley are to be closed and converted to a thermal plant, following increased concern after the 1988 earthquake. The USSR are looking at other energy sources, geothermal, solar, wind and wave. (author)

  12. Journey towards yourself / Rein Veidemann

    Index Scriptorium Estoniae

    Veidemann, Rein, 1946-

    2011-01-01

    Arvustus: Luik, Viivi. Varjuteater. Tallinn : Eesti Keele Sihtasutus, 2010 ; Luik, Viivi, Rosma, Hedi. Ma olen raamat. Tallinn : SE & JS, 2010 ; Jõerüüt, Jaak. Armastuse laiad, kõrged hooned. Tallinn : Tuum, 2010 ; Jõerüüt, Jaak. Muutlik. Tallinn : Tuum, 2010

  13. Iseolemise uus paradigma / Rein Lang

    Index Scriptorium Estoniae

    Lang, Rein, 1957-

    2004-01-01

    Oma essees nimetab autor 1992. aasta põhiseaduse neli kontseptuaalset eesmärki ning leiab, et neli peamist ülesannet, mis sellele põhiseadusele esitati, on enamjaolt täidetud, vaja on aga minna edasi. Meil tuleb mõtestada oma sõnum EL-is ja oma tahtmised järgmiseks iseolemise etapiks, ütleb autor kokkuvõtteks

  14. The Long Term Effects of Electronic Commerce and Data Interchange on Firms

    Directory of Open Access Journals (Sweden)

    François Bergeron

    1998-11-01

    Full Text Available This research aims to identify the determinants of electronic commerce effectiveness, as well as the variation over time of their effect. A two-phased study was undertaken for this purpose, using EDI as a specific form of electronic commerce. Sixty-five organisations were surveyed twice over a three-year period. In Phase 1, determining factors were found to be the level of organisational support, the rigour of the implementation process, the presence of control procedures, and the level of internal integration, external integration and imposition of EDI. Imposition also has a negative effect on the organisational context of EDI. In Phase 2, the implementation process, internal integration and imposition lost their importance, whereas the effect of imposition on the organisational context became positive. In the future, we expect the security and external integration to be the most important success factors of electronic commerce.

  15. Population-level associations between preschool vulnerability and grade-four basic skills.

    Directory of Open Access Journals (Sweden)

    Amedeo D'Angiulli

    2009-11-01

    Full Text Available This is a predictive validity study examining the extent to which developmental vulnerability at kindergarten entry (as measured by the Early Development Instrument, EDI is associated with children's basic skills in 4th grade (as measured by the Foundation Skills Assessment, FSA.Relative risk analysis was performed on a large database linking individual-level EDI ratings to the scores the same children obtained on a provincial assessment of academic skills (FSA--Foundation Skills Assessment four years later. We found that early vulnerability in kindergarten is associated with the basic skills that underlie populations of children's academic achievement in reading, writing and math, indicating that the Early Development Instrument permits to predict achievement-related skills four years in advance.The EDI can be used to predict children's educational trends at the population level and can help select early prevention and intervention programs targeting pre-school populations at minimum cost.

  16. Drivers and obstacles for employee-driven innovation in large client project organisations

    DEFF Research Database (Denmark)

    Sørensen, Henrik; Wandahl, Søren

    2012-01-01

    of employees’ spoken and tacit knowledge in development of new tools and structures to optimise the construction project management processes is a relatively new approach to engage innovation. In this broad perspective the aim is to map the boundary conditions for an EDI approach in a client project......, and in sequence increased revenue, this study suggests that the key source for innovation is the employees. Employee-driven innovation (EDI) is often seen in a greater innovation context, in which it is often de-emphasised contrary to product and process innovation. Hence a methodology to take advantage...... a literature review to clarify the most potential methodologies and tools. Based on this review a framework of tools and methods is derived from related development theories to engage EDI in client project organisa-tions, where product and process knowledge often are closely related to, and irregular driven by...

  17. Electronic commerce can cut purchasing costs

    Energy Technology Data Exchange (ETDEWEB)

    Hansen, T.

    1995-06-01

    Electronic commerce could be the most important strategy exercised by utilities involved in transmission and distribution in the next five to ten years. One key element of electronic commerce is electronic data interchange (EDI). EDI is the direct, standardized computer-to-computer exchange of business documents, such as purchase orders, invoices, payments and inventory analysis between trading partners. EDI enables business documents delivery in seconds instead of days. Inventory has been a big expense for utilities, especially in the transmission and distribution area. In order to provide and restore electrical service to customers, utilities have been required to stock high levels of many different items. At times, warehouse personnel have had difficulty determining the minimum quantity needed for a particular part so items are stocked just-in-case.Electronic commerce will allow utilities to more accurately determine minimum stocking requirements and reduce inventory without sacrificing customer service.

  18. Intensive inpatient treatment for bulimia nervosa: Statistical and clinical significance of symptom changes.

    Science.gov (United States)

    Diedrich, Alice; Schlegl, Sandra; Greetfeld, Martin; Fumi, Markus; Voderholzer, Ulrich

    2018-03-01

    This study examines the statistical and clinical significance of symptom changes during an intensive inpatient treatment program with a strong psychotherapeutic focus for individuals with severe bulimia nervosa. 295 consecutively admitted bulimic patients were administered the Structured Interview for Anorexic and Bulimic Syndromes-Self-Rating (SIAB-S), the Eating Disorder Inventory-2 (EDI-2), the Brief Symptom Inventory (BSI), and the Beck Depression Inventory-II (BDI-II) at treatment intake and discharge. Results indicated statistically significant symptom reductions with large effect sizes regarding severity of binge eating and compensatory behavior (SIAB-S), overall eating disorder symptom severity (EDI-2), overall psychopathology (BSI), and depressive symptom severity (BDI-II) even when controlling for antidepressant medication. The majority of patients showed either reliable (EDI-2: 33.7%, BSI: 34.8%, BDI-II: 18.1%) or even clinically significant symptom changes (EDI-2: 43.2%, BSI: 33.9%, BDI-II: 56.9%). Patients with clinically significant improvement were less distressed at intake and less likely to suffer from a comorbid borderline personality disorder when compared with those who did not improve to a clinically significant extent. Findings indicate that intensive psychotherapeutic inpatient treatment may be effective in about 75% of severely affected bulimic patients. For the remaining non-responding patients, inpatient treatment might be improved through an even stronger focus on the reduction of comorbid borderline personality traits.

  19. Prospective pilot study of a tablet computer in an Emergency Department.

    Science.gov (United States)

    Horng, Steven; Goss, Foster R; Chen, Richard S; Nathanson, Larry A

    2012-05-01

    The recent availability of low-cost tablet computers can facilitate bedside information retrieval by clinicians. To evaluate the effect of physician tablet use in the Emergency Department. Prospective cohort study comparing physician workstation usage with and without a tablet. 55,000 visits/year Level 1 Emergency Department at a tertiary academic teaching hospital. 13 emergency physicians (7 Attendings, 4 EM3s, and 2 EM1s) worked a total of 168 scheduled shifts (130 without and 38 with tablets) during the study period. Physician use of a tablet computer while delivering direct patient care in the Emergency Department. The primary outcome measure was the time spent using the Emergency Department Information System (EDIS) at a computer workstation per shift. The secondary outcome measure was the number of EDIS logins at a computer workstation per shift. Clinician use of a tablet was associated with a 38min (17-59) decrease in time spent per shift using the EDIS at a computer workstation (pcomputer was associated with a reduction in the number of times physicians logged into a computer workstation and a reduction in the amount of time they spent there using the EDIS. The presumed benefit is that decreasing time at a computer workstation increases physician availability at the bedside. However, this association will require further investigation. Copyright © 2011 Elsevier Ireland Ltd. All rights reserved.

  20. Arhitektuurivõistluse pinged / Endrik Mänd, Toomas Rein, Rein Murula, Tomomi Hayashi ; intervjueerinud Margit Mutso

    Index Scriptorium Estoniae

    2011-01-01

    Tallinna Muusikakeskkooli, Georg Otsa nimelise Tallinna Muusikakooli ja Tallinna Balletikooli ühishoone arhitektuurikonkursist räägivad arhitektid-kohtunikud. Võidutööst "Vaikuse aed" (Austria AB Atelier Thomas Pucher ZT GmbH), 2. preemia pälvinud tööst "Octopus" (AB Emil Urbel), 3. koha saanud tööst "Pausid ja poosid" (Ninja Stuudio). Loetletud premeeritud ja äramärgitud tööd, nende autorid, žürii koosseis

  1. Rotermanni kvartalit päästetakse nüüd juba pendlimehe abil / Askur Alas

    Index Scriptorium Estoniae

    Alas, Askur, 1973-

    2009-01-01

    Tallinna Rotermanni kvartali reanimeerimisest. Planeerimisprobleeme aitab lahendada arhitekt-geobioloog Rein Weber. Kvartali peaarhitektiks on Andres Alver. Festivali Tallinna Uue Linna Päevad üritustest

  2. Outer Retinal and Choroidal Evaluation in Multiple Evanescent White Dot Syndrome (MEWDS): An Enhanced Depth Imaging Optical Coherence Tomography Study.

    Science.gov (United States)

    Fiore, Tito; Iaccheri, Barbara; Cerquaglia, Alessio; Lupidi, Marco; Torroni, Giovanni; Fruttini, Daniela; Cagini, Carlo

    2018-01-01

    To perform an analysis of optical coherence tomography (OCT) abnormalities in patients with MEWDS, during the acute and recovery stages, using enhanced depth imaging-OCT (EDI-OCT). A retrospective case series of five patients with MEWDS was included. EDI-OCT imaging was evaluated to detect retinal and choroidal features. In the acute phase, focal impairment of the ellipsoid zone and external limiting membrane, hyperreflective dots in the inner choroid, and full-thickness increase of the choroidal profile were observed in the affected eye; disappearance of these findings and restoration of the choroidal thickness (p = 0.046) was appreciated in the recovery phase. No OCT abnormalities were assessed in the unaffected eye. EDI-OCT revealed transient outer retinal layer changes and inner choroidal hyperreflective dots. A transient increased thickness of the whole choroid was also identified. This might confirm a short-lasting inflammatory involvement of the whole choroidal tissue in the active phase of MEWDS.

  3. Coupled-spin filtered MR imaging in a low field

    International Nuclear Information System (INIS)

    Baudouin, C.J.; Bryant, D.J.; Coutts, G.A.; Bydder, G.M.; Young, I.R.

    1990-01-01

    This paper investigates the use of an editing method of imaging using spin-echo sequences with differing radio-frequency (RF) pulses for lipid imaging in poor fields and to compare it with solvent-suppression methods. A technique of echo difference imaging (EDI) has been described in which two data sets are acquired: a normal spin-echo sequence (90-180) and a 90-90 spin-echo sequence. The intrinsic signal of uncoupled spins in the EDI method is one-half that of the conventional sequence, so that subtracting twice the EDI signal from the conventional signal should result in signal cancellation. With coupled spins, the application of the second 90 degrees pulse results in coherence transfer, and echo magnitude will not be one-half that of the 90-180 echo. This method of lipid imaging may be less vulnerable to field inhomogeneity than are solvent-suppression methods. Phantom and in vivo studies were performed at 0.15 T (TE = 44 msec and various TRs)

  4. Elektriõnnetustest aastal 2005 / Meelis Kärt

    Index Scriptorium Estoniae

    Kärt, Meelis

    2006-01-01

    Tehnilise Järelevalve Inspektsiooni andmed 2005. a. toimunud elektriga seotud õnnetusjuhtumite kohta. Võrdlusandmed varasemate aastatega. Statistilised diagrammid. Vt. ka: Võrk, Rein. Meenutusi elektriõnnetuste ekspertiisidest

  5. Describing the association between socioeconomic inequalities and cancer survival: methodological guidelines and illustration with population-based data

    Directory of Open Access Journals (Sweden)

    Belot A

    2018-05-01

    Full Text Available Aurélien Belot,1-3 Laurent Remontet,3,4 Bernard Rachet,1 Olivier Dejardin,5,6 Hadrien Charvat,7 Simona Bara,8 Anne-Valérie Guizard,5,9 Laurent Roche,3,4 Guy Launoy,5,6 Nadine Bossard3,4 1Cancer Survival Group, Department of Non-Communicable Disease Epidemiology, Faculty of Epidemiology and Population Health, London School of Hygiene and Tropical Medicine, London, United Kingdom; 2Non-Communicable Diseases and Trauma Direction, The French Public Health Agency, Saint-Maurice, France; 3Department of Biostatistics and Bioinformatics, Hospices Civils de Lyon, Lyon, France; 4UMR 5558, Biometry and Evolutionary Biology Laboratory, Biostatistics Health Group, CNRS, University Lyon 1, Lyon, France; 5National Institute of Health and Medical Research U1086 ANTICIPE, Caen, France; 6Calvados Digestive Cancer Registry, Centre Hospitalier Universitaire, Caen, France; 7Prevention Division, Center for Public Health Sciences, National Cancer Center, Tokyo, Japan; 8Manche General Cancer Registry, Centre Hospitalier Public du Cotentin, Cherbourg-en-Cotentin, France; 9Calvados General Cancer Registry, Centre François Baclesse, Caen, France Background: Describing the relationship between socioeconomic inequalities and cancer survival is important but methodologically challenging. We propose guidelines for addressing these challenges and illustrate their implementation on French population-based data. Methods: We analyzed 17 cancers. Socioeconomic deprivation was measured by an ecological measure, the European Deprivation Index (EDI. The Excess Mortality Hazard (EMH, ie, the mortality hazard among cancer patients after accounting for other causes of death, was modeled using a flexible parametric model, allowing for nonlinear and/or time-dependent association between the EDI and the EMH. The model included a cluster-specific random effect to deal with the hierarchical structure of the data. Results: We reported the conventional age-standardized net survival (ASNS

  6. Rahvusvahelise Õiguse Assotsiatsiooni aastakoosolek / Robert Nelson

    Index Scriptorium Estoniae

    Nelson, Robert

    1986-01-01

    Nõukogude Rahvusvahelise Õiguse Assatsiooni 29. aastakoosolek toimus Moskvas. Rein Müllerson esines ettekandega "Rahvusvaheline avalik ja rahvusvaheline eraõigus, nende vahekord ning vastastikune mõju"

  7. Kuidas kaasajal mõtestada rahvuslust? / ref. Urmi Reinde

    Index Scriptorium Estoniae

    2008-01-01

    Keskerakonna noortekogu korraldatud konverentsil "Kuidas kaasajal mõtestada rahvuslust?" peetud ettekannete refereeringud: Edgar Savisaar, Leif Kalev, Ahto Lobjakas, Indrek Neivelt, Iris Pettai, Andrei Hvostov, Rein Ruutsoo

  8. Pop / Tõnu Kaalep

    Index Scriptorium Estoniae

    Kaalep, Tõnu, 1966-2018

    2005-01-01

    Heliplaatidest: Olav Ehala "Armastatud laulud", Rein Rannap "Tantsib klaveril", Annie "Anniemal", Freeform Five "Strangest Things", Handsome Boy Modeling School "White People", Def Räädu "Planet Duckrabbit"

  9. Nostalgia Pühajärve kaldal / Paavo Kangur

    Index Scriptorium Estoniae

    Kangur, Paavo, 1966-

    2006-01-01

    Edgar Savisaare kunagise üleminekuvalitsuse ministrite kohtumisest Pühajärvel. Vt. samas: Eksriigiministri Raivo Vare toost; Eksmajandusministri Jaak Leimanni anekdoot naistest; Eksharidusminister Rein Loik arvab. Fotod

  10. Tüli õhus / Mihkel Kärmas, Argo Ideon

    Index Scriptorium Estoniae

    Kärmas, Mihkel, 1974-

    2006-01-01

    Lennuameti lennuohutuse eest vastutava asedirektori Rein Porro arvates soovib majandus- ja kommunikatsiooniministeerium temast vabaneda, vastasseisu põhjustest, vastastikustest süüdistustest. Lisa: Porrode lennudünastia

  11. Unustamatu aasta 1988 / ref. Urmi Reinde

    Index Scriptorium Estoniae

    2008-01-01

    Rahvarinde 20. aastapäevale pühendatud konverentsil peetud ettekannete referaadid: Rein Ruutsoo, Dainis Ivans, Kazimiera Danute Prunskiene, Juri Afanasjev, Edgar Savisaar, Kazimieras Motieka, Kauko Sipponen

  12. Justiitsminister Langi umbusaldamine kogub hoogu / Tuuli Koch; kommenteerinud Andrus Ansip, AIn Seppik, Valdur Lahtvee, Karel Rüütli, Andres Herkel, Sven Mikser

    Index Scriptorium Estoniae

    Koch, Tuuli

    2009-01-01

    Reformierakonna valitsuspartner IRL ja opositsioon ei mõista justiitsminister Rein Langi otsust ajutise siseministrina kustutada küberrünnakuga seotud Sergei Markovi nimi Schengeni mustast nimekirjast

  13. [Runoff loss of soil mineral nitrogen and its relationship with grass coverage on Loess slope land].

    Science.gov (United States)

    Zhang, Yali; Li, Huai'en; Zhang, Xingchang; Xiao, Bo

    2006-12-01

    In a simulated rainfall experiment on Loess slope land, this paper determined the rainfall, surface runoff and the effective depth of interaction (EDI) between rainfall and soil mineral nitrogen, and studied the effects of grass coverage on the EDI and the runoff loss of soil mineral nitrogen. The results showed that with the increase of EDI, soil nitrogen in deeper layers could be released into surface runoff through dissolution and desorption. The higher the grass coverage, the deeper the EDI was. Grass coverage promoted the interaction between surface runoff and surface soil. On the slope land with 60%, 80% and 100% of grass coverage, the mean content of runoff mineral nitrogen increased by 34.52%, 32.67% and 6.00%, while surface runoff decreased by 4.72%, 9.84% and 12.89%, and eroded sediment decreased by 83.55%, 87.11% and 89.01%, respectively, compared with bare slope land. The total runoff loss of soil mineral nitrogen on the lands with 60%, 80%, and 100% of grass coverage was 95.73%, 109.04%, and 84.05% of that on bare land, respectively. Grass cover had dual effects on the surface runoff of soil mineral nitrogen. On one hand, it enhanced the influx of soil mineral nitrogen to surface runoff, and on the other hand, it markedly decreased the runoff, resulting in the decrease of soil mineral nitrogen loss through runoff and sediment. These two distinct factors codetermined the total runoff loss of soil mineral nitrogen.

  14. Determination of total vanadium and vanadium(V) in groundwater from Mt. Etna and estimate of daily intake of vanadium(V) through drinking water.

    Science.gov (United States)

    Arena, Giovanni; Copat, Chiara; Dimartino, Angela; Grasso, Alfina; Fallico, Roberto; Sciacca, Salvatore; Fiore, Maria; Ferrante, Margherita

    2015-06-01

    Vanadium(V) can be found in natural waters in the form of V(IV) and V(V) species, which have different biological properties and toxicity. The purpose of this study was to determine the concentrations of total V and V(V) in groundwater from the area of Mt. Etna and to assess the estimated daily intake (EDI) of V(V) of adults and children through drinking water. Water was sampled monthly at 21 sites in 2011. Total vanadium was determined by inductively coupled plasma-mass spectrometry (ICP-MS) and speciation by ion chromatography-ICP-MS (IC-ICP-MS). The concentration of V(V) species ranged from 62.8 to 98.9% of total V, with significantly higher concentrations in samples from the S/SW slope of Mt. Etna. The annual mean concentrations of total V exceeded the Italian legal limit of 140 μg/L at four sites on the S/SW slope. In the absence of thresholds for V(V) intake, only the Environmental Protection Agency (EPA) has calculated a reference dose. Children's EDI of V(V) at the sites with the higher V concentrations exceeded EPA thresholds (9 μg/kg/day). In particular, we found in Camporotondo, Mascalucia, Ragalna and San Pietro Clarenza sites children's EDIs of 11, 9.3, 11 and 9.9, respectively. The EDI of V(V) was significantly higher than the literature range (0.09-0.34 μg/kg/day).

  15. Aeg on hakata parke ja platse arukalt täis ehitama / Tõnu Kann

    Index Scriptorium Estoniae

    Kann, Tõnu, 1957-

    2005-01-01

    Pärnu linnavalitsuse planeerimisosakonna 1996. aasta kesklinna arengu ideekavandist, tühjade kvartalinurkade täisehitamisest, vanade tänavajoonte taastamisest. Kommenteerivad Tõnu Kann ja arhitekt Rein Raie

  16. Erakondade vastused küsimusele : kuidas defineeriksite maaelu?

    Index Scriptorium Estoniae

    2011-01-01

    Vastavad erakondade esindajad: Helir-Valdor Seeder (IRL), Arvo Sarapuu (Keskerakond), Aleksei Lotman (Eestimaa Rohelised), Jaanus Marrandi (Sotsiaaldemokraatlik Erakond), Jaan Sõrra (Sotsiaaldemokraatlik Erakond), Rein Aidma (Reformierakond), Arvo Sirendi (Rahvaliit)

  17. Kilplased saavad eesti filmi juubeliaastaks kilbi läikima / Erik Müürsepp

    Index Scriptorium Estoniae

    Müürsepp, Erik

    2010-01-01

    Tallinnfilm plaanib 2010. aasta jooksul juubeliprogrammi "Eesti film 100" raames digiteerida ning taastada pildi ja heli kolmel Rein Raamatu joonisfilmil: "Kilplased" (1974), "Suur Tõll" (1980) ja "Põrgu" (1983)

  18. 'Bad boys'' Bodies

    DEFF Research Database (Denmark)

    Skårderud, Finn; Nygren, Pär; Edlund, Birgitta

    2005-01-01

    (n= 196) completed the Eating Disorders Inventory ? Child version (EDI-C). The childcare residents also completed an extended questionnaire, including questions regarding the use of anabolic?andro-genic steroids. Our main ?ndings were high scores on EDI-C symptom scales for boys in the childcare...... resident group; few differences between girls in the two samples; and a high frequency of having used anabolic?androgenic steroids among boys in care. Body-image problems among boys have hitherto been given little attention. The results call for increased efforts in describing and detecting patho...

  19. Singularidades en ecuaciones diferenciales implícitas: aplicaciones a circuitos eléctricos

    OpenAIRE

    Kleiman, Diana

    2015-01-01

    El objetivo principal de esta tesis es aplicar resultados de la teoría de EDIs al análisis de distintos modelos de circuitos eléctricos. Dentro de estos modelos existen redes eléctricas lineales y no lineales. Para el caso de los circuitos lineales, se ha desarrollado una amplia teoría vinculada a las EDIs lineales que puede utilizarse para su estudio. En cambio, cuando se trabaja con circuitos no lineales, particularmente, en el estudio de cierto tipo de singularidades que aparecen en ellos,...

  20. Dos novelas colombianas olvidadas

    Directory of Open Access Journals (Sweden)

    Eduardo García Piedrahita

    1980-06-01

    Full Text Available Estas dos novelas olvidadas llevan por títulos Pax de don Lorenzo Marroquín (pr. edi. 1907, y Diana Cazadora de don Clímaco Soto Borda(pr. edi. 1917, ambos bogotanos aunque de disímiles estirpes literarias; y como tales en sus obras fluyen física y verbalmente, el ambiente de su ciudad natal; espíritu hecho de zumbona crítica, individualismo cáustico y solapada parodia de usos y costumbres. Y sobre tales bases sentimentales y estilísticas debe considerárselas.

  1. Confiabilidad de la detección de problemas de desarrollo mediante el semáforo de la prueba de Evaluación del Desarrollo Infantil: ¿es diferente un resultado amarillo de uno rojo?

    OpenAIRE

    Rizzoli-Córdoba, Antonio; Ortega-Ríosvelasco, Fernando; Villasís-Keever, Miguel Ángel; Pizarro-Castellanos, Mariel; Buenrostro-Márquez, Guillermo; Aceves-Villagrán, Daniel; O'Shea-Cuevas, Gabriel; Muñoz-Hernández, Onofre

    2014-01-01

    Introducción: La prueba Evaluación del Desarrollo Infantil (EDI) es un instrumento de tamizaje de problemas en el desarrollo diseñado y validado en México. La calificación obtenida se expresa como semáforo. Se consideran positivos tanto el resultado amarillo como el rojo, aunque se plantea una intervención diferente para cada uno. El objetivo de este trabajo fue evaluar la capacidad de la prueba EDI para discriminar entre los niños identificados con semáforo amarillo y los identificados con r...

  2. Guia de receitas brasileiras: uma saborosa viagem pela literatura

    OpenAIRE

    Santos, Denísia Moraes dos

    2011-01-01

    Esta dissertação tem por objetivo compreender, sob o ponto de vista da Análise Dialógica do Discurso, o processo de construção dos sentidos em Guia de receitas brasileiras ─ texto premiado na primeira edição do Concurso Cultural Viagem Nestlé pela Literatura (1999). Com o tema A literatura e a vida nos 500 anos de Brasil , essa edição desafiou alunos e professores a produzir um intertexto literário-cultural, utilizando cinco obras da literatura brasileira ─ Cronistas do Descobrim...

  3. THE REST-FRAME OPTICAL LUMINOSITY FUNCTION OF CLUSTER GALAXIES AT z < 0.8 AND THE ASSEMBLY OF THE CLUSTER RED SEQUENCE

    International Nuclear Information System (INIS)

    Rudnick, Gregory; Von der Linden, Anja; De Lucia, Gabriella; White, Simon; Pello, Roser; Aragon-Salamanca, Alfonso; Marchesini, Danilo; Clowe, Douglas; Halliday, Claire; Jablonka, Pascale; Milvang-Jensen, Bo; Poggianti, Bianca; Saglia, Roberto; Simard, Luc; Zaritsky, Dennis

    2009-01-01

    We present the rest-frame optical luminosity function (LF) of red-sequence galaxies in 16 clusters at 0.4 < z < 0.8 drawn from the ESO Distant Cluster Survey (EDisCS). We compare our clusters to an analogous sample from the Sloan Digital Sky Survey (SDSS) and match the EDisCS clusters to their most likely descendants. We measure all LFs down to M ∼ M * + (2.5-3.5). At z < 0.8, the bright end of the LF is consistent with passive evolution but there is a significant buildup of the faint end of the red sequence toward lower redshift. There is a weak dependence of the LF on cluster velocity dispersion for EDisCS but no such dependence for the SDSS clusters. We find tentative evidence that red-sequence galaxies brighter than a threshold magnitude are already in place, and that this threshold evolves to fainter magnitudes toward lower redshifts. We compare the EDisCS LFs with the LF of coeval red-sequence galaxies in the field and find that the bright end of the LFs agree. However, relative to the number of bright red galaxies, the field has more faint red galaxies than clusters at 0.6 < z < 0.8 but fewer at 0.4 < z < 0.6, implying differential evolution. We compare the total light in the EDisCS cluster red sequences to the total red-sequence light in our SDSS cluster sample. Clusters at 0.4 < z < 0.8 must increase their luminosity on the red sequence (and therefore stellar mass in red galaxies) by a factor of 1-3 by z = 0. The necessary processes that add mass to the red sequence in clusters predict local clusters that are overluminous as compared to those observed in the SDSS. The predicted cluster luminosities can be reconciled with observed local cluster luminosities by combining multiple previously known effects.

  4. Zdess dõshite, zdess ne dõshite / Lidia Iljina

    Index Scriptorium Estoniae

    Iljina, Lidia

    2006-01-01

    Tuntud politoloog Rein Taagepera tegi ettepaneku, et presidendikandidaadid läbiksid kohustuslikus korras arstliku läbivaatluse. Arvamused Toivo Tootsenilt, Liina Tõnissonilt ja psühholoog Jüri Ennetilt

  5. Nokia üllatas tulemustega analüütikuid ja saatis aktsia rallile / Annika Matson, Lauri Matsulevitsh

    Index Scriptorium Estoniae

    Matson, Annika, 1976-

    2005-01-01

    Mobiiltelefonitootja Nokia majandustulemustest esimeses kvartalis ning teise kvartali prognoosidest. Diagramm: Tulemuste peale võttis Nokia taas suuna üles. Vt. samas: Rein Küttim on Nokiaga kaubelnud pikemat aega

  6. Plaadid / Margit Tõnson

    Index Scriptorium Estoniae

    Tõnson, Margit, 1978-

    2005-01-01

    Uutest heliplaatidest Metro Luminal "Reboot", Rannap, Rein "Tantsib klaveril", Hüpnosaurus "Lint nr 33", Eminem "Encore", Marianne Faithfull "Before the Poision", Aerosmith "You Gotta move", Evanescence "Anywhwre but Home"

  7. Tundkem maailma kultuurilugu Amazonasest Mongooliani! / Laur Kiik

    Index Scriptorium Estoniae

    Kiik, Laur, 1987-

    2007-01-01

    Lääne-keskselt ajaloolt ja kultuuriloolt tuleks liikuda maailmakeskse ajaloo-, ühiskonna- ja kultuuriõppeni. Noorte sotsiaaldemokraatide poolt korraldatud maailmakultuuri koolitusel "Ilmaviis" esines ka TLÜ rektor Rein Raud

  8. Tallinna-Berliini raudteeprojekt valmimas / Toivo Tänavsuu

    Index Scriptorium Estoniae

    Tänavsuu, Toivo

    2002-01-01

    Saksa konsultatsioonifirmas PLANCO Consulting GmbH on valmimas Tallinna-Berliini kiirraudteeprojekti Rail Baltica eeluuring. Majandus- ja kommunikatsiooniministeeriumi peaspetsialisti Rein Lõokese kommentaare. Kaart. Poole ööpäevaga Berliini

  9. Center, Reform parties access government / Aleksei Gunter

    Index Scriptorium Estoniae

    Gunter, Aleksei, 1979-

    2004-01-01

    Keskerakonna ja Reformierakonna valitsuse ametisseastumise aastapäeva konverentsil esinesid kõnedega Edgar Savisaar ja Siim Kallas. Politoloog Rein Toomla tutvustas parlamendierakondade põhjal tehtud uurimust erakondade sobivusest koalitsiooni

  10. Vetshera estonskogo iskusstva / Ruta Pels

    Index Scriptorium Estoniae

    Pels, Ruta, 1960-

    2001-01-01

    Eesti kunsti õhtutest Suurbritannia saadiku residentsis Tallinnnas, partneriks La Galerie Passage. Iga kuu muutuvas kunstikollektsioonis olevatest eesti kunstnike töödest (Rein Tammik, Malle Leis, Sandra Jõgeva jt.)

  11. Padenije Res Publica / Viktoria Jürmann

    Index Scriptorium Estoniae

    Jürmann, Viktoria

    2005-01-01

    Res Publica üks rajajatest, Rein Taagepera, lahkus parteist, süüdistades erakonda paremtsentristlikust maailmavaatest loobumises. Res Publica Riigikogu fraktsioon tahab avaldada umbusaldust haridus- ja teadusminister Mailis Repsile

  12. Draamateatri direktor selgub kolme väljavalitu seast / Tambet Kaugema

    Index Scriptorium Estoniae

    Kaugema, Tambet

    1999-01-01

    Eesti Draamateatri direktori ametikoha täitmiseks moodustatud komisjonile esitas personaliotsingufirma Fontes kolm kandidaati - Estonia turundusjuhi Tiit Lauri, ENA tegevdirektori Külli Holstingi ja eraettevõtluses tegutseva Rein Kirsi

  13. Presidentti Toomas Hendrik Ilves arvostelee HS:n Viro-uutisointia / Kaja Kunnas

    Index Scriptorium Estoniae

    Kunnas, Kaja

    2011-01-01

    President Toomas Hendrik Ilvese väljendatud kriitikast ajalehe Helsingin Sanomat suhtes. Ajalehe Diplomaatia peatoimetaja Iivi Anna Masso ja kultuuriminister Rein Lang on samuti kritiseerinud Eesti kajastamist Soome meedias

  14. Pommisatelliit Eesti kohal / Peep Pedmanson

    Index Scriptorium Estoniae

    Pedmanson, Peep, 1963-

    1997-01-01

    Discovery Channel Europe presenteeris Pirital toimunud telemessil videofilmi "Profid. Pommirühm" ("Professionals : Bomb Squad"), stsenarist, režissöör ja operaator Rein Kotov : Inglismaa - Eesti - Taani 1997

  15. Is Electronic Privacy Achievable?

    National Research Council Canada - National Science Library

    Irvine, Cynthia E; Levin, Timothy E

    2000-01-01

    ... individuals. The purpose of this panel was to focus on how new technologies are affecting privacy. Technologies that might adversely affect privacy were identified by Rein Turn at previous symposia...

  16. Ambitsioonikas terviktõlgendus Eesti Suure murrangu kohta / Risto Alapuro ; tõlk. A. L.

    Index Scriptorium Estoniae

    Alapuro, Risto

    2004-01-01

    Rets. rmt.: Ruutsoo, Rein. Civil society and Nation Building in Estonia and the Baltic States : impact of traditions on mobilization and transition 1986-2000 - Historical and Sociological Study. Rovaniemi, 2002

  17. Tõsimeelne miljonimees / Gert D Hankewitz

    Index Scriptorium Estoniae

    Hankewitz, Gert D

    2007-01-01

    Silikaat Grupi nõukogu esimehest Vello Kunmanist. Kommenteerivad: Juhan Kolk, Urmas Sõõrumaa, Aivar Reivik, Rein Trei. Lisa: Vello Kunman; Tasub teada. Vt. samas: Kuidas telliskivide ja piimani jõuti

  18. Miks ekspordib Hiina Venemaale läbi Tallinna? / interv. Mihkel Kärmas

    Index Scriptorium Estoniae

    2005-01-01

    Hiina suured kaubalennukid veavad Venemaale kaupu läbi Tallinna lennujaama. Lühiintervjuu Tallinna tolliinspektuuri kontrolltalituse juhataja Peeter Kõve, lennujaama turundusdirektori Eduard Tüüri ja lennuameti asedirektori Rein Porroga

  19. Sissevaade kunstiilma / Riin Kübarsepp

    Index Scriptorium Estoniae

    Kübarsepp, Riin, 1978-

    2010-01-01

    Rein Raamatu dokumentaalfilmidest "Jaan Manitski tagasitulek" (stsenarist Jaan Kruusvall), "Armsad idealistid Signe ja Arseni Mölder" (stsenarist Juta Kivimäe) ning "Inge Tederi maailm" (stsenarist Juta Kivimäe)

  20. Inpatient Treatment for Adolescents with Anorexia Nervosa: Clinical Significance and Predictors of Treatment Outcome.

    Science.gov (United States)

    Schlegl, Sandra; Diedrich, Alice; Neumayr, Christina; Fumi, Markus; Naab, Silke; Voderholzer, Ulrich

    2016-05-01

    This study evaluated the clinical significance as well as predictors of outcome for adolescents with severe anorexia nervosa (AN) treated in an inpatient setting. Body mass index (BMI), eating disorder (ED) symptoms [Eating Disorder Inventory-2 (EDI-2)], general psychopathology and depression were assessed in 238 patients at admission and discharge. BMI increased from 14.8 + 1.2 to 17.3 + 1.4 kg/m(2). Almost a fourth (23.6%) of the patients showed reliable changes, and 44.7% showed clinically significant changes (EDI-2). BMI change did not significantly differ between those with reliable or clinically significant change or no reliable change in EDI-2. Length of stay, depression and body dissatisfaction were negative predictors of a clinically significant change. Inpatient treatment is effective in about two thirds of adolescents with AN and should be considered when outpatient treatment fails. About one third of patients showed significant weight gain, but did not improve regarding overall ED symptomatology. Future studies should focus on treatment strategies for non-responders. Copyright © 2015 John Wiley & Sons, Ltd and Eating Disorders Association.

  1. Early-onset restrictive eating disturbances in primary school boys and girls.

    Science.gov (United States)

    Kurz, Susanne; van Dyck, Zoé; Dremmel, Daniela; Munsch, Simone; Hilbert, Anja

    2015-07-01

    This study sought to determine the distribution of early-onset restrictive eating disturbances characteristic of the new DSM-5 diagnosis, avoidant/restrictive food intake disorder (ARFID) in middle childhood, as well as to evaluate the screening instrument, Eating Disturbances in Youth-Questionnaire (EDY-Q). A total of 1,444 8- to 13-year-old children were screened in regular schools (3rd to 6th grade) in Switzerland using the self-report measure EDY-Q, consisting of 12 items based on the DSM-5 criteria for ARFID. 46 children (3.2%) reported features of ARFID in the self-rating. Group differences were found for body mass index, with underweight children reporting features of ARFID more often than normal and overweight children. The EDY-Q revealed good psychometric properties, including adequate discriminant and convergent validity. Early-onset restrictive eating disturbances are commonly reported in middle childhood. Because of possible negative short- and long-term impact, early detection is essential. Further studies with structured interviews and parent reports are needed to confirm this study's findings.

  2. Age at menarche and digit ratio (2D:4D): relationships with body dissatisfaction, drive for thinness, and bulimia symptoms in women.

    Science.gov (United States)

    Oinonen, Kirsten A; Bird, Jessica L

    2012-03-01

    This study examined the hypothesis that lower prenatal androgen exposure and earlier puberty are associated with more dysfunctional eating attitudes and behaviors. Relationships between both age at menarche (AAM) and 2D:4D (a marker of prenatal androgen exposure), and EDI-2-Body Dissatisfaction, EDI-2-Drive for Thinness, and EDI-2-Bulimia scores, were examined in women using correlations and regressions. Earlier menarche was associated with higher drive for thinness after controlling for BMI and negative affect, but only in women who were not exclusively heterosexual. Higher 2D:4D was associated with higher Bulimia and Body Dissatisfaction scores, but only in exclusively heterosexual women, and relationships disappeared when covariates were controlled. Later AAM and higher 2D:4D were unique predictors of higher Bulimia scores for exclusive heterosexuals when BMI was controlled. These findings suggest future research should examine sexual orientation as a mediator or moderator of prenatal and postnatal organizational hormonal effects on women's disordered eating attitudes and behaviors. Copyright © 2011 Elsevier Ltd. All rights reserved.

  3. Embodiment Mediates the Relationship between Avoidant Attachment and Eating Disorder Psychopathology.

    Science.gov (United States)

    Monteleone, Alessio Maria; Castellini, Giovanni; Ricca, Valdo; Volpe, Umberto; De Riso, Francesco; Nigro, Massimiliano; Zamponi, Francesco; Mancini, Milena; Stanghellini, Giovanni; Monteleone, Palmiero; Treasure, Janet; Maj, Mario

    2017-11-01

    The overvaluation of body shape and weight of persons with eating disorders (EDs) is putatively explained by a disturbance in the way they experience their own body (embodiment). Moreover, attachment disorders seem to promote the use of body as source for self-definition. Therefore, we assessed the role of embodiment in the connection between attachment styles and ED psychopathology. One-hundred and thirteen ED patients and 117 healthy subjects completed the Identity and Eating Disorders (IDEA) Questionnaire, the Eating Disorder Inventory-2 (EDI-2) and the Experiences in Close Relationships Scale. Eating disorder patients displayed IDEA, EDI-2 and Experiences in Close Relationships scores significantly higher than controls. IDEA total and subtotal scores mediated entirely the influence of avoidant attachment on EDI-2 interoceptive awareness and impulsivity. These findings demonstrate a relationship between insecure attachment and disorders of identity and embodiment and point to embodiment as a possible mediator between avoidant attachment and specific ED psychopathological traits. Copyright © 2017 John Wiley & Sons, Ltd and Eating Disorders Association. Copyright © 2017 John Wiley & Sons, Ltd and Eating Disorders Association.

  4. Food survey: levels and potential health risks of chromium, lead, zinc and copper content in fruits and vegetables consumed in Algeria.

    Science.gov (United States)

    Cherfi, Abdelhamid; Abdoun, Samira; Gaci, Ouardia

    2014-08-01

    A food survey was carried out with the aim to investigate the levels of lead (Pb), zinc (Zn), copper (Cu) and chromium (Cr) in various fruits and vegetables sold in Algeria. Concentrations (mg/kgdry wt.) in selected foodstuffs were detected within the following ranges: 4-29.49, 11.17-49, 12.33-39.33 and 3-16.33 for Cu, Zn, Pb and Cr respectively. The food ingestion rate of the selected items was investigated by self-administered questionnaires which were filled by a total of 843 people randomly recruited at the exit of markets. The potential health risk for consumers was investigated by estimating the daily intake (EDI) and the target hazard quotient (THQ) for each heavy metal. For all foodstuffs, the EDI and the THQ were below the threshold values for Cu, Zn and Cr while they exceeded the thresholds for Pb (EDI: 15.66μgPb/kg body weight/day; THQ: 4.37), indicating an obvious health risk over a life time of exposure. Copyright © 2014 Elsevier Ltd. All rights reserved.

  5. Serial single molecule electron diffraction imaging: diffraction background of superfluid helium droplets

    Science.gov (United States)

    Zhang, Jie; He, Yunteng; Lei, Lei; Alghamdi, Maha; Oswalt, Andrew; Kong, Wei

    2017-08-01

    In an effort to solve the crystallization problem in crystallography, we have been engaged in developing a method termed "serial single molecule electron diffraction imaging" (SS-EDI). The unique features of SS-EDI are superfluid helium droplet cooling and field-induced orientation: together the two features constitute a molecular goniometer. Unfortunately, the helium atoms surrounding the sample molecule also contribute to a diffraction background. In this report, we analyze the properties of a superfluid helium droplet beam and its doping statistics, and demonstrate the feasibility of overcoming the background issue by using the velocity slip phenomenon of a pulsed droplet beam. Electron diffraction profiles and pair correlation functions of ferrocene-monomer-doped droplets and iodine-nanocluster-doped droplets are presented. The timing of the pulsed electron gun and the effective doping efficiency under different dopant pressures can both be controlled for size selection. This work clears any doubt of the effectiveness of superfluid helium droplets in SS-EDI, thereby advancing the effort in demonstrating the "proof-of-concept" one step further.

  6. Monitoring and risk assessment of pesticides in fresh omija (Schizandra chinensis Baillon) fruit and juice.

    Science.gov (United States)

    Jeong, Hye Ran; Lim, Sung Jin; Cho, Jae Young

    2012-02-01

    Schizandra chinensis Baillon, or omija, is a fruit native to northeast Asia that is cultivated in South Korea and China. Fresh omija fruit has been used in beverages, traditional East Asian medicine and cosmetics because of its complex flavor and pharmacological effectiveness. The objective of this study was to analyze residue levels of 33 kinds of pesticides on fresh omija fruits and in omija juices produced in South Korea. A risk assessment of the pesticides in omija juice was conducted by calculating EDI and ADI. Most of the pesticide levels were below the LOD in fresh omija fruits. Among the detected compounds, the most frequently detected pesticide was ethoprophos. The EDIs of ethoprophos, pendimethalin and hexaconazole were 5.89E-03, 7.08E-04 and 4.73E-05, respectively. The percent of EDI to ADI of ethoprophos, pendimethalin and hexaconazole was 28.0%, 13.6% and 4.5%, respectively. The results of this research concluded that the detected pesticides are not harmful to human beings. Published by Elsevier Ltd.

  7. Kanada eestlasele Marcus Kolgale CEMA auhind / Jaan Ruus

    Index Scriptorium Estoniae

    Ruus, Jaan, 1938-2017

    2007-01-01

    Kanada Etnilise Meedia Assotsiatsiooni (CEMA) telefilmipreemia sai dokumentaalfilm eestlase Eduard Kolga saatusest Teises Maailmasõjas "Gulag 113" : režissöör Marcus Kolga : operaator Rein Kotov : Eesti - Kanada 2005

  8. Литература как способ самопознания в "другом" / Ирина Белобровцева

    Index Scriptorium Estoniae

    Белобровцева, Ирина, 1946-

    2001-01-01

    Eesti ja vene kogukondade vahelise dialoogi olulisest aspektist : dialoogi toimumise teoreetilisest võimalusest ja nende praktilisest realiseerumisest kirjanduses. Vene teemast Enn Vetemaa, Rein Saluri, Jaan Unduski ja Ülo Tuuliku loomingus

  9. Pillide kuningannal oma fond / Eda Liiväär

    Index Scriptorium Estoniae

    Liiväär, Eda

    2006-01-01

    Eesti Rahvuskultuuri Fondi allfondi - Eesti Klaverifondi avamise tähistamisest disainklaverite näituse ja Rein Rannapi kontserdiga 8. juunil Viru keskuses. OÜ Reval Piano poolt loodud sihtasutusest Eesti Rahvuslik Klaverimuuseum

  10. Seltskond / Annika Haas

    Index Scriptorium Estoniae

    Haas, Annika

    2006-01-01

    Tallinna Ülikoolis toimunud ameerika kultuurantropoloogi Clifford Geertzi mälestusõhtust, kus esinesid rektor Rein Raud, Eesti Humanitaarinstituudi dotsent Lorenzo Cañás Bottos ja kultuuriteooria lektor Marek Tamm

  11. Kultuurantropoloog Clifford Geertzi mälestusõhtu

    Index Scriptorium Estoniae

    2006-01-01

    Tallinna Ülikoolis peetakse homme Ameerika kultuurantropoloogi Clifford Geertzi mälestusõhtut, esinevad rektor Rein Raud, Eesti Humanitaarinstituudi dotsent Lorenzo Cañás Bottos ja kultuuriteooria lektor Marek Tamm

  12. Erakondade vastused küsimusele : kes peab vastutama Eestimaa ääremaastumise eest?

    Index Scriptorium Estoniae

    2011-01-01

    Vastavad erakondade esindajad: Helir-Valdor Seeder (IRL), Ester Tuiksoo (Keskerakond), Arvo Sarapuu (Keskerakond), Aleksei Lotman (Eestimaa Rohelised), Jaanus Marrandi (Sotsiaaldemokraatlik Erakond), Jaan Sõrra (Sotsiaaldemokraatlik Erakond), Rein Aidma (Reformierakond), Arvo Sirendi (Rahvaliit)

  13. [Aire Veskimäe (toim.). Rahvarinne 1988 : (kakskümmend aastat hiljem)] / Heikki Rausmaa

    Index Scriptorium Estoniae

    Rausmaa, Heikki

    2009-01-01

    Tutvustus: Rahvarinne 1988 : (kakskümmend aastat hiljem) / Edgar Savisaar, Rein Ruutsoo, Kadri Simson ... [jt. ; toimetaja Aire Veskimäe ; eessõna: Raimond Kaljulaid ; kujundus: Sergei Didyk]. Tallinn : Tallinna Linnavalitsus, 2008

  14. Maffia, hullus ja Sannikovi maa / Vaapo Vaher

    Index Scriptorium Estoniae

    Vaher, Vaapo, 1945-

    2011-01-01

    Arvustus: Roberts, Gregory David. Shantaram. 1.-2. raamat / tõlkinud Riina Jesmin. Tallinn : Varrak, 2011 ; Akutagawa, Ryūnosuke. Mandariinid tihnikus. Tallinn : Varrak, 2011 ; Põder, Rein. Kauge. Tallinn : Eesti Raamat, 2011

  15. Kolm noort said majandusteadlase stipendiumi / Annika Poldre

    Index Scriptorium Estoniae

    Poldre, Annika

    2007-01-01

    Sihtasutuse Rein Otsasoni Fond noorte majandusteadlaste stipendiumid said Tallinna tehnikaülikooli majandusteaduskonna doktorandid Jelena Hartshenko ja Aaro Hazak ning Tartu ülikooli majandusteaduskonna magistriõppe üliõpilane Mark Kantshukov

  16. Eestlased võitsid enim kuldseid haamreid / Hando Sinisalu

    Index Scriptorium Estoniae

    Sinisalu, Hando, 1970-

    2004-01-01

    Riia rahvusvaheline Baltikumi reklaamifestival Golden Hammer. Festivali taset kommenteerivad žürii esimees Peeter Kandimaa ja žürii liige Rein Iida Eestist ning žürii liige Aleksei Golikov Venemaalt

  17. Kodaniku kohus on maksta makse / Märt Kubo

    Index Scriptorium Estoniae

    Kubo, Märt

    2002-01-01

    Dokumentaalfilm "Kodanik - riigi alus" : autor ja produtsent Rein Hanson : režissöörid Tambet Tasuja ja Marko Piirsoo : operaator Priit Murusalu : helilooja Olav Ehala : Läänemaa Telestuudio 2000

  18. ORF Alignment: NC_005090 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available ... succinogenes] ... Length = 120 ... Query: 6 ... FDPLRDLKEIERRFLTPFGEGGEGGAKSNLRGFAPVVNTREEEKGYFIEVD...LPGVQKEDI 65 ... FDPLRDLKEIERRFLTPFGEGGEGGAKSNLRGFAPVVNTREEEKGYFIEVDLPGVQK...EDI Sbjct: 1 ... FDPLRDLKEIERRFLTPFGEGGEGGAKSNLRGFAPVVNTREEEKGYFIEVDLPGVQKEDI 60 ...

  19. Sustainable Regulation of Information Sharing with Electronic Data Interchange by a Trust-Embedded Contract

    Directory of Open Access Journals (Sweden)

    Guanghua Han

    2017-06-01

    Full Text Available This paper studies the risks in demand information sharing applications by electronic soft-orders using electronic data interchange (EDI systems in e-commerce and aims to suggest a sustainable regulation mechanism with a trust-embedded contract. In a supply chain with one retailer and one supplier, the retailer solicits private forecasted demand and places soft-orders via EDI to the supplier. To ensure abundant supply, the retailer has an incentive to inflate her soft-orders, which potentially harms the credible information sharing and sustainability of business cooperation. Normally, the degree to which the supplier relies on the retailer’s order information is specified by trust, which is evaluated according to the retailer’s reputation and supplier’s intuition in this study. Based on standard game theory, we find that both the retailer’s order and the quantity of supplier prepared materials are independent of the retailer’s forecast. Therefore, EDI based information sharing in e-commerce without a regulation mechanism leads to inefficient demand information sharing. Since both the supplier and retailer are proved to faces huge of potential profit losses due to the failure of information sharing, the commerce by EDI based information sharing is full of risk and unsustainable. Therefore, a regulation mechanism that leaded by the retailer is proposed to establish ‘win-win’ sustainable cooperation. Numerical experiments highlight the value of trust, the impact of reputation and intuition in decisions, and the effectiveness of the regulation mechanism by a cost-sharing contract.

  20. The production process of "Étude sur le Rein des Urinaires", doctoral thesis of Joaquin María Albarrán at the Faculty of Medicine in Paris.

    Science.gov (United States)

    Fernández-Arias, M; Otero, I; Pérez-Albacete, M; Fariña, L A; Angulo, J C

    2014-01-01

    The manuscript of the Doctoral Thesis of Joaquín Albarrán in the Faculty of Medicine in Paris "Étudesur le Rein des Urinaires" has been donated to Asociación Española de Urología. Direct comparison of the original and printed material gives information of the production process of this master work. Direct comparison between the original hand-written work, a single hard bound volume covered with loin cloth and water paper composed of 145 numbered pages plus 206 newly numbered pages of clinico-pathological (37 subjects) and experimental (19 assays in 20 rabbits) data, and the printed work edited by Georges Steinheil in 1889. Prints included 4 plates with 14 figures, 9 temperature charts and 5 tables describing urine examinations. Figures were trichromic and charts and tables black & white. Chromolithographs were produced by Mr. Leuba in the printing owned by Lemercier et Cie, Paris. The original work was completed in 1887 without any correction or deletion. Differences are noticeable between the text in the master and printed works: rearrangement of data and inclusion of a new clinical observation, 5 new experiments, summary and dedications. Changes in iconography are noticeable. The masterwork included 24 plates (numbered from 1 to 22, 13bis, 16bis) with 46 figures (44 colored) integrated within the text and 26 double-page temperature registries that accompany clinical observations. Anatomical, histological and microbiological illustrations, including culture media, microbiological stains and histobacteriological preparations were depicted as watercolors (44%), watercolors mixed with pencil or ink (52%) or pencil drawings (4%). Four (9%) were signed by the author, 5 (11%) had numerical annotations and only 14 (30%) were definitely printed with loss of the black component and redrawn of 4/14 (29%) images. The largest images were not printed. Joaquín Albarrán described and beautifully illustrated himself the role "pyogenic bacillus" (E. coli) played in renal

  1. Täidetud aeg / Urmas Petti

    Index Scriptorium Estoniae

    Petti, Urmas, 1965-2016

    2013-01-01

    Usust, lootusest ja armastusest lihavõttepühadele eelneval Suurel nädalal; autor kommenteerib ka Kadri Tüüri, Haruki Murakami (romaanist "Kafka mererannas") ja Rein Raua (romaanist "Vend") mõtteid

  2. Helilooja sõnateatris / Mari Amor

    Index Scriptorium Estoniae

    Amor, Mari, 1973-

    2006-01-01

    Helilooja loodud originaalmuusika kasutamisest eesti sõnateatris, koostööst lavastajaga. Sõnalavastuste muusikalisest kujundusest avaldavad arvamust ka Viive Ernesaks, Ardo Ran Varres, Olav Ehala, Eino Tamberg, Mati Unt ja Rein Agur

  3. Deti vorujut "popsovõh" inoplanetjan / Sergei Semjonov

    Index Scriptorium Estoniae

    Semjonov, Sergei

    2004-01-01

    Eesti Mobiiltelefoni laste POP-kõnekaarti Tallinna prügikastidel reklaamivad posterid on saanud laste kollektsioneerimisobjektiks. Kampaania korraldanud reklaamibüroo Tank eesotsas Rein Ott'iga peab üritust kordaläinuks

  4. Raamatulett / Jaanus Tamm

    Index Scriptorium Estoniae

    Tamm, Jaanus

    1996-01-01

    Põder, Rein. Armastuse hääl; Schmidt, Erik. Pagana eestlane!; Lina, Jüri. Skorpioni märgi all; Nesser, Hõkan, Tagasitulek; Fallada, Hans. Tookord meil isakodus; Fitzgerald, Francis Scott. Suur Gatsby

  5. Jaan Toominga trupp mängib Vanemuise ovaalsaalis

    Index Scriptorium Estoniae

    2006-01-01

    Jaan Toominga näitetrupp Sagar Sagitta luulelavastus "Tähenõid", mille Tooming on kokku pannud eesti luulest koos paari Tagore luuletusega. Lisaks Toomingale osalevad lavastuses Anne Maasik ja Heikki-Rein Veromann

  6. Ekspertiis : ohvrid uppusid / Kristjan Roos

    Index Scriptorium Estoniae

    Roos, Kristjan, 1978-

    2005-01-01

    Kopteriõnnetuses hukkunute surma põhjustas kohtuekspertiisi esialgsetel andmetel uppumine. Kopteriõnnetuse uurimiskomisjoni esimehe Tõnu Aderi, lennuameti asejuhi Rein Porro kommentaare. Vt. samas: Mirjam Roosioja. Ohvrid olid kindlustatud 2 000 000 kroonile

  7. Mis saab Tallinna Polütehnikumist? / Sirje Tohver ; kommenteerib Mati Kask

    Index Scriptorium Estoniae

    Tohver, Sirje, 1948-

    2000-01-01

    Tallinna Polütehnikumi liitmisest Tallinna Kõrgema Tehnikakõrgkooliga. Arvamust avaldavad TPT õppealadirektor Jüri Mickfeldt ja AS Eesti Telefon IP Teenused turundusjuht Avo-Rein Tereping (TPT vilistlane, kooli nõukogu liige)

  8. Spiced: The Global Marketing of Psychoactive Substances

    OpenAIRE

    Graham, John

    2016-01-01

    Graham hopes to expose marketing’s role in sustaining our addiction to sugar, tobacco, and other psychoactive substances and to then inspire a discussion of strategies for reining in that marketing. 

  9. «Recetario de cocina mexicana»: edición semidiplomática y modernizada de un manuscrito inédito del siglo XIX

    OpenAIRE

    Susana Echeverría Echeverría

    2010-01-01

    Resumo: Neste trabalho apresentam-se amostras de edição semidiplomática e modernizada do texto manuscrito inédito intitulado Recetario de cocina mexicana (Mss/23133/15), ca. 1850, que se guarda na Biblioteca Nacional de España, em Madri. Para terminar, acrescenta-se um comentário linguístico sobre alguns aspectos destacáveis do recetuário. Palavras-chave: Crítica textual; edição; manuscrito; cozinha mexicana; século XIX.  Resumen: En este trabajo se presentan muestras de edición semidiplomáti...

  10. Diseño de un modelo de supervisión para la aplicación de la prueba de Evaluación del Desarrollo Infantil en las unidades de atención primaria en México

    OpenAIRE

    Villasís-Keever, Miguel Ángel; Rizzoli-Córdoba, Antonio; Delgado-Ginebra, Ismael; Mares-Serratos, Blanca Berenice; Martell-Valdez, Liliana; Sánchez-Velázquez, Olivia; Reyes-Morales, Hortensia; O'Shea-Cuevas, Gabriel; Aceves-Villagrán, Daniel; Carrasco-Mendoza, Joaquín; Antillón-Ocampo, Fátima Adriana; Villagrán-Muñoz, Víctor Manuel; Halley-Castillo, Elizabeth; Baqueiro-Hernández, César Iván; Pizarro-Castellanos, Mariel

    2015-01-01

    Introducción: La prueba Evaluación del Desarrollo Infantil (EDI), diseñada y validada en México, se ha aplicado en las unidades de atención primaria del país. Los resultados han sido heterogéneos entre los estados en que se aplicaron las pruebas, a pesar de haber utilizado un modelo de capacitación estandarizado con la misma metodología para la aplicación. El objetivo de este trabajo fue evaluar un modelo de supervisión que permita identificar la calidad de la aplicación de la prueba EDI a ni...

  11. NAVA: Nuevo modo de Ventilación

    OpenAIRE

    Martín Lorenzo, María del Carmen; Montón Giménez, Nuria; Paz Martín, Daniel

    2013-01-01

    La Ventilación Asistida Ajustada Neuronalmente (NAVA) es un nuevo modo de Ventilación Mecánica Asistida que utiliza la actividad eléctrica diafragmática (Edi) para el control del respirador. La Edi es registrada a través de un catéter esofágico, y representa directamente el impulso respiratorio central y, por lo tanto, la duración y la intensidad con que el paciente desea ventilar. La asistencia inspiratoria mecánica se inicia en el momento en que el centro respiratorio lo demanda, y el di...

  12. Para uma (re)leitura das Anotações sobre as cores de Wittgenstein

    OpenAIRE

    Salles, João Carlos

    2017-01-01

    As Anotações sobre as cores não têm tido o destaque merecido, pois parecem um conjunto parcialmente amorfo e desconexo, com precária estrutura de conjunto. Isso se deve, em grande medida, ao estado da edição dos textos realizada por G. E. M. Anscombe, que despreza variantes, faz sugestões equivocadas para a datação dos manuscritos, suprime parágrafos (inclusive uma quarta parte), além de ter desfigurado a Parte II, ordenando equivocadamente esses parágrafos. Uma edição bem cuidadaé necessária...

  13. EDI at the Jet Propulsion Laboratory Library

    Science.gov (United States)

    Amago, B.

    1994-01-01

    The JPL Library and Information Center orders and claims material elecronically whenever feasible. The NASA Aerospace Research Information Network (ARIN) is used to order books for the library collection; BIP Plus on CD-ROM is used to order office copies. Paper copies of invoices are processed when material is received. Subscriptions are ordered using the vendor's online system; monthly and annual invoices are received both in paper and electronic format (diskette of FTP). Library-developed dbase programs complement or duplicate functions available through ARIN and/or the JPL institutional accounting system.

  14. Erisused ja elu hind / Rein Tootmaa

    Index Scriptorium Estoniae

    Tootmaa, Rein

    2000-01-01

    IV Pimedate Ööde Filmifestivalil linastunud mängufilmidest : Prantsusmaa "Harry aitab sind" : režissöör Dominik Moll, Jaapani "Tabu" ("Gohatto") : režissöör Nagisha Oshima, Prantsusmaa "Vägista mind" ("Baise-moi") : režissöör Coralie Trinh Thi, Soome "Tundra seitse laulu" : režissöör Markku Lehmuskallio ja Prantsusmaa "Dogma 5 : Armastajad" : režissöör Jean-Marc Barri

  15. Allilma ja pealilma dilemma / Rein Lang

    Index Scriptorium Estoniae

    Lang, Rein, 1957-

    2007-01-01

    Justiitsminister kirjutab organiseeritud kuritegevusest Eestis, toob näiteid riikidest, kus on püütud organiseeritud kuritegevuse abil lahendada oma probleeme ning peab oluliseks, et riigi koostöö sellega peab olema võimatu. Kaitsepolitsei ja keskkriminaalpolitsei tähtsus organiseeritud kuritegevuse kaotamisel

  16. Julge unistada! / Timo Rein, Martin Sookael

    Index Scriptorium Estoniae

    Rein, Timo

    2003-01-01

    Autorid leiavad, et unistuste olemasolu ja unistamine mõjuvad motiveerivalt ning soovitavad lähtudes Dale Garnegiest "elada tänase päeva sektsioonis", mis tähendab unistamist, planeerimist ja tegutsemist ainult tänases päevas.

  17. States Eye Looser Rein on Districts

    Science.gov (United States)

    Jacobson, Linda

    2008-01-01

    The push to give school districts greater operating flexibility--a grassroots rallying cry eclipsed in recent years by the charter school movement--is seeing a resurgence, as states seek to spur innovation that will help raise student achievement. In Georgia, Governor Sonny Perdue is proposing "performance contracts" that would free…

  18. Rahvarinde esimene suurvõit / Rein Ruutsoo

    Index Scriptorium Estoniae

    Ruutsoo, Rein, 1947-

    2008-01-01

    17. juuni 1988 kui poliitilise revolutsiooni algus, mis viis kommunistliku režiimi kokkukukkumiseni. 1988. aasta kronoloogiad vaadates jääb autorile mulje, et Eesti taasvabanemise sisuks oli Alo Mattiiseni laulude esitamise tähe all sinimustvalgete lehvides kulgemine ühest kooslaulmisest teise

  19. Edasi - Juhan Liivi juurde! / Rein Veidemann

    Index Scriptorium Estoniae

    Veidemann, Rein, 1946-

    2008-01-01

    Arvustus: Liiv, Juhan. Tuulehoog lõi vetesse : [luuletused] / koostanud Jüri Talvet. Tallinn : Tänapäev, 2007. (Suur luuleraamat) ; Liiv, Juhan. Meel paremat ei kannata : valik luulet eesti ja inglise keeles = The Mind Would Bear No Better : A Selection of Poetry in Estonian and English / tõlkinud ja koostanud Jüri Talvet. Tartu : Tartu Ülikooli Kirjastus, 2007

  20. Edasi - Juhan Liivi juurde! / Rein Veidemann

    Index Scriptorium Estoniae

    Veidemann, Rein, 1946-

    2008-01-01

    Rets. rmt.: Liiv, Juhan. Tuulehoog lõi vetesse / koost. Jüri Talvet. Tallinn : Tänapäev, 2007; Liiv, Juhan. Meel paremat ei kannata : valik luulet eesti ja inglise keeles = The mind would bear no better : a selection of poetry in Estonian and English / koostanud Jüri Talvet; tõlkinud Jüri Talvet & H. L. Hix. Tartu : Tartu Ülikooli Kirjastus, 2007

  1. Teiseste andmete kasutamine turundusuuringutes / Rein Sirkel

    Index Scriptorium Estoniae

    Sirkel, Rein

    2003-01-01

    Probleemidest, mis kerkivad üles seoses teiseste andmete kasutamisega, teiseste teabeallikate klassifitseerimise süsteemist Eesti tingimustes, teabeallikate praktilise kasutamise võimalustest turundusuuringu läbiviimisel. Skeem

  2. Hasso Krulli eepiline pesamuna / Rein Veidemann

    Index Scriptorium Estoniae

    Veidemann, Rein, 1946-

    2015-01-01

    Eesti Kultuurkapitali aastapreemia laureaat Hasso Krull. Arvustus: Krull, Hasso. Pesa : tekstid 2000-2012. Tallinn : Eesti Keele Sihtasutus, 2014 ; Krull, Hasso. Muna : tekstid 1987-2012. Tallinn : Eesti Keele Sihtasutus, 2014 ; Krull, Hasso. Kui kivid olid veel pehmed. Tallinn : Eesti Keele Sihtasutus, 2014

  3. Mälestus laulvast revolutsioonist / Rein Veidemann

    Index Scriptorium Estoniae

    Veidemann, Rein, 1946-

    2008-01-01

    Rets. rmt. : Vesilind, Priit J. The Singing Revolution : how culture saved a nation / by Priit Vesilind with James and Maureen Tusty, based on their film "The Singing Revolution". Tallinn : Varrak, 2008

  4. Jalgratta leiutamine meie energiapoliitikas? / Rein Hanni

    Index Scriptorium Estoniae

    Hanni, Rein

    2004-01-01

    Autor leiab, et Eesti Energia peaks oma strateegiliste eesmärkide seadmisel lähtuma kütuse ja energiamajanduse pikaajalisest riiklikust arengukavast, mille vastuvõtmisega otsustati vähendada põlevkivienergia kasutamist

  5. Ants Paju exegi monumentum / Rein Veidemann

    Index Scriptorium Estoniae

    Veidemann, Rein, 1946-

    2004-01-01

    13. juunist 20. augustini 2004 toimunud graniitskulptuurifestivalist Põltsamaa lähedal Sõpruse pargis. Osales Erland Knudsson Madsen Taanist, Arto Lappalainen Soomest, Sandis Kondratas Lätist, Algirdas Kuzma Leedust, Christos Mondzios Poolast, Tauno Kangro, Are Haljas ja Art Allmägi Eestist

  6. Ehe : patt või püha? / Tanel Veenre

    Index Scriptorium Estoniae

    Veenre, Tanel, 1977-

    2003-01-01

    Muljeid ehtekunstinäituselt "Palve. Puudutus. Patt" Tallinna Kunstihoone galeriis. Rein Metsa, Arseni Mölderi, Kristi Saare, Bruno Lillemetsa, Kärt Marani, Lilian Linnaksi, Kaie Partsi ja Adolfas Shaulyse töödest

  7. Eesti joonisfilm taas edukas

    Index Scriptorium Estoniae

    2003-01-01

    Riia I rahvusvahelisel animafilmide festivalil võitis "Kontsert porgandipirukale" parima animafilmi auhinna. Grand prix'i sai inglase Ignacio Ferreresi film "How to Cope With a Death". Žüriisse kuulus ka Rein Raamat

  8. Naissaarele kerkivad esimesed ärimeeste suvemajad / Anne Oja

    Index Scriptorium Estoniae

    Oja, Anne, 1970-

    2004-01-01

    Naissaarele ostavad kinnistuid ja ehitavad suvilaid tuntud kultuuritegelased ja ärimehed, kelle seas on dirigent Tõnu Kaljuste, ehitusärimees Andres Koger, Hawaii Expressi omanik Kaijo Kuusing ja Laevaomanike Liidu juht Rein Merisalu

  9. Majanduskriis, vabadussammas, Barack Obama...

    Index Scriptorium Estoniae

    2008-01-01

    Ettevõtja Indrek Neivelt, TLÜ rektor Rein Raud, filmitegija Andres Maimik, peaminister Andrus Ansip, ajakirja Vikerkaar peatoimetaja Märt Väljataga, filmitegija Ilmar Raag avaldavad arvamust, millega läheb 2008. aasta ajalukku

  10. Tagasivaade 90-ndate eesti kirjandusele / Märt Väljataga

    Index Scriptorium Estoniae

    Väljataga, Märt, 1965-

    1999-01-01

    Vastukajad: Veidemann, Rein. Edasivaade 90-ndate eesti kirjandusele: teksti, metateksti ja konteksti probleem // Looming (1999) nr. 12, lk. 1847-1852 ; Merilai, Arne. Elule lähemale - sic! // Sirp (2000) 14. jaan.., lk. 14

  11. Muusikud on koolitatud palgamõrvareiks / Kai Kallastu ; interv. Karol Kallas

    Index Scriptorium Estoniae

    Kallastu, Kai, 1970-

    2007-01-01

    Lauljanna oma eelseisvast esietendusest : Pärnu mudaravilas esietendub täna Sven Kivisildniku audiovisuaalne ooperietendus "Topeltwagner juustuga", teostajaks lavastuse meeskond REPOO ENSEMBLE (Kivisildnik, Andrus ja Kai Kallastu, Indrek ja Leonora Palu, Rein Laos)

  12. Ehho kompjuternoi voinõ / Josef Kats

    Index Scriptorium Estoniae

    Kats, Josef, 1977-

    2007-01-01

    Justiitsminister Rein Lang ja peaminister Andrus Ansip on veendunud, et küberrünnakud Eesti riigi vastu aprilli lõpus ja mai alguses tulid muu hulgas ka Vene presidendi administratsiooni IP-aadressidelt

  13. Peal on propaganda, all on tugev off / Valle-Sten Maiste

    Index Scriptorium Estoniae

    Maiste, Valle-Sten, 1972-

    2008-01-01

    Lõppeva teatriaasta repertuaarivalikust. Teatriaasta õnnestumiste ja ebaõnnestumiste kohta vastavad küsimustele ka Pille-Riin Purje, Jaak Allik, Rein Veidemann, Rait Avestik, Jim Ashilevi, Eva Kübar, Madli Pesti ja Madis Kolk

  14. Abieluakti koostamine EELKs - õigus või kohustus? / Merje Talvik

    Index Scriptorium Estoniae

    Talvik, Merje

    2008-01-01

    Vaimulike õigusest pärast siseministeeriumi korraldatava koolituse läbimist riigi nimel abielu sõlmida. Kommenteerivad Kristjan Luhamets, Rein Schihalejev, Mare Palgi, Illimar Toomet, Mart Jaanson, Anna-Liisa Vaher ja Kalle Gaston

  15. A Synergistic Combination of Advanced Separation and Chemical Scale Inhibitor Technologies for Efficient Use of Imparied Water As Cooling Water in Coal-based Power Plants

    Energy Technology Data Exchange (ETDEWEB)

    Jasbir Gill

    2010-08-30

    Nalco Company is partnering with Argonne National Laboratory (ANL) in this project to jointly develop advanced scale control technologies that will provide cost-effective solutions for coal-based power plants to operate recirculating cooling water systems at high cycles using impaired waters. The overall approach is to use combinations of novel membrane separations and scale inhibitor technologies that will work synergistically, with membrane separations reducing the scaling potential of the cooling water and scale inhibitors extending the safe operating range of the cooling water system. The project started on March 31, 2006 and ended in August 30, 2010. The project was a multiyear, multi-phase project with laboratory research and development as well as a small pilot-scale field demonstration. In Phase 1 (Technical Targets and Proof of Concept), the objectives were to establish quantitative technical targets and develop calcite and silica scale inhibitor chemistries for high stress conditions. Additional Phase I work included bench-scale testing to determine the feasibility of two membrane separation technologies (electrodialysis ED and electrode-ionization EDI) for scale minimization. In Phase 2 (Technology Development and Integration), the objectives were to develop additional novel scale inhibitor chemistries, develop selected separation processes, and optimize the integration of the technology components at the laboratory scale. Phase 3 (Technology Validation) validated the integrated system's performance with a pilot-scale demonstration. During Phase 1, Initial evaluations of impaired water characteristics focused on produced waters and reclaimed municipal wastewater effluents. Literature and new data were collected and evaluated. Characteristics of produced waters vary significantly from one site to another, whereas reclaimed municipal wastewater effluents have relatively more uniform characteristics. Assessment to date confirmed that calcite and silica

  16. President 2001 / interv. Kai Kalamees

    Index Scriptorium Estoniae

    2001-01-01

    Eesti Päevaleht palus erinevate elualade esindajatel hinnata presidendikandidaatide ametisse sobivust (Savi, Tarand, Kelam, Kreitzberg, Tulviste). Vastavad: Aivar Voog, Rein Ruutsoo, Kaur Hanson, Ivo Rull, Tarmo Tammerk, Mart Helme, Pavel Ivanov, Jaan Kaplinski. Diagrammid

  17. PR-teenuse hind tõuseb 20% / Eda-Liis Kann

    Index Scriptorium Estoniae

    Kann, Eda-Liis, 1979-

    2004-01-01

    Suhtekorraldusfirmad prognoosivad aasta teiseks pooleks PR-teenuste 20protsendilist hinnatõusu. Kommenteerivad Kersti Luha, Maren Pärn, Ingrid Eha, Maria Raudsepp, Heidi Pihlak ja Rein Meripõld. Lisa: Väikefirmale on PR-teenus kallis

  18. Zdess budet gorod-sad / Jekaterina Rodina

    Index Scriptorium Estoniae

    Rodina, Jekaterina

    2003-01-01

    Tallinna Juhkentali, Liivalaia ja Imanta tänavate vahelise ala detailplaneering Rein Murula arhitektibüroolt näeb ette kõrghoone, 3-8 korruselisi maju, Juhkentali tän. liiklusummikute kaotamiseks estakaadi, haljasala

  19. Kolhoosikeskus - oma ja võõras = Collective farm centre - familiar and alien / Liina Jänes ; tõlk. Liisi Ojamaa

    Index Scriptorium Estoniae

    Jänes, Liina, 1977-

    2000-01-01

    Eesti kolhoosikeskuste arhitektuurist. Vaadeldakse aastail 1957-1990 ehitatud 24 keskusehoonet. Arhitektid Nikolai Kusmin, Harri Kingo, Toomas Rein, Vilen Künnapu, Ain Padrik, Maara Metsal, Meeli Truu jt. 17 välisvaadet, 3 joon., kaart

  20. Oma last juhendava treeneri dilemma - kas sõimata või poputada / Ann Hiiemaa, Inga Höglund

    Index Scriptorium Estoniae

    Hiiemaa, Ann

    2008-01-01

    Korvpallitreener Allan Dorbek tunnistab, et oma lastelt nõuab ja ootab ta paratamatult rohkem. Oma laste treenimisest räägivad ka Rein Kirsipuu, Keete Puri, Riho Aljand, Hille Saarepuu ja Janika Mölder