Enhanced pinning in mixed rare earth-123 films
Driscoll, Judith L [Los Alamos, NM; Foltyn, Stephen R [Los Alamos, NM
2009-06-16
An superconductive article and method of forming such an article is disclosed, the article including a substrate and a layer of a rare earth barium cuprate film upon the substrate, the rare earth barium cuprate film including two or more rare earth metals capable of yielding a superconductive composition where ion size variance between the two or more rare earth metals is characterized as greater than zero and less than about 10.times.10.sup.-4, and the rare earth barium cuprate film including two or more rare earth metals is further characterized as having an enhanced critical current density in comparison to a standard YBa.sub.2Cu.sub.3O.sub.y composition under identical testing conditions.
Strain effects on point defects and chain-oxygen order-disorder transition in 123 cuprate compounds
International Nuclear Information System (INIS)
Su Haibin; Welch, David O.; Wong-Ng, Winnie
2004-01-01
The energetics of Schottky defects in 123 cuprate superconductor series RBa 2 Cu 3 O 7 (where R=lanthandies) and YA 2 Cu 3 O 7 (A=alkali earths), were found to have unusual relations if one considers only the volumetric strain. Our calculations reveal the effect of nonuniform changes of interatomic distances within the R-123 structures, introduced by doping homovalent elements, on the Schottky defect formation energy. The energy of formation of Frenkel pair defects, which is an elementary disordering event, in 123 compounds can be substantially altered under both stress and chemical doping. Scaling the oxygen-oxygen short-range repulsive parameter using the calculated formation energy of Frenkel pair defects, the transition temperature between orthorhombic and tetragonal phases is computed by quasichemical approximations (QCA's). The theoretical results illustrate the same trend as the experimental measurements in that the larger the ionic radius of R, the lower the orthorhombic/tetragonal phase transition temperature. This study provides strong evidence of the strain effects on order-disorder transition due to oxygens in the CuO chain sites
Magnetic behavior of light rare earth ions in (Nd,Eu,Gd)-123 superconductors
Czech Academy of Sciences Publication Activity Database
Jirsa, Miloš; Rameš, Michal; Marcenat, C.; Wolf, T.
2013-01-01
Roč. 26, č. 4 (2013), s. 901-905 ISSN 1557-1939 R&D Projects: GA MŠk(CZ) ME10069 Institutional support: RVO:68378271 Keywords : high- T c superconductors * cuprates * thermodynamic properties * LRE-123 * paramagnetic ions Subject RIV: BM - Solid Matter Physics ; Magnetism Impact factor: 0.930, year: 2013
Oxygen hole mechanism of superconductivity in cuprates and other metal oxides
International Nuclear Information System (INIS)
Rao, C.N.R.
1989-01-01
Several theoretical models have been proposed to explain high-temperature superconductivity in cuprates. An issue that is central to any model is the nature of copper and oxygen species in the cuprates since superconductivity clearly owes its origin to the Cu-O sheets universally present in all the cuprate families. Thus, the five families of cuprate superconductors, La 2 - x M x CuO 4 (M = Ca, Sr or Ba) of the K 2 NiF 4 structure, LnBa 2 Cu 3 O 7 - δ (Ln = Y or rare earth), Bi 2 (Ca, Sr) n + 1 Cu n O 2n + 4 , Tl 2 (Ca, Ba) n + 1 Cu n O 2n + 4 and Tl (Ca, Ba) n + 1 Cu n O 2n + 3 , all contain two-dimensional Cu-O sheets. The Cu-O chains additionally present in the 123 compounds do not seem to play any crucial role. It has been generally believed that magnetic, superconducting and related properties of cuprates have some thing to do with the mixed valency of copper. For example, the resonating valence bond (RVB) model requires the presence of holes on Cu sites (Cu 3 + species). There are also a few models, however, based on the presence of holes on oxygen sites (O - species); dimerization of oxygen holes has also been suggested to occur by a few workers. It is the purpose of this article to briefly present the available experimental evidence for the presence of oxygen holes and to discuss their role in high-temperature conductivity. It will be shown that these holes play a role in other oxide materials as well as including the Cu-free Ba 1 - x K x BiO 3 superconductor
Effect of growth anisotropy on the morphology and property of directionally solidified RE123
International Nuclear Information System (INIS)
Nakamura, Yuichi; Shibusawa, Akira; Ooishi, Yoshihiro; Misu, Tomohiko; Inada, Ryoji; Oota, Akio
2005-01-01
The REBa 2 Cu 3 O y (RE123: RE = Y, Sm, Gd etc.) superconducting current lead is a favorable application due to the high J c properties and low thermal conductivity. Since the RE123 crystal shows the anisotropy in the J c properties as well as the mechanical properties, the ab-plane of the crystal parallel to the growth direction is preferable. The preferential growth direction during directional solidification is determined by the growth anisotropy in the early stage of the growth. In order to get the fundamental information to control the growth orientation, we investigated the growth rates of the Gd123 and Sm123 crystals against the undercooling and the continuous growth condition of Sm123 in directional solidification process. The growth rates of Sm123 and Gd123 were found to be about 5-10 times larger than that of Y123 at the same undercooling. The Sm123 showed the continuous growth structure up to 15 mm/h for fiber samples and up to 10 mm/h for 2 mm circle rods by the zone melting process. These pulling rates for continuous growth are larger than those of Y123 although the difference in growth rates between Sm123 and Y123 is much larger than this difference
Critical current densities in thick yttrium-barium cuprate (1-2-3) films
International Nuclear Information System (INIS)
Ryvkina, G.G.; Gorlanov, S.F.; Vedernikov, G.E.; Telegin, A.B.; Ryabin, V.A.; Khodos, M.Ya.
1993-01-01
The study of critical current densities j c of oxide superconductors and their thick films is a very important practical task because the value of j c is one of the main criteria for their utilization in modern cryoelectronics. For most devices based on the Josephson effect, the value of j c ∼ 10 2 - 10 3 A/cm 2 is acceptable, which is easily attainable for polycrystalline thick films obtained by stenciling. The study of the current-transport phenomenon involves a number of difficulties, especially for direct current, because both the sample itself and the lead-in contacts are resistance-heated during the measurements, which, in turn, results in lower values of the j c . Measurements with pulsed currents allow one to lower the power that is applied to the sample; the heat that is released in the sample is reduced, in comparison to measurements with direct current, by a factor of the pulsed-current duty cycle. In addition, measurements with direct current detects only the appearance of resistance; it provides no information on the rest of the transition from the normal to the superconductive state, i.e., on the so-called 'tail' of the transition. In this work, the authors studied critical current densities of thick HTSC yttrium-barium cuprate films of the 1-2-3 composition using pulsed current
Directory of Open Access Journals (Sweden)
Shigeru Horii, Atsushi Ishihara, Takayuki Fukushima, Tetsuo Uchikoshi, Hiraku Ogino, Tohru S Suzuki, Yoshio Sakka, Jun-ichi Shimoyama and Kohji Kishio
2009-01-01
Full Text Available The magnetic anisotropies and easy axes of magnetization at room temperature were determined, and the effects of rare-earth (RE ions were clarified for RE-based cuprates, RE-doped bismuth-based cuprates and RE-doped Bi-based cobaltite regarding the grain orientation by magnetic field. The easy axis, determined from the powder orientation in a static field of 10 T, depended qualitatively on the type of RE ion for all three systems. On the other hand, the magnetization measurement of the c-axis oriented powders, aligned in static or rotating fields, revealed that the type of RE ion strongly affected not only the directions of the easy axis but also the absolute value of magnetic anisotropy, and an appropriate choice of RE ion is required to minimize the magnetic field used for grain orientation. We also studied the possibility of triaxial grain orientation in high-critical-temperature superconductors by a modulated oval magnetic field. In particular, triaxial orientation was attempted in a high-oxygen-pressure phase of orthorhombic RE-based cuprates Y2Ba4Cu7Oy. Although the experiment was performed in epoxy resin, which is not practical, in-plane alignment within 3° was achieved.
Investigation of renormalization effects in high temperature cuprate superconductors
International Nuclear Information System (INIS)
Zabolotnyy, Volodymyr B.
2008-01-01
It has been found that the self-energy of high-T C cuprates indeed exhibits a well pronounced structure, which is currently attributed to coupling of the electrons either to lattice vibrations or to collective magnetic excitations in the system. To clarify this issue, the renormalization effects and the electronic structure of two cuprate families Bi 2 Sr 2 CaCu 2 O 8+δ and YBa 2 Cu 3 O 7-δ were chosen as the main subject for this thesis. With a simple example of an electronic system coupled to a collective mode unusual renormalization features observed in the photoemission spectra are introduced. It is shown that impurity substitution in general leads to suppression of the unusual renormalization. Finally an alternative possibility to obtain a purely superconducting surface of Y-123 via partial substitution of Y atoms with Ca is introduced. It is shown that renormalization in the superconducting Y-123 has similar strong momentum dependence as in the Bi-2212 family. It is also shown that in analogy to Bi-2212 the renormalization appears to have strong dependence on the doping level (no kinks for the overdoped component) and practically vanishes above T C suggesting that coupling to magnetic excitations fits much better than competing scenarios, according to which the unusual renormalization in ARPES spectra is caused by the coupling to single or multiple phononic modes. (orig.)
Fermi-surface reconstruction by stripe order in cuprate superconductors
Laliberté, Francis
2012-02-01
The origin of pairing in a superconductor resides in the underlying normal state. In the cuprate high-temperature superconductor YBCO, application of a magnetic field to suppress superconductivity reveals a ground state that appears to break the translational symmetry of the lattice, pointing to some density-wave order [1,2,3]. In another cuprate, Eu-LSCO, the onset of stripe order - a modulation of spin and charge densities - at low temperature is well established [4]. By a comparative study of thermoelectric transport in the cuprates YBCO and Eu-LSCO, we show that the two materials exhibit a very similar process of Fermi-surface reconstruction as a function of temperature and doping [5,6]. This strongly suggests that Fermi-surface reconstruction is caused by stripe order in both cases, compelling evidence that stripe order is a generic tendency of hole-doped cuprates.[4pt] Work done in collaboration with J. Chang, N. Doiron-Leyraud, E. Hassinger, R. Daou, D. LeBoeuf, M. Rondeau, B. J. Ramshaw, R. Liang, D. A. Bonn, W. N. Hardy, S. Pyon, T. Takayama, H. Takagi, I. Sheikin, L. Malone, C. Proust, K. Behnia and L. Taillefer.[4pt] [1] N. Doiron-Leyraud et al., Nature 447, 565 (2007).[0pt] [2] D. LeBoeuf et al., Nature 450, 533 (2007).[0pt] [3] D. LeBoeuf et al., Phys. Rev. B 83, 054506 (2011).[0pt] [4] J. Fink et al., Phys. Rev. B 83, 092503 (2011).[0pt] [5] J. Chang et al., Phys. Rev. Lett. 104, 057005 (2010).[0pt] [6] F. Lalibert'e et al., Nat. Commun. 2, 432 (2011).
Investigation of renormalization effects in high temperature cuprate superconductors
Energy Technology Data Exchange (ETDEWEB)
Zabolotnyy, Volodymyr B.
2008-04-16
It has been found that the self-energy of high-T{sub C} cuprates indeed exhibits a well pronounced structure, which is currently attributed to coupling of the electrons either to lattice vibrations or to collective magnetic excitations in the system. To clarify this issue, the renormalization effects and the electronic structure of two cuprate families Bi{sub 2}Sr{sub 2}CaCu{sub 2}O{sub 8+{delta}} and YBa{sub 2}Cu{sub 3}O{sub 7-{delta}} were chosen as the main subject for this thesis. With a simple example of an electronic system coupled to a collective mode unusual renormalization features observed in the photoemission spectra are introduced. It is shown that impurity substitution in general leads to suppression of the unusual renormalization. Finally an alternative possibility to obtain a purely superconducting surface of Y-123 via partial substitution of Y atoms with Ca is introduced. It is shown that renormalization in the superconducting Y-123 has similar strong momentum dependence as in the Bi-2212 family. It is also shown that in analogy to Bi-2212 the renormalization appears to have strong dependence on the doping level (no kinks for the overdoped component) and practically vanishes above T{sub C} suggesting that coupling to magnetic excitations fits much better than competing scenarios, according to which the unusual renormalization in ARPES spectra is caused by the coupling to single or multiple phononic modes. (orig.)
International Nuclear Information System (INIS)
Tang, I.M.; Thongruang, R.; Charoenthai, N.
1999-01-01
The depressions of the T c 's of the 123 REBa 2 Cu 3 O 7 HTSC's due to the substitution of Zn 2+ ions into the Cu(2) layer are studied. The orthorhombic distortion which occurs in the 123 ceramics is assumed to induce a modification to the spin-fluctuation (SF) mediated pairing interaction which in turn causes the order parameters of these HTSC's to be of mixed (d + s)-wave symmetry. It is shown that part of the rapid depression of the T c 's caused by Zn 2+ substitution into the CuO 2 is due to a reduction of the SF-mediated pairing interaction. The differences in the rates of suppression of T c due to Zn 2+ doping in the different RE-123 HTSC's are shown to be due to the changes in the orthorhombicity which depend on the size of the rare earth ions
Tang, I. M.; Charoenthai, N.; Thongruang, R.
The depressions of the Tc's of the "123" REBa2Cu3O7 HTSC's due to the substitution of Zn2+ ions into the Cu(2) layer are studied. The orthorhombic distortion which occurs in the "123" ceramics is assumed to induce a modification to the spin-fluctuation (SF) mediated pairing interaction which inturn causes the order parameters of these HTSC's to be of mixed (d+s)-wave symmetry. It is shown that part of the rapid depression of the Tc's caused by Zn2+ substitution into the CuO2 is due to a reduction of the SF-mediated pairing interaction. The differences in the rates of suppression of Tc due to Zn2+ doping in the different "RE-123" HTSC's are shown to be due to the changes in the orthorhombicity which depend on the size of the rare earth ions.
Heavy fermions and superconductivity in doped cuprates
International Nuclear Information System (INIS)
Tornow, S.; Zevin, V.; Zwicknagl, G.
1996-01-01
We present a Fermi liquid description for the low-energy excitations in rare Earth cuprates Nd 2-x Ce x CuO 4 . The strongly renormalized heavy quasiparticles which appear in the doped samples originate from the coherent decoupling of rare earth spins and correlated conduction electrons. The correlations among the conduction electrons are simulated by assuming a spin density wave ground state. We discuss results for the thermodynamic properties in the insulating, normal metallic and superconducting phases which are in fair agreement with experimental data. In addition, the model predicts interesting behaviour for the superconducting state of samples with low transition temperature T c which may help to assess the validity of the underlying assumptions. (orig.)
Heavy fermions and superconductivity in doped cuprates
Energy Technology Data Exchange (ETDEWEB)
Tornow, S. [Max-Planck-Inst. fur Phys. Komplexer Syst., Stuttgart (Germany). Aussenstelle Stuttgart; Zevin, V. [Hebrew Univ., Jerusalem (Israel). Racah Inst. of Physics; Zwicknagl, G. [Max-Planck-Inst. fur Phys. Komplexer Syst., Stuttgart (Germany). Aussenstelle Stuttgart
1996-10-01
We present a Fermi liquid description for the low-energy excitations in rare Earth cuprates Nd{sub 2-x}Ce{sub x}CuO{sub 4}. The strongly renormalized heavy quasiparticles which appear in the doped samples originate from the coherent decoupling of rare earth spins and correlated conduction electrons. The correlations among the conduction electrons are simulated by assuming a spin density wave ground state. We discuss results for the thermodynamic properties in the insulating, normal metallic and superconducting phases which are in fair agreement with experimental data. In addition, the model predicts interesting behaviour for the superconducting state of samples with low transition temperature T{sub c} which may help to assess the validity of the underlying assumptions. (orig.)
Fabrication and characterization of intrinsic Josephson junctions in RE-123 whiskers
International Nuclear Information System (INIS)
Okutsu, T.; Ueda, S.; Ishii, S.; Nagasawa, M.; Takano, Y.
2008-01-01
The series of REBa 2 Cu 3 O 7-δ RE-123; RE = Y, Eu, Gd, Dy, Ho, Er, Tm, and Lu) single-crystal whiskers have been successfully grown using the Te- or Sb-doping method. Intrinsic Josephson junctions (IJJs) were fabricated from the whiskers using a focused ion beam (FIB). As-grown IJJs with T c > 70 K showed a Josephson current but no multi-branches in the current-voltage (I-V) characteristics. Under-doped specimens were obtained by a post-annealing process. As-grown IJJs with lower T c and all the specimens of the post-annealed IJJs showed clear multi-branched structure. The post-annealing reduced the critical temperature (T c ) and the critical current density (J c ) of the IJJs, and increased the anisotropic parameter γ
On the pinning performance analysis in bulk RE-123 twin-free superconductors
Czech Academy of Sciences Publication Activity Database
Jirsa, Miloš; Petrenko, Pavlo; Yao, X.; Muralidhar, M.
463-465, - (2007), s. 353-356 ISSN 0921-4534. [International Symposium on Superconductivity /19./. Nagoya, 01.10.2006-03.10.2006] R&D Projects: GA MŠk 1P05ME728 Grant - others:MOST(CN) 2006CB601003; SSTC(CN) 055207077 Institutional research plan: CEZ:AV0Z10100520 Keywords : Penk effect * bulk RE-123 superconductors * pinning force scaling * pinning classification Subject RIV: BM - Solid Matter Physics ; Magnetism Impact factor: 1.079, year: 2007
International Nuclear Information System (INIS)
Nagai, R.; Horii, S.; Maeda, T.; Haruta, M.; Shimoyama, J.
2013-01-01
Highlights: •Tri-axial magnetic alignment of Bi2212 with rare-earth (RE) doping was attempted. •Magnetization axes depended on the type of doped RE ions. •RE-doping increased degrees of inplane orientation and inplane magnetic anisotropy. -- Abstract: We report relationship between the degrees of tri-axial orientation and doping level of rare earth (RE) ions in Bi 2 Sr 2 (Ca 1−x RE x )Cu 2 O y (RE-doped Bi2212; RE = Dy, Ho, Er and Tm) powder samples aligned under a modulated rotation magnetic field (MRF) of 10 T. Tri-axial magnetic alignment of the RE-doped Bi2212 with x = 0–0.5 was achieved by single-ion magnetic anisotropy of RE 3+ and tri-axial magnetic anisotropy induced by modulation microstructure in a grain level. The degrees of in-plane and c-axis orientation with ∼3° were achieved for the case of the Tm-doped Bi2212 with x = 0.5. The findings in the present study give us important information for the fabrication of triaxially oriented Bi-based cuprate superconductor materials by the magneto-scientific process
A simple model for normal state in- and out-of-plane resistivities of hole doped cuprates
Energy Technology Data Exchange (ETDEWEB)
Naqib, S.H., E-mail: shnaqib.physicsru@gmail.com [Department of Physics, University of Rajshahi, Rajshahi 6205 (Bangladesh); Azam, M. Afsana [Department of Physics, University of Rajshahi, Rajshahi 6205 (Bangladesh); Department of Physics, DUET, Gazipur, Dhaka (Bangladesh); Uddin, M. Borhan [Department of Physics, University of Rajshahi, Rajshahi 6205 (Bangladesh); Department of CSE, International Islamic University Chittagong, Sitakunda, IIUC Rd, Kumira 4314 Bangladesh (Bangladesh); Cole, J.R. [Cambridge Flow Solutions Ltd., Histon, Cambridge CB24 9AD (United Kingdom)
2016-05-15
Highlights: • In- and out-of-plane charge transport have been investigated for hole doped cuprates. • Effect of quantum critical point (QCP) on non-Fermi liquid behavior has been explored. • The impact of pseudogap (PG) on carrier scattering rate has been studied. • In- and out-of plane resistivities have been modeled by considering the QCP and the PG. • The model explains the non-Fermi liquid charge transport in hole doped cuprates. - Abstract: The highly anisotropic and qualitatively different nature of the normal state in- and out-of-plane charge dynamics in high-T{sub c} cuprates cannot be accommodated within the conventional Boltzmann transport theory. The variation of in-plane and out-of-plane resistivities with temperature and hole content are anomalous and cannot be explained by Fermi-liquid theory. In this study, we have proposed a simple phenomenological model for the dc resistivity of cuprates by incorporating two firmly established generic features of all hole doped cuprate superconductors—(i) the pseudogap in the quasiparticle energy spectrum and (ii) the T-linear resistivity at high temperatures. This T-linear behavior over an extended temperature range can be attributed to a quantum criticality, affecting the electronic phase diagram of cuprates. Experimental in-plane and out-of-plane resistivities (ρ{sub p}(T) and ρ{sub c}(T), respectively) of double-layer Y(Ca)123 have been analyzed using the proposed model. This phenomenological model describes the temperature and the hole content dependent resistivity over a wide range of temperature and hole content, p. The characteristic PG energy scale, ε{sub g}(p), extracted from the analysis of the resistivity data, agrees quite well with those found in variety of other experiments. Various other extracted parameters from the analysis of ρ{sub p}(T) and ρ{sub c}(T) data showed systematic trends with changing hole concentration. We have discussed important features found from the analysis in
Wu, Judy; Shi, Jack
2017-10-01
Raising critical current density J c in high temperature superconductors (HTSs) is an important strategy towards performance-cost balanced HTS technology for commercialization. The development of strong nanoscale artificial pinning centers (APCs) in HTS, such as YBa2Cu3O7 or RE-123 in general, represents one of the most exciting progressions in HTS material research in the last decade. Significantly raised J c has been demonstrated in APC/RE-123 nanocomposites by enhanced pinning on magnetic vortices in magnetic fields towards that demanded in practical applications. Among other processes, strain-mediated self-organization has been explored extensively for in situ formation of the APCs based on fundamental physics design rules. The desire in controlling the morphology, dimension, orientation, and concentration of APCs has led to a fundamental question on how strains interact in determining APCs at a macroscopic scale. Answering this question demands an interactive modeling-synthesis-characterization approach towards a thorough understanding of fundamental physics governing the strain-mediated self-organization of the APCs in the APC/RE-123 nanocomposites. Such an understanding is the key for a leap forward from the traditionally empirical method to materials-by-design to enable an optimal APC landscape to be achieved in epitaxial films of APC/YBCO nanocomposites under a precise guidance of fundamental physics. The paper intends to provide a review of recent progress made in the controllable generation of APCs using the interactive modeling-synthesis-characterization approach. The emphasis will be given to the understanding so far achieved using such an approach on the collective effect of the strain field on the morphology, dimension, and orientation of APCs in epitaxial APC/RE-123 nanocomposite films.
The color of polarization in cuprate superconductors
International Nuclear Information System (INIS)
Hoff, H.A.; Osofsky, M.S.; Lechter, W.L.; Pande, C.S.
1991-01-01
A technique for the identification of individual anisotropic grains in a heterogeneous and opaque material involves the observation of grain color in reflected light through crossed polarizers (color of polarization). Such colors are generally characteristic of particular phases. When grains of many members of the class of hole carrier cuprate superconductors are so viewed at room temperature with a 'daylight' source, a characteristic color of polarization is observed. This color was studied in many of these cuprate superconductors and a strong correlation was found between color and the existence of superconductivity. Two members were also examined of the electron cuprate superconductors and it was found that they possess the same color of polarization as the hole carrier cuprate superconductors so far examined. The commonality of the characteristic color regardless of charge carrier indicates that the presence of this color is independent of carrier type. The correlation of this color with the existence of superconductivity in the cuprate superconductors suggests that the origin of the color relates to the origin of superconductivity. Photometric techniques are also discussed
Temperature measurement of RE123 bulk superconductors on magnetizing process
International Nuclear Information System (INIS)
Yokoyama, K.; Kaneyama, M.; Oka, T.; Fujishiro, H.; Noto, K.
2004-01-01
We study on the magnetization behavior of to magnetize RE123 bulk superconductors to apply it as strong magnets. Through magnetizing process, the temperature of bulk superconductors is raised by pinning loss caused by the magnetic fluxes motion (e.g. flux jump of flux flow), and the trapped field is decreased. This paper presents the measurement of temperature changes of Sm123 bulk superconductors during the exciting process by iteratively magnetizing pulsed-field operation with reducing amplitudes (IMRA) method. Five thermocouples are put on the surface of Sm123 bulk superconductor of 46 mm in diameter. The temperatures at the center, on the growth sector boundary (GSB) line and in the sector region surrounded by GSB's line (inter-GSB region) are monitored. The temperature at a cold stage is also measured. A Hall sensor is attached near the center thermocouple to measure the trapped field. After a bulk superconductor is cooled by the GM type refrigerator until 40 K, iterative pulsed-fields of 2.32-5.42 T are applied by a magnetizing coil. When high magnetic field of 5.42 T is applied, a temperature of bulk superconductor reaches to 72.4 K and the magnetic field distribution has C form with which a part of circle is dented, and then, a trapped field is 2.28 T. When a lower magnetic field of 4.64 T is applied, a maximum temperature is 68.3 K and a trapped field is raised to 2.70 T, and moreover, the distribution becomes round shape like field-cooling method (FC). We showed clearly that heat generation by pinning loss was related to the mechanism of magnetic field capture
International Nuclear Information System (INIS)
Langhorn, J.B.; Black, M.A.; McGinn, P.J.
1999-01-01
The phases RE 2 BaCuO 5 /RE 4 Ba 2 Cu 2 O 10 phases (where RE is a mixture of Nd, Sm, Gd, Eu, Y and Yb) have been synthesized in an oxygen atmosphere and subsequently characterized. The mixing of RE elements which inherently form the RE 2 BaCuO 5 phase through the peritectic decomposition of REBa 2 Cu 3 O 7-x (RE123) (i.e. Sm, Gd, Eu, Y, Yb), was observed to give homogeneous mixing of the elements in the 211 phase. In contrast it was found that on mixing Nd with other RE elements a mixture of the Nd 4-2x Ba 2+2x Cu 2-x O 10-2x (Nd422) and RE 2 BaCuO 5 (RE211) phases resulted. It was also observed that on mixing Nd with other REs a finite amount of the RE is substituted into the Nd422 phase and Nd into the RE211. (author)
Superconductivity in doped two-leg ladder cuprates
International Nuclear Information System (INIS)
Qin Jihong; Yuan Feng; Feng Shiping
2006-01-01
Within the t-J ladder model, superconductivity with a modified d-wave symmetry in doped two-leg ladder cuprates is investigated based on the kinetic energy driven superconducting mechanism. It is shown that the spin-liquid ground-state at the half-filling evolves into the superconducting ground-state upon doping. In analogy to the doping dependence of the superconducting transition temperature in the planar cuprate superconductors, the superconducting transition temperature in doped two-leg ladder cuprates increases with increasing doping in the underdoped regime, and reaches a maximum in the optimal doping, then decreases in the overdoped regime
Energy Technology Data Exchange (ETDEWEB)
Naito, Michio, E-mail: minaito@cc.tuat.ac.jp [Department of Applied Physics, Tokyo University of Agriculture and Technology, Naka-cho 2-24-16, Koganei, Tokyo 184-8588 (Japan); Krockenberger, Yoshiharu; Ikeda, Ai; Yamamoto, Hideki [NTT Basic Research Laboratories, NTT Corporation, 3-1 Morinosato-Wakamiya, Atsugi, Kanagawa 243-0198 (Japan)
2016-04-15
Highlights: • The 30-year history of “electron-doped” cuprates is reviewed, including basic physics and material issues. • Undoped cuprates with the Nd{sub 2}CuO{sub 4} (T’) structure are superconducting with T{sub c} over 30 K. • Electron doping by Ce in T’-RE{sub 2}CuO{sub 4} lowers T{sub c} and the highest T{sub c} is obtained at no doping. - Abstract: The electronic phase diagram of the cuprates remains enigmatic and is still a key ingredient to understand the mechanism of high-T{sub c} superconductivity. It has been believed for a long time that parent compounds of cuprates were universally antiferromagnetic Mott insulators (charge-transfer insulators) and that high-T{sub c} superconductivity would develop upon doping holes or electrons in a Mott–Hubbard insulator (“doped Mott-insulator scenario”). However, our recent discovery of superconductivity in the parent compounds of square-planar cuprates with the Nd{sub 2}CuO{sub 4} (T’) structure and the revised electronic phase diagram in T’ cuprates urged a serious reassessment to the above scenario. In this review, we present the main results derived from our synthesis and experiments on T’ cuprates in the undoped or heavily underdoped regime over 20 years, including material issues and basic physics. The key material issue is how to remove excess oxygen ions at the apical site without introducing oxygen vacancies in the CuO{sub 2} planes. In order to put this into practice, the basic knowledge of complex solid-state chemistry in T’ cuprates is required, which is also included in this review.
Geology and rare earth (RE) metals in air Gegas area, South Bangka
International Nuclear Information System (INIS)
Bambang Soetopo
2013-01-01
Rare Earth (RE) is a valuable commodity both for industry and for the Nuclear Power Plant (NPP). In RE chemical bonds present in the phosphate (P) are the mineral monazite, xenotime, zircon minerals associated with cassiterite, magnetite, ilmenite, rutile, anatase, apatite, quartz and feldspar sand deposits are found in alluvial river or beach placer. RE deposits in monazite, zircon, xenotime in the Air Gegas of South Bangka area is an alluvial river that has the ease of exploration and mining. Geologically, monazite, xenotime and zircon minerals are from Klabat Granite aged Jurassic. The used method are the observation of geology, radioactivity measurement, sampling, laboratory analysis (microscopic and XRF). Results showed that the geology of the area Air Gegas of Tanjung Genting Formation consists of sandstone, clay (Early Triassic), Klabat Granite (Late Jurassic-Early Triassic) and Alluvial sediments (Quaternary). Alluvial monazite containing 0.071 to 3.574%, zircon from 0.172 to 10.376%, xenotime from 0.15 to 3.023% of the weight of MB from 10.73 to 168.072 grams. The presence of rare earth (RE) metals is derived from the mineral monazite, xenotime, zircon that was derived from granitic rocks of Klabat. Rare earth (RE) distributed in the eastern part of the study area which occupies the valley of the river. (author)
Pseudogap and cuprate superconductivity: MaxEnt-μSR studies
International Nuclear Information System (INIS)
Boekema, C.; Schwartz, R.; Love, A.; Browne, M.C.
2013-01-01
Highlights: • A magnetic origin of cuprate superconductivity is plausible. • Cuprate loop currents are observed, close to predictions. • Pseudogap effects are seen above and below T c . -- Abstract: The basic physics of cuprate superconductivity is still much deliberated after 27 years of research. In contrast to phononic or polaronic roots, Varma’s theory promotes a magnetic origin. To probe cuprate magnetism, we examine zero field (ZF) muon-spin-rotation (μSR) data of RBa 2 Cu 3 O 7−δ (RBCO; R = Gd, Eu) especially near T c . Possible weak effects are analyzed using Maximum Entropy (MaxEnt, ME) to transform our μSR time series. Concerning predicted pseudogap loop currents, we have observed μSR signals in zero field for GdBCO above and now also below T c . These are near predicted fields of about 100 Oe. Using MaxEnt, we analyze transverse field (TF) μSR data of optimal doped EuBCO. Our focus is also on a temperature interval above T c to comprehend precursor effects. Our results point toward magnetic roots of cuprate superconductivity
Electronic Raman response in electron-doped cuprate superconductors
International Nuclear Information System (INIS)
Geng Zhihao; Feng Shiping
2012-01-01
The electronic Raman response in the electron-doped cuprate superconductors is studied based on the t-t'-J model. It is shown that although the domelike shape of the doping dependent peak energy in the B 2g symmetry is a common feature for both electron-doped and hole-doped cuprate superconductors, there are pronounced deviations from a cubic response in the B 2g channel and a linear response in the B 2g channel for the electron-doped case in the low energy limit. It is also shown that these pronounced deviations are mainly caused by a nonmonotonic d-wave gap in the electron-doped cuprate superconductors.
Transport anomalies and quantum criticality in electron-doped cuprate superconductors
Energy Technology Data Exchange (ETDEWEB)
Zhang, Xu; Yu, Heshan; He, Ge; Hu, Wei; Yuan, Jie; Zhu, Beiyi [Beijing National Laboratory for Condensed Matter Physics, Institute of Physics, Chinese Academy of Sciences, Beijing 100190 (China); Jin, Kui, E-mail: kuijin@iphy.ac.cn [Beijing National Laboratory for Condensed Matter Physics, Institute of Physics, Chinese Academy of Sciences, Beijing 100190 (China); Collaborative Innovation Center of Quantum Matter, Beijing 100190 (China)
2016-06-15
Highlights: • Electrical transport and its complementary thermal transport on electron-doped cuprates are reviewed. • The common features of electron-doped cuprates are sorted out and shown in the last figure. • The complex superconducting fluctuations and quantum fluctuations are distinguished. - Abstract: Superconductivity research is like running a marathon. Three decades after the discovery of high-T{sub c} cuprates, there have been mass data generated from transport measurements, which bring fruitful information. In this review, we give a brief summary of the intriguing phenomena reported in electron-doped cuprates from the aspect of electrical transport as well as the complementary thermal transport. We attempt to sort out common features of the electron-doped family, e.g. the strange metal, negative magnetoresistance, multiple sign reversals of Hall in mixed state, abnormal Nernst signal, complex quantum criticality. Most of them have been challenging the existing theories, nevertheless, a unified diagram certainly helps to approach the nature of electron-doped cuprates.
Czech Academy of Sciences Publication Activity Database
Jirsa, Miloš; Rameš, Jiří; Wolf, T.
2012-01-01
Roč. 400, Part 2 (2012), 1-4 ISSN 1742-6588 R&D Projects: GA MŠk(CZ) ME10069 Institutional research plan: CEZ:AV0Z10100520 Keywords : paramagnetic rare earth ions * ternary cuprates * NEG-123 Subject RIV: BM - Solid Matter Physics ; Magnetism
Incommensurate Phonon Anomaly and the Nature of Charge Density Waves in Cuprates
Miao, H.; Ishikawa, D.; Heid, R.; Le Tacon, M.; Fabbris, G.; Meyers, D.; Gu, G. D.; Baron, A. Q. R.; Dean, M. P. M.
2018-01-01
While charge density wave (CDW) instabilities are ubiquitous to superconducting cuprates, the different ordering wave vectors in various cuprate families have hampered a unified description of the CDW formation mechanism. Here, we investigate the temperature dependence of the low-energy phonons in the canonical CDW-ordered cuprate La1.875 Ba0.125 CuO4 . We discover that the phonon softening wave vector associated with CDW correlations becomes temperature dependent in the high-temperature precursor phase and changes from a wave vector of 0.238 reciprocal lattice units (r.l.u.) below the ordering transition temperature to 0.3 r.l.u. at 300 K. This high-temperature behavior shows that "214"-type cuprates can host CDW correlations at a similar wave vector to previously reported CDW correlations in non-214-type cuprates such as YBa2 Cu3 O6 +δ . This indicates that cuprate CDWs may arise from the same underlying instability despite their apparently different low-temperature ordering wave vectors.
Excess Oxygen Defects in Layered Cuprates
Lightfoot, P.; Pei, S. Y.; Jorgensen, J. D.; Manthiram, A.; Tang, X. X.; Goodenough, J. B.
1990-09-01
Neutron powder diffraction has been used to study the oxygen defect chemistry of two non-superconducting layered cuprates, La{sub 1. 25}Dy{sub 0.75}Cu{sub 3.75}F{sub 0.5}, having a T{sup {asterisk}}- related structure, and La{sub 1.85}Sr{sub 1.15}Cu{sub 2}O{sub 6.25}, having a structure related to that of the newly discovered double-layer superconductor La{sub 2-x}Sr{sub x}CaCu{sub 2}O{sub 6}. The role played by oxygen defects in determining the superconducting properties of layered cuprates is discussed.
What is strange about high-temperature superconductivity in cuprates?
Božović, I.; He, X.; Wu, J.; Bollinger, A. T.
2017-10-01
Cuprate superconductors exhibit many features, but the ultimate question is why the critical temperature (Tc) is so high. The fundamental dichotomy is between the weak-pairing, Bardeen-Cooper-Schrieffer (BCS) scenario, and Bose-Einstein condensation (BEC) of strongly-bound pairs. While for underdoped cuprates it is hotly debated which of these pictures is appropriate, it is commonly believed that on the overdoped side strongly-correlated fermion physics evolves smoothly into the conventional BCS behavior. Here, we test this dogma by studying the dependence of key superconducting parameters on doping, temperature, and external fields, in thousands of cuprate samples. The findings do not conform to BCS predictions anywhere in the phase diagram.
High-Temperature Cuprate Superconductors Experiment, Theory, and Applications
Plakida, Nikolay Maksimilianovich
2010-01-01
High-Temperature Cuprate Superconductors provides an up-to-date and comprehensive review of the properties of these fascinating materials. The essential properties of high-temperature cuprate superconductors are reviewed on the background of their theoretical interpretation. The experimental results for structural, magnetic, thermal, electric, optical and lattice properties of various cuprate superconductors are presented with respect to relevant theoretical models. A critical comparison of various theoretical models involving strong electron correlations, antiferromagnetic spin fluctuations, phonons and excitons provides a background for understanding of the mechanism of high-temperature superconductivity. Recent achievements in their applications are also reviewed. A large number of illustrations and tables gives valuable information for specialists. A text-book level presentation with formulation of a general theory of strong-coupling superconductivity will help students and researches to consolidate their...
High-temperature cuprate superconductors. Experiment, theory, and applications
International Nuclear Information System (INIS)
Plakida, Nikolay
2010-01-01
High-Temperature Cuprate Superconductors provides an up-to-date and comprehensive review of the properties of these fascinating materials. The essential properties of high-temperature cuprate superconductors are reviewed on the background of their theoretical interpretation. The experimental results for structural, magnetic, thermal, electric, optical and lattice properties of various cuprate superconductors are presented with respect to relevant theoretical models. A critical comparison of various theoretical models involving strong electron correlations, antiferromagnetic spin fluctuations, phonons and excitons provides a background for understanding of the mechanism of high-temperature superconductivity. Recent achievements in their applications are also reviewed. A large number of illustrations and tables gives valuable information for specialists. A text-book level presentation with formulation of a general theory of strong-coupling superconductivity will help students and researches to consolidate their knowledge of this remarkable class of materials. (orig.)
Metal–insulator crossover in high Tc cuprates: A gauge field approach
Indian Academy of Sciences (India)
plane resistivity of underdoped cuprates and a range of superconducting cuprates in the presence of a strong magnetic field suppressing superconductivity. We propose an explanation for this phenomenon based on a gauge field theory approach ...
Energy Technology Data Exchange (ETDEWEB)
Nishiyama, Atsuhide; Doi, Yoshihiro; Hinatsu, Yukio, E-mail: hinatsu@sci.hokudai.ac.jp
2017-04-15
The perovskite-type compounds containing both rare earth and rhenium Sr{sub 2}LnReO{sub 6} (Ln=Y, Tb-Lu) have been prepared. Powder X-ray diffraction measurements and Rietveld analysis show that Ln{sup 3+} and Re{sup 5+} ions are structurally ordered at the B site of the perovskite SrBO{sub 3}. Magnetic anomalies are found in their magnetic susceptibility and specific heat measurements at 2.6–20 K for Ln=Y, Tb, Dy, Yb, Lu compounds. They are due to magnetic interactions between Re{sup 5+} ions. The results of the magnetic hysteresis and remnant magnetization measurements for Sr{sub 2}YReO{sub 6} and Sr{sub 2}LuReO{sub 6} indicate that the antiferromagnetic interactions between Re{sup 5+} ions below transition temperatures have a weak ferromagnetic component. The analysis of the magnetic specific heat data for Sr{sub 2}YbReO{sub 6} shows that both the Yb{sup 3+} and Re{sup 5+} ions magnetically order at 20 K. For the case of Sr{sub 2}DyReO{sub 6}, magnetic ordering of the Re{sup 5+} moments occurs at 93 K, and with decreasing temperature, the moments of Dy{sup 3+} ferromagnetically order at 5 K from the measurements of magnetic susceptibility and specific heat. - Graphical abstract: Crystal structure of double perovskite Sr{sub 2}LnReO{sub 6}. Red and black lines show cubic and monoclinic unit cells, respectively. - Highlights: • Double perovskites Sr{sub 2}LnReO{sub 6} (Ln=rare earths) were prepared. • They show an antiferromagnetic transition at 2.6–20 K. • In Sr{sub 2}DyReO{sub 6}, Dy and Re moments magnetically order at 5 and 93 K, respectively.
Tl Cuprate Superconductors Studied by XPS
Energy Technology Data Exchange (ETDEWEB)
Vasquez, R. P. [Jet Propulsion Laboratory, California Institute of Technology, Pasadena, CA 91109-8099 (United States); Siegal, M. P. [Sandia National Laboratories, Albuquerque, NM 87185-1421 (United States); Overmyer, D. L. [Sandia National Laboratories, Albuquerque, NM 87185-1421 (United States); Ren, Z. F. [Department of Chemistry, State University of New York, Buffalo, NY 14260-3000 (United States); Lao, J. Y. [Department of Chemistry, State University of New York, Buffalo, NY 14260-3000 (United States); Wang, J. H. [Department of Chemistry, State University of New York, Buffalo, NY 14260-3000 (United States)
1999-07-01
XPS measurements on epitaxial thin films of the Tl cuprate superconductors Tl2Ba2CaCu2O8, Tl2Ba2Ca2Cu3O10, and Tl0.78Bi0.22Ba0.4Sr1.6Ca2Cu3O9-{delta} are presented. These data, together with previous measurements in this lab on Tl2Ba2CuO6-{delta} and TlBa2CaCu2O7-{delta}, comprise a comprehensive data set for comparison of Tl cuprates in which the number of Tl-O and Cu-O layers, and hence the chemical and electronic properties, vary. (c) 2000 American Vacuum Society.
Tl Cuprate Superconductors Studied by XPS
International Nuclear Information System (INIS)
Vasquez, R. P.; Siegal, M. P.; Overmyer, D. L.; Ren, Z. F.; Lao, J. Y.; Wang, J. H.
1999-01-01
XPS measurements on epitaxial thin films of the Tl cuprate superconductors Tl2Ba2CaCu2O8, Tl2Ba2Ca2Cu3O10, and Tl0.78Bi0.22Ba0.4Sr1.6Ca2Cu3O9-δ are presented. These data, together with previous measurements in this lab on Tl2Ba2CuO6-δ and TlBa2CaCu2O7-δ, comprise a comprehensive data set for comparison of Tl cuprates in which the number of Tl-O and Cu-O layers, and hence the chemical and electronic properties, vary. (c) 2000 American Vacuum Society
Bosonic Spectral Function and the Electron-Phonon Interaction in HTSC Cuprates
International Nuclear Information System (INIS)
Maksimov, E. G.; Tamm, I. E.; Kulic, M.L.; Kulic, M.L.; Dolgov, O. V.
2010-01-01
In this paper we discuss experimental evidence related to the structure and origin of the bosonic spectral function a2F(ο) in high-temperature superconducting (HTSC) cuprates at and near optimal doping. Global properties of a2F(ο), such as number and positions of peaks, are extracted by combining optics, neutron scattering, ARPES and tunnelling measurements. These methods give evidence for strong electron-phonon interaction (EPI) with 1<λep <3.5 in cuprates near optimal doping. We clarify how these results are in favor of the modified Migdal-Eliashberg (ME) theory for HTSC cuprates near optimal doping. In Section 2 we discuss theoretical ingredients such as strong EPI, strong correlations which are necessary to explain the mechanism of d-wave pairing in optimally doped cuprates. These comprise the ME theory for EPI in strongly correlated systems which give rise to the forward scattering peak. The latter is supported by the long-range part of EPI due to the weakly screened Madelung interaction in the ionic-metallic structure of layered HTSC cuprates. In this approach EPI is responsible for the strength of pairing while the residual Coulomb interaction and spin fluctuations trigger the d-wave pairing.
Spin dynamics in high-TC superconducting cuprates
International Nuclear Information System (INIS)
Bourges, Ph.
2003-07-01
This work is dedicated to the detailed investigations of the magnetic resonance peak in the superconducting state of cuprates. The existence of such a peak could be the signature of a mechanism linked to magnetism that could explain high critical temperature superconductivity. Inelastic neutron scattering is an adequate tool for the understanding of cuprate properties because it reveals magnetic fluctuations whose behaviour and variety depend strongly on temperature and on the level of doping. The last part of this work is dedicated to the study of spin dynamics in YBa 2 Cu 3 O 6+x system
Doping dependence of Meissner effect in cuprate superconductors
International Nuclear Information System (INIS)
Feng Shiping; Huang Zheyu; Zhao Huaisong
2010-01-01
Within the t-t'-J model, the doping dependence of the Meissner effect in cuprate superconductors is studied based on the kinetic energy driven superconducting mechanism. Following the linear response theory, it is shown that the electromagnetic response consists of two parts, the diamagnetic current and the paramagnetic current, which exactly cancels the diamagnetic term in the normal state, and then the Meissner effect is obtained for all the temperature T ≤ T c throughout the superconducting dome. By considering the two-dimensional geometry of cuprate superconductors within the specular reflection model, the main features of the doping and temperature dependence of the local magnetic field profile, the magnetic field penetration depth, and the superfluid density observed on cuprate superconductors are well reproduced. In particular, it is shown that in analogy to the domelike shape of the doping dependent superconducting transition temperature, the maximal superfluid density occurs around the critical doping δ ∼ 0.195, and then decreases in both lower doped and higher doped regimes.
Yttrium aluminum garnet (YAG) obtained by rare-earth mixed oxide (RE2O3)
International Nuclear Information System (INIS)
Castro, D.F.; Daguano, J.K.M.F.; Rodrigues Junior, D.; Suzuki, P.A.; Silva, O.M.M.
2010-01-01
In this work, the substitution of commercial Y 2 O 3 by a rare earth mixed oxide, RE 2 O 3 , to form Yttrium aluminum Garnet-Y 3 Al 5 O 12 , was investigated. Al 2 O 3 :Y 2 O 3 and Al 2 O 3 :RE 2 O 3 powder-mixtures, in a molar ratio of 60:40, were milled and subsequently cold uniaxially-pressed. Compacts were sintered at 1000, 1400 or 1600 deg C, for 120 minutes. RE 2 O 3 oxide was characterized by high-resolution synchrotron X-ray diffraction (HRXRD) and compared to Y 2 O 3 . X-ray diffraction pattern of the RE 2 O 3 indicates a true solid solution formation. Rietveld refinement of the sintered YAG and (RE)AG reveled a similar crystal structure to the YAGs obtained by the use of Al 2 O 3 -Y 2 O 3 or Al 2 O 3 -RE 2 O 3 respectively. Microstructural analysis of both, YAG or (RE)AG, revealed similar grain sizes of about 2.5 μm besides mechanical properties, with hardness of 400HV and fracture toughness of 3.8MPa.m1/2. It could be, thus, demonstrated that pure Y 2 O 3 can be substituted by the rare-earth solid solution, RE 2 O 3 , in the formation YAGs, presenting similar microstructural and mechanical properties. (author)
Optical and electron microanalysis of cuprate superconductors
International Nuclear Information System (INIS)
Hoff, H.A.; Osofsky, M.S.; Toth, L.E.; Richards, L.E.; Pande, C.S.; Lechter, W.L.
1990-01-01
Individual anisotropic grains in heterogeneous and opaque cuprate materials, when viewed in a reflected-light optical microscope through crossed polarizers, often have characteristic colors, when a daylight source is used. Of the cuprate superconductors, regardless of charge carrier type, examined so far, only one characteristic color has been observed We have studied the presence of color and found a strong correlation with the existence of superconductivity. The change in color from insulator to metal to superconductor and the compositions corresponding to these changes found by quantitative energy dispersive x-ray spectroscopy on superconducting Tl-Sr-Ca-Cu-O and metallic but not superconducting La-Sr-Cu-O materials is discussed
Energy Technology Data Exchange (ETDEWEB)
Sakai, N; Murakami, M [International Superconductivity Technology Center, Tokyo (Japan); Shisa, A [Ishikawajima-Harima Heavy Industries Co., Ltd., Toky o(Japan); Hirata, H [Institute for Unmanned Space Experiment Free Flyer, Tokyo (Japan)
1999-11-25
Large single-grain bulk rare earth element (RE)-Ba-Cu-O superconductors can be used for various applications such magnetic bearings, load trapped field magnets. The magnetic field generated by bulk RE-Ba-Cu-O superconductors is proportional to its radius, however, the growth of a large single-grain bulk with good quality is difficult due to contamination from the substrate or the crucible and also due to liquid loss. Such problems can be solved by growing RE-Cu-O bulk in a microgravity environment, where the bulk can be supported by a seed crystal alone during crystal growth. Such experiments will be conducted in the Unmanned Space Experiment Recovery System (USERS) project. In this paper, the experiment plan and the present status of the system development are reported. (author)
The pseudogap in the c-axis optical conductivity in high Tc-cuprates
International Nuclear Information System (INIS)
Won, H.
1999-01-01
The pseudogap phenomenon is most remarkable in the underdoped region of high-T c cuprates. Since the superconducting state in the optimally doped high-T c cuprates is well described by the BCS-like d-wave superconductors, it is natural to assume that the pseudogap arises from the standard superconducting fluctuation. In particular in the layered compounds like high-T c cuprates Varlamov and his coworkers pointed out the density of states (DOS) correction to the superconducting fluctuation will play the crucial role. However, unfortunately in their analysis d-wave nature of the high-T c cuprates is ignored. Perhaps more seriously some unnecessary approximations were introduced in their analysis. The present theory gives somewhat different expressions of quasi-particle density of states for B = 0 and B ≠ 0, which can be tested experimentally. (orig.)
Metal–insulator crossover in high c cuprates: A gauge field ...
Indian Academy of Sciences (India)
A metal–insulator crossover appears in the experimental data for in-plane resistivity of underdoped cuprates and a range of superconducting cuprates in the presence of a strong magnetic field suppressing superconductivity. We propose an explanation for this phenomenon based on a gauge field theory approach to the t-J ...
Impurity induced resistivity upturns in underdoped cuprates
Energy Technology Data Exchange (ETDEWEB)
Das, Nabyendu, E-mail: nabyendudas@gmail.com; Singh, Navinder
2016-01-28
Impurity induced low temperature upturns in both the ab-plane and the c-axis dc-resistivities of cuprates in the pseudogap state have been observed in experiments. We provide an explanation of this phenomenon by incorporating impurity scattering of the charge carriers within a phenomenological model proposed by Yang, Rice and Zhang. The scattering between charge carriers and the impurity atom is considered within the lowest order Born approximation. Resistivity is calculated within Kubo formula using the impurity renormalized spectral functions. Using physical parameters for cuprates, we describe qualitative features of the upturn phenomena and its doping evolution that coincides with the experimental findings. We stress that this effect is largely due to the strong electronic correlations.
Impurity induced resistivity upturns in underdoped cuprates
International Nuclear Information System (INIS)
Das, Nabyendu; Singh, Navinder
2016-01-01
Impurity induced low temperature upturns in both the ab-plane and the c-axis dc-resistivities of cuprates in the pseudogap state have been observed in experiments. We provide an explanation of this phenomenon by incorporating impurity scattering of the charge carriers within a phenomenological model proposed by Yang, Rice and Zhang. The scattering between charge carriers and the impurity atom is considered within the lowest order Born approximation. Resistivity is calculated within Kubo formula using the impurity renormalized spectral functions. Using physical parameters for cuprates, we describe qualitative features of the upturn phenomena and its doping evolution that coincides with the experimental findings. We stress that this effect is largely due to the strong electronic correlations.
The oxygen isotope effect on the in-plane penetration depth in cuprate superconductors
International Nuclear Information System (INIS)
Khasanov, R; Shengelaya, A; Morenzoni, E; Conder, K; Savic, I M; Keller, H
2004-01-01
Muon spin rotation (μSR) studies of the oxygen isotope ( 16 O/ 18 O) effect (OIE) on the in-plane magnetic field penetration depth λ ab in cuprate high-temperature superconductors (HTS) are presented. First, the doping dependence of the OIE on the transition temperature T c in various HTS is briefly discussed. It is observed that different cuprate families show similar doping dependences of the OIE on T c . Then, bulk μSR, low-energy μSR, and magnetization studies of the total and site-selective OIE on λ ab are described in some detail. A substantial OIE on λ ab was observed in various cuprate families at all doping levels, suggesting that cuprate HTS are non-adiabatic superconductors. The experiments clearly demonstrate that the total OIE on T c and λ ab arise from the oxygen sites within the superconducting CuO 2 planes, demonstrating that the phonon modes involving the movement of planar oxygen are dominantly coupled to the supercarriers. Finally, it is shown that the OIE on T c and λ ab exhibit a relation that appears to be generic for different families of cuprate HTS. The observation of these unusual isotope effects implies that lattice effects play an essential role in cuprate HTS and have to be considered in any realistic model of high-temperature superconductivity
Effect of light rare earth doping in 123 high temperature supercoductors
Directory of Open Access Journals (Sweden)
M. Mirzadeh
2006-09-01
Full Text Available We have studied the structural and electrical properties of Gd(Ba2-xLaxCu3O7+δ [Gd(BaLa123], Gd(Ba2-xNdxCu3O7+δ [Gd(BaNd123], and Nd(Ba2-xPrxCu3O7+δ [Nd(BaPr123] compounds with 0.0≤x≤0.8 prepared by the standard solid-state reaction. The XRD patterns show that all of the samples with x≤0.5 are isosructure 123 phase, but in Gd(BaNd123 and Nd(BaPr123 there are several impurity peaks in the XRD patterns for x≥0.6. We estimated the xcsolubility=1.1, 0.6 and 0.55 in Gd(BaLa123, Nd(BaPr123, and Gd(BaNd123, respectively. The resistivity increases with the increase of doping. The decrease of Tc with the increase of Pr doping is faster than Nd and La doping. The normal-state resistivity is fitted for two and three dimensional variable range hopping (2D&amp3D-VRH and Coulomb gap (CG regimes, separately. Our results indicate that the dominant mechanism for x≥xcSIT is 3D-VRH. The broadening of magnetoresistance have been investigated by TAFC and AH models. The pinning energy and Josephson coupling energy, decrease with the increase of applied magnetic field as U~H-β, these values also decrease with doping concentration Pr is more effective than Nd and La.
Visualizing electron pockets in cuprate superconductors
Das, Tanmoy; Markiewicz, R. S.; Bansil, A.; Balatsky, A. V.
2012-06-01
Fingerprints of the electron pocket in cuprates have been obtained only in numerous magnetotransport measurements, but its absence in spectroscopic observations poses a long-standing mystery. We develop a theoretical tool to provide ways to detect electron pockets via spectroscopies including scanning tunneling microscopy (STM) spectra, inelastic neutron scattering (INS), and angle-resolved photoemission spectroscopy (ARPES). We show that the quasiparticle-interference (QPI) pattern, measured by STM, shows an additional seven q vectors associated with the scattering on the electron pocket than that on the hole pocket. Furthermore, the Bogolyubov quasiparticle scatterings of the electron pocket lead to a second magnetic resonance mode in the INS spectra at a higher resonance energy. Finally, we reanalyze some STM, INS, and ARPES experimental data of several cuprates which dictates the direct fingerprints of electron pockets in these systems.
First-principles study of rare-earth (RE) cobaltites (RE=Nd,Sm,Gd,Dy,Er,Lu)
Topsakal, M.; Wentzcovitch, R. M.
2014-12-01
The lanthanide series of the periodic table comprises 15 members ranging from Lanthanum (La) to Lutetium (Lu). Although they are more abundant than silver, and some of them are more abundant than lead, they are known as rare-earth (RE) elements. The "rare" in their name refers to the difficulty of obtaining the pure elements, not to their abundances in nature. They are never found as free metals in the Earth's crust and do not exist as pure minerals. Using first-principles plane-wave calculations, we investigate the structural and electronic properties of rare-earth cobaltites (RECoO3). Structurally consistent Hubbard U treatment was shown to essential for proper description of strongly correlated cobalt-d electrons. We successfully capture the experimentally observed structural trends and give first-principles insights on interesting phenomena related with the cobalt spin state change. It was demonstrated that increase of crystal-field splitting energy between eg-t2g orbitals and shrinking of unoccupied σ*-bonding eg bands are responsible for the increase of onset spin-state transition temperature along the series.
Insights on the cuprate high energy anomaly observed in ARPES
International Nuclear Information System (INIS)
Moritz, B.; Johnston, S.; Devereaux, T.P.
2010-01-01
Recently, angle-resolved photoemission spectroscopy has been used to highlight an anomalously large band renormalization at high binding energies in cuprate superconductors: the high energy 'waterfall' or high energy anomaly (HEA). The anomaly is present for both hole- and electron-doped cuprates as well as the half-filled parent insulators with different energy scales arising on either side of the phase diagram. While photoemission matrix elements clearly play a role in changing the aesthetic appearance of the band dispersion, i.e. creating a 'waterfall'-like appearance, they provide an inadequate description for the physics that underlies the strong band renormalization giving rise to the HEA. Model calculations of the single-band Hubbard Hamiltonian showcase the role played by correlations in the formation of the HEA and uncover significant differences in the HEA energy scale for hole- and electron-doped cuprates. In addition, this approach properly captures the transfer of spectral weight accompanying doping in a correlated material and provides a unifying description of the HEA across both sides of the cuprate phase diagram. We find that the anomaly demarcates a transition, or cross-over, from a quasiparticle band at low binding energies near the Fermi level to valence bands at higher binding energy, assumed to be of strong oxygen character.
Insights on the cuprate high energy anomaly observed in ARPES
Energy Technology Data Exchange (ETDEWEB)
Moritz, B., E-mail: moritzb@slac.stanford.ed [Stanford Institute for Materials and Energy Science, SLAC National Accelerator Laboratory, Menlo Park, CA 94025 (United States); Department of Physics and Astrophysics, University of North Dakota, Grand Forks, ND 58202 (United States); Johnston, S. [Stanford Institute for Materials and Energy Science, SLAC National Accelerator Laboratory, Menlo Park, CA 94025 (United States); Department of Physics and Astronomy, University of Waterloo, Waterloo, ON N2L 3G1 (Canada); Devereaux, T.P. [Stanford Institute for Materials and Energy Science, SLAC National Accelerator Laboratory, Menlo Park, CA 94025 (United States); Geballe Laboratory for Advanced Materials, Stanford University, Stanford, CA 94305 (United States)
2010-07-15
Recently, angle-resolved photoemission spectroscopy has been used to highlight an anomalously large band renormalization at high binding energies in cuprate superconductors: the high energy 'waterfall' or high energy anomaly (HEA). The anomaly is present for both hole- and electron-doped cuprates as well as the half-filled parent insulators with different energy scales arising on either side of the phase diagram. While photoemission matrix elements clearly play a role in changing the aesthetic appearance of the band dispersion, i.e. creating a 'waterfall'-like appearance, they provide an inadequate description for the physics that underlies the strong band renormalization giving rise to the HEA. Model calculations of the single-band Hubbard Hamiltonian showcase the role played by correlations in the formation of the HEA and uncover significant differences in the HEA energy scale for hole- and electron-doped cuprates. In addition, this approach properly captures the transfer of spectral weight accompanying doping in a correlated material and provides a unifying description of the HEA across both sides of the cuprate phase diagram. We find that the anomaly demarcates a transition, or cross-over, from a quasiparticle band at low binding energies near the Fermi level to valence bands at higher binding energy, assumed to be of strong oxygen character.
Energy Technology Data Exchange (ETDEWEB)
Borja-Urby, R. [Grupo de Espectroscopia de Materiales Avanzados y Nanoestructurados (EMANA), Centro de Investigaciones en Optica A. C., Leon, Gto. 37150 (Mexico); Diaz-Torres, L.A., E-mail: ditlacio@cio.mx [Grupo de Espectroscopia de Materiales Avanzados y Nanoestructurados (EMANA), Centro de Investigaciones en Optica A. C., Leon, Gto. 37150 (Mexico); Salas, P. [Centro de Fisica Aplicada y Tecnologia Avanzada, Universidad Nacional Autonoma de Mexico, A.P. 1-1010, Queretaro, Qro. 76000 (Mexico); Angeles-Chavez, C. [Instituto Mexicano del Petroleo, Ciudad de Mexico, D. F. 07730 (Mexico); Meza, O. [Grupo de Espectroscopia de Materiales Avanzados y Nanoestructurados (EMANA), Centro de Investigaciones en Optica A. C., Leon, Gto. 37150 (Mexico)
2011-10-25
Highlights: > Trivalent rare earth (RE) substitution on Zr{sup 4+} sites in BaZrO{sub 3} lead to band gap narrowing. > RE substitution lead to enhanced blue-green intrinsic emission of nanocrystalline BaZrO{sub 3} > Blue-green hue of BaZrO3:RE depends on RE dopant and excitation UV wavelength > BaZrO3: Dy{sup 3+} PL chromatic coordinates correspond to pure white color coordinates of CIE 1931 model - Abstract: The wet synthesis hydrothermal method at 100 deg. C was used to elaborate barium zirconate (BaZrO{sub 3}) unpurified with 0.5 mol% of different rare earth ions (RE = Yb, Er, Dy, Eu, Ce). Morphological, structural and UV-photoluminescence properties depend on the substituted rare earth ionic radii. While the crystalline structure of RE doped BaZrO{sub 3} remains as a cubic perovskite for all substituted RE ions, its band gap changes between 4.65 and 4.93 eV. Under 267 nm excitation the intrinsic green photoluminescence of the as synthesized BaZrO{sub 3}: RE samples is considerably improved by the substitution on RE ions. For 1000 deg. C annealed samples, under 267 nm, the photoluminescence is dominated by the intrinsic BZO emission. It is interesting to notice that Dy{sup 3+}, Er{sup 3+} and Yb{sup 3+} doped samples present whitish emissions that might be useful for white light generation under 267 nm excitation. CIE color coordinates are reported for all samples.
The oxygen isotope effect on the in-plane penetration depth in cuprate superconductors
Energy Technology Data Exchange (ETDEWEB)
Khasanov, R [Physik-Institut der Universitaet Zuerich, CH-8057 Zurich (Switzerland); Shengelaya, A [Physik-Institut der Universitaet Zuerich, CH-8057 Zurich (Switzerland); Morenzoni, E [Laboratory for Muon Spin Spectroscopy, Paul Scherrer Institute, CH-5232 Villigen PSI (Switzerland); Conder, K [Laboratory for Neutron Scattering, ETH Zuerich and PSI Villigen, CH-5232 Villigen PSI (Switzerland); Savic, I M [Faculty of Physics, University of Belgrade, 11001 Belgrade (Serbia and Montenegro); Keller, H [Physik-Institut der Universitaet Zuerich, CH-8057 Zurich (Switzerland)
2004-10-13
Muon spin rotation ({mu}SR) studies of the oxygen isotope ({sup 16}O/{sup 18}O) effect (OIE) on the in-plane magnetic field penetration depth {lambda}{sub ab} in cuprate high-temperature superconductors (HTS) are presented. First, the doping dependence of the OIE on the transition temperature T{sub c} in various HTS is briefly discussed. It is observed that different cuprate families show similar doping dependences of the OIE on T{sub c}. Then, bulk {mu}SR, low-energy {mu}SR, and magnetization studies of the total and site-selective OIE on {lambda}{sub ab} are described in some detail. A substantial OIE on {lambda}{sub ab} was observed in various cuprate families at all doping levels, suggesting that cuprate HTS are non-adiabatic superconductors. The experiments clearly demonstrate that the total OIE on T{sub c} and {lambda}{sub ab} arise from the oxygen sites within the superconducting CuO{sub 2} planes, demonstrating that the phonon modes involving the movement of planar oxygen are dominantly coupled to the supercarriers. Finally, it is shown that the OIE on T{sub c} and {lambda}{sub ab} exhibit a relation that appears to be generic for different families of cuprate HTS. The observation of these unusual isotope effects implies that lattice effects play an essential role in cuprate HTS and have to be considered in any realistic model of high-temperature superconductivity.
International Nuclear Information System (INIS)
Gopalakrishnan, J.; Shivakumara, C.; Manivannan, V.
1994-01-01
A new series of superconducting thallium cuprates of nominal composition, (Tl 2-x Cu x )Ba 2 CaCu 2 O 8 (0 c s in the range 110--99K. The phases are metastable, decomposing at higher temperatures (∼1,150K) to a mixture of thallium cuprates, CuO and BaCuO 2 . Significantly, x=1 member decomposes at 1,150K to mixture of Tl2223, CuO and BaCuO 2 . Chemical titrations involving oxidation of bromide ions reveals that the copper substituting for thallium in (Tl 2-x Cu x )Ba 2 CaCu 2 O 8 most likely occurs in the III oxidation state for x≤0.25 and in a mixed state (II,III) state for x>0.25
Fermion local charged boson model and cuprate superconductors
International Nuclear Information System (INIS)
Sinha, K.P.; Kakani, S.L.
2002-01-01
One of the most exciting developments in Science in past few years is the discovery of high temperature superconductivity (HTSC) in cuprates. It has been observed that the superconducting state in these cuprates is rather normal compared to the anomalous normal state. This discovery has led to deluge of experimental and theoretical researches all along the world. These cuprates are close to metal-insulator transition and the stability of the insulating and metallic phase depends on the degree of doping. Measurements of physical properties of these systems have revealed many anomalous results both in the superconducting and normal states, e.g. d-wave superconducting gap, the presence of pseudo gap in the normal state, static or dynamic striped structure of CuO 2 planes etc. These have posed serious theoretical challenges towards formulating the mechanisms of pairing and explanation of anomalous behaviour. Several theoretical proposals have been advanced and only a few are likely to survive in the teeth of some reliable experimental data. A combined mechanism mediated by phonons and lochons (local charged bosons, local pairs or bipolarons) for the pairing of fermions (holes or electrons) belonging to a wide band provides a microscopic explanation of anomalous normal state properties of HTSC cuprates and vindicates features of the phenomenological marginal Fermi liquid formulation. In the present review article detailed features of combined lochon and phonon mediated pairing mechanism are presented and a contact with the normal and superconducting state properties of HTSC in YBa 2 Cu 3 O x does indicate pair hopping between planes via such resonant centres lying in between the CuO 2 planes. (author)
Monazite processing of tin mining waste : rare earth separation from U and Th
International Nuclear Information System (INIS)
Hafni, L.N.; Faizal, R.; Sugeng, W.; Budi, S.; Arif, S.; Susilaningtyas
2000-01-01
Separation of Rare Earths from U and Th of Bangka monazite digestion solution, by using NaOH reagent and precipitation system has been carried out. The aim of the experiment is to find a condition of RE(OH) sub.3 precipitation to produce maximal RE recovery and high purity of RE that are free from radioelements U and Th. Parameters studied were pH, NaOH normality and precipitation time. The optimal conditions obtained were pH 9.8, 1N NaOH and 3 hours precipitation time. At this condition recovery of the RE(OH) sub.3 is 99.79 % and Th 4.52 %. However uranium and phosphate were not detected. Purity of the products are RE(OH) sub.3 98.868 %, Th(OH) sub.4 0.009 % and the others 1.123 %. (author)
International Nuclear Information System (INIS)
Suen, Nian-Tzu; Bobev, Svilen
2012-01-01
Reported are the synthesis and structural characterization of Ce_5Mg_8Ge_8 (its own structure type), CeMg_2_-_xGe_2_+_x (BaAl_4-type structure), RE_4Mg_7Ge_6 (RE = Ce-Nd, Sm; La_4Mg_7Ge_6-type structure), and RE_4Mg_5Ge_6 (RE = Ce, Pr; Tm_4Zn_5Ge_6-type structure). The structures of these compounds have been established by single-crystal and powder X-ray diffraction. These compounds are closely related to each other not only in their chemical compositions but also in their structures. A common structural feature of all are MgGe_4 tetrahedra, which are connected by corner- and/or edge-sharing into complex polyanionic frameworks with the rare-earth metal atoms filling the ''empty'' space. The structures are compared to known types of structures, and we have investigated the chemical bonding in Ce_5Mg_8Ge_8 with electronic structure calculations, which were carried out by the tight-bonding linear muffin-tin orbital (TB-LMTO) method. (Copyright copyright 2012 WILEY-VCH Verlag GmbH and Co. KGaA, Weinheim)
d+s wave superconductivity: analysis of the electronic Raman data of YBa2Cu3O7-δ and other cuprates
International Nuclear Information System (INIS)
Nemetschek, R.; Hackl, R.; Opel, M.; Philipp, R.; Beal-Monod, M.T.; Bieri, J.B.; Maki, K.; Erb, A.; Walker, E.
1998-01-01
After briefly recalling the d+s model valid for some anisotropic high T c superconductors, we present a theory of electronic Raman spectra in that model and then compare it with new experimental data obtained for an overdoped Y123 single crystal. The d+s model appears to describe satisfactorily the experimental results, indicating a possible doping dependence of the mixing ratio. We note that the Raman spectrum of the overdoped Bi2212 could also be accounted for by the d+s superconductivity model. The case of Hg1212 (or Hg1223) is reexamined. It appears that the spontaneous breakdown of d-wave symmetry may be rather universal in high T c cuprates. (orig.)
Diffusion of nonequilibrium quasi-particles in a cuprate superconductor
International Nuclear Information System (INIS)
Gedik, N.; Orenstein, J.; Liang, Ruixing; Bonn, D.A.; Hardy, W.N.
2003-01-01
We report a transport study of nonequilibrium quasi-particles in a high-transition-temperature cuprate superconductor using the transient grating technique. Low-intensity laser excitation (at a photon energy of 1.5 electron volts) was used to introduce a spatially periodic density of quasi-particles into a high-quality untwinned single crystal of YBa2Cu3O6.5. Probing the evolution of the initial density through space and time yielded the quasi-particle diffusion coefficient and the inelastic and elastic scattering rates. The technique reported here is potentially applicable to precision measurements of quasi-particle dynamics not only in cuprate superconductors but in other electronic systems as well
Interpretation of scanning tunneling quasiparticle interference and impurity states in cuprates.
Kreisel, A; Choubey, Peayush; Berlijn, T; Ku, W; Andersen, B M; Hirschfeld, P J
2015-05-29
We apply a recently developed method combining first principles based Wannier functions with solutions to the Bogoliubov-de Gennes equations to the problem of interpreting STM data in cuprate superconductors. We show that the observed images of Zn on the surface of Bi_{2}Sr_{2}CaCu_{2}O_{8} can only be understood by accounting for the tails of the Cu Wannier functions, which include significant weight on apical O sites in neighboring unit cells. This calculation thus puts earlier crude "filter" theories on a microscopic foundation and solves a long-standing puzzle. We then study quasiparticle interference phenomena induced by out-of-plane weak potential scatterers, and show how patterns long observed in cuprates can be understood in terms of the interference of Wannier functions above the surface. Our results show excellent agreement with experiment and enable a better understanding of novel phenomena in the cuprates via STM imaging.
High-energy kink in the single-particle spectra of cuprates
International Nuclear Information System (INIS)
Cojocaru, S.; Citro, R.; Marinaro, M.
2008-01-01
Within a phenomenological model where electrons are coupled to a bosonic mode in a generic form of damped oscillator, we analyze the high-energy kink recently observed in ARPES experiments on cuprates. It is shown that the model allows to describe the main anomalous features found in experiments, such as the broad incoherent spectral weight, the 'waterfall dispersion', its doping and temperature dependence. In contrast to the low-energy kink, presence of significant damping is required to account for the anomalies. The 'bosonic mode' is related to the incoherent excitation peak observed in optical conductivity spectra of cuprates
High-energy kink in the single-particle spectra of cuprates
Energy Technology Data Exchange (ETDEWEB)
Cojocaru, S. [Dipartimento di Fisica ' E. R. Caianiello' and C.N.I.S.M., Universita degli Studi di Salerno, Via S. Allende, I-84081 Baronissi (Italy); Institute of Applied Physics, Chisinau 2028 (Moldova, Republic of); Citro, R. [Dipartimento di Fisica ' E. R. Caianiello' and C.N.I.S.M., Universita degli Studi di Salerno, Via S. Allende, I-84081 Baronissi (Italy)], E-mail: citro@sa.infn.it; Marinaro, M. [Dipartimento di Fisica ' E. R. Caianiello' and C.N.I.S.M., Universita degli Studi di Salerno, Via S. Allende, I-84081 Baronissi (Italy); I.I.A.S.S., Via G. Pellegrino, n. 19 84019 Vietri sul Mare (Italy)
2008-04-01
Within a phenomenological model where electrons are coupled to a bosonic mode in a generic form of damped oscillator, we analyze the high-energy kink recently observed in ARPES experiments on cuprates. It is shown that the model allows to describe the main anomalous features found in experiments, such as the broad incoherent spectral weight, the 'waterfall dispersion', its doping and temperature dependence. In contrast to the low-energy kink, presence of significant damping is required to account for the anomalies. The 'bosonic mode' is related to the incoherent excitation peak observed in optical conductivity spectra of cuprates.
Tsuei, C. C.; Gupta, A.; Trafas, G.; Mitzi, D.
1994-03-01
The synthesis of high-quality films of the recently discovered mercury-based cuprate films with high transition temperatures has been plagued by problems such as the air sensitivity of the cuprate precursor and the volatility of Hg and HgO. These processing difficulties have been circumvented by a technique of atomic-scale mixing of the HgO and cuprate precursors, use of a protective cap layer, and annealing in an appropriate Hg and O_2 environment. With this procedure, a zero-resistance transition temperature as high as 124 kelvin in c axis-oriented epitaxial HgBa_2CaCu_2O6+δ films has been achieved.
Tsuei, C C; Gupta, A; Trafas, G; Mitzi, D
1994-03-04
The synthesis of high-quality films of the recently discovered mercury-based cuprate films with high transition temperatures has been plagued by problems such as the air sensitivity of the cuprate precursor and the volatility of Hg and HgO. These processing difficulties have been circumvented by a technique of atomic-scale mixing of the HgO and cuprate precursors, use of a protective cap layer, and annealing in an appropriate Hg and O(2) environment. With this procedure, a zero-resistance transition temperature as high as 124 kelvin in c axis-oriented epitaxial HgBa(2)CaCu(2)O(6+delta) films has been achieved.
Energy Technology Data Exchange (ETDEWEB)
Zhou, X.J.
2010-04-30
In addition to the record high superconducting transition temperature (T{sub c}), high temperature cuprate superconductors are characterized by their unusual superconducting properties below T{sub c}, and anomalous normal state properties above T{sub c}. In the superconducting state, although it has long been realized that superconductivity still involves Cooper pairs, as in the traditional BCS theory, the experimentally determined d-wave pairing is different from the usual s-wave pairing found in conventional superconductors. The identification of the pairing mechanism in cuprate superconductors remains an outstanding issue. The normal state properties, particularly in the underdoped region, have been found to be at odd with conventional metals which is usually described by Fermi liquid theory; instead, the normal state at optimal doping fits better with the marginal Fermi liquid phenomenology. Most notable is the observation of the pseudogap state in the underdoped region above T{sub c}. As in other strongly correlated electrons systems, these unusual properties stem from the interplay between electronic, magnetic, lattice and orbital degrees of freedom. Understanding the microscopic process involved in these materials and the interaction of electrons with other entities is essential to understand the mechanism of high temperature superconductivity. Since the discovery of high-T{sub c} superconductivity in cuprates, angle-resolved photoemission spectroscopy (ARPES) has provided key experimental insights in revealing the electronic structure of high temperature superconductors. These include, among others, the earliest identification of dispersion and a large Fermi surface, an anisotropic superconducting gap suggestive of a d-wave order parameter, and an observation of the pseudogap in underdoped samples. In the mean time, this technique itself has experienced a dramatic improvement in its energy and momentum resolutions, leading to a series of new discoveries not
International Nuclear Information System (INIS)
Zhou, X.J.
2010-01-01
In addition to the record high superconducting transition temperature (T c ), high temperature cuprate superconductors are characterized by their unusual superconducting properties below T c , and anomalous normal state properties above T c . In the superconducting state, although it has long been realized that superconductivity still involves Cooper pairs, as in the traditional BCS theory, the experimentally determined d-wave pairing is different from the usual s-wave pairing found in conventional superconductors. The identification of the pairing mechanism in cuprate superconductors remains an outstanding issue. The normal state properties, particularly in the underdoped region, have been found to be at odd with conventional metals which is usually described by Fermi liquid theory; instead, the normal state at optimal doping fits better with the marginal Fermi liquid phenomenology. Most notable is the observation of the pseudogap state in the underdoped region above T c . As in other strongly correlated electrons systems, these unusual properties stem from the interplay between electronic, magnetic, lattice and orbital degrees of freedom. Understanding the microscopic process involved in these materials and the interaction of electrons with other entities is essential to understand the mechanism of high temperature superconductivity. Since the discovery of high-T c superconductivity in cuprates, angle-resolved photoemission spectroscopy (ARPES) has provided key experimental insights in revealing the electronic structure of high temperature superconductors. These include, among others, the earliest identification of dispersion and a large Fermi surface, an anisotropic superconducting gap suggestive of a d-wave order parameter, and an observation of the pseudogap in underdoped samples. In the mean time, this technique itself has experienced a dramatic improvement in its energy and momentum resolutions, leading to a series of new discoveries not thought possible
Dzhumanov, S.; Karimboev, E. X.
2014-07-01
In this paper, we show that the pseudogap in the excitation spectra of high-Tc cuprates together with the impurity phase and charge inhomogeneity plays key roles in determining the essential features of their anomalous specific heat properties observed above Tc. We consider the doped cuprate superconductor as a multi-carrier model system (which consists of intrinsic and extrinsic polarons and pre-formed bosonic Cooper pairs) and study the competing pseudogap and impurity effects on the normal-state electronic specific heat of high-Tc cuprates taking into account charge inhomogeneities. We argue that unconventional electron-phonon interactions are responsible for the precursor Cooper pairing in the polaronic band below a mean-field temperature T∗ and the existence of a pseudogap above Tc in the cuprates. The electronic specific heat Ce(T) of doped cuprates below T∗ is calculated taking into account three contributions coming from the excited components of Cooper pairs, the ideal Bose-gas of incoherent Cooper pairs and the unpaired carriers in the impurity band. Above T∗, two contributions to Ce(T) coming from the unpaired intrinsic and extrinsic polarons are calculated within the two-component degenerate Fermi-gas model. By comparing our results with the experimental Ce(T) data obtained for La- and Y-based cuprates, we find that the observed behaviors of Ce(T) (below and above T∗) are similar to the calculated results for Ce(T) and the BCS-type jumps of Ce(T) at T∗ may be depressed by the impurity effects and may become more or less pronounced BCS-type anomalies in Ce(T) .
Temperature and doping dependence of the high-energy kink in cuprates.
Zemljic, M M; Prelovsek, P; Tohyama, T
2008-01-25
It is shown that spectral functions within the extended t-J model, evaluated using the finite-temperature diagonalization of small clusters, exhibit the high-energy kink in single-particle dispersion consistent with recent angle-resolved photoemission results on hole-doped cuprates. The kink and waterfall-like features persist up to large doping and to temperatures beyond J; hence, the origin can be generally attributed to strong correlations and incoherent hole propagation at large binding energies. In contrast, our analysis predicts that electron-doped cuprates do not exhibit these phenomena in photoemission.
Quantum critical scaling at the edge of Fermi liquid stability in a cuprate superconductor.
Butch, Nicholas P; Jin, Kui; Kirshenbaum, Kevin; Greene, Richard L; Paglione, Johnpierre
2012-05-29
In the high-temperature cuprate superconductors, the pervasiveness of anomalous electronic transport properties suggests that violation of conventional Fermi liquid behavior is closely tied to superconductivity. In other classes of unconventional superconductors, atypical transport is well correlated with proximity to a quantum critical point, but the relative importance of quantum criticality in the cuprates remains uncertain. Here, we identify quantum critical scaling in the electron-doped cuprate material La(2-x)Ce(x)CuO(4) with a line of quantum critical points that surrounds the superconducting phase as a function of magnetic field and charge doping. This zero-temperature phase boundary, which delineates a metallic Fermi liquid regime from an extended non-Fermi liquid ground state, closely follows the upper critical field of the overdoped superconducting phase and gives rise to an expanse of distinct non-Fermi liquid behavior at finite temperatures. Together with signatures of two distinct flavors of quantum fluctuations, these facts suggest that quantum criticality plays a significant role in shaping the anomalous properties of the cuprate phase diagram.
Energy Technology Data Exchange (ETDEWEB)
Arko, A.J.; List, R.S.; Bartlett, R.J.; Cheong, S.W.; Fisk, Z.; Thompson, J.D.; Olson, C.G.; Yang, A.B.; Liu, R.; Gu, C.; Veal, B.W.; Liu, J.Z.; Paulikas, A.P.; Vandervoort, K.; Claus, H.; Campuzano, J.C.; Schirber, J.E.; Shinn, N.D.
1989-01-01
We have performed angle-integrated and angle-resolved photoemission measurements at 20 K on well-characterized single crystals of high-T/sub c/ cuprates (both 1:2:3-type and 2:2:1:2-type) cleaved in situ, and find a relatively large, resolution limited Fermi edge which shows large amplitude variations with photon energy, indicative of band structure final state effects. The lineshapes of the spectra of the 1:2:3 materials as a function of photon energy are well reproduced by band structure predictions, indicating a correct mix of 2p and 3d orbitals on the calculations, while the energy positions of the peaks agree with calculated bands only to within /approx/0.5 eV. This may yet prove to reflect the effects of Coulomb correlation. We nevertheless conclude that a Fermi liquid approach to conductivity is appropriate. Angle-resolved data, while still incomplete, suggest agreement with the Fermi surface predicted by the LDA calculations. A BCS-like energy gap is observed in the 2:2:1:2 materials, whose magnitude is twice the weak coupling BCS value (i.e., 2/Delta/ = 7 KT/sub c/). 49 refs., 11 figs.
Metal-insulator crossover in superconducting cuprates in strong magnetic fields
International Nuclear Information System (INIS)
Marchetti, P.A.; Su Zhaobin; Yu Lu
2001-02-01
The metal-insulator crossover of the in-plane resistivity upon temperature decrease, recently observed in several classes of cuprate superconductors, when a strong magnetic field suppresses the superconductivity, is explained using the U(1)xSU(2) Chern-Simons gauge field theory. The origin of this crossover is the same as that for a similar phenomenon observed in heavily underdoped cuprates without magnetic field. It is due to the interplay between the diffusive motion of the charge carriers and the 'peculiar' localization effect due to short-range antiferromagnetic order. We also calculate the in-plane transverse magnetoresistance which is in a fairly good agreement with available experimental data. (author)
Angle-resolved photoemission in high Tc cuprates from theoretical viewpoints
International Nuclear Information System (INIS)
Tohyama, T.; Maekawa, S.
2000-01-01
The angle-resolved photoemission (ARPES) technique has been developed rapidly over the last decade, accompanied by the improvement of energy and momentum resolutions. This technique has been established as the most powerful tool to investigate the high T c cuprate superconductors. We review recent ARPES data on the cuprates from a theoretical point of view, with emphasis on the systematic evolution of the spectral weight near the momentum (π, 0) from insulator to overdoped systems. The effects of charge stripes on the ARPES spectra are also reviewed. Some recent experimental and theoretical efforts to understand the superconducting state and the pseudogap phenomenon are discussed. (author)
Energy Technology Data Exchange (ETDEWEB)
Suen, Nian-Tzu; Broda, Matthew; Bobev, Svilen, E-mail: bobev@udel.edu
2014-09-15
Reported are the synthesis and the structural characterization of an extended family of rare-earth metal–germanides with a general formula RE{sub 5–x}Ca{sub x}Ge{sub 3} (RE=Y, Ce–Nd, Sm, Gd–Tm and Lu; x<2). All twelve phases are isotypic, crystallizing with the Mn{sub 5}Si{sub 3} structure type (Pearson index hP16, hexagonal space group P6{sub 3}/mcm); they are the Ca-substituted variants of the corresponding RE{sub 5}Ge{sub 3} binaries. Across the series, despite some small variations in the Ca-uptake, the unit cell volumes decrease monotonically, following the lanthanide contraction. Temperature dependent DC magnetization measurements reveal paramagnetic behavior in the high temperature range, and the obtained effective moments are consistent with free-ion RE{sup 3+} ground state, as expected from prior studies of the binary RE{sub 5}Ge{sub 3} phases. The onset of magnetic ordering is observed in the low temperature range, and complex magnetic interactions (ferromagnetic/ferrimagnetic) can be inferred, different from the binary phases RE{sub 5}Ge{sub 3}, which are known as antiferromagnetic. In order to understand the role of Ca in the bonding, the electronic structures of the La{sub 5}Ge{sub 3} and the hypothetical compounds La{sub 2}Ca{sub 3}Ge{sub 3} and La{sub 3}Ca{sub 2}Ge{sub 3} with ordered metal atoms are compared and discussed. - Graphical abstract: The family of rare-earth metal–calcium–germanides with the general formula RE{sub 5–x}Ca{sub x}Ge{sub 3} (RE=Y, Ce–Nd, Sm, Gd–Tm and Lu) crystallize in the hexagonal space group P6{sub 3}/mcm (No. 193, Pearson symbol hP16) with a structure that is a variant of the Mn{sub 5}Si{sub 3} structure type. - Highlights: • The newly synthesized RE{sub 5–x}Ca{sub x}Ge{sub 3} (RE=Y, Ce–Nd, Sm, Gd–Tm and Lu) constitute an extended family. • The structure is a substitution variant of the hexagonal Mn{sub 5}Si{sub 3} structure type. • Ca-uptake is the highest in the early members, and
A study on artificial rare earth (RE2O3) based neutron absorber
International Nuclear Information System (INIS)
KIM, Kyung-O; Kyung KIM, Jong
2015-01-01
A new concept of a neutron absorption material (i.e., an artificial rare earth compound) was introduced for criticality control in a spent fuel storage system. In particular, spent nuclear fuels were considered as a potential source of rare earth elements because the nuclear fission of uranium produces a full range of nuclides. It was also found that an artificial rare earth compound (RE 2 O 3 ) as a High-Level Waste (HLW) was naturally extracted from pyroprocessing technology developed for recovering uranium and transuranic elements (TRU) from spent fuels. In this study, various characteristics (e.g., activity, neutron absorption cross-section) were analyzed for validating the application possibility of this waste compound as a neutron absorption material. As a result, the artificial rare earth compound had a higher neutron absorption probability in the entire energy range, and it can be used for maintaining sub-criticality for more than 40 years on the basis of the neutron absorption capability of Boral™. Therefore, this approach is expected to vastly improve the efficiency of radioactive waste management by simultaneously keeping HLW and spent nuclear fuel in a restricted space. - Highlights: • Quantitative analysis of rare earth elements in PWR spent fuels. • Extraction of artificial rare earth compound using pyroprocessing technology. • Characteristic analysis of artificial rare earth elements. • Performance evaluation of artificial rare earth for criticality control.
Scheuerlein, C.; Grether, A; Rikel, M O; Hudspeth, J; Sugano, M; Ballarino, A; Bottura, L
2016-01-01
The electromechanical properties of different cuprate high-temperature superconductors, notably two ReBCO tapes, a reinforced and a nonreinforced Bi-2223 tape, and a Bi-2212 wire, have been studied. The axial tensile stress and strain, as well as the transverse compressive stress limits at which an irreversible critical current degradation occurs, are compared. The experimental setup has been integrated in a high-energy synchrotron beamline, and the self-field critical current and lattice parameter changes as a function of tensile stress and strain of a reinforced Bi-2223 tape have been measured simultaneously. Initially, the Bi-2223 filaments exhibit nearly linear elastic behavior up to the strain at which an irreversible degradation is observed. At 77 K, an axial Bi-2223 filament precompression of 0.09% in the composite tape and a Bi-2223 Poisson ratio ν = 0.21 have been determined.
Renormalized modes in cuprate superconductors
Gupta, Anushri; Kumari, Anita; Verma, Sanjeev K.; Indu, B. D.
2018-04-01
The renormalized mode frequencies are obtained with the help of quantum dynamical approach of many body phonon Green's function technique via a general Hamiltonian (excluding BCS Hamiltonian) including the effects of phonons and electrons, anharmonicities and electron-phonon interactions. The numerical estimates have been carried out to study the renormalized mode frequency of high temperature cuprate superconductor (HTS) YBa2Cu3O7-δ using modified Born-Mayer-Huggins interaction potential (MBMHP) best applicable to study the dynamical properties of all HTS.
Directory of Open Access Journals (Sweden)
Fapeng Yu
2014-07-01
Full Text Available Rare-earth calcium oxyborate crystals, ReCa4O(BO33 (ReCOB, Re = Er, Y, Gd, Sm, Nd, Pr, and La , are potential piezoelectric materials for ultrahigh temperature sensor applications, due to their high electrical resistivity at elevated temperature, high piezoelectric sensitivity and temperature stability. In this paper, different techniques for ReCOB single-crystal growth are introduced, including the Bridgman and Czochralski pulling methods. Crystal orientations and the relationships between the crystallographic and physical axes of the monoclinic ReCOB crystals are discussed. The procedures for dielectric, elastic, electromechanical and piezoelectric property characterization, taking advantage of the impedance method, are presented. In addition, the maximum piezoelectric coefficients for different piezoelectric vibration modes are explored, and the optimized crystal cuts free of piezoelectric cross-talk are obtained by rotation calculations.
First-principles study on the creation of holes in high Tc cuprates
International Nuclear Information System (INIS)
Ambrosch-Draxl, C.; Sherman, E.Ya.; Auer, H.; Thonhauser, T.
2004-01-01
We investigate the charge redistribution in high T c cuprates as a function of pressure, composition, and doping. To this extent we have performed first-principles calculations based on density functional theory for several representatives of the Hg based cuprates. In particular, we focus on the creation of holes in the copper-oxygen planes. Conclusions are drawn about the similarities and differences between the three parameters influencing the superconducting transition temperature. (copyright 2004 WILEY-VCH Verlag GmbH and Co. KGaA, Weinheim) (orig.)
Manganite/Cuprate Superlattice as Artificial Reentrant Spin Glass
Ding, Junfeng; Cossu, Fabrizio; Lebedev, Oleg I.; Zhang, Yuqin; Zhang, Zhidong; Schwingenschlö gl, Udo; Wu, Tao
2016-01-01
magnetic memory effect discovered in oxide heterostructures composed of ultrathin manganite La0.7Sr0.3MnO3 (LSMO) and cuprate La2CuO4 (LCO) layers. These heterostructures are featured with enhanced ferromagnetism before entering the spin glass state: a
Enhancing critical current density of cuprate superconductors
Chaudhari, Praveen
2015-06-16
The present invention concerns the enhancement of critical current densities in cuprate superconductors. Such enhancement of critical current densities include using wave function symmetry and restricting movement of Abrikosov (A) vortices, Josephson (J) vortices, or Abrikosov-Josephson (A-J) vortices by using the half integer vortices associated with d-wave symmetry present in the grain boundary.
On the interplay of Jahn-Teller physics and Mott physics in cuprates
International Nuclear Information System (INIS)
Kamimura, H; Ushio, H
2008-01-01
The extended two-story house model which is now called the Kamimura-Suwa (K-S) model has clarified how the interplay of Mott physics and Jahn-Teller physics plays an important role in determining the superconducting as well as metallic state of underdoped cuprates. In this paper it is first pointed out for underdoped cuprates that Mott physics leads to the existence of local antiferromagnetic order constructed from the localized spins while that the anti-Jahn-Teller effect as a central issue of Jahn-Teller physics leads to the existence of two kinds of orbitals parallel and perpendicular to a CuO 2 plane whose states have nearly the same energy. As a result of the interplay of both physics the K-S model has shown that the exchange interactions between the spins of a localized hole and of a carrier hole play an important role in producing the coexistence of superconductivity and antiferromagnetism in underdoped cuprates. The appearance of d-wave superconductivity even in the phonon-involved mechanism is also shown to be due to the interplay of Jahn-Teller physics and Mott Physics. Brief review of these facts as well as the K-S model is given in this paper. More outstanding result in this paper is that the origin of pseudogap in the deeply underdoped regime has been clarified. In this paper it is shown theoretically for the first time that the so-called T* pseudogap observed in ARPES, STM and tunneling experiments below T c in underdoped cuprates corresponds to the real transition of photo-excited electrons from the occupied states in the originally conduction band below the superconducting gap to a free-electron state above the vacuum level. Thus we conclude that the T* pseudogap in the underdoped cuprates which increases with decreasing the hole concentration is not 'pseudo', but a real gap which exists even below T c
Zeeman and orbital limiting magnetic fields in cuprates: The ...
Indian Academy of Sciences (India)
1IBM T. J. Watson Research Center, Yorktown Heights, New York 10598, ... In cuprates, in a view where pairing correlations set in at the pseudogap ... the field Hc2 bounding the superconducting response and the pseudogap closing field.
Theory of superconductivity and spin excitations in cuprates
Plakida, Nikolay M.
2018-06-01
A microscopic theory of high-temperature superconductivity in strongly correlated systems as cuprates is presented. The two-subband extended Hubbard model is considered where the intersite Coulomb repulsion and electron-phonon interaction are taken into account. The low-energy spin excitations are considered within the t-J model.
Influence of rare-earth ions on SiO{sub 2}-Na{sub 2}O-RE{sub 2}O{sub 3} glass structure
Energy Technology Data Exchange (ETDEWEB)
Johnson, J A [Department of Materials Science and Engineering, University of Tennessee Space Institute, Tullahoma, TN 37388 (United States); Benmore, C J [X-ray Science Division, Argonne National Laboratory, Argonne, IL 60439 (United States); Holland, D [Department of Physics, University of Warwick, CV4 7AL (United Kingdom); Du, J [Department of Material Science and Engineering, University of North Texas, Denton, TX 76203 (United States); Beuneu, B [Laboratoire Leon Brillouin, CEA-CNRS, CEA/Saclay, F-91191 Gif-sur-Yvette (France); Mekki, A, E-mail: jjohnson@utsi.edu [Department of Physics, King Fahd University of Petroleum and Minerals, Dhahran 31261 (Saudi Arabia)
2011-02-16
Praseodymium and europium sodium silicate glasses of nominal composition (SiO{sub 2}){sub 0.70-x}(Na{sub 2}O){sub 0.30}(RE{sub 2}O{sub 3}){sub x}, where RE is the rare earth and 0 {<=} x {<=} 0.10, were studied by neutron and high-energy x-ray scattering and classical molecular dynamics simulations. The observation of a significant x-ray intensity in doped as compared to un-doped glasses is indicative of RE-RE correlations at a distance of {approx} 3.7-3.9 A, much shorter than would be expected for a homogeneous distribution, suggesting that clustering of the rare-earth cations occurs in both these glass systems at low concentrations. Above x = 0.075 (nominal), minimal changes in this region indicate that the RE atoms are incorporated much more randomly into the glass structure. The molecular dynamics simulations suggest that the rare-earth ions enter the sodium-rich regions in the sodium silicate glasses and act as modifiers. A cluster analysis performed on the model systems indicates that the tendency for clustering is higher in praseodymium-containing glasses than in the europium glasses.
International Nuclear Information System (INIS)
Kresin, V.Z.; Wolf, S.A.
1989-01-01
In this paper the authors report on several important properties of the high t c cuprates. Firstly, the authors have developed a method for evaluating the electron-phonon coupling strength λ using an analysis of the heat capacity data. The authors estimate λ to be about 2.0 for La-Sr-Cu-O, which indicates that phonons are important but are not sufficient to explain the measured T c . Secondly, the authors have demonstrated that these materials exhibit gap anisotropy and multigap structure (the latter in the Re-Ba-Cu-O materials) which is responsible for the experimental difficulties in analyzing tunnelling and infrared data. Finally the authors have explained the anomalous results on the Pr substituted Y-Ba-Cu-O by its effects on the two dimensional Cu-O band in the framework of a two band multigap structure
Condensation energy of the superconducting bilayer cuprates
Indian Academy of Sciences (India)
cuprates also depends on the number of CuO2 layers per unit cell and the extent of doping. In a bilayer or ... unit cell is smaller than the adjacent layers in a single layer system; therefore it is natural to include interlayer .... energy conservation principle, the change in the kinetic energy of the electrons in the out- of-plane ...
Oxygen diffusion in cuprate superconductors
International Nuclear Information System (INIS)
Routbort, J.L.; Rothman, S.J.
1995-01-01
Superconducting properties of the cuprate superconductors depend on the oxygen content of the material; the diffusion of oxygen is thus an important process in the fabrication and application of these materials. This article reviews studies of the diffusion of oxygen in La 2-x Sr x CuO 4 , YBa 2 Cu 3 O 7- δ, YBa 2 Cu 4 O 8 , and the Bi 2 Sr 2 Ca n-1 Cu n O 2+4 (n = 1, and 2) superconductors, and attempt to elucidate the atomic mechanisms responsible
Flop transitions in cuprate and color superconductors: From SO(5) to SO(10) unification?
Energy Technology Data Exchange (ETDEWEB)
Chandrasekharan, S.; Chudnovsky, V.; Schlittgen, B.; Wiese, U.-J
2001-03-01
The phase diagrams of cuprate superconductors and of QCD at non-zero baryon chemical potential are qualitatively similar. The Neel phase of the cuprates corresponds to the chirally broken phase of QCD, and the high-temperature superconducting phase corresponds to the color superconducting phase. In the SO(5) theory for the cuprates the SO(3){sub s} spin rotational symmetry and the U(1){sub em} gauge symmetry of electromagnetism are dynamically unified. This suggests that the SU(2){sub L} x SU(2){sub R} x U(1){sub B} chiral symmetry of QCD and the SU(3){sub c} color gauge symmetry may get unified to SO(10). Dynamical enhancement of symmetry from SO(2){sub s} x Z(2) to SO(3){sub s} is known to occur in anisotropic antiferromagnets. In these systems the staggered magnetization flops from an easy 3-axis into the 12-plane at a critical value of the external magnetic field. Similarly, the phase transitions in the SO(5) and SO(10) models are flop transitions of a 'superspin'. Despite this fact, a renormalization group flow analysis in 4 -- {epsilon} dimensions indicates that a point with full SO(5) or SO(10) symmetry exists neither in the cuprates nor in QCD.
Flop transitions in cuprate and color superconductors: From SO(5) to SO(10) unification?
International Nuclear Information System (INIS)
Chandrasekharan, S.; Chudnovsky, V.; Schlittgen, B.; Wiese, U.-J.
2001-01-01
The phase diagrams of cuprate superconductors and of QCD at non-zero baryon chemical potential are qualitatively similar. The Neel phase of the cuprates corresponds to the chirally broken phase of QCD, and the high-temperature superconducting phase corresponds to the color superconducting phase. In the SO(5) theory for the cuprates the SO(3) s spin rotational symmetry and the U(1) em gauge symmetry of electromagnetism are dynamically unified. This suggests that the SU(2) L x SU(2) R x U(1) B chiral symmetry of QCD and the SU(3) c color gauge symmetry may get unified to SO(10). Dynamical enhancement of symmetry from SO(2) s x Z(2) to SO(3) s is known to occur in anisotropic antiferromagnets. In these systems the staggered magnetization flops from an easy 3-axis into the 12-plane at a critical value of the external magnetic field. Similarly, the phase transitions in the SO(5) and SO(10) models are flop transitions of a 'superspin'. Despite this fact, a renormalization group flow analysis in 4 -- ε dimensions indicates that a point with full SO(5) or SO(10) symmetry exists neither in the cuprates nor in QCD
Energy Technology Data Exchange (ETDEWEB)
Glaetzle, Matthias; Hoerder, Gregor J.; Huppertz, Hubert [Innsbruck Univ. (Austria). Inst. fuer Allgemeine, Anorganische und Theoretische Chemie
2016-08-01
The rare earth borates RE{sub 2}B{sub 8}O{sub 15} (RE = La, Pr, Nd) were synthesized in a Walker-type multianvil apparatus under conditions of 5.5 GPa and 1100 C. Starting from the corresponding rare earth oxides and boron oxide, the syntheses yielded crystalline products of all new compounds that allowed crystal structure analyses based on single-crystal X-ray diffraction data for La{sub 2}B{sub 8}O{sub 15} and Nd{sub 2}B{sub 8}O{sub 15}. The compound Pr{sub 2}B{sub 8}O{sub 15} could be characterized via X-ray powder diffractometry. The results show that the new compounds crystallize isotypically to Ce{sub 2}B{sub 8}O{sub 15} in the monoclinic space group P2/c. The infrared spectra of RE{sub 2}B{sub 8}O{sub 15} (RE = La, Pr, Nd) have also been studied.
A study on artificial rare earth (RE2O3) based neutron absorber.
Kim, Kyung-O; Kyung Kim, Jong
2015-11-01
A new concept of a neutron absorption material (i.e., an artificial rare earth compound) was introduced for criticality control in a spent fuel storage system. In particular, spent nuclear fuels were considered as a potential source of rare earth elements because the nuclear fission of uranium produces a full range of nuclides. It was also found that an artificial rare earth compound (RE2O3) as a High-Level Waste (HLW) was naturally extracted from pyroprocessing technology developed for recovering uranium and transuranic elements (TRU) from spent fuels. In this study, various characteristics (e.g., activity, neutron absorption cross-section) were analyzed for validating the application possibility of this waste compound as a neutron absorption material. As a result, the artificial rare earth compound had a higher neutron absorption probability in the entire energy range, and it can be used for maintaining sub-criticality for more than 40 years on the basis of the neutron absorption capability of Boral™. Therefore, this approach is expected to vastly improve the efficiency of radioactive waste management by simultaneously keeping HLW and spent nuclear fuel in a restricted space. Copyright © 2015 Elsevier Ltd. All rights reserved.
Hybrid crystals of cuprates and iron-based superconductors
Xia, Dai; Cong-Cong, Le; Xian-Xin, Wu; Jiang-Ping, Hu
2016-07-01
We propose two possible new compounds, Ba2CuO2Fe2As2 and K2CuO2Fe2Se2, which hybridize the building blocks of two high temperature superconductors, cuprates and iron-based superconductors. These compounds consist of square CuO2 layers and antifluorite-type Fe2 X 2 (X = As, Se) layers separated by Ba/K. The calculations of binding energies and phonon spectra indicate that they are dynamically stable, which ensures that they may be experimentally synthesized. The Fermi surfaces and electronic structures of the two compounds inherit the characteristics of both cuprates and iron-based superconductors. These compounds can be superconductors with intriguing physical properties to help to determine the pairing mechanisms of high T c superconductivity. Project supported by the National Basic Research Program of China (Grant No. 2015CB921300), the National Natural Science Foundation of China (Grant Nos. 1190020 and 11334012), and the Strategic Priority Research Program of Chinese Academy of Sciences (Grant No. XDB07000000).
Normal state Raman spectra of high-Tc cuprates
International Nuclear Information System (INIS)
Bishoyi, K.C.; Rout, G.C.; Behera, S.N.
2003-01-01
We present a microscopic theory to explain Raman spectra of high-T c cuprates R 2-x M x CuO 4 in the normal state. We used electronic Hamiltonian prescribed by Fulde in presence of anti-ferromagnetism. Phonon interaction to the hybridization between the conduction electrons of the system and the f-electrons has been incorporated in the calculation. The phonon spectral density is calculated by the Green function technique of Zubarev at zero wave vector and finite (room) temperature limit. Parameter dependence of Raman active phonon frequencies are studied by varying model parameters of the system i.e. the position of f-level (ε f ), the effective electron-phonon coupling strength (g), the staggered magnetic field (h 1 ), and the hybridization parameter (v). The four Raman active peaks (P 1 to P 4 ) represent the electronic states of the atomic sub-systems of the cuprate systems. They show up as phonon excitations due to the coupling of the phonon to the electrons and the anti-ferromagnetic gap. (author)
Aspects of electron correlations in the cuprate superconductors
International Nuclear Information System (INIS)
Brenig, W.
1995-01-01
We review concepts and effects of electron correlations in the copper-oxide superconductors. The purpose of this article is twofold. First, we provide an overview of results of various electron spectroscopies, Raman scattering and optical conductivity studies with a particular emphasis on experiments which identify the charge and spin correlations relevant to the cuprates. Second, we focus on microscopic theories of the single-particle excitations, and the charge and spin dynamics in the normal state of cuprates considering those models which incorporate strong electron correlations. The single-particle spectrum of the three-band Hubbard model is reviewed and related to results of electron spectroscopy. The carrier dynamics in the t-J model and the one-band Hubbard model at low doping is discussed in detail. We examine approaches which describe the single-particle excitations of correlated electron systems at finite doping. Theories of the static and dynamic magnetic correlations are considered and we speculate on the consequences of the spin dynamics for Raman scattering and the optical conductivity. Finally, selected phenomenological ideas are reviewed. ((orig.))
Non-separable pairing interaction kernels applied to superconducting cuprates
International Nuclear Information System (INIS)
Haley, Stephen B.; Fink, Herman J.
2014-01-01
Highlights: • Non-separable interaction kernels with weak interactions produces HTS. • A probabilistic approach is used in filling the electronic states in the unit cell. • A set of coupled equations is derived which describes the energy gap. • SC properties of separable with non-separable interactions are compared. • There is agreement with measured properties of the SC and normal states. - Abstract: A pairing Hamiltonian H(Γ) with a non-separable interaction kernel Γ produces HTS for relatively weak interactions. The doping and temperature dependence of Γ(x,T) and the chemical potential μ(x) is determined by a probabilistic filling of the electronic states in the cuprate unit cell. A diverse set of HTS and normal state properties is examined, including the SC phase transition boundary T C (x), SC gap Δ(x,T), entropy S(x,T), specific heat C(x,T), and spin susceptibility χ s (x,T). Detailed x,T agreement with cuprate experiment is obtained for all properties
A spatial interpretation of emerging superconductivity in lightly doped cuprates
Deutscher, Guy; de Gennes, Pierre-Gilles
The formation of domains comprising alternating 'hole rich' and 'hole poor' ladders recently observed by Scanning Tunneling Microscopy by Kohsaka et al., on lightly hole doped cuprates, is interpreted in terms of an attractive mechanism which favors the presence of doped holes on Cu sites located each on one side of an oxygen atom. This mechanism leads to a geometrical pattern of alternating hole-rich and hole-poor ladders with a periodicity equal to 4 times the lattice spacing in the CuO plane, as observed experimentally. Cuprates supraconducteurs peu dopés : une interprétation des structures spatiales. Des arrangements électroniques réguliers ont été détectés récemment par Kohsaka et al. dans des cuprates sous dopés (via une sonde tunnel locale). Certaines paires Cu-O-Cu sont « actives », et forment une échelle. Les autres sites sont peu actifs. Pour expliquer ces structures, nous postulons que, lorsqu'une liaison Cu-O-Cu est occupée par deux trous, la distance (Cu-Cu) rétrécit et l'intégrale de transfert (t) est fortement augmentée. Ceci peut engendrer des paires localisées (réelles ou virtuelles). Aux taux de dopage étudiés, la période de répétition vaudrait 4 mailles élémentaires.
Chasing the cuprates with dilatonic dyons
Energy Technology Data Exchange (ETDEWEB)
Amoretti, Andrea [Department of Applied Mathematics and Theoretical Physics, University of Cambridge,Cambridge, CB3 OWA (United Kingdom); Baggioli, Matteo [Institut de Física d’Altes Energies (IFAE), Universitat Autònoma de Barcelona,The Barcelona Institute of Science and Technology,Campus UAB, 08193 Bellaterra (Barcelona) (Spain); Magnoli, Nicodemo [Dipartimento di Fisica, Università di Genova, and I.N.F.N. - Sezione di Genova,via Dodecaneso 33, I-16146, Genova (Italy); Musso, Daniele [Abdus Salam International Centre for Theoretical Physics (ICTP),Strada Costiera 11, I-34151 Trieste (Italy)
2016-06-20
Magnetic field and momentum dissipation are key ingredients in describing condensed matter systems. We include them in gauge/gravity and systematically explore the bottom-up panorama of holographic IR effective field theories based on bulk Einstein-Maxwell Lagrangians plus scalars. The class of solutions here examined appears insufficient to capture the phenomenology of charge transport in the cuprates. We analyze in particular the temperature scaling of the resistivity and of the Hall angle. Keeping an open attitude, we illustrate weak and strong points of the approach.
Determination of Retardation Effects in the High Tc Cuprates from Sharvin Contact Measurements
International Nuclear Information System (INIS)
Deutscher, G.
1995-01-01
It is well known that retardation effects are essential to allow the attractive part of the electron-electron interaction (for instance, phonon mediated) to overcome the Coulomb repulsion. In new superconductors such as the cuprates for which the interaction is a priori unknown, it is therefore essential to determine the retarded and non retarded parts of the interaction. We show how this can be achieved by an analysis of Sharvin contact measurements between a noble metal tip and a cuprate. It turns out that both the retarded and non retarded parts are large, the former being however larger than the later
Angle-resolved photoemission spectroscopy (ARPES) studies of cuprate superconductors
Energy Technology Data Exchange (ETDEWEB)
Palczewski, Ari Deibert [Iowa State Univ., Ames, IA (United States)
2010-01-01
This dissertation is comprised of three different angle-resolved photoemission spectroscopy (ARPES) studies on cuprate superconductors. The first study compares the band structure from two different single layer cuprates Tl2Ba2CuO6+δ (Tl2201) Tc, max ≈ 95 K and (Bi 1.35Pb0.85)(Sr1.47La0.38)CuO6+δ (Bi2201) Tc, max ≈ 35 K. The aim of the study was to provide some insight into the reasons why single layer cuprate's maximum transition temperatures are so different. The study found two major differences in the band structure. First, the Fermi surface segments close to (π,0) are more parallel in Tl2201 than in Bi2201. Second, the shadow band usually related to crystal structure is only present in Bi2201, but absent in higher Tc Tl2201. The second study looks at the different ways of doping Bi2Sr2CaCu2O8+δ (Bi2212) in-situ by only changing the post bake-out vacuum conditions and temperature. The aim of the study is to systematically look into the generally overlooked experimental conditions that change the doping of a cleaved sample in ultra high vacuum (UHV) experiments. The study found two major experimental facts. First, in inadequate UHV conditions the carrier concentration of Bi2212 increases with time, due to the absorption of oxygen from CO2/CO molecules, prime contaminants present in UHV systems. Second, in a very clean UHV system at elevated temperatures (above about 200 K), the carrier concentration decreases due to the loss of oxygen atoms from the Bi-O layer. The final study probed the particle-hole symmetry of the pseudogap phase in high temperature superconducting cuprates by looking at the thermally excited bands above the Fermi level. The data showed a particle-hole symmetric pseudogap which symmetrically closes away from the nested FS before the node. The data is
Angle-resolved photoemission spectroscopy (ARPES) studies of cuprate superconductors
Energy Technology Data Exchange (ETDEWEB)
Palczewski, Ari Deibert [Iowa State Univ., Ames, IA (United States)
2010-01-01
This dissertation is comprised of three different angle-resolved photoemission spectroscopy (ARPES) studies on cuprate superconductors. The first study compares the band structure from two different single layer cuprates Tl2Ba2CuO6+δ (Tl2201) Tc,max ~95 K and (Bi1.35Pb0.85)(Sr1.47La0.38)CuO6+δ (Bi2201) Tc,max 35 K. The aim of the study was to provide some insight into the reasons why single layer cuprate's maximum transition temperatures are so different. The study found two major di erences in the band structure. First, the Fermi surface segments close to ( π,0) are more parallel in Tl2201 than in Bi2201. Second, the shadow band usually related to crystal structure is only present in Bi2201, but absent in higher Tc Tl2201. The second study looks at the different ways of doping Bi2Sr2CaCu2O8+δ (Bi2212) in-situ by only changing the post bake-out vacuum conditions and temperature. The aim of the study is to systematically look into the generally overlooked experimental conditions that change the doping of a cleaved sample in ultra high vacuum (UHV) experiments. The study found two major experimental facts. First, in inadequate UHV conditions the carrier concentration of Bi2212 increases with time, due to the absorption of oxygen from CO2/CO molecules, prime contaminants present in UHV systems. Second, in a very clean UHV system at elevated temperatures (above about 200 K), the carrier concentration decreases due to the loss of oxygen atoms from the Bi-O layer. The final study probed the particle-hole symmetry of the pseudogap phase in high temperature superconducting cuprates by looking at the thermally excited bands above the Fermi level. The data showed a particle-hole symmetric pseudogap which symmetrically closes away from the nested FS before the node. The data is consistent with
Mukherjee, Kunal; Hayamizu, Yoshiaki; Kim, Chang Sub; Kolchina, Liudmila M; Mazo, Galina N; Istomin, Sergey Ya; Bishop, Sean R; Tuller, Harry L
2016-12-21
Highly textured thin films of undoped, Ce-doped, and Sr-doped Pr 2 CuO 4 were synthesized on single crystal YSZ substrates using pulsed laser deposition to investigate their area-specific resistance (ASR) as cathodes in solid-oxide fuel cells (SOFCs). The effects of T' and T* crystal structures, donor and acceptor doping, and a-axis and c-axis orientation on ASR were systematically studied using electrochemical impedance spectroscopy on half cells. The addition of both Ce and Sr dopants resulted in improvements in ASR in c-axis oriented films, as did the T* crystal structure with the a-axis orientation. Pr 1.6 Sr 0.4 CuO 4 is identified as a potential cathode material with nearly an order of magnitude faster oxygen reduction reaction kinetics at 600 °C compared to thin films of the commonly studied cathode material La 0.6 Sr 0.4 Co 0.8 Fe 0.2 O 3-δ . Orientation control of the cuprate films on YSZ was achieved using seed layers, and the anisotropy in the ASR was found to be less than an order of magnitude. The rare-earth doped cuprate was found to be a versatile system for study of relationships between bulk properties and the oxygen reduction reaction, critical for improving SOFC performance.
2011 Aspen Winter Conference on Contrasting Superconductivity of Pnictides and Cuprates
Energy Technology Data Exchange (ETDEWEB)
Johnson, P. [Aspen Center for Physics, CO (United States); Schmalian, J. [Aspen Center for Physics, CO (United States); Canfield, P. [Aspen Center for Physics, CO (United States); Chakravarty, S. [Aspen Center for Physics, CO (United States)
2011-05-02
Our quest for materials with better properties is closely integral to the fabric of our society. Currently the development of materials that will allow for improved generation, transport, and storage of energy is at the forefront of our research in condensed matter physics and materials science. Among these materials, compounds that exhibit correlated electron states and emergent phenomena such as superconductivity have great promise, but also difficulties that need to be overcome: problems associated with our need to reliably find, understand, improve and control these promising materials. At the same time, the field of correlated electrons represents the frontier of our understanding of the electronic properties of solids. It contains deep open scientific issues within the broad area of quantum phenomena in matter. The aim of this workshop is to explore and understand the physics of recently discovered Fe-based high-temperature superconductors and contrast and compare them with the cuprates. The superconductivity in iron pnictides, with transition temperatures in excess of 55 K, was discovered in early 2008. The impact of this discovery is comparable to cuprates discovered in 1986. At the same time a number of recent experimental developments in cuprates may lead to a shift in our thinking with regards to these materials. There is therefore much to be learned by devoting a conference in which both classes of superconductors are discussed, especially at this nascent stage of the pnictides.
International Nuclear Information System (INIS)
Singh, M.P.; Tewari, B.S.; Ajay
2006-01-01
In the present work, we have studied the effect of temperature and carrier density on anisotropy in supercurrent density in bilayer cuprate superconductors. Here, we have considered a tight binding bilayered Hubbard Hamiltonian containing intra and interlayer attractive interactions. The situation considered here is similar to a SIS junction. We have got the expressions for the superconducting order parameters, carrier density and anisotropy in superconducting density (I ab /I c ) for such SIS junction. The numerical analysis show that the anisotropy in the supercurrent density depends on temperature and carrier density in layered high T c cuprates. (author)
International Nuclear Information System (INIS)
Reddy, E Sudhakar; Tarka, M; Noudem, J G; Goodilin, E A; Schmitz, G J
2005-01-01
A new method for the processing of textured YBa 2 Cu 3 O y (Y 123) thick film stripes on metallic tapes is discussed. The process involves the texturing of Y123 grains by a localized directional solidification method by creating constitutional gradients along the width of the precursor Y 2 BaCuO 5 (Y 211) stripe during an infiltration and growth process. The differences in the solidification temperatures of different rare earth 123 compounds were utilized to generate the constitutional gradients. The sample configuration involves printed lines of light (Nd) and heavy (Yb) rare earth compounds on either side of an airbrushed Y211 stripe underneath a liquid phase (barium cuprates) layer. The higher peritectic temperature (T p ) Nd regions serve as nucleating sites for Y123 grains nucleated in the adjacent Y211 stripes and the constitutional gradients produced due to the diffusion of respective rare earth ions between the Nd and Yb regions, typically of 200 K cm -1 in the region, induce a driving force for the directional growth of the nucleated grains. The solidification is analogous to that in a typical Bridgman furnace in applied high temperature gradients. The process, being independent of growth rate parameter and texture of the underlying substrate, is suitable for the fabrication of long length thick film conductors by a wind and react process in simple box type furnaces
High-Tc cuprate superconductivity in a nutshell
International Nuclear Information System (INIS)
Won, Hyekyung; Haas, Stephan; Parker, David; Maki, Kazumi
2005-01-01
Since the discovery of high-T c cuprate superconductivity in 1986 many new experimental techniques and theoretical concepts have been developed. In particular it was shown that the BCS theory of d-wave superconductivity describes semi-quantitatively the high-T c superconductivity. Furthermore, it was demonstrated that Volovik's approach is extremely useful for finding the quasiparticle properties in the vortex state. Here we survey these developments and forecast future directions. (copyright 2005 WILEY-VCH Verlag GmbH and Co. KGaA, Weinheim) (orig.)
Pseudogap and competing states in underdoped cuprates
International Nuclear Information System (INIS)
Lee, Patrick A.
2004-01-01
I shall argue that the high T c problem is the problem of doping into a Mott insulator. Furthermore, the well documented pseudo-gap phenomenon in underdoped cuprates holds the key to understanding this physics. Phase fluctuation alone cannot explain this phenomenon, but there is a clear need to identify a competing state which lives in the vortex core. The staggered flux state is a good candidate for the competing state and experimental tests of these ideas will be discussed
Oxygen diffusion in cuprate superconductors
Energy Technology Data Exchange (ETDEWEB)
Routbort, J.L.; Rothman, S.J.
1995-01-01
Superconducting properties of the cuprate superconductors depend on the oxygen content of the material; the diffusion of oxygen is thus an important process in the fabrication and application of these materials. This article reviews studies of the diffusion of oxygen in La{sub 2}{sub {minus}}{sub {times}}Sr{sub {times}}CuO{sub 4}, YBa{sub 2}Cu{sub 3}O{sub 7}{sub {minus}}{delta}, YBa{sub 2}Cu{sub 4}O{sub 8}, and the Bi{sub 2}Sr{sub 2}Ca{sub n}{sub {minus}}{sub 1}Cu{sub n}O{sub 2}{sub +}{sub 4} (n = 1, and 2) superconductors, and attempt to elucidate the atomic mechanisms responsible.
Half-integer flux quantum effect in cuprate superconductors - a probe of pairing symmetry
International Nuclear Information System (INIS)
Tsuei, C.C.; Kirtley, J.R.; Gupta, A.; Sun, J.Z.; Moler, K.A.; Wang, J.H.
1996-01-01
Based on macroscopic quantum coherence effects arising from pair tunneling and flux quantization, a series of tricrystal experiments have been designed and carried out to test the order parameter symmetry in high-T c cuprate superconductors. By using a scanning SQUID microscope, we have directly and non-invasively observed the spontaneously generated half-integer flux quantum effect in controlled-orientation tricrystal cuprate superconducting systems. The presence or absence of the half-integer flux quantum effect as a function of the tricrystal geometry allows us to prove that the order parameter symmetry in the YBCO and Tl2201 systems is consistent with that of the d x 2 -y 2 pair state. (orig.)
Remarkable progress in fabricating RE123 coated conductors by IBAD/PLD technique at Fujikura
Energy Technology Data Exchange (ETDEWEB)
Igarashi, M; Kakimoto, K; Hanyu, S; Tashita, C; Hayashida, T; Hanada, Y; Fujita, S; Morita, K; Nakamura, N; Sutoh, Y; Kutami, H; Iijima, Y; Saitoh, T, E-mail: m_igarashi@fujikura.co.j [Fujikura Ltd., 1440, Mutsuzaki, Sakura, Chiba, 285-8550 (Japan)
2010-06-01
Increase of production rate and improvement of quality for RE123 coated conductors have been tried. In-plane texturing of MgO was attempted by the IBAD system with the world largest ion source. As a result of optimizing condition in large deposition area, the dramatically high throughput of 1000 m / h was realized to obtain the IBAD-MgO with {Delta}{phi} < 10{sup 0}. Furthermore, simple buffer structure was demonstrated. Well textured CeO{sub 2} layer with {Delta}{phi} of around 4{sup 0} was obtained by directly deposited on IBAD-MgO layer in spite of large lattice mismatch of 28% between CeO{sub 2} and MgO. Several over 100 m buffer substrates with the architecture of / PLD-CeO{sub 2} (60 m / h) / IBAD-MgO (333{approx}1000 m / h) / Y{sub 2}O{sub 3} (500 m / h) / Al{sub 2}O{sub 3} (150 m / h) / Hastelloy / were already prepared. On these production substrates, GdBCO layer was deposited by the large PLD system at high throughput. The 260 m long GdBCO tape with I{sub c} > 600 A except some locations was obtained at the throughput of 15 m / h. In addition to the speed-up, the very high I{sub c} of 1040 A was also achieved by the hot-wall heating PLD system.
The industry of metallic rare earths (R.E.)
International Nuclear Information System (INIS)
Poirier, P.
1979-01-01
The following subjects are discussed: rare earths resources (rare earths abondance and world reserves, main ores). Rare earths separation and purification (ionic exchange, solvent extraction). Metallic rare earths and their mixtures, metallothermic reduction of oxides or fluorides (Ca, Mg, Al, Si or rare earth metals), Co-reduction process for intermetallic compounds (SmCo 5 ). Industrial applications of metallic rare earths (traditional applications such as flints, nodular cast iron, steel refining, magnesium industrie, applications under development such as rare earths/cobalt magnets, LaNi 5 for hydrogen storage, special alloys (automotive post combustion), magnetostrictive alloys). Economical problems: rare earth are elements relatively abundant and often at easily accessible prices. However, this group of 15 elements are liable to certain economical restraints. It is difficult to crack ore for only one rare earth. Availability of one given rare earth must be associated with the other corresponding rare earths to absorb all the other rare earths in other applications. Rare-earth industry has a strong expanding rate. 20% per year average for 6 years with Rhone-Poulenc. Thanks to their exceptional, specific characteristics rare earths have a bright future particularly for their metals
Energy Technology Data Exchange (ETDEWEB)
Varma, K. B. R.; Subbanna, G. N.; Ramakrishnan, T. V.; Rao, C. N. R.
1989-07-03
Glasses obtained from quenching melts of superconducting bismuth cuprates of the formula Bi/sub 2/(Ca,Sr)/sub /ital n/+1/Cu/sub /ital n//O/sub 2/ital n/+4/ with /ital n/=1 and 3 exhibit novel dielectric properties. They possess relatively high dielectric constants as well as high electrical conductivity. The novel dielectric properties of these cuprate glasses are likely to be of electronic origin. They exhibit a weak microwave absorption due to the presence of microcrystallites.
Uppal, Baljinder S; Booth, Rebecca K; Ali, Noreen; Lockwood, Cindy; Rice, Craig R; Elliott, Paul I P
2011-08-07
A series of 1-alkyl-4-aryl-1,2,3-triazoles (1-methyl-4-phenyl-1,2,3-triazole (1a); 1-propyl-4-phenyl-1,2,3-triazole (1b); 1-benzyl-4-phenyl-1,2,3-triazole (1c); 1-propyl-4-p-tolyl-1,2,3-triazole (1d)) have been prepared through a one-pot procedure involving in situ generation of the alkyl azide from a halide precursor followed by copper catalysed alkyne/azide cycloaddition (CuAAC) with the appropriate aryl alkyne. Cationic Re(I) complexes [Re(bpy)(CO)(3)(1a-d)]PF(6) (2a-d) were then prepared by stirring [Re(bpy)(CO)(3)Cl] with AgPF(6) in dichloromethane in the presence of ligands 1a-d. X-ray crystal structures were obtained for 2a and 2b. In the solid state, 2a adopts a highly distorted geometry, which is not seen for 2b, in which the plane of the triazole ligand tilts by 13° with respect to the Re-N bond as a result of a π-stacking interaction between the Ph substituent and one of the rings of the bpy ligand. This π-stacking interaction also results in severe twisting of the bpy ligand. Infrared spectra of 2a-d exhibit ν(CO) bands at ∼2035 and ∼1926 cm(-1) suggesting that these ligands are marginally better donors than pyridine (ν(CO) = 2037, 1932 cm(-1)). The complexes are luminescent in aerated dichloromethane at room temperature with emission maxima at 542 to 552 nm comparable to that of the pyridine analogue (549 nm) and blue shifted relative to the parent chloride complex. Long luminescent lifetimes are observed for the triazole complexes (475 to 513 ns) in aerated dichloromethane solutions at room temperature.
Unparticles and anomalous dimensions in the cuprates
Energy Technology Data Exchange (ETDEWEB)
Karch, Andreas [Department of Physics, University of Washington,3910 15th Ave. NE, Seattle, WA 98195-1560 (United States); Limtragool, Kridsanaphong; Phillips, Philip W. [Department of Physics and Institute for Condensed Matter Theory, University of Illinois,1110 W. Green Street, Urbana, IL 61801 (United States)
2016-03-25
Motivated by the overwhelming evidence some type of quantum criticality underlies the power-law for the optical conductivity and T−linear resistivity in the cuprates, we demonstrate here how a scale-invariant or unparticle sector can lead to a unifying description of the observed scaling forms. We adopt the continuous mass formalism or multi band (flavor) formalism of the unparticle sector by letting various microscopic parameters be mass-dependent. In particular, we show that an effective mass that varies with the flavor index as well as a running band edge and lifetime capture the AC and DC transport phenomenology of the cuprates. A key consequence of the running mass is that the effective dynamical exponent can differ from the underlying bare critical exponent, thereby providing a mechanism for realizing the fractional values of the dynamical exponent required in a previous analysis http://dx.doi.org/10.1103/PhysRevB.91.155126. We also predict that regardless of the bare dynamical exponent, z, a non-zero anomalous dimension for the current is required. Physically, the anomalous dimension arises because the charge depends on the flavor, mass or energy. The equivalent phenomenon in a d+1 gravitational construction is the running of the charge along the radial direction. The nature of the superconducting instability in the presence of scale invariant stuff shows that the transition temperature is not necessarily a monotonic function of the pairing interaction.
Considerations for improved polycrystalline cuprate superconductors
International Nuclear Information System (INIS)
Shinde, S.L.; Shaw, T.M.
1990-01-01
Polycrystalline cuprate superconductors exhibit two-stage superconducting transitions, that are characteristic of granular systems. This behaviour suggests approaches involving improvements in intra and inter-grain properties in order to improve the technologically important superconducting properties such as the magnetic remanent moment and transport critical current density. This paper reports results of our studies on oxygenation, twin density control through grain size and changes in flux pinning within the YBa 2 Cu 3 O 7-δ matrix with Ag substitution under the heading of intra-grain properties and the detrimental effect of grain boundary phases and the effect of Ag substitution on grain boundary pinning under the heading of inter-grain properties
Energy Technology Data Exchange (ETDEWEB)
Misra, Sumohan [Iowa State Univ., Ames, IA (United States)
2008-01-01
The binary, ternary and multicomponent intermetallic compounds of rare-earth metals (RE) with group 14 elements (Tt) at the RE5Tt4 stoichiometry have been known for over 30 years, but only in the past decade have these materials become a gold mine for solid-state chemistry, materials science and condensed matter physics. It all started with the discovery of a giant magnetocaloric effect in Gd5Si2Ge2, along with other extraordinary magnetic properties, such as a colossal magnetostriction and giant magnetoresistance. The distinctiveness of this series is in the remarkable flexibility of the chemical bonding between well-defined, subnanometer-thick slabs and the resultant magnetic, transport, and thermodynamic properties of these materials. This can be controlled by varying either or both RE and Tt elements, including mixed rare-earth elements on the RE sites and different group 14 (or T = group 13 or 15) elements occupying the Tt sites. In addition to chemical means, the interslab interactions are also tunable by temperature, pressure, and magnetic field. Thus, this system provides a splendid 'playground' to investigate the interrelationships among composition, structure, physical properties, and chemical bonding. The work presented in this dissertation involving RE5T4 materials has resulted in the successful synthesis, characterization, property measurements, and theoretical analyses of various new intermetallic compounds. The results provide significant insight into the fundamental magnetic and structural behavior of these materials and help us better understand the complex link between a compound's composition, its observed structure, and its properties.
Manganite/Cuprate Superlattice as Artificial Reentrant Spin Glass
Ding, Junfeng
2016-05-04
Emerging physical phenomena at the unit-cell-controlled interfaces of transition-metal oxides have attracted lots of interest because of the rich physics and application opportunities. This work reports a reentrant spin glass behavior with strong magnetic memory effect discovered in oxide heterostructures composed of ultrathin manganite La0.7Sr0.3MnO3 (LSMO) and cuprate La2CuO4 (LCO) layers. These heterostructures are featured with enhanced ferromagnetism before entering the spin glass state: a Curie temperature of 246 K is observed in the superlattice with six-unit-cell LSMO layers, while the reference LSMO film with the same thickness shows much weaker magnetism. Furthermore, an insulator-metal transition emerges at the Curie temperature, and below the freezing temperature the superlattices can be considered as a glassy ferromagnetic insulator. These experimental results are closely related to the interfacial spin reconstruction revealed by the first-principles calculations, and the dependence of the reentrant spin glass behavior on the LSMO layer thickness is in line with the general phase diagram of a spin system derived from the infinite-range SK model. The results of this work underscore the manganite/cuprate superlattices as a versatile platform of creating artificial materials with tailored interfacial spin coupling and physical properties. © 2016 WILEY-VCH Verlag GmbH & Co. KGaA, Weinheim.
Muon and other studies of magnetic ordering in cuprate layer-compounds
International Nuclear Information System (INIS)
Portis, A.M.; Celio, M.
1989-01-01
Muon spin rotation studies of magnetic ordering in the planar cuprates are reviewed. Particular attention is given to doped La 2 CuO 4 and oxygen-depleted YBa 2 Cu 3 O 7-δ and to related experimental investigations. Studies of transition element substituted compounds are also reviewed. (orig.)
Magnetic excitations of layered cuprates studied by RIXS at Cu L{sub 3} edge
Energy Technology Data Exchange (ETDEWEB)
Ghiringhelli, G., E-mail: giacomo.ghiringhelli@fisi.polimi.it [CNR/SPIN, CNISM and Dipartimento di Fisica, Politecnico di Milano, piazza Leonardo da Vinci 32, 20133 Milano (Italy); Braicovich, L. [CNR/SPIN, CNISM and Dipartimento di Fisica, Politecnico di Milano, piazza Leonardo da Vinci 32, 20133 Milano (Italy)
2013-06-15
Highlights: ► We have developed very high resolution RIXS instrumentation. ► Cu L{sub 3} RIXS is ideal for studying magnetic excitations in layered cuprates. ► RIXS has been used to map magnon and paramagnon dispersion in HTcS. ► We have developed the first partial polarization analyzer for RIXS in the soft X-rays. -- Abstract: The inelastic scattering of X-rays is becoming a powerful alternative to better established techniques, based on neutrons or low energy photons, for the study of low- and medium-energy excitations in solids. When performed in the soft range the resonant inelastic X-ray scattering (RIXS) is ideal for strongly correlated electron systems based on 3d transition metals. The remarkable evolution of Cu L{sub 3} RIXS has been boosted by the steady improvement of experimental energy resolution, and by the fortunate fact that cuprates give intense and richly featured spectra. Over the last 8 years several key results were obtained using the AXES (ESRF) and the SAXES (SLS) spectrometers. This initial success is now supporting several new projects for soft X-ray RIXS worldwide. We briefly present here the case of spin excitation dispersion in insulating and superconducting cuprates and the first RIXS spectra with partial polarization analysis of the scattered photons.
International Nuclear Information System (INIS)
Rice, T.M.
1997-01-01
The discovery of high-T c superconductivity focussed attention on the cuprates. Square planar coordinated Cu 2+ -ions are ideal S=1/2 ions. The exchange interaction between neighboring ions is very different for edge sharing (weak and ferromagnetic) and corner sharing (strong and antiferromagnetic) configurations. Many different magnetic structures are possible, e.g. chains, zig-zag chains, ladders, etc., weakly coupled to each other. The spin-liquid state of the two-leg ladder is especially interesting, not least because of the possible quantum critical point separating the spin liquid and long-range ordered states as the interladder coupling is increased. Hole doping to introduce mobile Cu 3+ -ionic configuration opens new possibilities. The recent discovery of superconductivity under pressure in a doped ladder system is encouraging. (orig.)
International Nuclear Information System (INIS)
Dunne, L.J.; Univ. of Sussex, Falmer; Braendas, E.J.; Murrell, J.N.
1999-01-01
The discovery of high T c superconducting cuprates occurred over a decade ago but the cause of the superconducting condensation and electronic structure of such compounds is still a matter of considerable debate. While there is no agreement as to the pairing mechanism, there is, on the other hand, a wide consensus about the main properties which a theoretical description should provide. In this article, a theory is presented which accounts in a straightforward way for many of the essential properties of the high T c cuprate superconductors. Some further developments of the model are suggested, particularly relating to the normal state spin-gap which the model does not currently describe
Energy Technology Data Exchange (ETDEWEB)
Sarrao, J L [Los Alamos National Laboratory; Thompson, Joe D [Los Alamos National Laboratory; Tobash, P H [UNIV. OF DE; Bobev, S [UNIV. OF DE
2009-01-01
A series of magnesium-substituted rare-earth metal germanides with a general formula RE{sub 5-x}Mg{sub x}Ge{sub 4} (x {approx} 1.0-2.3; RE =Gd-Tm, Lu, Y) have been synthesized by high-temperature reactions and structurally characterized by single-crystal X-ray diffraction. These compounds crystallize with the common Gd{sub 5}Si{sub 4} type in the orthorhombic space group Pnma (No. 62; Z =4; Pearson's code oP36) and do not appear to undergo temperature-induced crystallographic phase transitions down to 120 K. Replacing rare-earth metal atoms with Mg, up to nearly 45 % at., reduces the valence electron count and is clearly expressed in the subtle changes of the Ge-Ge and metal-metal bonding. Magnetization measurements as a function of the temperature and the applied field reveal complex magnetic structures at cryogenic temperatures, and Curie-Weiss paramagnetic behavior at higher temperatures. The observed local moment magnetism is consistent with RE+ ground states in all cases. In the magnetically ordered phases, the magnetization cannot reach saturation in fields up to 50 kOe. The structural trends across the series and the variations of hte magnetic properties as a function of the Mg content are also discussed. KEYWORDS: Rare-earth intermetallics, germanides, crystal structure,Gd{sub 5}Si{sub 4} type.
Marginal Fermi liquid and kink structure of quasiparticles in cuprates
International Nuclear Information System (INIS)
Kakehashi, Y.; Fulde, P.
2007-01-01
On the basis of the self-consistent projection operator method for nonlocal excitations, we show that a kink structure appears in the quasiparticle excitation spectrum of the two-dimensional Hubbard model at low doping concentrations. It is caused by a mixing between the quasiparticle state and the excitations with short-range antiferromagnetic order. The results explain the kink in high-T c cuprates
NMR studies of spin dynamics in cuprates
International Nuclear Information System (INIS)
Takigawa, M.; Mitzi, D.B.
1994-01-01
The authors report recent NMR results in cuprates. The oxygen Knight shift and the Cu nuclear spin-lattice relaxation rate in Bi 2.1 Sr 1.94 Ca 0.88 Cu 2.07 O 8+σ single crystals revealed a gapless superconducting state, which can be most naturally explained by a d-wave pairing state and the intrinsic disorder in this material. The Cu nuclear spin-spin relaxation rate in underdoped YBa 2 Cu 3 O 6.63 shows distinct temperature dependence from the spin-lattice relaxation rate, providing direct evidence for a pseudo spin-gap near the antiferromagnetic wave vector
NMR studies of spin dynamics in cuprates
Takigawa, M.; Mitzi, D. B.
1994-04-01
We report recent NMR results in cuprates. The oxygen Knight shift and the Cu nuclear spin-lattice relaxation rate in Bi2.1Sr1.94Ca0.88Cu2.07O8+δ single crystals revealed a gapless superconducting state, which can be most naturally explained by a d-wave pairing state and the intrinsic disorder in this material. The Cu nuclear spin-spin relaxation rate in underdoped YBa2Cu3O6.63 shows distinct temperature dependence from the spin-lattice relaxation rate, providing direct evidence for a pseudo spin-gap near the antiferromagnetic wave vector.
Oxygen chain disorder and compensation by Ca in Y(1-2-3) cuprates
International Nuclear Information System (INIS)
Suryanarayanan, R.; Ouhammou, L.; Das, A.; Leelaprute, S.
1994-01-01
Several M dopants such as Al, Fe, and Co at the Cu site destroy the superconductivity of YBa 2 Cu 3 O 6+z . However, superconductivity is restored by substituting Ca at the Y site. Arguments are developed to show that the oxygen chain disorder is not the only cause for destroying the superconductivity. A universal relation seems to exist between the net hole density as a result of Ca substitution and Tc. To stabilize the perovskite structure of YSr 2 Cu 3 O 6+z , it is necessary to substitute Cu by certain elements. Examples are given on Ti and Re substitution. Again, Ca cosubstitution increases Tc. Further, the irreversibility line is enhanced by Ca, indicating improved pinning in these materials in spite of the oxygen disorder. 16 refs., 4 figs., 1 tab
Phenomenological Theory for Pseudogap States in High Tc Cuprate
Directory of Open Access Journals (Sweden)
Zhang Fuchun
2012-03-01
Full Text Available Pseudogap phase in the underdoped region of high-Tc cuprate is one of the challenging issues in condensed matter physics. In this talk, I will describe a phenomenological theory for this phase, based on analogies to the approach to Mott localization at weak coupling in lower dimensional systems. I will make comparisons of the theory to a series of the experiments, including angle resolved photoemission spectroscope, scanning tunneling microscope.
Nonlinear optical control of Josephson coupling in cuprates
Energy Technology Data Exchange (ETDEWEB)
Casandruc, Eliza
2017-03-15
In High-T{sub C} cuprates superconducting Cu-O planes alternate with insulating layers along the crystallographic c-axis, making the materials equivalent to Josephson junctions connected in series. The most intriguing consequence is that the out-of-plane superconducting transport occurs via Cooper pairs tunneling across the insulating layers and can be predicted by the Josephson tunneling equations. Nonlinear interaction between light fields and the superconducting carriers serves as a powerful dynamical probe of cuprates, while offering opportunities for controlling them in an analogous fashion to other stimuli such as pressure and magnetic fields. The main goal of this thesis work is to use intense transient light fields to control the interlayer superconducting transport on ultrafast time scales. This was achieved by tuning the wavelength of such light pulses to completely different ranges, in order to either directly excite Josephson Plasma Waves in the nonlinear regime, or efficiently melt the competing charge and spin order phase, which in certain cuprates quenches the Josephson tunneling at equilibrium. In a first study, I have utilized strong field terahertz transients with frequencies tuned to the Josephson plasma resonance (JPR) to coherently control the c-axis superconducting transport. The Josephson relations have a cubic nonlinearity which is exploited to achieve two related, albeit slightly different, phenomena. Depending on the driving pulse, solitonic breathers were excited with narrow-band multi-cycle pulses in La{sub 1.84}Sr{sub 0.16}CuO{sub 4} while broad-band half-cycle pulses were employed to achieve a parametric amplification of Josephson Plasma Waves in La{sub 1.905}Ba{sub 0.095}CuO{sub 4}. These experiments are supported by extensive modeling, showing exceptional agreement. A comprehensive study illustrates the strong enhancement of the nonlinear effects near the JPR frequency. Then, I turned to investigate the competition between
The normal state resistivity of CaTh- and La-doped Y(Nd-123 superconductors in the bipolaron model
Directory of Open Access Journals (Sweden)
S. Ghorbani
2007-12-01
Full Text Available Polycrystalline samples of Y1-2xCaxThxBa2Cu3O7-δ (with 0.00 ≤x ≤ 0.075 and NdBa2-xLaxCu3O7-δ (with 0.0≤x≤ 0.30 were prepared by the standard solid state method. The transport and superconducting properties have been studied by the resistivity measurements as a function of temperature and doping concentration. Data of resistivity as a function of temperature was analyzed in terms of the bipolaran model. The model well described resistivity data up to near the critical temperature. Obtained results suggested that the hole localization is the main reason for superconducting suppression in the charge neutral doped cuprates and the La doped Nd-123 in addition charge filling.
Chemical bonding in Tl cuprates studied by x-ray photoemission
International Nuclear Information System (INIS)
Vasquez, R.P.; Siegal, M.P.; Overmyer, D.L.; Ren, Z.F.; Lao, J.Y.; Wang, J.H.
1999-01-01
Epitaxial thin films of the Tl cuprate superconductors Tl 2 Ba 2 CaCu 2 O 8 , Tl 2 Ba 2 Ca 2 Cu 3 O 10 , and Tl 0.78 Bi 0.22 Ba 0.4 Sr 1.6 Ca 2 Cu 3 O 9-δ are studied with x-ray photoemission spectroscopy. These data, together with previous measurements in this lab of Tl 2 Ba 2 CuO 6+δ and TlBa 2 CaCu 2 O 7-δ , comprise a comprehensive data set for a comparative study of Tl cuprates with a range of chemical and electronic properties. In the Cu 2p spectra, a larger energy separation between the satellite and main peaks (E s -E m ) and a lower intensity ratio (I s /I m ) are found to correlate with higher values of T c . Analysis of these spectra within a simple configuration interaction model suggests that higher values of T c are related to low values of the O 2p→Cu 3d charge transfer energy. In the O 1s region, a smaller bond length between Ba and Cu-O planar oxygen is found to correlate with a lower binding energy for the signal associated with Cu-O bonding, most likely resulting from the increased polarization screening by Ba 2+ ions. For samples near optimum doping, maximum T c is observed to occur when the Tl 4f 7/2 binding energy is near 117.9 eV, which is near the middle of the range of values observed for Tl cuprates. Higher Tl 4f 7/2 binding energies, corresponding to formal oxidation states nearer Tl 1+ , are also found to correlate with longer bond lengths between Ba and Tl-O planar oxygen, and with higher binding energies of the O 1s signal associated with Tl-O bonding. copyright 1999 The American Physical Society
Journal of Earth System Science | Indian Academy of Sciences
Indian Academy of Sciences (India)
Home; Journals; Journal of Earth System Science; Volume 123; Issue 3. Evaluation of regional fracture properties for groundwater development using hydrolithostructural domain approach in variably fractured hard rocks of Purulia district, West Bengal, India. Tapas Acharya Rajesh Prasad S Chakrabarti. Volume 123 Issue ...
Images of interlayer Josephson vortices in single-layer cuprates
International Nuclear Information System (INIS)
Moler, K. A.; Kirtley, J. R.; Liang, R.; Bonn, D. A.; Hardy, W. N.; Williams, J. M.; Schlueter, J. A.; Hinks, D.; Villard, G.; Maignan, A.; Nohara, M.; Takagi, H.
2000-01-01
The interlayer penetration depth in layered superconductors may be determined from scanning Superconducting QUantum Interference Device (SQUID) microscope images of interlayer Josephson vortices. The authors compare their findings at 4 K for single crystals of the organic superconductor κ-(BEDT-TTF) 2 Cu(NCS) 2 and three near-optimally doped cuprate superconductors: La 2-x Sr x CuO 4 , (Hg, Cu)Ba 2 CuO 4+δ , and Tl 2 Ba 2 CuO 6+δ
Two band model for the cuprates
Liu, Shiu; White, Steven
2009-03-01
We use a numerical canonical transformation approach to derive an effective two-band model for the hole-doped cuprates, which keeps both oxygen and copper orbitals but removes double occupancy from each. A similar model was considered previously by Frenkel, Gooding, Shraiman, and Siggia (PRB 41, number 1, page 350). We compare the numerically derived model with previously obtained analytical results. In addition to the usual hopping terms between oxygens tpp and Cu-Cu exchange terms Jdd, the model also includes a strong copper-oxygen exchange interaction Jpd and a Kondo-like spin-flip oxygen-oxygen hopping term Kpdp. We use the density matrix renormalization group to study the charge, spin, and pairing properties of the derived model on ladder systems.
Harter, John Wallace
Among the multitude of known cuprate material families and associated structures, the archetype is "infinite-layer" ACuO2, where perfectly square and flat CuO2 planes are separated by layers of alkaline earth atoms. The infinite-layer structure is free of magnetic rare earth ions, oxygen chains, orthorhombic distortions, incommensurate superstructures, ordered vacancies, and other complications that abound among the other material families. Furthermore, it is the only cuprate that can be made superconducting by both electron and hole doping, making it a potential platform for decoding the complex many-body interactions responsible for high-temperature superconductivity. Research on the infinite-layer compound has been severely hindered by the inability to synthesize bulk single crystals, but recent progress has led to high-quality superconducting thin film samples. Here we report in situ angle-resolved photoemission spectroscopy measurements of epitaxially-stabilized Sr1-chiLa chiCuO2 thin films grown by molecular-beam epitaxy. At low doping, the material exhibits a dispersive lower Hubbard band typical of other cuprate parent compounds. As carriers are added to the system, a continuous evolution from Mott insulator to superconducting metal is observed as a coherent low-energy band develops on top of a concomitant remnant lower Hubbard band, gradually filling in the Mott gap. For chi = 0.10, our results reveal a strong coupling between electrons and (pi,pi) anti-ferromagnetism, inducing a Fermi surface reconstruction that pushes the nodal states below the Fermi level and realizing nodeless superconductivity. Electron diffraction measurements indicate the presence of a surface reconstruction that is consistent with the polar nature of Sr1-chiLachiCuO2. Most knowledge about the electron-doped side of the cuprate phase diagram has been deduced by generalizing from a single material family, Re2-chi CechiCuO4, where robust antiferromagnetism has been observed past chi
DEFF Research Database (Denmark)
Tang, Xiao
temperature, REBCO (RE= rare earth) has some evident advantages compared to other high-temperature superconductors in retaining high current densities under strong magnetic fields, thus REBCO high temperature superconducto rs have significant potential for high field engineering applications. Compared...... to Pulsed Laser Deposition (PLD) and Chemical Vapor Deposition (CVD), the trifluoroacetate metal-organic deposition (TFA-MOD) route is more promising for producing REBCO superconducting films, owing to the high-Jc, high reproducibility, and low cost of this technique, which doesn't require any high vacuum...... on the microstructure and performance of FF-MOD derived YBCO films was investigated. Chapter 9 is the summary of the thesis....
Universal spectral signatures in pnictides and cuprates: the role of quasiparticle-pair coupling.
Sacks, William; Mauger, Alain; Noat, Yves
2017-11-08
Understanding the physical properties of a large variety of high-T c superconductors (SC), the cuprate family as well as the more recent iron-based superconductors, is still a major challenge. In particular, these materials exhibit the 'peak-dip-hump' structure in the quasiparticle density of states (DOS). The origin of this structure is explained within our pair-pair interaction (PPI) model: The non-superconducting state consists of incoherent pairs, a 'Cooper-pair glass' which, due to the PPI, undergoes a Bose-like condensation below T c to the coherent SC state. We derive the equations of motion for the quasiparticle operators showing that the DOS 'peak-dip-hump' is caused by the coupling between quasiparticles and excited pair states, or 'super-quasiparticles'. The renormalized SC gap function becomes energy-dependent and non retarded, reproducing accurately the experimental spectra of both pnictides and cuprates, despite the large difference in gap value.
Rare earths production and marketing opportunities
International Nuclear Information System (INIS)
Falconnet, P.G.
1988-01-01
The rare earths (RE) market is relatively small. The total production during 1968 was only 10000 tons (REO) which rose to 27000 tons (REO) during 1985. The three major areas of application, which are volume market for ceric rare earths are catalysts, glass ceramics and metallurgy. Among the other uses of rare earths, the permanent magnets, lamp phosphors and fine ceramics have registered significant growth in RE consumption. Monazite and bastnasite are the main natural source for rare earths and processing of these for one of the rare earths in high demand leads to over production of some others not in demand, thus creating a balance problem. The growth in RE market has always been influenced by the technology shifts and product substitution. For example, the RE consumption during 1974/76 for desulfurization of steel had substantially decreased due to the usage of calcium. Similarly, 1985 had witnessed a drastic cut in the use of REs in fluid cracking due to the introduction of stabilized zeolites which contain less REO. Thus, the overall compound growth rate of demand was only 3.9 % per year during the period 1970-1985. At present, 37 % of the rare earths production goes to the glass/ceramics industry, 33 % for catalyst and 25 % to metallurgy. The price of REs constantly shows a downward trend. This trend coupled with the rapid changes taking place in the various technological fields, demands greater flexibility and high marketing skills from the RE producers. The key factor for future expansion of RE market will be the development of 'high volume' application of ceric rare earths. (author) 2 figs., 8 tabs
A tale of two metals: contrasting criticalities in the pnictides and hole-doped cuprates
Hussey, N. E.; Buhot, J.; Licciardello, S.
2018-05-01
The iron-based high temperature superconductors share a number of similarities with their copper-based counterparts, such as reduced dimensionality, proximity to states of competing order, and a critical role for 3d electron orbitals. Their respective temperature-doping phase diagrams also contain certain commonalities that have led to claims that the metallic and superconducting (SC) properties of both families are governed by their proximity to a quantum critical point (QCP) located inside the SC dome. In this review, we critically examine these claims and highlight significant differences in the bulk physical properties of both systems. While there is now a large body of evidence supporting the presence of a (magnetic) QCP in the iron pnictides, the situation in the cuprates is much less apparent, at least for the end point of the pseudogap phase. We argue that the opening of the normal state pseudogap in cuprates, so often tied to a putative QCP, arises from a momentum-dependent breakdown of quasiparticle coherence that sets in at much higher doping levels but which is driven by the proximity to the Mott insulating state at half filling. Finally, we present a new scenario for the cuprates in which this loss of quasiparticle integrity and its evolution with momentum, temperature and doping plays a key role in shaping the resultant phase diagram. This key issues review is dedicated to the memory of Dr John Loram whose pioneering measurements, analysis and ideas inspired much of its content.
International Nuclear Information System (INIS)
Inosov, Dmytro S.
2008-01-01
In the present work some steps are done towards understanding the anomalous effects observed in the single-particle excitation spectra of cuprates. First, the electronic properties of BSCCO are considered. The main result of this part of the work is a model of the Green's function that is later used for calculating the two-particle excitation spectrum. Then, the matrix element effects in the photoemission spectra of cuprates are discussed. After a general introduction to the problem, the thesis focuses on the recently discovered anomalous behavior of the ARPES spectra that partially originates from the momentum-dependent photoemission matrix element. The momentum- and excitation energy dependence of the anomalous high-energy dispersion, termed ''waterfalls'', is covered in full detail. Understanding the role of the matrix element effects in this phenomenon proves crucial, as they obstruct the view of the underlying excitation spectrum that is of indisputable interest. For the optimally doped bilayer Bi-based cuprate, the renormalized two-particle correlation function in the superconducting state is calculated from ARPES data within an itinerant model based on the random phase approximation (RPA). (orig.)
Role of Coulomb repulsion in multilayer cuprate superconductor
International Nuclear Information System (INIS)
Singh Chauhan, Ekta; Singh, Vipul; Masih, Piyush
2012-01-01
Although BCS theory completely neglects coulomb repulsion; Anderson and Morel showed very early that it plays a central role in superconductivity. Since all high T c superconductors are based on the structure of closely spaced square planner CuO 2 layers and role of interlayer interaction plays important role in enhancement of T c . Therefore the work has been dealt with 'Role of Coulomb repulsion in Multilayer Cuprate Superconductors'. An expression for transition temperature T c is obtained by using simple integration technique and is numerically solved. It has found that T c decreases with electronic repulsion. (author)
Awaji, Satoshi; Tsuchiya, Yuji; Miura, Shun; Ichino, Yusuke; Yoshida, Yutaka; Matsumoto, Kaname
2017-11-01
Nanorods, which are nano-scaled columnar-shape precipitates, have recently been used to improve critical current density J c in magnetic fields for REBa2Cu3O y (RE123, RE: rare earth element) high temperature superconducting tapes/films. However, the flux pinning mechanism of the nanorod is not clear yet. We investigated the J c and resistivity ρ properties in detail and discussed the flux pinning properties on the basis of the flux pinning state diagram for high-quality Sm123 films with well-aligned 5.6 vol% BaHfO3 nanorods. Plateaus were observed in the field dependence of J c and ρ at high temperatures above the delocalization temperature. This suggests that nanorod pinning becomes effective in the vortex liquid phase and it grows up when the temperature decreases toward the delocalization temperature. In the ‘many-nanorod’ state in the high temperature region above the delocalization temperature, double peaks in the F p curves appear due to the coexistence of nanorod pinning and random pinning. At low temperatures below 70 K, however, the well-scaled F p curves at low fields and temperature dependent (non-scaled) normalized F p curves are observed. From detailed analysis using the cooperation model of the random and the correlated pinning centers, we found that nanorod pinning is dominant below the matching field and the cooperation between nanorod pinning and random pinning determines the high field J c properties above the matching field.
High-T{sub c} cuprate superconductivity in a nutshell
Energy Technology Data Exchange (ETDEWEB)
Won, Hyekyung [Department of Physics, Hallym University, Chuncheon 200-702 (Korea); Haas, Stephan; Parker, David; Maki, Kazumi [Department of Physics and Astronomy, University of Southern California, Los Angeles, CA 90089-0484 (United States)
2005-02-01
Since the discovery of high-T{sub c} cuprate superconductivity in 1986 many new experimental techniques and theoretical concepts have been developed. In particular it was shown that the BCS theory of d-wave superconductivity describes semi-quantitatively the high-T{sub c} superconductivity. Furthermore, it was demonstrated that Volovik's approach is extremely useful for finding the quasiparticle properties in the vortex state. Here we survey these developments and forecast future directions. (copyright 2005 WILEY-VCH Verlag GmbH and Co. KGaA, Weinheim) (orig.)
Identification of Raman peaks of high-Tc cuprates in normal state through density of states
International Nuclear Information System (INIS)
Bishoyi, K.C.; Rout, G.C.; Behera, S.N.
2007-01-01
We present a microscopic theory to explain and identify the Raman spectral peaks of high-T c cuprates R 2-x M x CuO 4 in the normal state. We used electronic Hamiltonian prescribed by Fulde in presence of anti-ferromagnetism. Phonon interaction to the hybridization between the conduction electrons of the system and the f-electrons has been incorporated in the calculation. The phonon spectral density is calculated by the Green's function technique of Zubarev at zero wave vector and finite (room) temperature limit. The four Raman active peaks (P 1 -P 4 ) representing the electronic states of the atomic sub-systems of the cuprate system are identified by the calculated quasi-particle energy bands and electron density of states (DOS). The effect of interactions on these peaks are also explained
Energy Technology Data Exchange (ETDEWEB)
Mohapatra, Rasmita, E-mail: rmrmmohapatra@gmail.com [P.G. Department of Applied Physics and Ballistics, F.M. University, Balasore, Odisha 756019 (India); Rout, G.C., E-mail: gcr@iopb.res.in [Physics Enclave, Plot no-664/4825, Lane-4A, Shree Vihar, Patia, Bhubaneswar, Odisha 751024 (India)
2015-05-15
Highlights: • We considered here the interplay of antiferromagnetism (AFM) and Superconductivity (SC) with d-wave pairing symmetry in presence of impurity effect. • The tunneling conductance explains the multiple peaks and dip-hump structure. • It is observed that AFM coupling enhances the superconducting transition temperature. • The low temperature specific heat anomaly due to impurity atoms. - Abstract: We present here a model Hamiltonian to study the interplay between staggered magnetic field and the superconductivity with d-wave pairing symmetry in presence of hybridization between impurity f-electrons of rare-earth ions and 3d-electrons of copper ions. The staggered field and superconducting (SC) gaps are calculated by Green’s function technique and solved self-consistently. The coupling constants are compared using s-wave and d-wave pairings. The strength of hybridization suppresses the magnitude of the gaps; while antiferromagnetic coupling enhances the superconducting transition temperature, but suppresses the Neel temperature. The density of states (DOS) representing tunneling conductance shows complex character with impurity level lying at the Fermi level. The electronic specific heat explains prototype heavy fermion behavior in cuprate systems at low temperatures.
International Nuclear Information System (INIS)
Mohapatra, Rasmita; Rout, G.C.
2015-01-01
Highlights: • We considered here the interplay of antiferromagnetism (AFM) and Superconductivity (SC) with d-wave pairing symmetry in presence of impurity effect. • The tunneling conductance explains the multiple peaks and dip-hump structure. • It is observed that AFM coupling enhances the superconducting transition temperature. • The low temperature specific heat anomaly due to impurity atoms. - Abstract: We present here a model Hamiltonian to study the interplay between staggered magnetic field and the superconductivity with d-wave pairing symmetry in presence of hybridization between impurity f-electrons of rare-earth ions and 3d-electrons of copper ions. The staggered field and superconducting (SC) gaps are calculated by Green’s function technique and solved self-consistently. The coupling constants are compared using s-wave and d-wave pairings. The strength of hybridization suppresses the magnitude of the gaps; while antiferromagnetic coupling enhances the superconducting transition temperature, but suppresses the Neel temperature. The density of states (DOS) representing tunneling conductance shows complex character with impurity level lying at the Fermi level. The electronic specific heat explains prototype heavy fermion behavior in cuprate systems at low temperatures
Dynamics of correlation-frozen antinodal quasiparticles in superconducting cuprates
Cilento, Federico; Manzoni, Giulia; Sterzi, Andrea; Peli, Simone; Ronchi, Andrea; Crepaldi, Alberto; Boschini, Fabio; Cacho, Cephise; Chapman, Richard; Springate, Emma; Eisaki, Hiroshi; Greven, Martin; Berciu, Mona; Kemper, Alexander F.; Damascelli, Andrea; Capone, Massimo; Giannetti, Claudio; Parmigiani, Fulvio
2018-01-01
Many puzzling properties of high–critical temperature (Tc) superconducting (HTSC) copper oxides have deep roots in the nature of the antinodal quasiparticles, the elementary excitations with wave vector parallel to the Cu–O bonds. These electronic states are most affected by the onset of antiferromagnetic correlations and charge instabilities, and they host the maximum of the anisotropic superconducting gap and pseudogap. We use time-resolved extreme-ultraviolet photoemission with proper photon energy (18 eV) and time resolution (50 fs) to disclose the ultrafast dynamics of the antinodal states in a prototypical HTSC cuprate. After photoinducing a nonthermal charge redistribution within the Cu and O orbitals, we reveal a dramatic momentum-space differentiation of the transient electron dynamics. Whereas the nodal quasiparticle distribution is heated up as in a conventional metal, new quasiparticle states transiently emerge at the antinodes, similarly to what is expected for a photoexcited Mott insulator, where the frozen charges can be released by an impulsive excitation. This transient antinodal metallicity is mapped into the dynamics of the O-2p bands, thus directly demonstrating the intertwining between the low- and high-energy scales that is typical of correlated materials. Our results suggest that the correlation-driven freezing of the electrons moving along the Cu–O bonds, analogous to the Mott localization mechanism, constitutes the starting point for any model of high-Tc superconductivity and other exotic phases of HTSC cuprates. PMID:29507885
Simulation of ion-beam induced defects in cuprate superconductors
International Nuclear Information System (INIS)
Dineva, M.; Marksteiner, M.; Lang, W.
2005-01-01
Full text: Heavy-ion irradiation of cuprate superconductors is well known to produce columnar defect tracks along which magnetic vortices can be pinned. Hence, this effect has a large potential for practical applications and can enhance the critical current of the high-temperature superconducting materials. On the other hand, little work has been devoted to light-ion irradiation of the new superconductors. Our previous experimental results have indicated a systematic change of electric transport properties when irradiating YBa 2 Cu 3 O 7 (YBCO) with 75 KEXV He + ions. The purpose of the present study is the investigation of the ion-target interactions with computer simulation programs based on the binary collision approximation. The program package SRIM (Stopping and Range of Ions in Matter) is widely used to simulate the impact of energetic ions (10 eV to 2 GeV) on a solid target using a quantum mechanical treatment of ion-atom collisions under the assumption of an unstructured target material. A similar program, MARLOWE, includes the exact crystalline structure of the target and, thus, is able to calculate ion channeling effects and angle dependences. Detailed results of the penetration range of ions into YBCO, scattering cascades, creation of vacancies and interstitials, are reported for various kinds of ions. One of the central results is that light ions with energy of about 80 KEXV can penetrate through thin films of the cuprate superconductors and create point defects, mainly by oxygen displacement. (author)
Chemical Bonding in Tl Cuprates Studied by X-Ray Photoemission
Energy Technology Data Exchange (ETDEWEB)
Lao, J.Y.; Overmyer, D.L.; Ren, Z.F.; Siegal, M.P.; Vasquez, R.P.; Wang, J.H.
1999-04-05
Epitaxial thin films of the Tl cuprate superconductors Tl{sub 2}Ba{sub 2}CaCu{sub 2}O{sub 8}, Tl{sub 2}Ba{sub 2}Ca{sub 2}Cu{sub 3}O{sub 10}, and TL{sub 0.78}Bi{sub 0.22}Ba{sub 0.4}Sr{sub 1.6}Ca{sub 2}Cu{sub 3}O{sub 9{minus}{delta}} are studied with x-ray photoemission spectroscopy. These data, together with previous measurements in this lab of Tl{sub 2}Ba{sub 2}CuO{sub 6+{delta}} and TlBa{sub 2}CaCu{sub 2}O{sub 7{minus}{delta}}, comprise a comprehensive data set for a comparative study of Tl cuprates with a range of chemical and electronic properties. In the Cu 2p spectra, a larger energy separation between the satellite and main peaks (E{sub s}-E{sub m}) and a lower intensity ratio (I{sub s}/I{sub m}) are found to correlate with higher values of T{sub c}. Analysis of these spectra within a simple configuration interaction model suggests that higher values of T{sub c} are related to low values of the O 2p {r_arrow} Cu 3d charge transfer energy. In the O 1s region, a smaller bond length between Ba and Cu-O planar oxygen is found to correlate with a lower binding energy for the signal associated with Cu-O bonding, most likely resulting from the increased polarization screening by Ba{sup 2+} ions. For samples near optimum doping, maximum T{sub c} is observed to occur when the Tl 4f{sub 7/2} binding energy is near 117.9 eV, which is near the middle of the range of values observed for Tl cuprates. Higher Tl 4f{sub 7/2} binding energies, corresponding to formal oxidation states nearer Tl{sup 1+}, are also found to correlate with longer bond lengths between Ba and Tl-O planar oxygen, and with higher binding energies of the O 1s signal associated with Tl-O bonding.
Chemical bonding in Tl cuprates studied by x-ray photoemission
Energy Technology Data Exchange (ETDEWEB)
Vasquez, R.P. [Center for Space Microelectronics Technology, Jet Propulsion Laboratory, California Institute of Technology, Pasadena, California 91109-8099 (United States); Siegal, M.P.; Overmyer, D.L. [Sandia National Laboratories, Albuquerque, New Mexico 87185-1421 (United States); Ren, Z.F.; Lao, J.Y.; Wang, J.H. [Materials Synthesis Laboratory, Department of Chemistry, State University of New York, Buffalo, New York 14260-3000 (United States)
1999-08-01
Epitaxial thin films of the Tl cuprate superconductors Tl{sub 2}Ba{sub 2}CaCu{sub 2}O{sub 8}, Tl{sub 2}Ba{sub 2}Ca{sub 2}Cu{sub 3}O{sub 10}, and Tl{sub 0.78}Bi{sub 0.22}Ba{sub 0.4}Sr{sub 1.6}Ca{sub 2}Cu{sub 3}O{sub 9{minus}{delta}} are studied with x-ray photoemission spectroscopy. These data, together with previous measurements in this lab of Tl{sub 2}Ba{sub 2}CuO{sub 6+{delta}} and TlBa{sub 2}CaCu{sub 2}O{sub 7{minus}{delta}}, comprise a comprehensive data set for a comparative study of Tl cuprates with a range of chemical and electronic properties. In the Cu 2p spectra, a larger energy separation between the satellite and main peaks (E{sub s}{minus}E{sub m}) and a lower intensity ratio (I{sub s}/I{sub m}) are found to correlate with higher values of T{sub c}. Analysis of these spectra within a simple configuration interaction model suggests that higher values of T{sub c} are related to low values of the O&hthinsp;2p{r_arrow}Cu&hthinsp;3d charge transfer energy. In the O&hthinsp;1s region, a smaller bond length between Ba and Cu-O planar oxygen is found to correlate with a lower binding energy for the signal associated with Cu-O bonding, most likely resulting from the increased polarization screening by Ba{sup 2+} ions. For samples near optimum doping, maximum T{sub c} is observed to occur when the Tl 4f{sub 7/2} binding energy is near 117.9 eV, which is near the middle of the range of values observed for Tl cuprates. Higher Tl&hthinsp;4f{sub 7/2} binding energies, corresponding to formal oxidation states nearer Tl{sup 1+}, are also found to correlate with longer bond lengths between Ba and Tl-O planar oxygen, and with higher binding energies of the O&hthinsp;1s signal associated with Tl-O bonding. {copyright} {ital 1999} {ital The American Physical Society}
Pseudogap temperature T* of cuprate superconductors from the Nernst effect
Cyr-Choinière, O.; Daou, R.; Laliberté, F.; Collignon, C.; Badoux, S.; LeBoeuf, D.; Chang, J.; Ramshaw, B. J.; Bonn, D. A.; Hardy, W. N.; Liang, R.; Yan, J.-Q.; Cheng, J.-G.; Zhou, J.-S.; Goodenough, J. B.; Pyon, S.; Takayama, T.; Takagi, H.; Doiron-Leyraud, N.; Taillefer, Louis
2018-02-01
We use the Nernst effect to delineate the boundary of the pseudogap phase in the temperature-doping phase diagram of hole-doped cuprate superconductors. New data for the Nernst coefficient ν (T ) of YBa2Cu3Oy (YBCO), La1.8 -xEu0.2SrxCuO4 (Eu-LSCO), and La1.6 -xNd0.4SrxCuO4 (Nd-LSCO) are presented and compared with previously published data on YBCO, Eu-LSCO, Nd-LSCO, and La2 -xSrxCuO4 (LSCO). The temperature Tν at which ν /T deviates from its high-temperature linear behavior is found to coincide with the temperature at which the resistivity ρ (T ) deviates from its linear-T dependence, which we take as the definition of the pseudogap temperature T★—in agreement with the temperature at which the antinodal spectral gap detected in angle-resolved photoemission spectroscopy (ARPES) opens. We track T★ as a function of doping and find that it decreases linearly vs p in all four materials, having the same value in the three LSCO-based cuprates, irrespective of their different crystal structures. At low p ,T★ is higher than the onset temperature of the various orders observed in underdoped cuprates, suggesting that these orders are secondary instabilities of the pseudogap phase. A linear extrapolation of T★(p ) to p =0 yields T★(p →0 ) ≃TN (0), the Néel temperature for the onset of antiferromagnetic order at p =0 , suggesting that there is a link between pseudogap and antiferromagnetism. With increasing p ,T★(p ) extrapolates linearly to zero at p ≃pc 2 , the critical doping below which superconductivity emerges at high doping, suggesting that the conditions which favor pseudogap formation also favor pairing. We also use the Nernst effect to investigate how far superconducting fluctuations extend above the critical temperature Tc, as a function of doping, and find that a narrow fluctuation regime tracks Tc, and not T★. This confirms that the pseudogap phase is not a form of precursor superconductivity, and fluctuations in the phase of the
International Nuclear Information System (INIS)
Lagunas-Solar, M.C.; Thibeau, H.L.; Goodart, C.E.; Little, F.E.; Navarro, N.J.; Hartnett, D.E.
1985-01-01
An integrally shielded 123 Xe → 123 I generator system has been designed and tested under production conditions for its suitability as a multicurie handling device from which to produce radiopharmaceutical-quality high-purity no-carrier-added (NCA) 123 I. The 123 Xe → 123 I generator system is expected to provide an alternative to current techniques and to increase the availability and reliability of high-purity 123 I made via the 127 I(p,5n) 123 Xe → 123 I nuclear reaction. The generator system is based on the Crocker Nuclear Laboratory's continuous-flow production system which has been operating since 1974 for the multicurie production of 123 I. The generator system, which consists of an integrally shielded xenon trap and separate loading and processing apparatuses, is simple and reliable to operate, can be adapted to computerized control, and provides a safe working environment for the repeated handling of multicurie amounts of Xe-I radioactivities
Boskovic, Colette
2017-09-19
Longstanding and important applications make use of the chemical and physical properties of both rare earth metals and polyoxometalates of early transition metals. The catalytic, optical, and magnetic features of rare earth metal ions are well-known, as are the reversible multielectron redox and photoredox capabilities of polyoxomolybdates and polyoxotungstates. The combination of rare earth ions and polyoxometalates in discrete molecules and coordination polymers is of interest for the unique combination of chemical and physical properties that can arise. This Account surveys our efforts to synthesize and investigate compounds with rare earth ions and polyoxometalates (RE-POMs), sometimes with carboxylate-based organic coligands. Our general synthetic approach is "bottom-up", which affords well-defined nanoscale molecules, typically in crystalline form and amenable to single-crystal X-ray diffraction for structure determination. Our particular focus is on elucidation of the physical properties conferred by the different structural components with a view to ultimately being able to tune these properties chemically. For this purpose, we employ a variety of spectroscopic, magnetochemical, electrochemical, and scattering techniques in concert with theoretical modeling and computation. Studies of RE-POM single-molecule magnets (SMMs) have utilized magnetic susceptibility, inelastic neutron scattering, and ab initio calculations. These investigations have allowed characterization of the crystal field splitting of the rare earth(III) ions that is responsible for the SMM properties of slow magnetic relaxation and magnetization quantum tunneling. Such SMMs are promising for applications in quantum computing and molecular spintronics. Photophysical measurements of a family of hybrid RE-POMs with organic ligands have afforded insights into sensitization of Tb(III) and Eu(III) emission through both organic and polyoxometalate chromophores in the same molecule. Detailed
Evaluation of image reconstruction methods for 123I-MIBG-SPECT. A rank-order study
International Nuclear Information System (INIS)
Soederberg, Marcus; Mattsson, Soeren; Oddstig, Jenny; Uusijaervi-Lizana, Helena; Leide-Svegborn, Sigrid; Valind, Sven; Thorsson, Ola; Garpered, Sabine; Prautzsch, Tilmann; Tischenko, Oleg
2012-01-01
Background: There is an opportunity to improve the image quality and lesion detectability in single photon emission computed tomography (SPECT) by choosing an appropriate reconstruction method and optimal parameters for the reconstruction. Purpose: To optimize the use of the Flash 3D reconstruction algorithm in terms of equivalent iteration (EI) number (number of subsets times the number of iterations) and to compare with two recently developed reconstruction algorithms ReSPECT and orthogonal polynomial expansion on disc (OPED) for application on 123 I-metaiodobenzylguanidine (MIBG)-SPECT. Material and Methods: Eleven adult patients underwent SPECT 4 h and 14 patients 24 h after injection of approximately 200 MBq 123 I-MIBG using a Siemens Symbia T6 SPECT/CT. Images were reconstructed from raw data using the Flash 3D algorithm at eight different EI numbers. The images were ranked by three experienced nuclear medicine physicians according to their overall impression of the image quality. The obtained optimal images were then compared in one further visual comparison with images reconstructed using the ReSPECT and OPED algorithms. Results: The optimal EI number for Flash 3D was determined to be 32 for acquisition 4 h and 24 h after injection. The average rank order (best first) for the different reconstructions for acquisition after 4 h was: Flash 3D 32 > ReSPECT > Flash 3D 64 > OPED, and after 24 h: Flash 3D 16 > ReSPECT > Flash 3D 32 > OPED. A fair level of inter-observer agreement concerning optimal EI number and reconstruction algorithm was obtained, which may be explained by the different individual preferences of what is appropriate image quality. Conclusion: Using Siemens Symbia T6 SPECT/CT and specified acquisition parameters, Flash 3D 32 (4 h) and Flash 3D 16 (24 h), followed by ReSPECT, were assessed to be the preferable reconstruction algorithms in visual assessment of 123 I-MIBG images
Radioanalysis of RE enrichment of ion adsorption type RE ores
Zhao Shu Quan; Hu He Ping; Li Fu Sheng; Chen Ying Min; LiuShiMing
2002-01-01
Objective: To analyze the radioactivity in Rare Earth (RE) enrichment of ion adsorption type RE ores. Methods: Using HPGe-gamma spectrometer to analyze the activity ratio of gamma radionuclides in kind of samples, using FJ-2603 low background alpha, beta measurement apparatus to measure their total alpha and total beta activities, and using X-ray fluorescence spectrometer to analyze contents of La sub 2 O sub 3 and Y sub 2 O sub 3 , respectively. Results: HPGe gamma spectroscopy and X-ray fluorescence spectroscopy are simple, convenient and non-destructive methods of analyzing radionuclides and La sub 2 O sub 3 , Y sub 2 O sub 3 in RE enrichment of ion adsorption type RE ores, respectively. Conclusion: The basic data were provided for radiation protection and treatment of gas, liquid and solid waste in RE production of ion adsorption type RE ores; method and experience were provided for studying ion adsorption type RE ores
International Nuclear Information System (INIS)
Li, Lu; Zhou, Pin; Zhang, Hongbo; Meng, Xianglong; Li, Juexiu; Sun, Tonghua
2017-01-01
Highlights: • Various rare earth (RE)-doped ZnO/KIT-6 sorbents were prepared via sol-gel method. • La showed the highest efficiency on promoting ZnO/KIT-6 desulfurization activity. • The morphology of ZnO on KIT-6 played a crucial role for the reactivity. • The most initial factor of improving reactivity by RE was surface chemical property. • Crystallinity, host-guest interaction were also important to ZnO state on support. - Abstract: Rare earth oxides (RE = Ce, La, Sm and Gd) doped ZnO supported on KIT-6 sorbents (RE-ZnO/KIT-6) were synthesized by sol-gel method and their performance for deep removal of H 2 S (bellow 0.1 ppmv) from gas stream at medium temperature was tested. The RE dopants (except Ce) significantly enhance the deep desulfurization capacity of ZnO/KIT-6 sorbent and maintained higher sulfur uptake capacities upon multiple cycles of regeneration by a simple thermal oxidation in 10 v% of O 2 in N 2 atmosphere. The results of SAXS, XRD, N 2 physisorption, TEM, FIIR, and XPS implied that the KIT-6 structure of loading metal oxides remained intact. It was found that RE could hinder the ZnO crystal ripening during calcination resulted in smaller ZnO particles, enhance the interaction of ZnO and silica matrix to improve the dispersion of active phase on KIT-6. Furthermore, by increasing the outlayer electron density of Zn atom and oxygen transfer ability, the synergistic effect considered to be favorable for RE-ZnO/KIT-6 sulfidation. Even though the performance of improving ZnO dispersion was weaker than that of Sm and Gd, La-ZnO/KIT-6 performs the best deep desulfurizers by changing the surface chemical atmosphere for ZnO. Steam in the gas stream inhibited the capture of H 2 S by ZnO in the sorbents, in the case of La-ZnO/KIT-6, the steam content should control as lower as 5 v% to ensure the desulfurization efficiency and precision.
Rare earth elements and permanent magnets (invited)
Dent, Peter C.
2012-04-01
Rare earth (RE) magnets have become virtually indispensible in a wide variety of industries such as aerospace, automotive, electronics, medical, and military. RE elements are essential ingredients in these high performance magnets based on intermetallic compounds RECo5, RE2TM17 (TM: transition metal), and RE2TM14B. Rare earth magnets are known for their superior magnetic properties—high induction, and coercive force. These properties arise due to the extremely high magnetocrystalline anisotropy made possible by unique 3d-4f interactions between transition metals and rare earths. For more than 40 years, these magnets remain the number one choice in applications that require high magnetic fields in extreme operating conditions—high demagnetization forces and high temperature. EEC produces and specializes in RECo5 and RE2TM17 type sintered magnets. Samarium and gadolinium are key RE ingredients in the powder metallurgical magnet production processes which include melting, crushing, jet milling, pressing, sintering, and heat treating. The magnetic properties and applications of these magnets will be discussed. We will also briefly discuss the past, current, and future of the permanent magnet business. Currently, over 95% of all pure rare earth oxides are sourced from China, which currently controls the market. We will provide insights regarding current and potential new magnet technologies and designer choices, which may mitigate rare earth supply chain issues now and into the future.
Doping dependence of charge order in electron-doped cuprate superconductors
Mou, Yingping; Feng, Shiping
2017-12-01
In the recent studies of the unconventional physics in cuprate superconductors, one of the central issues is the interplay between charge order and superconductivity. Here the mechanism of the charge-order formation in the electron-doped cuprate superconductors is investigated based on the t-J model. The experimentally observed momentum dependence of the electron quasiparticle scattering rate is qualitatively reproduced, where the scattering rate is highly anisotropic in momentum space, and is intriguingly related to the charge-order gap. Although the scattering strength appears to be weakest at the hot spots, the scattering in the antinodal region is stronger than that in the nodal region, which leads to the original electron Fermi surface is broken up into the Fermi pockets and their coexistence with the Fermi arcs located around the nodal region. In particular, this electron Fermi surface instability drives the charge-order correlation, with the charge-order wave vector that matches well with the wave vector connecting the hot spots, as the charge-order correlation in the hole-doped counterparts. However, in a striking contrast to the hole-doped case, the charge-order wave vector in the electron-doped side increases in magnitude with the electron doping. The theory also shows the existence of a quantitative link between the single-electron fermiology and the collective response of the electron density.
Inverse correlation between quasiparticle mass and T c in a cuprate high-T c superconductor.
Putzke, Carsten; Malone, Liam; Badoux, Sven; Vignolle, Baptiste; Vignolles, David; Tabis, Wojciech; Walmsley, Philip; Bird, Matthew; Hussey, Nigel E; Proust, Cyril; Carrington, Antony
2016-03-01
Close to a zero-temperature transition between ordered and disordered electronic phases, quantum fluctuations can lead to a strong enhancement of electron mass and to the emergence of competing phases such as superconductivity. A correlation between the existence of such a quantum phase transition and superconductivity is quite well established in some heavy fermion and iron-based superconductors, and there have been suggestions that high-temperature superconductivity in copper-oxide materials (cuprates) may also be driven by the same mechanism. Close to optimal doping, where the superconducting transition temperature T c is maximal in cuprates, two different phases are known to compete with superconductivity: a poorly understood pseudogap phase and a charge-ordered phase. Recent experiments have shown a strong increase in quasiparticle mass m* in the cuprate YBa2Cu3O7-δ as optimal doping is approached, suggesting that quantum fluctuations of the charge-ordered phase may be responsible for the high-T c superconductivity. We have tested the robustness of this correlation between m* and T c by performing quantum oscillation studies on the stoichiometric compound YBa2Cu4O8 under hydrostatic pressure. In contrast to the results for YBa2Cu3O7-δ, we find that in YBa2Cu4O8, the mass decreases as T c increases under pressure. This inverse correlation between m* and T c suggests that quantum fluctuations of the charge order enhance m* but do not enhance T c.
Two types of charge transfer excitations in low dimensional cuprates: an electron energy-loss study
Czech Academy of Sciences Publication Activity Database
Knupfer, M.; Fink, J.; Drechsler, S.-L.; Hayn, R.; Málek, Jiří; Moskvin, A.S.
137-140, - (2004), s. 469-473 ISSN 0368-2048 Institutional research plan: CEZ:AV0Z1010914 Keywords : cuprates * electronic excitations * electron energy-loss spectroscopy Subject RIV: BM - Solid Matter Physics ; Magnetism Impact factor: 1.069, year: 2004
High-temperature superconductivity in solid solutions based on mixed yttrium and barium cuprate
International Nuclear Information System (INIS)
Bazuev, G.V.; Kirsanov, N.A.; Makarova, O.V.; Zubkov, V.G.; Shveikin, G.P.
1990-01-01
The discovery of high-temperature superconductivity (T c = 30-40 K) in mixed lanthanum and alkaline earth cuprates La 2-x M x CuO 4 , where M = Ba and Ca (1-3) stimulated an extensive search for new superconducting phases based on mixed oxides of these elements. The superconducting transition temperature T c in LnBa 2 Cu 3 O 7-z phases is practically independent of the REE and lies between 90-96 K. The crystal structure of superconducting YBa 2 Cu 3 O 7-z is similar to perovskite, has orthorhombic symmetry (4,5), and is related to the lanthanum barium cuprite tetragonal defect structure La 3 Ba 3 Cu 6 O 14.1 (8). A study of possible solid solutions (SS) based on YBa 2 Cu 3 O 7-z through iso- or heterovalent substitution for Y 3+ and Ba 2+ and of their electrical properties seems warranted. In the present work, the authors report the synthesis, x-ray diffraction study, and specific electric resistivity of SS Y 1-x M x (Ba 1-y M y ') 2 Cu 3 O 7-z , where M = La, Lu, Sc, In, K, Zr, and Ce and M' = Ca, Sr, Mg, K, and La
Probing the singlet character of the two-hole states in cuprate superconductors
Ghiringhelli, G; Brookes, NB; Tjeng, LH; Mizokawa, T; Tjernberg, O; Menovsky, AA; Steeneken, P.G.
Using spin-resolved resonant photoemission we have probed the singlet vs. triplet character of the two-hole state in the layered cuprates Bi2Sr2CaCu2O8+delta La2-xSrxCuO4 and Sr2CuO2Cl2. The combination of the photon circular polarization with the photoelectron spin detection gives access to the
Journal of Earth System Science | Indian Academy of Sciences
Indian Academy of Sciences (India)
Home; Journals; Journal of Earth System Science. K Dharanirajan. Articles written in Journal of Earth System Science. Volume 123 Issue 8 December 2014 pp 1819-1830. Geomorphic settings of mangrove ecosystem in South Andaman Island: A geospatial approach · E Yuvaraj K Dharanirajan S Jayakumar Saravanan.
Microscopic Superconductivity and Room Temperature Electronics of High-Tc Cuprates
International Nuclear Information System (INIS)
Liu Fusui; Chen Wanfang
2008-01-01
This paper points out that the Landau criterion for macroscopic superfluidity of He II is only a criterion for microscopic superfluidity of 4 He, extends the Landau criterion to microscopic superconductivity in fermions (electron and hole) system and system with Cooper pairs without long-range phase coherence. This paper gives another three non-superconductive systems that are of microscopic superconductivity. This paper demonstrates that one application of microscopic superconductivity is to establish room temperature electronics of the high-T c cuprates
Non-BCS superconductivity for underdoped cuprates by spin-vortex attraction
Marchetti, P. A.; Ye, F.; Su, Z. B.; Yu, L.
2011-01-01
Within a gauge approach to the t-J model, we propose a new, non-BCS mechanism of superconductivity for underdoped cuprates. The gluing force of the superconducting mechanism is an attraction between spin vortices on two different N\\'eel sublattices, centered around the empty sites described in terms of fermionic holons. The spin fluctuations are described by bosonic spinons with a gap generated by the spin vortices. Due to the no-double occupation constraint, there is a gauge attraction betwe...
Strong Three-magnon Scattering in Cuprates by Resonant X-rays
Ament, Luuk J. P.; Brink, Jeroen van den
2010-01-01
We show that Resonant Inelastic X-ray scattering (RIXS) is sensitive to three-magnon excitations in cuprates. Even if it requires three electrons to simultaneously flip their spin, the RIXS tri-magnon scattering amplitude is not small. At the Cu $L$-edge its intensity is generally larger than the bi-magnon one and at low transferred momentum even larger than the single-magnon intensity. At the copper $M$-edge the situation is yet more extreme: in this case three-magnon scattering is dominatin...
Energy Technology Data Exchange (ETDEWEB)
Morales, L.A; Sierra-Gallego, G. [Departamento de Materiales y Minerales, Facultad de Minas, Universidad Nacional de Colombia, Calle 75 # 79A-51, Bloque M17, Medellín (Colombia); Barrero, C.A. [Grupo de Estado Sólido, Instituto de Física, Universidad de Antioquia, Calle 70 No. 52-21, A.A. 1226, Medellín (Colombia); Arnache, O., E-mail: oscar.arnache@udea.edu.co [Grupo de Estado Sólido, Instituto de Física, Universidad de Antioquia, Calle 70 No. 52-21, A.A. 1226, Medellín (Colombia)
2016-09-15
Highlights: • Rare-earth orthoferrites were successfully synthesized by the self-combustion method. • The relative recoilless F-factors for REFeO{sub 3} with respect to α-Fe were calculated. • Magnetic hyperfine fields, cell volumes and Fe−O−Fe bond angles are correlated. - Abstract: In this work, rare-earth orthoferrites polycrystalline compounds REFeO{sub 3} (REFO) with RE = rare-earth La, Pr, Nd and Sm were synthesized by the self-combustion method. A direct correlation between the magnitude of the magnetic hyperfine field and the Fe−O{sub 1}−Fe bond angles was observed. From transmission Mössbauer spectra recorded at room-temperature, relative recoilless F-factors for these REFO compounds were estimated. The method applied to perform this calculation was based on the determination of two subspectral areas present in a mixture of known amounts of the compound under study and a standard sample (α-Fe). For that purpose spectra were thickness-corrected and fitted using lorentzian lines. The so obtained factors were F-{sub REFeO3} (RE = rare-earth La, Pr, Nd and Sm): 1.30 ± 0.02, 1.08 ± 0.04, 1.15 ± 0.05, 1.18 ± 0.08 respectively. The absolute recoilless factors obtained by this method had an average relative error around 11% in comparison with the values predicted by the Debye model.
Investigation on thermophysical properties of RE{sub 6}UO{sub 12}(s) (RE = La, Pr, Nd, Sm)
Energy Technology Data Exchange (ETDEWEB)
Sahu, Manjulata, E-mail: manju@barc.gov.in [Radioanalytical Chemistry Division, Bhabha Atomic Research Centre, Trombay, Mumbai 400085 (India); Krishnan, K. [Fuel Chemistry Division, Bhabha Atomic Research Centre, Trombay, Mumbai 400085 (India); Jain, Dheeraj [Chemistry Division, Bhabha Atomic Research Centre, Trombay, Mumbai 400085 (India); Saxena, M.K. [Radioanalytical Chemistry Division, Bhabha Atomic Research Centre, Trombay, Mumbai 400085 (India); Dash, Smruti [Product development Division, Bhabha Atomic Research Centre, Trombay, Mumbai 400085 (India)
2016-08-10
Highlights: • Synthesis of RE{sub 6}UO{sub 12}(s)(RE = La, Pr, Nd, Sm) was performed by combustion method and characterization by XRD. • Thermal expansion measurements were carried out on RE{sub 6}UO{sub 12}(s)(RE = Pr, and Sm) using HT-XRD. • Heat capacity of RE{sub 6}UO{sub 12}(s)(RE = La, Pr, Nd, Sm) was measured in the temperature range 300–870 K. • The nonstoichiometry in RE{sub 6}UO{sub 12}(s) was checked using TG, XPS, chemical analysis and electrical conductivity measurement. - Abstract: RE{sub 6}UO{sub 12}(s) (RE = La, Pr, Nd, Sm) was synthesized by citrate-nitrate combustion method. The synthesis condition for Pr{sub 6}UO{sub 12}(s) was optimized. Nonstoichiometry in these rare earth uranates in argon atmosphere was analysed using various techniques like thermogravimetry (TG), X-ray photo electron spectroscopy (XPS), chemical analysis and electrical conductivity measurements. Thermal expansions of RE{sub 6}UO{sub 12}(s) (RE = Pr and Sm) was studied in the temperature range 298–1273 K by high temperature X-ray powder diffractometry and compared with that of similar rare earth compounds reported in the literature. Heat capacity of RE{sub 6}UO{sub 12}(s) (RE = La, Pr, Nd, Sm) was measured by differential scanning calorimetry in the temperature range 300–870 K. Enthalpy, entropy and Gibbs energy functions of these compounds were computed from the measured heat capacity data.
Low-energy charge excitations in an undoped cuprate:Description beyond the standard pdĺ-model?
Czech Academy of Sciences Publication Activity Database
Drechsler, S.L.; Málek, Jiří; Hayn, R.; Knupfer, M.; Moskvin, A. S.; Fink, J.
2003-01-01
Roč. 17, 18, 19 & 20 (2003), s. 3324-3328 ISSN 0217-9792 Institutional research plan: CEZ:AV0Z1010914 Keywords : cuprates * EELS * loss function exact diagonalization Subject RIV: BM - Solid Matter Physics ; Magnetism Impact factor: 0.473, year: 2003
Energy Technology Data Exchange (ETDEWEB)
Block, Theresa; Klenner, Steffen; Heletta, Lukas; Poettgen, Rainer [Muenster Univ. (Germany). Inst. fuer Anorganische und Analytische Chemie
2018-04-01
Eighteen new rare earth-rich intermetallic phases RE{sub 10}TCd{sub 3} (RE = Y, Tb, Dy, Ho, Er, Tm, Lu; T = Rh, Pd, Ir, Pt) were obtained by induction melting of the elements in sealed niobium ampoules followed by annealing in muffle furnaces. All samples were characterized by X-ray powder diffraction. The structures of four representatives were refined from single-crystal X-ray diffractometer data: ordered Co{sub 2}Al{sub 5} type, P6{sub 3}/mmc, a = 951.2(1), c = 962.9(2) pm, wR = 0.0460, 595 F{sup 2} values, 20 parameters for Er{sub 10}RhCd{sub 3}; a = 945.17(4), c = 943.33(4), wR = 0.0395, 582 F{sup 2} values, 21 parameters for Lu{sub 9.89}PdCd{sub 3.11}; a = 964.16(6), c = 974.93(6) pm, wR = 0.0463, 614 F{sup 2} values, 21 parameters for Y{sub 10}Ir{sub 1.09}Cd{sub 2.91}; a = 955.33(3), c = 974.56(3) pm, wR = 0.0508, 607 F{sup 2} values, 22 refined parameters for Dy{sub 9.92}IrCd{sub 3.08}. Refinements of the occupancy parameters revealed small homogeneity ranges resulting from RE/Cd, respectively T/Cd mixing. The basic building units of the RE{sub 10}TCd{sub 3} phases are transition metal-centered RE{sub 6} trigonal prisms (TP) that are condensed with double-pairs of empty RE{sub 6} octahedra via common triangular faces. A second type of rods is formed by slightly distorted RE3 rate at Cd{sub 6}RE{sub 6} icosahedra which are condensed via Cd{sub 3} triangular faces. The shortest interatomic distances occur for RE-T, compatible with strong covalent bonding interactions. Temperature dependent magnetic susceptibility measurements were performed for RE{sub 10}RhCd{sub 3} (RE = Dy-Tm, Lu), RE{sub 10}IrCd{sub 3} (RE = Er, Tm, Lu) and RE{sub 10}PtCd{sub 3} (RE = Y, Lu). While Y{sub 10}PtCd{sub 3} and Lu{sub 10}TCd{sub 3} (T = Rh, Ir, Pt) show Pauli paramagnetic behavior, the compounds containing paramagnetic rare earth elements show Curie-Weiss behavior (the experimental magnetic moments indicate stable trivalent RE{sup 3+}) and magnetic ordering at low temperatures
Energy Technology Data Exchange (ETDEWEB)
Hatterer, C.J.; Eustache, B.; Collin, L.; Beuran, C.F.; Partiot, C.; Germain, P.; Xu, X.Z.; Lagues, M. [CNRS, Paris (France). Surfaces et Supraconducteurs; Michalowicz, A. [Laboratoire de Physique des Milieux Desordonnes, Universite Paris XII Val-de-Marne, 61 avenue du general de Gaulle, 94010, Creteil Cedex (France)]|[LURE, Universite Paris Sud, 91405, Orsay Cedex (France); Moscovici, J. [Laboratoire de Physique des Milieux Desordonnes, Universite Paris XII Val-de-Marne, 61 avenue du general de Gaulle, 94010, Creteil Cedex (France); Deville Cavellin, C. [CNRS, Paris (France). Surfaces et Supraconducteurs]|[Laboratoire d`Electronique, Universite Paris XII Val-de-Marne, 61 av. du general de Gaulle, 94010, Creteil Cedex (France); Traverse, A. [LURE, Universite Paris Sud, 91405, Orsay Cedex (France)
1997-04-01
The structure of high-T{sub c} superconducting cuprate compounds is based on CuO{sub 2} planes alternating with blocks that behave as charge reservoirs. The apical oxygen atoms which belong to these reservoirs are suspected to play a role in the mechanism of superconductivity. It thus seems necessary to measure the amount of apical oxygen atoms in various compounds, as a function of the superconducting properties. Polarisation dependent X-ray absorption spectroscopy (XAS) measurements were performed near the Cu K-edge on three types of phases. We collected information about the neighbourhood of the copper atom in the cuprate planes and in the direction perpendicular to these planes. Two of these phases have well known structures: Bi2212 in which copper atoms are on a pyramidal site and infinite layer phase, a square planar cuprate without apical oxygen. We used the obtained results as reference data to study a new copper-rich phase related to the spin-ladder series. (orig.)
Rare earth niobate coordination polymers
Muniz, Collin N.; Patel, Hiral; Fast, Dylan B.; Rohwer, Lauren E. S.; Reinheimer, Eric W.; Dolgos, Michelle; Graham, Matt W.; Nyman, May
2018-03-01
Rare-earth (RE) coordination polymers are infinitely tailorable to yield luminescent materials for various applications. Here we described the synthesis of a heterometallic rare-earth coordination compound ((CH3)2SO)3(RE)NbO(C2O4)3((CH3)2SO) = dimethylsulfoxide, DMSO, (C2O2= oxalate), (RE=La, Ce, Pr, Nd, Sm, Eu, Gd, Tb). The structure was obtained from single crystal X-ray diffraction of the La analogue. The Nb˭O and DMSO terminal-bonding character guides assembly of an open framework structure with noncentrosymmetric RE-coordination geometry, and large spacing between the RE centers. A second structure was observed by PXRD for the smaller rare earths (Dy, Ho, Er, Yb); this structure has not yet been determined. The materials were further characterized using FTIR, and photoluminescence measurements. Characteristic excitation and emission transitions were observed for RE = Nd, Sm, Eu, and Tb. Quantum yield (QY) measurements were performed by exciting Eu and Tb analoges at 394 nm (QY 66%) and 464 nm (QY 71%) for Eu; and 370 nm (QY=40%) for Tb. We attribute the high QY and bright luminescence to two main structure-function properties of the system; namely the absence of water in the structure, and absence of concentration quenching.
Journal of Earth System Science | Indian Academy of Sciences
Indian Academy of Sciences (India)
Home; Journals; Journal of Earth System Science. Umesh S Balpande. Articles written in Journal of Earth System Science. Volume 123 Issue 7 October 2014 pp 1501-1515. Morphometric analysis of Suketi river basin, Himachal Himalaya, India · Anil M Pophare Umesh S Balpande · More Details Abstract Fulltext PDF.
Journal of Earth System Science | Indian Academy of Sciences
Indian Academy of Sciences (India)
Home; Journals; Journal of Earth System Science. Bibhuti Gogoi. Articles written in Journal of Earth System Science. Volume 123 Issue 5 July 2014 pp 959-987. Geochemical constraints on the evolution of mafic and felsic rocks in the Bathani volcanic and volcano-sedimentary sequence of Chotanagpur Granite Gneiss ...
Angle-resolved photoemission spectroscopy of band tails in lightly doped cuprates
Alexandrov, A. S.; Reynolds, K.
2007-01-01
We amend ab initio strongly-correlated band structures by taking into account the band-tailing phenomenon in doped charge-transfer Mott-Hubbard insulators. We show that the photoemission from band tails accounts for sharp "quasi-particle" peaks, rapid loss of their intensities in some directions of the Brillouin zone ("Fermi-arcs") and high-energy "waterfall" anomalies as a consequence of matrix-element effects of disorder-localised states in the charge-transfer gap of doped cuprates.
Rare earth oxyhydrides and preparation process
International Nuclear Information System (INIS)
Diaz, H.
1986-01-01
Rare earth oxyhydrides of formula RE 1-q Th q Ni 5-p M p O x H y are claimed. RE is a rare earth, Th can be replaced by Yt, M is Cu, Mn, Al, Fe, Cr or Co, o O C and the hydrides are oxidized. They are catalysts for various chemical reactions [fr
Weak ferromagnetism in Re0.67Ca0.33FeO3 (Re=La, Sm, Gd) nanoparticles
International Nuclear Information System (INIS)
Li Jiangong; Kou Xinli; Qin Yong; He Haiying
2003-01-01
Perovskite-type complex ferrite Re 0.67 Ca 0.33 FeO 3 (Re=La, Sm, Gd) nanoparticles of nearly the same particle size were prepared using sol-gel method. The influence of rare-earth ions on weak ferromagnetism in the Re 0.67 Ca 0.33 FeO 3 nanoparticles has been studied. The spontaneous magnetization M s of the Sm 0.67 Ca 0.33 FeO 3 nanoparticles is greater than that of Gd 0.67 Ca 0.33 FeO 3 nanoparticles; and M s of Gd 0.67 Ca 0.33 FeO 3 nanoparticles is greater than that of La 0.67 Ca 0.33 FeO 3 nanoparticles. The ferromagnetic component arising from the Fe sublattice increases with the decreasing rare-earth ionic radii. The magnetization of the rare-earth ions in the Sm 0.67 Ca 0.33 FeO 3 nanoparticles is smaller than that in the Gd 0.67 Ca 0.33 FeO 3 nanoparticles. The influences of the geometric and intrinsic magnetic characters of rare-earth ions as well as the particle size of the nanoparticles on weak ferromagnetism are discussed
Phonon-induced anomalous Raman spectra in undoped high-Tc cuprates
International Nuclear Information System (INIS)
Lee, J.D.; Min, B.I.
1997-01-01
In order to describe a shoulder peak structure near 4J in the magnon Raman spectra of undoped high-T c cuprates, we have explored the phonon contribution to the Raman spectra. Incorporating the magnon-phonon Hamiltonian in the spin-wave theory, we have evaluated the two-magnon Raman spectral function originating from the lowest-order magnon-phonon-magnon scattering. It is found that phonons induce a shoulder peak near 4J besides the dominant two-magnon peak near 3J, in agreement with experiments. (orig.)
Evaluation of image reconstruction methods for {sup 123}I-MIBG-SPECT. A rank-order study
Energy Technology Data Exchange (ETDEWEB)
Soederberg, Marcus; Mattsson, Soeren; Oddstig, Jenny; Uusijaervi-Lizana, Helena; Leide-Svegborn, Sigrid [Medical Radiation Physics, Dept. of Clinical Sciences Malmoe, Lund Univ., Skaane Univ. Hospital, Malmoe (Sweden)], e-mail: marcus.soderberg@med.lu.se; Valind, Sven; Thorsson, Ola; Garpered, Sabine [Dept. of Clinical Physiology, Skaane Univ. Hospital, Malmoe (Sweden); Prautzsch, Tilmann [Scivis wissenschaftlice Bildverarbeitung GmbH, Goettingen (Germany); Tischenko, Oleg [Research Unit Medical Radiation Physics and Diagnostics (AMSD), Helmholtz Zentrum Muenchen (Germany); German Research Center for Environmental Health, Neuherberg (Germany)
2012-09-15
Background: There is an opportunity to improve the image quality and lesion detectability in single photon emission computed tomography (SPECT) by choosing an appropriate reconstruction method and optimal parameters for the reconstruction. Purpose: To optimize the use of the Flash 3D reconstruction algorithm in terms of equivalent iteration (EI) number (number of subsets times the number of iterations) and to compare with two recently developed reconstruction algorithms ReSPECT and orthogonal polynomial expansion on disc (OPED) for application on {sup 123}I-metaiodobenzylguanidine (MIBG)-SPECT. Material and Methods: Eleven adult patients underwent SPECT 4 h and 14 patients 24 h after injection of approximately 200 MBq {sup 123}I-MIBG using a Siemens Symbia T6 SPECT/CT. Images were reconstructed from raw data using the Flash 3D algorithm at eight different EI numbers. The images were ranked by three experienced nuclear medicine physicians according to their overall impression of the image quality. The obtained optimal images were then compared in one further visual comparison with images reconstructed using the ReSPECT and OPED algorithms. Results: The optimal EI number for Flash 3D was determined to be 32 for acquisition 4 h and 24 h after injection. The average rank order (best first) for the different reconstructions for acquisition after 4 h was: Flash 3D{sub 32} > ReSPECT > Flash 3D{sub 64} > OPED, and after 24 h: Flash 3D{sub 16} > ReSPECT > Flash 3D{sub 32} > OPED. A fair level of inter-observer agreement concerning optimal EI number and reconstruction algorithm was obtained, which may be explained by the different individual preferences of what is appropriate image quality. Conclusion: Using Siemens Symbia T6 SPECT/CT and specified acquisition parameters, Flash 3D{sub 32} (4 h) and Flash 3D{sub 16} (24 h), followed by ReSPECT, were assessed to be the preferable reconstruction algorithms in visual assessment of {sup 123}I-MIBG images.
Journal of Earth System Science | Indian Academy of Sciences
Indian Academy of Sciences (India)
Home; Journals; Journal of Earth System Science. Bhushan R Lamsoge. Articles written in Journal of Earth System Science. Volume 123 Issue 7 October 2014 pp 1541-1566. Impact of over-exploitation on groundwater quality: A case study from WR-2Watershed, India · Anil M Pophare Bhushan R Lamsoge Yashwant B ...
Journal of Earth System Science | Indian Academy of Sciences
Indian Academy of Sciences (India)
Home; Journals; Journal of Earth System Science. Arka Rudra. Articles written in Journal of Earth System Science. Volume 123 Issue 5 July 2014 pp 935-941. Molecular composition and paleobotanical origin of Eocene resin from northeast India · Arka Rudra Suryendu Dutta Srinivasan V Raju · More Details Abstract Fulltext ...
Journal of Earth System Science | Indian Academy of Sciences
Indian Academy of Sciences (India)
Home; Journals; Journal of Earth System Science. J U Chukudebelu. Articles written in Journal of Earth System Science. Volume 123 Issue 3 April 2014 pp 491-502. Evaluation of soil corrosivity and aquifer protective capacity using geoelectrical investigation in Bwari basement complex area, Abuja · A E Adeniji O V ...
The Inward Dispersion of the Neutron Scattering Experiments in HTSC Cuprates
Dayan, Moshe
2016-01-01
The theory of the high temperature superconducting cuprates, which is based on the condensation of holes into strings in checker-board geometry, was successful to explain the elastically scattered Neutrons by spin waves. Here it is extended to analyze the inward dispersion curve of its inelastic counterpart, up to the resonance energy- . This extension is done by applying the perturbation theory of the linear response to the condensed strings. The approximated susceptibility is derived by mea...
Varma, Chandra; Choi, Han-Yong; Zhang, Wentao; Zhou, Xingjiang
2012-02-01
The spectra of fluctuations and their coupling to fermions has been deduced from extensive high resolution laser ARPES in several BISCCO samples and quantitatively analyzed. We ask the question whether some of the theories for superconductivity in Cuprates are consistent or inconsistent with the frequency and the momentum dependence of the deductions. We find that any fluctuation spectra, for example that of Antiferromagnetic Fluctuations, whose frequency dependence depends significantly on momentum dependence are excluded. We consider the quantum-critical spectra of the loop-current order observed in under-doped cuprates and its coupling to fermions and find it consistent with the data.
Kohno, Masanori
2018-04-01
A fundamental issue of the Mott transition is how electrons behaving as single particles carrying spin and charge in a metal change into those exhibiting separated spin and charge excitations (low-energy spin excitation and high-energy charge excitation) in a Mott insulator. This issue has attracted considerable attention particularly in relation to high-temperature cuprate superconductors, which exhibit electronic states near the Mott transition that are difficult to explain in conventional pictures. Here, from a new viewpoint of the Mott transition based on analyses of the Hubbard model, we review anomalous features observed in high-temperature cuprate superconductors near the Mott transition.
International Nuclear Information System (INIS)
Singh, D.S.
2016-01-01
Rare Earths (RE) comprises of 17 elements i.e. elements from atomic No. 57-71 (lanthanide series) along with yttrium (atomic No. 39) and scandium (atomic No. 21). They exhibit special electronic, magnetic, optical and catalytic properties. The first 7 elements in the lanthanide series from atomic Nos. 57 to 63 (La to Eu) are called Light Rare Earths (LRE), while the remaining elements from atomic Nos. 64 to 71 (Gd to Lu) are grouped as Heavy Rare Earths (HRE). Scandium and Yttrium have properties similar to HRE. The concentration of the REs in the earth's crust is as high as some other elements including that of copper. The only difference is that REs do not occur as separate minerals amenable for easy exploration and mining and are widely distributed across the earth's surface, hence they are called as REs. Resources In India, monazite has been the principal source of RE. It occurs in association with other heavy minerals, such as ilmenite, rutile, zircon etc. in the beach sands and inland placer deposits. The monazite content in this assemblage varies from negligible quantity to as high as 5%. As per AMD resource estimation, the reported resource of monazite in India is about 11.93 million tons which corresponds with about 6.9 million tons of RE oxides. Although India possesses large deposits of monazite, the heavier RE are not present in sufficient quantities in this mineral. (author)
Energy Technology Data Exchange (ETDEWEB)
Hashimoto, M.
2010-04-30
We have performed angle-resolved photoemission and core-level x-ray photoemission studies of the single-layer cuprate Bi{sub 2}Sr{sub 2-x}La{sub x}CuO{sub 6+{delta}} (Bi2201) and revealed the doping evolution of the electronic structure from the lightly-doped to optimally-doped regions. We have observed the formation of the dispersive quasi-particle band, evolution of the Fermi 'arc' into the Fermi surface and the shift of the chemical potential with hole doping as in other cuprates. The doping evolution in Bi2201 is similar to that in Ca{sub 2-x}Na{sub x}CuO{sub 2}Cl{sub 2} (Na-CCOC), where a rapid chemical potential shift toward the lower Hubbard band of the parent insulator has been observed, but is quite different from that in La{sub 2-x}Sr{sub x}CuO{sub 4} (LSCO), where the chemical potential does not shift, yet the dispersive band and the Fermi arc/surface are formed around the Fermi level already in the lightly-doped region. The (underlying) Fermi surface shape and band dispersions are quantitatively analyzed using tightbinding fit, and the deduced next-nearest-neighbor hopping integral t also confirm the similarity to Na-CCOC and the difference from LSCO.
Journal of Earth System Science | Indian Academy of Sciences
Indian Academy of Sciences (India)
Home; Journals; Journal of Earth System Science. Ali Asgari. Articles written in Journal of Earth System Science. Volume 123 Issue 2 March 2014 pp 365-379. Numerical evaluation of seismic response of shallow foundation on loose silt and silty sand · Ali Asgari Aliakbar Golshani Mohsen Bagheri · More Details Abstract ...
Journal of Earth System Science | Indian Academy of Sciences
Indian Academy of Sciences (India)
Home; Journals; Journal of Earth System Science. V Fernando. Articles written in Journal of Earth System Science. Volume 123 Issue 5 July 2014 pp 1045-1074. Observed intraseasonal and seasonal variability of the West India Coastal Current on the continental slope · P Amol D Shankar V Fernando A Mukherjee S G ...
International Nuclear Information System (INIS)
Guo Kai; Man Zhenyong; Cao Qigao; Chen Haohong; Guo Xiangxin; Zhao Jingtai
2011-01-01
Graphical abstract: The structure stability of REZnOSb decreases with varying rare-earth from La to Gd because of the increased binding energy. Research highlights: → As increasing the atomic number of the RE, the structural stability of REZnOSb decreases. → Varying the rare-earth elements from La to Gd, the covalent interactions between [ZnSb] and [LaO] layer are enhanced by 4f-electrons. → The electrical transport properties of REZnOSb could be improved using the large atomic number of the RE. - Abstract: The structural stability, chemical bonding, Mulliken populations, and charge-density distribution of REZnOSb (RE = La-Nd, Sm-Gd) were investigated by first-principles calculations. Unit cell parameters calculated by the generalized gradient approximation (GGA) are in better agreement with experimental results than those derived from the local density approximation (LDA). Binding energy comparisons indicate that the structural stability of REZnOSb decreases with the increment of the atomic number of the RE, as confirmed by X-ray diffraction (XRD) results. Semimetal or narrow band-gap semiconductor behaviors are found for selected REZnOSb. Moreover, chemical bonding analysis shows that there exist considerable polar covalent interactions between the participating atoms. It also reveals that the [ZnSb] layers receive some electrons from the [LaO] layers (donor) as an electrons acceptor and holes transport tunnel. The covalent interactions between the [ZnSb] and [LaO] layers, which are enhanced by 4f-electrons of the RE, are supposed to improve the electrical transport properties.
Energy Technology Data Exchange (ETDEWEB)
Li, Lu; Zhou, Pin; Zhang, Hongbo; Meng, Xianglong; Li, Juexiu; Sun, Tonghua, E-mail: sunth@sjtu.edu.cn
2017-06-15
Highlights: • Various rare earth (RE)-doped ZnO/KIT-6 sorbents were prepared via sol-gel method. • La showed the highest efficiency on promoting ZnO/KIT-6 desulfurization activity. • The morphology of ZnO on KIT-6 played a crucial role for the reactivity. • The most initial factor of improving reactivity by RE was surface chemical property. • Crystallinity, host-guest interaction were also important to ZnO state on support. - Abstract: Rare earth oxides (RE = Ce, La, Sm and Gd) doped ZnO supported on KIT-6 sorbents (RE-ZnO/KIT-6) were synthesized by sol-gel method and their performance for deep removal of H{sub 2}S (bellow 0.1 ppmv) from gas stream at medium temperature was tested. The RE dopants (except Ce) significantly enhance the deep desulfurization capacity of ZnO/KIT-6 sorbent and maintained higher sulfur uptake capacities upon multiple cycles of regeneration by a simple thermal oxidation in 10 v% of O{sub 2} in N{sub 2} atmosphere. The results of SAXS, XRD, N{sub 2} physisorption, TEM, FIIR, and XPS implied that the KIT-6 structure of loading metal oxides remained intact. It was found that RE could hinder the ZnO crystal ripening during calcination resulted in smaller ZnO particles, enhance the interaction of ZnO and silica matrix to improve the dispersion of active phase on KIT-6. Furthermore, by increasing the outlayer electron density of Zn atom and oxygen transfer ability, the synergistic effect considered to be favorable for RE-ZnO/KIT-6 sulfidation. Even though the performance of improving ZnO dispersion was weaker than that of Sm and Gd, La-ZnO/KIT-6 performs the best deep desulfurizers by changing the surface chemical atmosphere for ZnO. Steam in the gas stream inhibited the capture of H{sub 2}S by ZnO in the sorbents, in the case of La-ZnO/KIT-6, the steam content should control as lower as 5 v% to ensure the desulfurization efficiency and precision.
Theory of high-Tc superconducting cuprates based on experimental evidence
International Nuclear Information System (INIS)
Abrikosov, A. A.
1999-01-01
A model of superconductivity in layered high-temperature superconducting cuprates is proposed, based on the extended saddle point singularities in the electron spectrum, weak screening of the Coulomb interaction and phonon-mediated interaction between electrons plus a small short-range repulsion of Hund's, or spin-fluctuation, origin. This permits to explain the large values of Tc, features of the isotope effect on oxygen and copper, the existence of two types of the order parameter, the peak in the inelastic neutron scattering, the positive curvature of the upper critical field, as function of temperature etc
Iodine-123 (123I) is promising radiopharmaceutical in the radionuclide diagnostics
International Nuclear Information System (INIS)
Tazhedinov, I.T.
2003-01-01
In the paper some advantages of the radiopharmaceuticals with 123 I against 99m Tc preparations are shown. It is noted that the 123 I is the most favourable among cyclotron radionuclides for radionuclide diagnostics by it nuclear-physical characteristics. With application of 123 I it is possible to attain a significant progress in the thyroid examination. 123 I labelled preparations should have a high bond strength providing the high information valuation of examinations
International Nuclear Information System (INIS)
Gustafson, D.E.; Hofmeister, W.H.; Bayuzick, R.J.; Nagashio, K.; Kuribayashi, K.
2003-01-01
This paper presents the results of rapid solidification experiments performed on the copper oxide superconductors Y x Nd 1-x Ba 2 Cu 3 O 7-δ (0≤x≤0.9). Spherical rare earth (RE) 123 specimens were levitated in O 2 using aero-acoustic levitation (AAL), melted with a laser, undercooled, and solidified. The peritectic transformation temperature for the reaction RE 2 BaCuO 5 +liquid→REBa 2 Cu 3 O 7-δ corresponding to the maximum recalescence temperature during solidification was determined. RE123 was formed directly from the melt for Y-Nd binary alloy compositions with Nd concentration greater than 20% (Y concentration less than 80%). A minimum in the peritectic transformation temperature for the Nd/Y123 system corresponding to a composition Y 0.3 Nd 0.7 123 was determined at 66 deg. C below the peritectic of pure Nd123
Rare-earth metal transition metal borocarbide and nitridoborate superconductors
Energy Technology Data Exchange (ETDEWEB)
Niewa, Rainer; Shlyk, Larysa; Blaschkowski, Bjoern [Stuttgart Univ. (Germany). Inst. fuer Anorganische Chemie
2011-07-01
Few years after the discovery of superconductivity in high-T{sub c} cuprates, borocarbides and shortly after nitridoborates with reasonably high T{sub c}s up to about 23 K attracted considerable attention. Particularly for the rare-earth metal series with composition RNi{sub 2}[B{sub 2}C] it turned out, that several members exhibit superconductivity next to magnetic order with both T{sub c} above or below the magnetic ordering temperature. Therefore, these compounds have been regarded as ideal materials to study the interplay and coexistence of superconductivity and long range magnetic order, due to their comparably high ordering temperatures and similar magnetic and superconducting condensation energies. This review gathers information on the series RNi{sub 2}[B{sub 2}C] and isostructural compounds with different transition metals substituting Ni as well as related series like RM[BC], RM[BN], AM[BN] and R{sub 3}M{sub 2}[BN]{sub 2}N (all with R = rare-earth metal, A = alkaline-earth metal, M = transition metal) with special focus on synthesis, crystal structures and structural trends in correspondence to physical properties. (orig.)
Energy Technology Data Exchange (ETDEWEB)
Le Tacon, M.; Sacuto, A. [Paris-7 Univ., Lab. Mat riaux et Ph nom nes Quantiques (UMR 7162 CNRS), 75 (France); Laboratoire de Physique du Solide, ESPCI, 75 - Paris (France); Georges, A. [Centre de Physique Theorique, Ecole Polytechnique, 91 - Palaiseau (France); Kotliar, G. [Centre de Physique Theorique, Ecole Polytechnique, 91 - Palaiseau (France); Rutgers Univ., Serin Physics Lab. (United States); Gallais, Y. [Columbia Univ. New York, Dept. of Physics and Applied Physics, NY (United States); Colson, D.; Forget, A. [CEA Saclay, Service de Physique de l' Etat Condense, 91 - Gif-sur-Yvette (France)
2006-07-01
The superconducting state of under-doped cuprates is often described in terms of a single energy scale, associated with the maximum of the (d-wave) gap. Here, we report on electronic Raman scattering results, which show that the gap function in the under-doped regime is characterized by two energy scales, depending on doping in opposite manners. Their ratios to the maximum critical temperature are found to be universal in cuprates. Our experimental results also reveal two different quasiparticle dynamics in the under-doped superconducting state, associated with two regions of momentum space: nodal regions near the zeros of the gap and anti-nodal regions. While anti-nodal quasiparticles quickly loose coherence as doping is reduced, coherent nodal quasiparticles persist down to low doping levels. A theoretical analysis using a new sum-rule allows us to relate the low-frequency-dependence of the Raman response to the temperature-dependence of the superfluid density, both controlled by nodal excitations. (authors)
Energy Technology Data Exchange (ETDEWEB)
Klauss, Hans-Henning, E-mail: h.klauss@physik.tu-dresden.de [Institute for Solid State Physics, TU Dresden, D-01069 Dresden (Germany)
2012-11-01
In this work we review muon spin relaxation experiments on the layered La{sub 2-x}Sr{sub x}NiO{sub 4} nickelate as well as La{sub 2-x}Ba{sub x}CuO{sub 4} and La{sub 2-x}Sr{sub x}CuO{sub 4} cuprate systems to examine spin stripe order. In particular, the interplay of stripe order with superconductivity in Nd and Eu doped La{sub 2-x}Sr{sub x}CuO{sub 4} cuprates is discussed. Detailed studies of the electronic phase diagrams as well as the magnetic and superconducting order parameters for different rare-earth and Sr doping levels in La{sub 2-x-y}RE{sub y}Sr{sub x}CuO{sub 4} revealed the strong correlation of static spin stripe order with the structural distortion in the low temperature tetragonal (LTT) phase and the competition with the superconducting ground state. High magnetic field studies demonstrate the nearly degenerate ground state energy of the different electronic phases. Slow transverse fluctuations of the charge stripes are found in nickelates and cuprates at low temperatures.
International Nuclear Information System (INIS)
Britto, J.L.Q. de; Silva, A.G. da; Teixeira, F.C.M.; Costa e Silva, A.; Souza, A.S.F. de
1981-01-01
The 12 I is prepared by 122 Te( 3 He, 2n) 123 Xe sup(β+) → 123 I reaction. The remotization of the Xe diffusion and capture system and the retired of the 123 I produced by the 123 Xe precursory decaying. (E.G.) [pt
Microscopic theory of longitudinal sound velocity in CDW and SDW ordered cuprate systems
International Nuclear Information System (INIS)
Rout, G.C.; Panda, S.K.
2011-01-01
Research highlights: → Reported the study of the interplay of the CDW and SDW interactions in the high-Tc cuprates. → The longitudinal velocity of sound is studied in the under-doped region. → The velocity of sound exhibits suppression in both the CDW and SDW phases. → Strong electron-phonon interaction is observed in normal phases. - Abstract: We address here the self-consistent calculation of the spin density wave and the charge density wave gap parameters for high-T c cuprates on the basis of the Hubbard model. In order to describe the experimental observations for the velocity of sound, we consider the phonon coupling to the conduction band in the harmonic approximation and then the expression for the temperature dependent velocity of sound is calculated from the real part of the phonon Green's function. The effects of the electron-phonon coupling, the frequency of the sound wave, the hole doping concentration, the CDW coupling and the SDW coupling parameters on the sound velocity are investigated in the pure CDW phase as well as in the co-existence phase of the CDW and SDW states. The results are discussed to explain the experimental observations.
Microscopic theory of longitudinal sound velocity in CDW and SDW ordered cuprate systems
Energy Technology Data Exchange (ETDEWEB)
Rout, G.C., E-mail: gcr@iopb.res.i [Condensed Matter Physics Group, PG Dept. of Applied Physics and Ballistics, FM University, Balasore 756 019 (India); Panda, S K [KD Science College, Pochilima, Hinjilicut 761 101, Ganjam, Orissa (India)
2011-02-15
Research highlights: {yields} Reported the study of the interplay of the CDW and SDW interactions in the high-Tc cuprates. {yields} The longitudinal velocity of sound is studied in the under-doped region. {yields} The velocity of sound exhibits suppression in both the CDW and SDW phases. {yields} Strong electron-phonon interaction is observed in normal phases. - Abstract: We address here the self-consistent calculation of the spin density wave and the charge density wave gap parameters for high-T{sub c} cuprates on the basis of the Hubbard model. In order to describe the experimental observations for the velocity of sound, we consider the phonon coupling to the conduction band in the harmonic approximation and then the expression for the temperature dependent velocity of sound is calculated from the real part of the phonon Green's function. The effects of the electron-phonon coupling, the frequency of the sound wave, the hole doping concentration, the CDW coupling and the SDW coupling parameters on the sound velocity are investigated in the pure CDW phase as well as in the co-existence phase of the CDW and SDW states. The results are discussed to explain the experimental observations.
Microscopic theory of longitudinal sound velocity in CDW and SDW ordered cuprate systems
Energy Technology Data Exchange (ETDEWEB)
Rout, G.C., E-mail: gcr@iopb.res.i [Condensed Matter Physics Group, PG Dept. of Applied Physics and Ballistics, FM University, Balasore 756 019 (India); Panda, S.K. [KD Science College, Pochilima, Hinjilicut 761 101, Ganjam, Orissa (India)
2011-02-15
Research highlights: {yields} Reported the study of the interplay of the CDW and SDW interactions in the high-Tc cuprates. {yields} The longitudinal velocity of sound is studied in the under-doped region. {yields} The velocity of sound exhibits suppression in both the CDW and SDW phases. {yields} Strong electron-phonon interaction is observed in normal phases. - Abstract: We address here the self-consistent calculation of the spin density wave and the charge density wave gap parameters for high-T{sub c} cuprates on the basis of the Hubbard model. In order to describe the experimental observations for the velocity of sound, we consider the phonon coupling to the conduction band in the harmonic approximation and then the expression for the temperature dependent velocity of sound is calculated from the real part of the phonon Green's function. The effects of the electron-phonon coupling, the frequency of the sound wave, the hole doping concentration, the CDW coupling and the SDW coupling parameters on the sound velocity are investigated in the pure CDW phase as well as in the co-existence phase of the CDW and SDW states. The results are discussed to explain the experimental observations.
Verma, Shefali; Verma, Kartikey; Kumar, Deepak; Chaudhary, Babulal; Som, Sudipta; Sharma, Vishal; Kumar, Vijay; Swart, Hendrik C.
2018-04-01
As a novel class of inorganic phosphor, the alkali-alkaline earth borate phosphors have gained huge attention due to their charming applications in solid-state lighting (SSL) and display devices. The current research drive shows that phosphors based on the alkali-alkaline earth borates have transformed the science and technology due to their high transparency over a broad spectral range, their flexibility in structure and durability for mechanical and high-laser applications. Recent advances in various aspects of rare-earth (RE) doped borate based phosphors and their utilizations in SSL and light emitting diodes are summarized in this review article. Moreover, the present status and upcoming scenario of RE-doped borate phosphors were reviewed in general along with the proper credential from the existing literature. It is believed that this review is a sole compilation of crucial information about the RE-doped borate phosphors in a single platform.
Energy Technology Data Exchange (ETDEWEB)
Inosov, Dmytro S.
2008-06-18
In the present work some steps are done towards understanding the anomalous effects observed in the single-particle excitation spectra of cuprates. First, the electronic properties of BSCCO are considered. The main result of this part of the work is a model of the Green's function that is later used for calculating the two-particle excitation spectrum. Then, the matrix element effects in the photoemission spectra of cuprates are discussed. After a general introduction to the problem, the thesis focuses on the recently discovered anomalous behavior of the ARPES spectra that partially originates from the momentum-dependent photoemission matrix element. The momentum- and excitation energy dependence of the anomalous high-energy dispersion, termed ''waterfalls'', is covered in full detail. Understanding the role of the matrix element effects in this phenomenon proves crucial, as they obstruct the view of the underlying excitation spectrum that is of indisputable interest. For the optimally doped bilayer Bi-based cuprate, the renormalized two-particle correlation function in the superconducting state is calculated from ARPES data within an itinerant model based on the random phase approximation (RPA). (orig.)
Journal of Earth System Science | Indian Academy of Sciences
Indian Academy of Sciences (India)
Home; Journals; Journal of Earth System Science. B O Adebesin. Articles written in Journal of Earth System Science. Volume 123 Issue 4 June 2014 pp 751-765. Ionospheric foF2 morphology and response of F2 layer height over Jicamarca during different solar epochs and comparison with IRI-2012 model · B O Adebesin ...
Journal of Earth System Science | Indian Academy of Sciences
Indian Academy of Sciences (India)
Home; Journals; Journal of Earth System Science. R A Scrutton. Articles written in Journal of Earth System Science. Volume 123 Issue 1 February 2014 pp 33-47. Growth of the Afanasy Nikitin seamount and its relationship with the 85°E Ridge, northeastern Indian Ocean · K S Krishna J M Bull O Ishizuka R A Scrutton S ...
Theory of antiferromagnetic pairing in cuprate superconductors
International Nuclear Information System (INIS)
Plakida, N.M.
2006-01-01
A review of the antiferromagnetic exchange and spin-fluctuation pairing theory in the cuprate superconductors is given. We briefly discuss a phenomenological approach and a theory in the limit of weak Coulomb correlations. A microscopic theory in the strong correlation limit is presented in more detail. In particular, results of our recently developed theory for the effective p-d Hubbard model and the reduced t-J model are given. We have proved that retardation effects for the antiferromagnetic exchange interaction are unimportant that results in pairing of all charge carriers in the conduction band and high Tc proportional to the Fermi energy. The spin-fluctuation interaction caused by kinematic interaction gives an additional contribution to the d-wave pairing. Dependence of Tc on the hole concentration and the lattice constant (or pressure) and an oxygen isotope shift are discussed
Novel precursors for the deposition of rare earth oxides
International Nuclear Information System (INIS)
Ahlers, Mareike
2010-01-01
During this work rare earth solvates with nitrate and perchlorate anions have been investigated. All compounds have been structurally characterized and analyzed using thermal gravimetric analysis. The decomposition residues were analyzed using powder diffraction methods. Almost all compounds showed a characteristically intense exothermic decomposition step during the thermal decomposition, most likely caused by an intramolecular redox reaction between the nitrate or perchlorate anion respectively and the organic solvent molecules. The nitrates RE(NO 3 ) 3 (CH(OCH 3 ) 3 ) 2 (RE = Sm, Eu) were isolated and characterized for the first time as the intermediate of the dehydration reaction with trimethyl orthoformate. The known compound group of dimethoxyethane solvates was then expanded with RE(NO 3 ) 3 (O 2 C 4 H 10 ) (RE = La, Sm, Eu). Considering the possible use as precursor material the already described neodymium compound is also discussed. The thermal decomposition of these compounds yields the respective cubic rare earth oxide and shows the typical intense exothermic decomposition reaction. A variety of different precursor system based on nitrate solvates for the deposition of rare earth oxide layers on a silicon surface was developed and investigated in collaboration with the group of Prof. Dr. Al-Shamery (Univ. Oldenburg). Ultra thin films on a H-Si(111) surface were obtained via the deposition of the precursor, which was dissolved in organic solvents. An oxide layer was detected after the heating of the sample. The film thickness was measured as < 10 nm, whereas the thickness of the film was controlled by the concentration of the precursor solution. Sm(ClO 4 ) 3 (CH(OCH 3 ) 3 ) 3 was isolated and characterized for the first time as the intermediate of the dehydration reaction with trimethyl orthoformate. Eu(ClO 4 ) 3 (CH(OCH 3 ) 3 ) 2 (MeOH) 2 was obtained without recrystallization. The methanol molecules, formed during the hydrolysis of the trimethyl
Resistance-Based Ceramic Ho123 Ionic Conductor for Oxygen Gas Sensing
Idrus, L. H.; Yahya, A. K.
2009-07-01
Oxygen sensing properties of HoBa2Cu3O7-δ ceramic rods utilizing hot-spot phenomenon have been characterized. The rods were prepared from high purity oxides using the conventional solid-state reaction method. I-V characterization showed increase in output current with voltage before the appearance of the hot spot. After the appearance of the hot-spot, the output current strongly depended on oxygen partial pressure. The rod showed stable sensing characteristics with good electrical stability and reproducibility with higher sensitivity at low oxygen partial pressure. The sensing property is associated with the absorption of oxygen and dissociation into holes and oxide ions. Ho123 is more sensitive at pO2 below 20% compared to Er123 possibly due to differences in oxygen activation energy related to RE ionic radius.
Resistance-Based Ceramic Ho123 Ionic Conductor for Oxygen Gas Sensing
International Nuclear Information System (INIS)
Idrus, L. H.; Yahya, A. K.
2009-01-01
Oxygen sensing properties of HoBa 2 Cu 3 O 7-δ ceramic rods utilizing hot-spot phenomenon have been characterized. The rods were prepared from high purity oxides using the conventional solid-state reaction method. I-V characterization showed increase in output current with voltage before the appearance of the hot spot. After the appearance of the hot-spot, the output current strongly depended on oxygen partial pressure. The rod showed stable sensing characteristics with good electrical stability and reproducibility with higher sensitivity at low oxygen partial pressure. The sensing property is associated with the absorption of oxygen and dissociation into holes and oxide ions. Ho123 is more sensitive at pO 2 below 20% compared to Er123 possibly due to differences in oxygen activation energy related to RE ionic radius.
Rizzo, Antonio; Trauner, Dirk
2018-04-06
An approach toward (-)-enterocin, an antibiotic isolated from Streptomyces hygroscopicus, is described. Its compact, heavily oxidized protoadamantane core represents a daunting challenge for an efficient synthesis. Convergent assembly of its 2-oxabicyclo[3.3.1]nonane core with a cuprate-mediated Barbier reaction is disclosed. Its functionalization to a suitable substrate for a biomimetic aldol to close the final ring of the natural product is evaluated.
In situ XANES cell used for the study of lanthanum strontium cuprate deNOx catalysts
DEFF Research Database (Denmark)
Hagen, Anke
2011-01-01
, maintaining charge neutrality, with the concentration of oxygen vacancies likely increasing at substitution ratios larger than Sr/La>0.08. During heating in air, the valence of copper ions in the structure increased. Upon exposure to NO at 500 °C the valence of copper ions in a lanthanum strontium cuprate...
Identification of Raman peaks of high-T{sub c} cuprates in normal state through density of states
Energy Technology Data Exchange (ETDEWEB)
Bishoyi, K.C. [P.G. Department of Physics, F.M. College (Auto.), Balasore 756 001 (India)]. E-mail: bishoyi@iopb.res.in; Rout, G.C. [Condensed Matter Physics Group, Govt. Science College, Chatrapur 761 020, Orissa (India); Behera, S.N. [Physics Enclave, H.I.G.-23/1, Housing Board Phase-I, Chandrasekharpur, Bhubaneswar 7510016 (India)
2007-05-31
We present a microscopic theory to explain and identify the Raman spectral peaks of high-T{sub c} cuprates R{sub 2-x}M{sub x}CuO{sub 4} in the normal state. We used electronic Hamiltonian prescribed by Fulde in presence of anti-ferromagnetism. Phonon interaction to the hybridization between the conduction electrons of the system and the f-electrons has been incorporated in the calculation. The phonon spectral density is calculated by the Green's function technique of Zubarev at zero wave vector and finite (room) temperature limit. The four Raman active peaks (P{sub 1}-P{sub 4}) representing the electronic states of the atomic sub-systems of the cuprate system are identified by the calculated quasi-particle energy bands and electron density of states (DOS). The effect of interactions on these peaks are also explained.
Energy Technology Data Exchange (ETDEWEB)
Gustafson, D.E.; Hofmeister, W.H.; Bayuzick, R.J.; Nagashio, K.; Kuribayashi, K
2003-01-20
This paper presents the results of rapid solidification experiments performed on the copper oxide superconductors Y{sub x}Nd{sub 1-x}Ba{sub 2}Cu{sub 3}O{sub 7-{delta}} (0{<=}x{<=}0.9). Spherical rare earth (RE) 123 specimens were levitated in O{sub 2} using aero-acoustic levitation (AAL), melted with a laser, undercooled, and solidified. The peritectic transformation temperature for the reaction RE{sub 2}BaCuO{sub 5}+liquid{yields}REBa{sub 2}Cu{sub 3}O{sub 7-{delta}} corresponding to the maximum recalescence temperature during solidification was determined. RE123 was formed directly from the melt for Y-Nd binary alloy compositions with Nd concentration greater than 20% (Y concentration less than 80%). A minimum in the peritectic transformation temperature for the Nd/Y123 system corresponding to a composition Y{sub 0.3}Nd{sub 0.7}123 was determined at 66 deg. C below the peritectic of pure Nd123.
International Nuclear Information System (INIS)
Lagunas-Solar, M.C.
1985-01-01
The use of iodine-123 in nuclear medicine procedures is well documented in the scientific literature. Also, several methods for its production based on accelerator techniques have been described. Indirectly made 123 I via the 127 I(p,5n) 123 Xe → 123 I reaction produces 123 I of > 99.9% radionuclidic purity, with only 125 I ( 123 I production were developed at the University of California at Davis, where since 1974 the 76-in. isochronous cyclotron of the Crocker Nuclear Laboratory has been used for routine biweekly production of high-purity no-carrier-added 123 I
Solubility and superconductivity in RE(Ba2-xREx)Cu3O7+δ (RE = Nd, Sm, Eu, Gd, Dy)
International Nuclear Information System (INIS)
Zhang, K.; Dabrowski, B.; Segre, C.U.; Hinks, D.G.; Schuller, I.K.; Jorgensen, J.D.; Slaski, M.
1987-10-01
Solid solutions of RE(Ba 2-x RE x )Cu 3 O 7- δ (RE=Nd,Sm,Eu,Gd,Dy) for x=0 to x=0.5 have been investigated. X-ray and resistivity measurements show that there exists a solid solution region, through which, the structure changes from orthorhombic to tetragonal and the superconducting properties are depressed. The solubility limits depend strongly on the size of the rare-earth ion, with the smallest (Dy) showing no appreciable solubility. The superconducting transition temperature versus x for all of the rare-earth ion substitutions falls on a universal curve, indicating that the Ba sites are extremely ionic and magnetically isolated. 20 refs., 4 figs
Thermodynamics of rare earths in steelmaking
International Nuclear Information System (INIS)
Vahed, A.; Kay, D.A.R.
1976-01-01
The standard free energies of formation of the oxides, sulfides and oxysulfides of cerium and lanthanum under steelmaking conditions have been calculated and used to predict the behavior of rare earths in steelmaking. Deoxidation and desulfurization constants, expressed in terms of Henrian activities, have been used to construct a precipitation diagram which indicates the sequence of rare earth inclusion formation. An enrichment of lanthanum in (RE)-oxysulfide and cerium in (RE)-sulfide is predicted. It is also predicted that rare earths should be able to reduce the soluble oxygen and sulfur contents of liquid steel well below the contents presently found in most industrial and laboratory practices. A simple method of calculating steelmaking additions for complete rare earth control of inclusion composition is presented
Thermal expansion and conductivity of RE2Sn2O7 (RE = La, Nd, Sm, Gd, Er and Yb) pyrochlores
International Nuclear Information System (INIS)
Feng, J.; Xiao, B.; Zhou, R.; Pan, W.
2013-01-01
Graphical abstract: Calculated cohesive energies and formation enthalpies of RE 2 Sn 2 O 7 compounds. The formation enthalpies at 298 K are more close to the experimental values. -- The calculated cohesive energies and formation enthalpies of Rare earth stannate (RE 2 Sn 2 O 7 ) compounds are in good agreement with the corresponding experimental values. The thermal expansion coefficients (TECs) of rare earth stannates are 7–9 × 10 −6 K −1 at high temperature. The results show that local spin density approximation predicts smaller TECs than the real values. The computed thermal conductivity of RE 2 Sn 2 O 7 is 1.8–2.5 W (m · K) −1 at 1273 K using the Slack–Clarke model, indicating that RE 2 Sn 2 O 7 compounds exhibit good thermal insulating properties at high temperature
International Nuclear Information System (INIS)
Barry, Stephen D.; Tkachuk, Andriy V.; Bie, Haiying; Blanchard, Peter E.R.; Mar, Arthur
2011-01-01
Ternary bismuthides RE 5 TtBi 2 containing rare-earth (RE=La-Nd, Gd-Er) and tetrel (Tt=Si, Ge) atoms have been prepared by arc-melting of the elements followed by annealing at 800 o C. They adopt the β-Yb 5 Sb 3 -type structure (Pearson symbol oP32, space group Pnma, Z=4), as revealed through analysis by single-crystal X-ray diffraction on Ce 5 Si 0.869(4) Bi 2.131(4) and powder X-ray diffraction on Ce 5 GeBi 2 . Cell parameters for the entire series lie in the ranges of a=12.8-11.8 A, b=9.6-9.0 A, and c=8.4-7.9 A. Solid solubility in Ce 5 Si x Bi 3-x and Pr 5 Si x Bi 3-x (approximately 0.9≤x≤1.2, depending on the RE member) is much more limited compared to the antimonides, consistent with a highly ordered structure in which the two possible anion sites are essentially segregated into a smaller one occupied by Tt atoms (CN7) and a larger one occupied by Bi atoms (CN9). Band structure calculations on La 5 SiBi 2 confirm the importance of La-La bonding interactions near the Fermi level. X-ray photoelectron spectra support the presence of partially anionic Bi atoms, as indicated by a small negative binding energy shift relative to elemental Bi. The Ce and Pr members undergo magnetic transitions at low temperatures, possibly involving ferromagnetic interactions, that are strongly influenced by the nature of the Tt atom. -- Graphical Abstract: Tetrel (Si or Ge) and Bi atoms are arranged in an ordered manner in the β-Yb 5 Sb 3 -type structure adopted by RE 5 TtBi 2 . Display Omitted
International Nuclear Information System (INIS)
Tetenbaum, M.
1999-01-01
Electromotive force (EMF) measurements of oxygen fugacities as a function of stoichiometry have been made on the YBa 2 Cu 3 O x , GdBa 2 Cu 3 O x , NdBa 2 Cu 3 O x and bismuth cuprate systems in the temperature range ∼400-750 C by means of an oxygen titration technique with an yttria-stabilized zirconia electrolyte. The shapes of the 400 C isotherms as a function of oxygen stoichiometry for the Gd and Nd cuprate systems suggest the presence of miscibility gaps at values of x that are higher than those in the YBa 2 Cu 3 O x system. For a given oxygen stoichiometry, oxygen partial pressures above GdBa 2 Cu 3 O x and NdBa 2 Cu 3 O x are higher (above x=6.5) than that for the promising YBa 2 Cu 3 O x system. A thermodynamic assessment and intercomparison of our partial pressure measurements with the results of related measurements will be presented
The Origin of Tc Enhancement in Heterostructure Cuprate Superconductors
Directory of Open Access Journals (Sweden)
Doron L. Bergman
2011-10-01
Full Text Available Recent experiments on heterostructures composed of two or more films of cuprate superconductors of different oxygen doping levels have shown a remarkable Tc enhancement (up to 50% relative to single compound films. We provide a simple explanation of the enhancement which arises naturally from a collection of experimental works. We show that the enhancement could be caused by a structural change in the lattice, namely an increase in the distance of the apical oxygen from the copper-oxygen plane. This increase modifies the effective off-site interaction in the plane which in turn enhances the d-wave superconductivity order parameter. To illustrate this point we study the extended Hubbard model using the fluctuation exchange approximation.
Spontaneous growth of whiskers on RE-bearing intermetallic compounds of Sn-RE, In-RE, and Pb-RE
International Nuclear Information System (INIS)
Liu Meng; Xian Aiping
2009-01-01
A phenomenon of the whiskers growth on the bulk rare earth (RE)-intermetallic compounds of NdSn 3 , NdIn 3 , and LaPb 3 is reported. The whiskers formed spontaneously on all of the RE-intermetallic compounds after exposed to room ambience (21-28 deg. C/20-56% RH, relative humidity) for several days. Among the samples, the propensity of whisker growth for NdSn 3 is the strongest, on which the tin whiskers were flourishing and covered all of the surfaces after exposed to room ambience for 22 days; while LaPb 3 is the secondary and NdIn 3 is the last one. Observed by SEM, the whiskers were exhibited as different morphology, size, and number density. The XRD analysis confirms the existence of RE(OH) 3 after whiskers formed, also, the weight gain curve of the samples exposed to room ambience supports that a spontaneous chemical reaction of the RE-intermetallic compounds with water in room ambience takes place. In discussion, it is proposed that the fresh metal atoms released by the chemical reaction could be causative to result in nucleation and spontaneous growth of the whiskers, while the anisotropy of crystal structure could be a reason to understand the difference of the whisker growth behaviors between Sn and Pb.
Energy Technology Data Exchange (ETDEWEB)
Bourges, Ph
2003-07-01
This work is dedicated to the detailed investigations of the magnetic resonance peak in the superconducting state of cuprates. The existence of such a peak could be the signature of a mechanism linked to magnetism that could explain high critical temperature superconductivity. Inelastic neutron scattering is an adequate tool for the understanding of cuprate properties because it reveals magnetic fluctuations whose behaviour and variety depend strongly on temperature and on the level of doping. The last part of this work is dedicated to the study of spin dynamics in YBa{sub 2}Cu{sub 3}O{sub 6+x} system.
Electron energy-loss spectroscopy of quasi-one-dimensional cuprates and vanadates
International Nuclear Information System (INIS)
Atzkern, S.
2001-01-01
In a combination of experimental and theoretical methods in this thesis the electronic structures of quasi-one-dimensional cuprates and vanadates were studied. For this the momentum-dependent loss function was measured by means of the electron energy-loss spectroscopy in transmission on monocrystals of Li 2 CuO 2 , CuGeO 3 , V 2 O 5 and α'-NaVO 5 . The comparison of the experimental data with results from band-structure and cluster calculations allowed conclusions on the mobility and correlations of the electrons in these systems
Journal of Earth System Science | Indian Academy of Sciences
Indian Academy of Sciences (India)
Home; Journals; Journal of Earth System Science; Volume 123; Issue 8 ... (SF) receivers has the advantages of stand-alone, absolute positioning and cost efficiency. ... College of Informatics, South China Agricultural University, Guangzhou, ...
Magnetic field induced incommensurate resonance in cuprate superconductors
International Nuclear Information System (INIS)
Zhang Jingge; Cheng Li; Guo Huaiming; Feng Shiping
2009-01-01
The influence of a uniform external magnetic field on the dynamical spin response of cuprate superconductors in the superconducting state is studied based on the kinetic energy driven superconducting mechanism. It is shown that the magnetic scattering around low and intermediate energies is dramatically changed with a modest external magnetic field. With increasing the external magnetic field, although the incommensurate magnetic scattering from both low and high energies is rather robust, the commensurate magnetic resonance scattering peak is broadened. The part of the spin excitation dispersion seems to be an hourglass-like dispersion, which breaks down at the heavily low energy regime. The theory also predicts that the commensurate resonance scattering at zero external magnetic field is induced into the incommensurate resonance scattering by applying an external magnetic field large enough
Tunneling in cuprate and bismuthate superconductors
International Nuclear Information System (INIS)
Zasadzinski, J.F.; Huang, Qiang; Tralshawala, N.
1991-10-01
Tunneling measurements using a point-contact technique are reported for the following high temperature superconducting oxides: Ba 1-x K x BiO 3 (BKBO), Nd 2-x Ce x CuO 4 (NCCO), Bi 2 Sr 2 CaCu 2 O 7 (BSCCO) and Tl 2 Ba 2 CaCu 2 O x (TBCCO). For the bismuthate, BKBO, ideal, S-I-N tunneling characteristics are observed using a Au tip. The normalized conductance is fitted to a BCS density of states and thermal smearing only proving there is no fundamental limitation in BKBO for device applications. For the cuprates, the normalized conductance displays BCS-like characteristics, but with a broadening larger than from thermal smearing. Energy gap values are presented for each material. For BKBO and NCCO the Eliashberg functions, α 2 F(ω), obtained from the tunneling are shown to be in good agreement with neutron scattering results. Proximity effect tunneling studies are reported for Au/BSCCO bilayers and show that the energy gap of BSCCO can be observed through Au layers up to 600 Angstrom thick
Quasi-particles ultrafastly releasing kink bosons to form Fermi arcs in a cuprate superconductor.
Ishida, Y; Saitoh, T; Mochiku, T; Nakane, T; Hirata, K; Shin, S
2016-01-05
In a conventional framework, superconductivity is lost at a critical temperature (Tc) because, at higher temperatures, gluing bosons can no longer bind two electrons into a Cooper pair. In high-Tc cuprates, it is still unknown how superconductivity vanishes at Tc. We provide evidence that the so-called ≲ 70-meV kink bosons that dress the quasi-particle excitations are playing a key role in the loss of superconductivity in a cuprate. We irradiated a 170-fs laser pulse on Bi2Sr2CaCu2O(8+δ) and monitored the responses of the superconducting gap and dressed quasi-particles by time- and angle-resolved photoemission spectroscopy. We observe an ultrafast loss of superconducting gap near the d-wave node, or light-induced Fermi arcs, which is accompanied by spectral broadenings and weight redistributions occurring within the kink binding energy. We discuss that the underlying mechanism of the spectral broadening that induce the Fermi arc is the undressing of quasi-particles from the kink bosons. The loss mechanism is beyond the conventional framework, and can accept the unconventional phenomena such as the signatures of Cooper pairs remaining at temperatures above Tc.
International Nuclear Information System (INIS)
Fan, J.D.; Malozovsky, Y.M.
2013-01-01
Highlights: • In a layered 2D cuprates the long-range order antiferromagnetism is driven mainly by the Van Hove singularity. • The long-range antiferromagnetism quickly disappear with doping away from the Van Hove singularity. • For pnictides the antiferromagnetism exists as a result of the nesting condition. • Since the doping steadily changes the nesting conditions, the antiferromagnetism and superconductivity may coexist. -- Abstract: We consider the Hubbard model in terms of the perturbative diagrammatic approach (UN F ⩽1) where the interaction between two electrons with antiparallel spins in the lowest order of perturbation is described by the short-range repulsive contact (on-site) interaction (U>0). We argue that in layered 2D cuprates the long-range order antiferromagnetism is driven mainly by the Van Hove singularity, whereas in the case of pnictides the antiferromagnetism exists as a result of the nesting condition. We show that when the interaction is quite strong (UN F ≈1) in the case of the Van Hove singularity the electron system undergoes the antiferromagnetic phase transition with the log-range order parameter and large insulating gap. The long-range antiferromagnetism quickly disappear, as shown, with the doping away from the Van Hove singularity, but the antiferromagnetic short-range correlation persists (UN F < 1) due to Coulomb repulsive interaction which is the mechanism for superconductivity in cuprates. We argue that in the case of pnictides the antiferromagnetism appears when the nesting conditions for the Fermi surface are met. Since the doping steadily changes the nesting conditions, the antiferromagnetism and superconductivity may coexist as has been observed in pnictides. We show that the proximity of the antiferromagnetism and superconductivity implies the repulsive interaction between electrons, which turns into attractive between quasiparticles as shown by the authors in the article published on the same issue as this one
Mineral characterisation of Don Pao rare earth deposit in Vietnam
International Nuclear Information System (INIS)
XuanBen, T.
1998-01-01
Full text: The Don Pao Rare Earth Deposit was discovered in 1959 in Phon Tho district, about 450km North-West of Hanoi capital. Geological work was conducted between 1959-95, resulting in 60 ore bodies of various sizes being identified. The ore bodies are irregularly shaped nests, lenses and veins hosted in the shear zone, at the margin of a Paeleogene aged syenite massif. The mineral composition of Don Pao Deposit is very complex, consisting of more than 50 minerals. Among them, basnaesite, parisite, fluorite and barite are the main constituent minerals of the ore. All the minerals were identified by the modern methods of mineralogical studies. Based on the constituent mineral ratios, four ore types have been distinguished in the deposit: 1. Rare earth ore containing over 5 percent of RE 2 O 3 . 2. Rare Earth-Barite ore containing 0.5 to 30 percent of RE 2 O 3 . 3. Rare Earth-Barite-Fluorite ore containing 1 to 5 percent of RE 2 O 3 . 4. Rare Earth bearing Fluorite ore containing 1 to 5 percent of RE 2 O 3 . According to the benefication test, the ores in Don Pao can be enriched to a concentrate of 60 percent of RE 2 O 3 with a recover of 75 percent
Effects of magnetic field on the cuprate high-Tc superconductor La2-xSrxCuO4
DEFF Research Database (Denmark)
Lake, B.; Aeppli, G.; Christensen, N.B.
2004-01-01
This article discusses neutron scattering measurements on the cuprate, high transition temperature superconductor La2-xSrxCuO4 (LSCO) in an applied magnetic field. LSCO is a type-II superconductor and magnetic flux can penetrate the material via the formation of vorticies. Phase coherent...
Problems of synthesis and thermal treatment of bismuth-strontium-calcium superconducting cuprates
International Nuclear Information System (INIS)
Tret'yakov, Yu.D.; Os'kina, T.E.; Putlyaev, V.I.
1990-01-01
The results, which have recently appeared in literature on synthesis and high-temperature treatment of Bi-Sr-Ca superconducting cuprates, are generalized. The review will contribute to the overcoming of experimental difficulties in the process of synthesis of monophase superconducting materials with a high transition temperature T c , including optimization of cation composition and heat treatment regime. Radional selection of synthesis conditions (component ratio, temperature, time, reactive area geometry, medium, cooling) was realized, taking into account the newest achievements in crystallochemistry of the phases
International Nuclear Information System (INIS)
Nakashima, T.; Shimoyama, J.; Honzumi, M.; Tazaki, Y.; Horii, S.; Kishio, K.
2005-01-01
We report the synthesis of cylindrical melt-solidified bulks in REBa 2 Cu 3 O y (RE = Sm, Gd, Dy, Ho, Y and Er), and their critical current properties and microstructures of the a- and the c-growth regions. It was found from the microstructure analysis that the volume fractions of RE211 particles in the c-growth region were always lower than those in the a-growth region. Moreover, those in the c-growth region were increased with distance from the seed crystal. Interestingly, the second peak effects in J c -B curves were prominently enhanced for the c-growth region. J c values at zero field for the c-growth region through the appropriate oxygen post-annealing reached approximately 95 kA cm -2 for RE = Ho, Dy and Y
Bec Model of HIGH-Tc Superconductivity in Layered Cuprates
Lomnitz, M.; Villarreal, C.; de Llano, M.
2013-11-01
High-Tc superconductivity in layered cuprates is described in a BCS-BEC formalism with linearly-dispersive s- and d-wave Cooper pairs moving in quasi-2D finite-width layers around the CuO2 planes. This yields a closed formula for Tc involving the layer width, the Debye frequency, the pairing energy and the in-plane penetration depth. The new formula has no free parameters and reasonably reproduces empirical values of superconducting Tcs for 11 different layered superconductors over a wide doping regime including YBCO itself as well as other compounds like LSCO, BSCCO and TBCCO. In agreement with the London formalism, the formula also yields a fair description of the Tc dependence of the lower critical magnetic field in highly underdoped YBCO.
Fractal analysis of striatal dopamine re-uptake sites
International Nuclear Information System (INIS)
Kuikka, J.T.; Bergstroem, K.A.; Tiihonen, J.; Raesaenen, P.; Karhu, J.
1997-01-01
Spatial variation in regional blood flow, metabolism and receptor density within the brain and in other organs is measurable even with a low spatial resolution technique such as emission tomography. It has been previously shown that the observed variance increases with increasing number of subregions in the organ/tissue studied. This resolution-dependent variance can be described by fractal analysis. We studied striatal dopamine re-uptake sites in 39 healthy volunteers with high-resolution single-photon emission tomography using iodine-123 labelled 2β-carbomethoxy-3β-(4-iodophenyl)tropane ([ 123 I]β-CIT). The mean fractal dimension was 1.15±0.07. The results indicate that regional striatal dopamine re-uptake sites involve considerable spatial heterogeneity which is higher than the uniform density (dimension=1.00) but much lower than complete randomness (dimension=1.50). There was a gender difference, with females having a higher heterogeneity in both the left and the right striatum. In addition, we found striatal asymmetry (left-to-right heterogeneity ratio of 1.19±0.15; P<0.001), suggesting functional hemispheric lateralization consistent with the control of motor behaviour and integrative functions. (orig.). With 5 figs., 1 tab
Fractal analysis of striatal dopamine re-uptake sites
Energy Technology Data Exchange (ETDEWEB)
Kuikka, J.T.; Bergstroem, K.A. [Department of Clinical Physiology, Kuopio University Hospital, Kuopio (Finland); Tiihonen, J.; Raesaenen, P. [Department of Forensic Psychiatry, University of Kuopio and Niuvanniemi Hospital, Kuopio (Finland); Karhu, J. [Department of Clinical Neurophysiology, Kuopio University Hospital, Kuopio (Finland)
1997-09-01
Spatial variation in regional blood flow, metabolism and receptor density within the brain and in other organs is measurable even with a low spatial resolution technique such as emission tomography. It has been previously shown that the observed variance increases with increasing number of subregions in the organ/tissue studied. This resolution-dependent variance can be described by fractal analysis. We studied striatal dopamine re-uptake sites in 39 healthy volunteers with high-resolution single-photon emission tomography using iodine-123 labelled 2{beta}-carbomethoxy-3{beta}-(4-iodophenyl)tropane ([{sup 123}I]{beta}-CIT). The mean fractal dimension was 1.15{+-}0.07. The results indicate that regional striatal dopamine re-uptake sites involve considerable spatial heterogeneity which is higher than the uniform density (dimension=1.00) but much lower than complete randomness (dimension=1.50). There was a gender difference, with females having a higher heterogeneity in both the left and the right striatum. In addition, we found striatal asymmetry (left-to-right heterogeneity ratio of 1.19{+-}0.15; P<0.001), suggesting functional hemispheric lateralization consistent with the control of motor behaviour and integrative functions. (orig.). With 5 figs., 1 tab.
International Nuclear Information System (INIS)
Octaviano, E.S.; Levada, C.L.; Missiato, O.; Semenzato, M.J.; Silva, R.A.; Andreeta, J.P.
2009-01-01
A desirable alternative for a faster development, characterization and application of material of technological interest has been the growth of single crystal fibers by LHPG - Laser Heated Pedestal Growth. In this work it was reported the growth of pure, doped and gradient single crystal fibers of the chemical formulation REMO_4 (M = Nb e Ta, e RE= Rare Earth), characterized through primary techniques such as X-Ray and optical spectroscopy. (author)
Spontaneous growth of whiskers on RE-bearing intermetallic compounds of Sn-RE, In-RE, and Pb-RE
Energy Technology Data Exchange (ETDEWEB)
Liu Meng [Shenyang National Laboratory for Materials Science, Institute of Metal Research, Chinese Academy of Science, 72 Wenhua Road, Shenyang 110016 (China); Xian Aiping, E-mail: ap.xian@imr.ac.c [Shenyang National Laboratory for Materials Science, Institute of Metal Research, Chinese Academy of Science, 72 Wenhua Road, Shenyang 110016 (China)
2009-11-03
A phenomenon of the whiskers growth on the bulk rare earth (RE)-intermetallic compounds of NdSn{sub 3}, NdIn{sub 3}, and LaPb{sub 3} is reported. The whiskers formed spontaneously on all of the RE-intermetallic compounds after exposed to room ambience (21-28 deg. C/20-56% RH, relative humidity) for several days. Among the samples, the propensity of whisker growth for NdSn{sub 3} is the strongest, on which the tin whiskers were flourishing and covered all of the surfaces after exposed to room ambience for 22 days; while LaPb{sub 3} is the secondary and NdIn{sub 3} is the last one. Observed by SEM, the whiskers were exhibited as different morphology, size, and number density. The XRD analysis confirms the existence of RE(OH){sub 3} after whiskers formed, also, the weight gain curve of the samples exposed to room ambience supports that a spontaneous chemical reaction of the RE-intermetallic compounds with water in room ambience takes place. In discussion, it is proposed that the fresh metal atoms released by the chemical reaction could be causative to result in nucleation and spontaneous growth of the whiskers, while the anisotropy of crystal structure could be a reason to understand the difference of the whisker growth behaviors between Sn and Pb.
Systematics of c-axis phonons in the thallium- and bismuth-based cuprate superconductors
Tsvetkov, A.A.; Dulic, Diana; Marel, D. van der; Damascelli, A.; Kaljushnaia, G.A.; Gorina, J.I.; Senturina, N.N.; Kolesnikov, N.N.; Ren, Z.F.; Wang, J.H.; Menovsky, A.A.; Palstra, T.T.M.
1999-01-01
We present grazing incidence reflectivity measurements in the far-infrared region at temperatures above and below Tc for a series of thallium- (Tl2Ba2CuO6, Tl2Ba2CaCu2O8) and bismuth- (Bi2Sr2CuO6, Bi2Sr2CaCu2O8, and Bi2-xPbxSr2CaCu2O8) based cuprate superconductors. From the spectra, which are
Bosonic excitations and electron pairing in an electron-doped cuprate superconductor
Wang, M. C.; Yu, H. S.; Xiong, J.; Yang, Y.-F.; Luo, S. N.; Jin, K.; Qi, J.
2018-04-01
By applying ultrafast optical spectroscopy to electron-doped La1.9Ce0.1CuO4 ±δ , we discern a bosonic mode of electronic origin and provide the evolution of its coupling with the charge carriers as a function of temperature. Our results show that it has the strongest coupling strength near Tc and can fully account for the superconducting pairing. This mode can be associated with the two-dimensional antiferromagnetic spin correlations emerging below a critical temperature T† larger than Tc. Our work may help to establish a quantitative relation between bosonic excitations and superconducting pairing in electron-doped cuprates.
Sulangi, Miguel Antonio; Zaanen, Jan
2018-04-01
We explore the effects of various kinds of random disorder on the quasiparticle density of states of two-dimensional d -wave superconductors using an exact real-space method, incorporating realistic details known about the cuprates. Random on-site energy and pointlike unitary impurity models are found to give rise to a vanishing DOS at the Fermi energy for narrow distributions and low concentrations, respectively, and lead to a finite, but suppressed, DOS at unrealistically large levels of disorder. Smooth disorder arising from impurities located away from the copper-oxide planes meanwhile gives rise to a finite DOS at realistic impurity concentrations. For the case of smooth disorder whose average potential is zero, a resonance is found at zero energy for the quasiparticle DOS at large impurity concentrations. We discuss the implications of these results on the computed low-temperature specific heat, the behavior of which we find is strongly affected by the amount of disorder present in the system. We also compute the localization length as a function of disorder strength for various types of disorder and find that intermediate- and high-energy states are quasiextended for low disorder, and that states near the Fermi energy are strongly localized and have a localization length that exhibits an unusual dependence on the amount of disorder. We comment on the origin of disorder in the cuprates and provide constraints on these based on known results from scanning tunneling spectroscopy and specific heat experiments.
Pseudogap-generated a coexistence of Fermi arcs and Fermi pockets in cuprate superconductors
Zhao, Huaisong; Gao, Deheng; Feng, Shiping
2017-03-01
One of the most intriguing puzzle is why there is a coexistence of Fermi arcs and Fermi pockets in the pseudogap phase of cuprate superconductors? This puzzle is calling for an explanation. Based on the t - J model in the fermion-spin representation, the coexistence of the Fermi arcs and Fermi pockets in cuprate superconductors is studied by taking into account the pseudogap effect. It is shown that the pseudogap induces an energy band splitting, and then the poles of the electron Green's function at zero energy form two contours in momentum space, however, the electron spectral weight on these two contours around the antinodal region is gapped out by the pseudogap, leaving behind the low-energy electron spectral weight only located at the disconnected segments around the nodal region. In particular, the tips of these disconnected segments converge on the hot spots to form the closed Fermi pockets, generating a coexistence of the Fermi arcs and Fermi pockets. Moreover, the single-particle coherent weight is directly related to the pseudogap, and grows linearly with doping. The calculated result of the overall dispersion of the electron excitations is in qualitative agreement with the experimental data. The theory also predicts that the pseudogap-induced peak-dip-hump structure in the electron spectrum is absent from the hot-spot directions.
Energy Technology Data Exchange (ETDEWEB)
Ogura, Daisuke; Kuroki, Kazuhiko [Department of Physics, Graduate School of Science, Osaka University, Toyonaka (Japan)
2017-06-15
In the hole-doped type cuprate superconductors, it is well-known that the superconducting transition temperature T{sub c} exhibits a dome-like structure against doping. On the other hand, recent experiments unveil that T{sub c} in the electron-doped compounds shows a monotonic increase with decreasing the doping, at least down to a very small doping rate. Our recent study for the three-band d-p model has unveiled that this asymmetric behavior can be explained as a combined effect of the intrinsic electron-hole asymmetry in systems comprising Cu3 d and O2 p orbitals and the band-filling-dependent vertex correction. In the present study, we study another compound Tl{sub 2} Ba{sub 2} CuO{sub 6} to show that this explanation can be applied to other cuprate superconductors with the small d{sub z{sup 2}} orbital mixture. By varying the d-p offset, we also study how the strength of the d-p hybridization controls the spin fluctuation and hence the pairing interaction. (copyright 2017 WILEY-VCH Verlag GmbH and Co. KGaA, Weinheim)
Barry, Stephen D.; Tkachuk, Andriy V.; Bie, Haiying; Blanchard, Peter E. R.; Mar, Arthur
2011-01-01
Ternary bismuthides RE5TtBi 2 containing rare-earth ( RE=La-Nd, Gd-Er) and tetrel ( Tt=Si, Ge) atoms have been prepared by arc-melting of the elements followed by annealing at 800 °C. They adopt the β-Yb 5Sb 3-type structure (Pearson symbol o P32, space group Pnma, Z=4), as revealed through analysis by single-crystal X-ray diffraction on Ce 5Si 0.869(4)Bi 2.131(4) and powder X-ray diffraction on Ce 5GeBi 2. Cell parameters for the entire series lie in the ranges of a=12.8-11.8 Å, b=9.6-9.0 Å, and c=8.4-7.9 Å. Solid solubility in Ce 5Si xBi 3- x and Pr 5Si xBi 3- x (approximately 0.9≤ x≤1.2, depending on the RE member) is much more limited compared to the antimonides, consistent with a highly ordered structure in which the two possible anion sites are essentially segregated into a smaller one occupied by Tt atoms (CN7) and a larger one occupied by Bi atoms (CN9). Band structure calculations on La 5SiBi 2 confirm the importance of La-La bonding interactions near the Fermi level. X-ray photoelectron spectra support the presence of partially anionic Bi atoms, as indicated by a small negative binding energy shift relative to elemental Bi. The Ce and Pr members undergo magnetic transitions at low temperatures, possibly involving ferromagnetic interactions, that are strongly influenced by the nature of the Tt atom.
Fanciulli, Marco
2007-01-01
Thin rare earth (RE) oxide films are emerging materials for microelectronic, nanoelectronic, and spintronic applications. The state-of-the-art of thin film deposition techniques as well as the structural, physical, chemical, and electrical properties of thin RE oxide films and of their interface with semiconducting substrates are discussed. The aim is to identify proper methodologies for the development of RE oxides thin films and to evaluate their effectiveness as innovative materials in different applications.
International Nuclear Information System (INIS)
Honda, R.; Ichino, Y.; Yoshida, Y.; Takai, Y.; Matsumoto, K.; Ichinose, A.; Kita, R.; Mukaida, M.; Horii, S.
2005-01-01
We studied the orientation and superconducting properties in (Yb 1-x Nd x )Ba 2 Cu 3 O y (Yb/Nd123) thin films as a function of Yb/Nd composition ratio x. As a results, we needed so high oxygen pressure as to increase x for obtaining the c-axis oriented films. J c -B curves in the Yb/Nd123 thin films were superior to that in YBa 2 Cu 3 O y thin film. Since a RE fluctuation in a composition in the Yb/Nd123 thin films was observed with TEM-EDX, we speculated the pinning centers in the Yb/Nd123 thin films were strongly affected by the RE fluctuation
Strong-coupling approach to nematicity in the cuprates
Orth, Peter Philipp; Jeevanesan, Bhilahari; Schmalian, Joerg; Fernandes, Rafael
The underdoped cuprate superconductor YBa2Cu3O7-δ is known to exhibit an electronic nematic phase in proximity to antiferromagnetism. While nematicity sets in at large temperatures of T ~ 150 K, static spin density wave order only emerges at much lower temperatures. The magnetic response shows a strong in-plane anisotropy, displaying incommensurate Bragg peaks along one of the crystalline directions and a commensurate peak along the other one. Such an anisotropy persists even in the absence of long-range magnetic order at higher temperatures, marking the onset of nematic order. Here we theoretically investigate this situation using a strong-coupling method that takes into account both the localized Cu spins and the holes doped into the oxygen orbitals. We derive an effective spin Hamiltonian and show that charge fluctuations promote an enhancement of the nematic susceptibility near the antiferromagnetic transition temperature.
Fermi surface of underdoped high-Tc superconducting cuprates
International Nuclear Information System (INIS)
Dai, X.; Su, Z.; Yu, L.
1997-01-01
The coexistence of a π-flux state and a d-wave resonant-valance-bond (RVB) state is considered in this paper within the slave-boson approach. A critical value of doping concentration δ c is found, below which the coexisting π-flux and d-wave RVB state is favored in energy. The pseudo-Fermi surface of spinons and the physical electron spectral function are calculated. A clear Fermi-level crossing is found along the (0,0) to (π, π) direction, but no such crossing is detected along the (π, 0) to (π, π) direction. Also, an energy gap of d-wave symmetry appears at the Fermi level in our calculation. The above results are in agreement with the angle-resolved photoemission experiments which indicate at a d-wave pseudogap and a half-pocket-like Fermi surface in underdoped cuprates. copyright 1997 The American Physical Society
Clinical uses of I-123 produced by 127I(p, 5n)123Xe to 123I reaction in NIRS
International Nuclear Information System (INIS)
Saegusa, Kenji; Arimizu, Noboru; Uchiyama, Guio; Tateno, Yukio; Rikitake, Tomoyuki.
1978-01-01
123 I capsules produced by NIRS which are believed to be uncontaminated by radioactive impurities other than 125 I were compared with commercial 123 I capsules regarding gamma-ray spectra, thyroid phantoms and clinical scintigrams. Absorbed radiation doses of 123 I contaminated with nuclides other than 123 I to thyroid and whole body were also estimated. Regarding gamma-ray spectra, any nuclides other than 125 I(0.53%) did not contaminate in 123 I produced by NIRS, and it was superior to commercial capsules. Regarding phantoms and clinical scintigrams, background counts around the thyroid gland seemed to be slightly higher in commercial capsules than that produced by NIRS because of contamination with other nuclides. Exposed doses in thyroid and whole body were counted. Ratios in thyroid and whole body were increased by 30% and 9%, respectively in 123 I produced by NIRS because of contamination with 0.53% of 125 I in the event that the intake ratio of thyroid was determined as 25%. In commercial capsules the doses in thyroid and whole body were increased by 500% and 150%, respectively. Doses of commercial capsules and NIRS capsules were 7.87 rad and 1.72 rad, respectively per 100 μCi in thyroid. The ratio of NIRS capsules to commercial capsules in thyroid was 1/4.6, and that in the whole body was less than 1/2. (Ichikawa, K.)
Investigation into magnetic correlations in cuprates by means of neutron scattering experiments
International Nuclear Information System (INIS)
Henggeler, W.
1996-01-01
This thesis shows the results of our investigation on cuprate materials containing rare earth ions. The main experimental tools were inelastic and elastic neutron scattering techniques. In some cases we also performed μSR, susceptibility and specific heat measurements. One aim was to learn more about the crystalline environment of the rare earth ions in these substances via the crystalline electric field (CEF) interaction. Furthermore, we investigated the correlations of the magnetic moments of these ions by a determination of the dispersion of the CEF excitations. The theory that is essential for the understanding of this work is outlined. The instruments on which the experiments have been performed are presented in the third chapter. In the fourth chapter we show the measurements of the CEF excitations of Ho 3+ in Y 0.99 Ho 0.01 Ba 2 Cu 3 O 6+x . The Ho ions represent ideal local probes to examine changes of the charge distribution in the copper oxide planes upon doping with oxygen. To prevent any influence of the Ho-Ho exchange interaction on the CEF excitations we performed the experiments on substances containing only one percent of Ho. Our results show that for all the intermediately doped compounds the charge distribution is very inhomogeneous. For all the highly doped samples we observe a line asymmetry for which several possible origins are discussed. In the fifth chapter we examine the Pr 3+ CEF excitations in the Pr 2-x Ce x CuO 4(-δ) (0≤x≤0.2)-substances. Our results show a coexistence of different environments of the Pr ions in all the doped compounds. We try to describe these inhomogeneities with the help of a model. We used the μSR-technique on some of these samples in order to learn more about the oxygen reduction process. Finally, we performed inelastic neutron scattering experiments on Pr 1.86 Ce 0.14 CuO 4 single crystal, which allowed a direct determination of the coupling constants between the magnetic moments of the Pr ions. (author
International Nuclear Information System (INIS)
McDonald, Ross D; Harrison, Neil; Singleton, John
2009-01-01
We propose that the extraordinarily high superconducting transition temperatures in the cuprates are driven by an exact mapping of the d x 2 -y 2 Cooper-pair wavefunction onto the incommensurate spin fluctuations observed in neutron-scattering experiments. This is manifested in the direct correspondence between the inverse of the incommensurability factor δ seen in inelastic neutron-scattering experiments and the measured superconducting coherence length ξ 0 . Strikingly, the relationship between ξ 0 and δ is valid for both La 2-x Sr x CuO 4 and YBa 2 Cu 3 O 7-x , suggesting a common mechanism for superconductivity across the entire hole-doped cuprate family. Using data from recent quantum-oscillation experiments in the cuprates, we propose that the fluctuations responsible for superconductivity are driven by a Fermi-surface instability. On the basis of these findings, one can specify the optimal characteristics of a solid that will exhibit 'high T c ' superconductivity. (fast track communication)
Similarity in the superconducting properties of chalcogenides, cuprate oxides and fullerides
International Nuclear Information System (INIS)
Tsendin, K.D.; Popov, B.P.; Denisov, D.V.
2004-01-01
The idea of Anderson pairs has been put forward for explanation of many extraordinary properties of chalcogenides glassy semiconductors. Recent decades made obvious that these pairs localized on the centers with negative effective correlation energy (negative-U centers) really exist in chalcogenides. If the concentration of negative-U centers is enough to create the pair band states, this can lead to superconductivity because Anderson pairs are Bose particles. In the present paper we show that several puzzling superconductivity properties of chalcogenides, high-temperature cuprate superconductors and fullerides are similar for these three groups of materials and can be naturally explained in the frame of negative-U centers model of superconductivity
Energy Technology Data Exchange (ETDEWEB)
Mašková, S., E-mail: maskova@mag.mff.cuni.cz [Department of Condensed Matter Physics, Charles University, Prague 2 (Czech Republic); Kolomiets, A. [Department of Condensed Matter Physics, Charles University, Prague 2 (Czech Republic); Department of Physics, Lviv Polytechnic National University, Lviv (Ukraine); Havela, L. [Department of Condensed Matter Physics, Charles University, Prague 2 (Czech Republic); Andreev, A.V. [Institute of Physics, AVCR, Prague 8 (Czech Republic); Svoboda, P. [Department of Condensed Matter Physics, Charles University, Prague 2 (Czech Republic)
2015-10-05
Highlights: • RE{sub 2}Pd{sub 2}In(Sn) compounds absorb, depending on RE, different amounts of hydrogen. • Compounds with the light rare earths become amorphous upon the hydrogenation. • Compounds with the heavy rare earths preserve the original tetragonal structure. • Magnetic ordering temperatures of RE{sub 2}Pd{sub 2}In compounds are reduced by the hydrogenation. - Abstract: RE{sub 2}Pd{sub 2}In, RE{sub 2}Pd{sub 2}Sn compounds (RE = rare earth) absorb, depending on the rare earth (RE) element, different amounts of hydrogen. The parent compounds RE{sub 2}Pd{sub 2}In show the linear decrease of both lattice parameters and the unit cell volume with the increasing atomic number of RE, attributed to the lanthanide contraction. All the compounds absorb at least 2 H/f.u.; the tetragonal structure is merely expanded. The expansion is anisotropic (Δc/c > Δa/a), and for RE = Tb, Dy, Ho, and Er the lattice even contracts along the a-axis (Δa/a < 0), whereas Δc/c still weakly increases. A higher H concentration can be achieved in the compounds with light rare earths (La, Nd, both for In and Sn), which then become amorphous. The magnetic ordering temperatures of all studied RE{sub 2}Pd{sub 2}In compounds are dramatically reduced by the hydrogenation, typically to the temperature range below 1.8 K.
2010-01-01
... 7 Agriculture 10 2010-01-01 2010-01-01 false State. 1280.123 Section 1280.123 Agriculture... INFORMATION ORDER Lamb Promotion, Research, and Information Order Definitions § 1280.123 State. State means each of the 50 States and the District of Columbia. ...
Indides RE{sub 3}T{sub 2}In{sub 4} (RE = Y, Gd-Tm, Lu; T = Ni, Ru, Rh) with a ZrNiAl superstructure
Energy Technology Data Exchange (ETDEWEB)
Heying, Birgit; Niehaus, Oliver; Rodewald, Ute C.; Poettgen, Rainer [Univ. Muenster (Germany). Inst. fuer Anorganische und Analytische Chemie
2016-07-01
Three series of rare earth-transition metal-indides RE{sub 3}T{sub 2}In{sub 4} (RE=Y, Gd-Tm, Lu; T=Ni, Ru, Rh) were synthesized from arc-melted RE{sub 3}T{sub 2} precursor compounds and indium tear shot in sealed niobium ampoules using different annealing sequences. The new indides crystallize with the hexagonal Lu{sub 3}Co{sub 2}In{sub 4}-type structure, space group P anti 6. All samples were characterized on the basis of Guinier powder patterns and six structures were refined from single crystal X-ray diffractometer data. The RE{sub 3}T{sub 2}In{sub 4} structures are derived from the ZrNiAl type through RE/In ordering, paralleled by a symmetry reduction from P anti 62m to P anti 6. This induces twinning for some of the investigated crystals. The main crystal chemical motifs of the RE{sub 3}T{sub 2}In{sub 4} structures are trigonal prisms of rare earth, respectively indium atoms that are filled by the transition metals.
Journal of Earth System Science | Indian Academy of Sciences
Indian Academy of Sciences (India)
Home; Journals; Journal of Earth System Science; Volume 123; Issue 4 .... Hydrologic modelling of the effect of snowmelt and temperature on a ... Spatial control of groundwater contamination, using principal component analysis ..... Forthcoming Articles · Search · Editorial Board · Information for Authors · Subscription ...
2010-01-01
... 7 Agriculture 10 2010-01-01 2010-01-01 false Research. 1260.123 Section 1260.123 Agriculture... AND ORDERS; MISCELLANEOUS COMMODITIES), DEPARTMENT OF AGRICULTURE BEEF PROMOTION AND RESEARCH Beef Promotion and Research Order Definitions § 1260.123 Research. Research means studies relative to the...
Theory of High-T{sub c} Superconducting Cuprates Based on Experimental Evidence
Abrikosov, A. A.
1999-12-10
A model of superconductivity in layered high-temperature superconducting cuprates is proposed, based on the extended saddle point singularities in the electron spectrum, weak screening of the Coulomb interaction and phonon-mediated interaction between electrons plus a small short-range repulsion of Hund's, or spin-fluctuation, origin. This permits to explain the large values of T{sub c}, features of the isotope effect on oxygen and copper, the existence of two types of the order parameter, the peak in the inelastic neutron scattering, the positive curvature of the upper critical field, as function of temperature etc.
Interplay of structural transition and superconductivity in cuprates
International Nuclear Information System (INIS)
Ghosh, Haranath; Mitra, Manidipa; Behera, S.N.; Ghatak, S.K.
1997-01-01
The presence of lattice distortion is known to suppress the superconducting (SC) transition in the cuprates. It is now accepted that electron correlation plays a dominant role in shaping the properties of these undoped and doped systems. Furthermore, since the Fermi level in these systems lies in a degenerate band of Cu : d and O : p orbitals the structural transition can be modeled as a band Jahn-Teller effect. We study the coexistence of superconductivity and band Jahn-Teller (J-T) distortion, taking into account the electron correlation within the slave boson formalism. It is shown that with increasing dopant concentration (δ), the structural transition temperature (T s ) remains constant up to a certain value and then vanishes, while the SC transition temperature (T c ) increases to a maximum value. The highest value of T c corresponds to that value of δ where T s vanishes. Besides with increasing lattice distortion superconductivity is suppressed. These findings are in qualitative agreement with the experimental results. (author)
Iodine-123 iodobenzofuran (I-123 IBF) SPECT in patients with parkinsonism
Energy Technology Data Exchange (ETDEWEB)
Nakabeppu, Yoshiaki; Nakajo, Masayuki; Mitsuda, Mitsuru; Tsuchimochi, Shinsaku; Tani, Atsushi; Osame, Mitsuhiro [Kagoshima Univ. (Japan). Faculty of Medicine
1999-12-01
Iodine-123 benzofuran (I-123 IBF) is a dopaminergic antagonist which is suitable for SPECT imaging of D2 receptors. The purpose of this study is to evaluate the potential usefulness of semi-quantitative parameters obtained from brain SPECT data of I-123 IBF for differential diagnosis in patients with parkinsonism (PN). Subjects were 10 patients with PN: 2 patients with striato-nigral degeneration (SND), 5 patients with Parkinson's disease (PD), 2 patients with progressive supranuclear palsy (PSP) and one patient with olivo-ponto-cerebellar atrophy (OPCA). The data were acquired with a triple-head gamma camera at 2 hours after intravenous injection of 167 MBq of I-123 IBF. Transverse images were reconstructed by means of filtered backprojection, and attenuation correction was performed by Chang's method ({mu}=0.08). The basal ganglia-to-frontal cortex ratio (GFR) and the basal ganglia-to-occipital cortex ratio (GOR) on slices of 5 different thicknesses were calculated. The GFR and GOR were lower in the SND group than in the other disease groups in all slices with different thicknesses (7.2 mm, 14.4 mm, 21.6 mm, 28.8 mm and 43.2 mm). The semiquantitative parameters (GFR and GOR) obtained from brain SPECT data at 2 hours after intravenous injection of I-123 IBF may be useful for differential diagnosis in patients with PN. (author)
Iodine-123 iodobenzofuran (I-123 IBF) SPECT in patients with parkinsonism
International Nuclear Information System (INIS)
Nakabeppu, Yoshiaki; Nakajo, Masayuki; Mitsuda, Mitsuru; Tsuchimochi, Shinsaku; Tani, Atsushi; Osame, Mitsuhiro
1999-01-01
Iodine-123 benzofuran (I-123 IBF) is a dopaminergic antagonist which is suitable for SPECT imaging of D2 receptors. The purpose of this study is to evaluate the potential usefulness of semi-quantitative parameters obtained from brain SPECT data of I-123 IBF for differential diagnosis in patients with parkinsonism (PN). Subjects were 10 patients with PN: 2 patients with striato-nigral degeneration (SND), 5 patients with Parkinson's disease (PD), 2 patients with progressive supranuclear palsy (PSP) and one patient with olivo-ponto-cerebellar atrophy (OPCA). The data were acquired with a triple-head gamma camera at 2 hours after intravenous injection of 167 MBq of I-123 IBF. Transverse images were reconstructed by means of filtered backprojection, and attenuation correction was performed by Chang's method (μ=0.08). The basal ganglia-to-frontal cortex ratio (GFR) and the basal ganglia-to-occipital cortex ratio (GOR) on slices of 5 different thicknesses were calculated. The GFR and GOR were lower in the SND group than in the other disease groups in all slices with different thicknesses (7.2 mm, 14.4 mm, 21.6 mm, 28.8 mm and 43.2 mm). The semiquantitative parameters (GFR and GOR) obtained from brain SPECT data at 2 hours after intravenous injection of I-123 IBF may be useful for differential diagnosis in patients with PN. (author)
Theoretical Modeling of Various Spectroscopies for Cuprates and Topological Insulators
Basak, Susmita
Spectroscopies resolved highly in momentum, energy and/or spatial dimensions are playing an important role in unraveling key properties of wide classes of novel materials. However, spectroscopies do not usually provide a direct map of the underlying electronic spectrum, but act as a complex 'filter' to produce a 'mapping' of the underlying energy levels, Fermi surfaces (FSs) and excitation spectra. The connection between the electronic spectrum and the measured spectra is described as a generalized 'matrix element effect'. The nature of the matrix element involved differs greatly between different spectroscopies. For example, in angle-resolved photoemission (ARPES) an incoming photon knocks out an electron from the sample and the energy and momentum of the photoemitted electron is measured. This is quite different from what happens in K-edge resonant inelastic X-ray scattering (RIXS), where an X-ray photon is scattered after inducing electronic transitions near the Fermi energy through an indirect second order process, or in Compton scattering where the incident X-ray photon is scattered inelastically from an electron transferring energy and momentum to the scattering electron. For any given spectroscopy, the matrix element is, in general, a complex function of the phase space of the experiment, e.g. energy/polarization of the incoming photon and the energy/momentum/spin of the photoemitted electron in the case of ARPES. The matrix element can enhance or suppress signals from specific states, or merge signals of groups of states, making a good understanding of the matrix element effects important for not only a robust interpretation of the spectra, but also for ascertaining optimal regions of the experimental phase space for zooming in on states of the greatest interest. In this thesis I discuss a comprehensive scheme for modeling various highly resolved spectroscopies of the cuprates and topological insulators (TIs) where effects of matrix element, crystal
Journal of Earth System Science | Indian Academy of Sciences
Indian Academy of Sciences (India)
Home; Journals; Journal of Earth System Science; Volume 123; Issue 1 .... Liquefaction-induced settlement, site effects and damage in the vicinity of Yalova ... Climatic control on extreme sediment transfer from Dokriani Glacier during monsoon, ... India that has been noticed in several global and regional climate models.
Journal of Earth System Science | Indian Academy of Sciences
Indian Academy of Sciences (India)
Home; Journals; Journal of Earth System Science; Volume 123; Issue 7 ... less than 5000 mg/l is recommended in this area, at flow rate less than 10m3/hr/well. In other words, one can expect that the brackish water is probably found where the ...
Energy Technology Data Exchange (ETDEWEB)
Abdeen, W. [Superconductivity and Metallic Glass Lab, Physics Department, Faculty of Science, Alexandria University, Alexandria (Egypt); Physics Department, Physics Department – University College at Al-Gamom, Umm Al-Qura University (Saudi Arabia); El-Tahan, A. [Physics Department, Faculty of Science, Tanta University, Tanta (Egypt); Roumié, M. [Accelerator Laboratory, Lebanese Atomic Energy Commission, CNRS, Beirut (Lebanon); Awad, R. [Physics Department, Faculty of Science, Beirut Arab University (BAU), Beirut (Lebanon); Aly, A.I. Abou [Superconductivity and Metallic Glass Lab, Physics Department, Faculty of Science, Alexandria University, Alexandria (Egypt); El-Maghraby, E.M.; Khalaf, A. [Physics Department, Faculty of Science, Damanhur University, Damanhur (Egypt)
2016-12-01
Superconducting samples of SmBa{sub 2}Cu{sub 3}O{sub 7−δ} (Sm-123) added with various amounts of nanosized MnFe{sub 2}O{sub 4} addition (0.0−0.20 wt%) were investigated. The investigated samples prepared by the solid-state reaction method. The phase formation and microstructure of these samples were examined using X-ray powder diffraction (XRD), scanning electron microscopy (SEM), energy dispersive X-ray (EDX), proton induced X-ray emission (PIXE) and Rutherford backscattering spectrometry (RBS). XRD data indicate that the volume fraction of Sm-123 increases as nanosized MnFe{sub 2}O{sub 4} increases up to 0.02 wt%. The elemental distribution and oxygen content were deduced from PIXE and RBS. The oxygen content slightly decreases as MnFe{sub 2}O{sub 4} wt% increases. The superconducting transition temperature (T{sub c}) and critical current density (J{sub c}) of the prepared samples were estimated from electrical resistivity and transport critical current density measurements. It was found that T{sub c} decreases as nanosized MnFe{sub 2}O{sub 4} addition increases, while J{sub c} enhances up to 0.02 wt%. Moreover, the temperature dependence of normal state electrical resistivity was studied in view of the pseudogap opening in order to determine the pseudogap temperature T* as a function of nanosized MnFe{sub 2}O{sub 4} addition. T* increases as nanosized MnFe{sub 2}O{sub 4} increased, indicating the enhancement of the pseudogap formation in HTSCs by adding magnetic impurities. The crossover to fluctuation conductivity near the T{sub c} is discussed. - Highlights: • Nanosized MnFe{sub 2}O{sub 4} most likely does not enter the Sm-123 crystal structure. • Samples present a metallic-like behavior in the normal state at high temperature. • Nanosized MnFe{sub 2}O{sub 4} lead to enhancement the formation of pseudogap in cuprates HTSCs. • The increase in T{sub LD} crossover temperature up to x=0.02 wt% has been observed. • Nanosized MnFe{sub 2}O{sub 4} can
International Nuclear Information System (INIS)
Yuan Feng; Feng Shiping; Su Zhaobin; Yu Lu
2001-08-01
The doping, temperature and energy dependence of the dynamical spin structure factors of the underdoped lanthanum cuprates in the normal state is studied within the t-J model using the fermion-spin transformation technique. Incommensurate peaks are found at [(1±δ)π, π], [π, (1±δ)π] at relatively low temperatures with δ linearly increasing with doping at the beginning and then saturating at higher dopings. These peaks broaden and weaken in amplitude with temperature and energy, in good agreement with experiments. The theory also predicts a rotation of these peaks by π/4 at even higher temperatures, being shifted to [(1±δ/√2)π, (1±δ/√2)π]. (author)
2010-07-01
... 29 Labor 3 2010-07-01 2010-07-01 false Agriculture. 570.123 Section 570.123 Labor Regulations... Provisions of the Fair Labor Standards Act of 1938, as Amended Exemptions § 570.123 Agriculture. (a) Section... agriculture outside of school hours for the school district where such employee is living while he is so...
Direct current electroluminescence in rare-earth-doped zinc sulphide
International Nuclear Information System (INIS)
Bryant, F.J.; Krier, A.
1984-01-01
Some of the properties and characteristics of rare-earth-doped zinc sulphide DCEL devices are reported. Two types of devices are discussed, co-evaporated ZnS:RE thin films and ion implanted ZnS:RE single crystal diodes. The thin film devices exhibit bright DCEL of various colours at low applied voltages (typically approximately 12 V). A study of the spectral intensities and lifetimes of the Er 3+ ion in ZnS:Er 3+ thin films is consistent with a Boltzmann energy distribution amongst the conduction electrons present in these devices. The ZnS:RE single crystal diodes fabricated in this laboratory by ion implantation are also capable of various colour DCEL. By comparing the EL emission obtained from the different rare earth dopants, erbium and neodymium are identified as the most efficient luminescence centres. Further consideration of the EL emission spectra gives evidence for the presence of inter-conduction band hot electron transitions in those devices containing rare earth dopants which are inefficent electroluminescence centres. These findings can be explained in terms of Auger processes occurring in rare earth complexes. (author)
Lin, Xinsong; Tabassum, Danisa; Mar, Arthur
2015-12-14
A homologous series of ternary rare-earth zinc arsenides, prepared by reactions of the elements at 750 °C, has been identified with the formula RE(2-y)Zn4As4·n(REAs) (n = 2, 3, 4) for various RE members. They adopt trigonal structures: RE(4-y)Zn4As6 (RE = La-Nd), space group R3̄m1, Z = 3; RE(5-y)Zn4As7 (RE = Pr, Nd, Sm, Gd), space group P3̄m1, Z = 1; RE(6-y)Zn4As8 (RE = La-Nd, Sm, Gd), space group R3̄m1, Z = 3. The Zn atoms can be partially substituted by Mn atoms, resulting in quaternary derivatives RE(2-y)Mn(x)Zn(4-x)As4·n(REAs). Single-crystal structures were determined for nine ternary and quaternary arsenides RE(2-y)M4As4·n(REAs) (M = Mn, Zn) as representative examples of these series. The structures are built by stacking close-packed nets of As atoms, sometimes in very long sequences, with RE atoms occupying octahedral sites and M atoms occupying tetrahedral sites, resulting in an intergrowth of [REAs] and [M2As2] slabs. The recurring feature of all members of the homologous series is a sandwich of [M2As2]-[REAs]-[M2As2] slabs, while rocksalt-type blocks of [REAs] increase in thickness between these sandwiches with higher n. Similar to the previously known related homologous series REM(2-x)As2·n(REAs) which is deficient in M, this new series RE(2-y)M4As4·n(REAs) exhibits deficiencies in RE to reduce the electron excess that would be present in the fully stoichiometric formulas. Enthalpic and entropic factors are considered to account for the differences in site deficiencies in these two homologous series. Band structure calculations indicate that the semiconducting behaviour of the parent n = 0 member (with CaAl2Si2-type structure) gradually evolves, through a narrowing of the gap between valence and conduction bands, to semimetallic behaviour as the number of [REAs] blocks increases, to the limit of n = ∞ for rocksalt-type REAs.
Journal of Earth System Science | Indian Academy of Sciences
Indian Academy of Sciences (India)
Home; Journals; Journal of Earth System Science; Volume 123; Issue 7 ... Net short wave and long wave radiative fluxes substantially varied with cloud dynamics, season, .... Impact of over-exploitation on groundwater quality: A case study from .... using large scale climate variables and downscaling models – A case study.
Comprehensive Study of the Model Mercury-Based Cuprate Superconductors
Energy Technology Data Exchange (ETDEWEB)
Greven, Martin [Univ. of Minnesota, Minneapolis, MN (United States)
2017-11-13
This is the Final Report on DE-SC0006858, which opened 15 August 2011 and closed 14 August 2017. The Principal Investigator is Martin Greven, School of Physics and Astronomy, University of Minnesota, Minneapolis, MN 555455 (email: greven@umn.edu). The Administrative Point of Contact is Patricia Jondahl, phone: 612-624-5599, email: awards@umn.edu. The DOE Program is the Office of Basic Energy Sciences, Program manager is Dr. P. Thiyagarajan, Neutron Scattering SC-22.2/ Germantown Bldg. (email: Thiyagarajan@science.doe.gov). The chief activity was the crystal growth, characterization, neutron and X-ray scattering study of the mercury-based cuprates, arguably the most desirable high-Tc superconductors for experimental study due to their record values of Tc and their relatively simple crystal structures. It is thought that the unusual magnetic and charge degrees of freedom of the copper-oxygen sheets that form the fundamental building block of all cuprate superconductors give rise to the high Tc and to many other unusual properties exhibited by the class of quantum materials. Neutron scattering experiments were performed to reveal the nature of the magnetic degrees of freedom of the copper-oxygen sheets, whereas X-ray scattering experiments and complementary charge-transport experiments were performed to reveal the nature of the charge degrees of freedom. In addition, collaborations were initiated with experts in the use of complementary experimental techniques. The primary products are (i) scientific articles published in peer-reviewed scientific journals, (ii) scientific presentations at national and international conferences, and (iii) education of postdoctoral researchers, PhD graduate students and undergraduate researchers by providing a research experience in crystal growth, characterization and scattering. Twenty scientific papers were published in peer-reviewed journals, thirty-one invited talks were presented at national or international conferences, or as
Theory of the c-axis penetration depth in the cuprates
International Nuclear Information System (INIS)
Radtke, R.J.; Kostur, V.N.; Levin, K.
1996-01-01
Recent measurements of the London penetration-depth tensor in the cuprates find a weak temperature dependence along the c direction that is seemingly inconsistent with evidence for d-wave pairing deduced from in-plane measurements. We demonstrate in this paper that these disparate results are not in contradiction, but can be explained within a theory based on incoherent quasiparticle hopping between the CuO 2 layers. By relating the calculated temperature dependence of the penetration depth λ c (T) to the c-axis resistivity, we show how the measured ratio λ 2 c (0)/λ 2 c (T) can provide insight into the behavior of c-axis transport below T c and the related issue of open-quote open-quote confinement.close-quote close-quote copyright 1996 The American Physical Society
Exploring the phase diagram of the Bi-cuprates by photoemission
International Nuclear Information System (INIS)
Janowitz, C.
2004-01-01
High temperature superconductivity is achieved by hole doping of parent compounds, which undergo a phase transition from the antiferromagnetic, insulating state to the metallic and superconducting state. This development can only be studied continuously on few members of the cuprate family: Bi 2 Sr 2 Ca 1-x Y x Cu 2 O 8+δ single crystals, where the hole concentration in the two CuO 2 -planes per unit cell (n=2) is controlled by the substitution of Ca by Y, and Bi 2 Sr 2 Ca 1- x La x CuO 6+δ single crystals, where this concentration in the one CuO 2 -plane per unit cell (n=1) is controlled by the substitution of Sr by La enable this study of the doping dependence over a wide range of hole concentrations with ARPES. Investigations of antiferromagnetic parent compounds have so far mostly been reported for oxychlorides, like e.g. Sr 2 CuO 2 Cl 2 and discussed within the t-t'-t'''-J model. Since the character of the CuO derived states near the Fermi level is decisive for the electronic structure, it will be discussed, whether this or other models like the generalized tight binding method (GTBM) give an appropriate description. A detailed treatment by this method with a five band Hubbard Hamiltonian, i.e. involving planar and off planar states of the CuO-planes shows, that the first removal state is composed not only from the Zhang-Rice singlet state but also from states with spin triplet character. In the second part of the talk the electronic structure for hole concentrations in the vicinity of the optimum transition temperature is addressed. It is general consensus that in this region the electronic structure can no longer be described by Fermi liquid (FL) theory. Instead various other non-FL theories are discussed. A class of these models deals with reduced dimensionality in the CuO 2 - planes, leading to Luttinger liquid like behaviour with spin and charge separation. Another route to one-dimensionality comes from the so called striped phase with spin and charge
Helimagnetism and weak ferromagnetism in edge-shared chain cuprates
International Nuclear Information System (INIS)
Drechsler, S.-L.; Richter, J.; Kuzian, R.; Malek, J.; Tristan, N.; Buechner, B.; Moskvin, A.S.; Gippius, A.A.; Vasiliev, A.; Volkova, O.; Prokofiev, A.; Rakoto, H.; Broto, J.-M.; Schnelle, W.; Schmitt, M.; Ormeci, A.; Loison, C.; Rosner, H.
2007-01-01
The present understanding of a novel growing class of chain cuprates with intriguing magnetic properties is reviewed. Among them, several undoped edge-shared CuO 2 chain compounds show at low temperature a clear tendency to helicoidal magnetical ordering with acute pitch angles and sometimes also to weak ferromagnetism. Our analysis is based on the isotropic 1D frustrated J 1 -J 2 Heisenberg model with ferromagnetic (FM) 1st neighbor and antiferromagnetic 2nd neighbor exchange. The achieved assignment is supported by microscopic calculations of the electronic and magnetic structure. We consider Na(Li)Cu 2 O 2 , LiVCuO 4 as the best studied helimagnets, Li 2 ZrCuO 4 and other systems close to a FM quantum critical point, as well as Li 2 CuO 2 with FM inchain ordering. The interplay of frustrated inchain couplings, anisotropy and interchain exchange is discussed
Metabolism of 123I-FP-CIT in humans
International Nuclear Information System (INIS)
Tanaka, Akihiro; Okano, Kyoko; Tamagami, Hiroshi
1999-01-01
The metabolism of N-(3-fluoropropyl)-2β-carbomethoxy-3β-(4-iodophenyl)nortropane ( 123 I) ( 123 I-FP-CIT) in healthy humans was studied. Plasma and urine samples, obtained after i.v. administration of 123 I-FP-CIT, were analyzed using the two-dimensional thin-layer chromatography technique. Eleven radiochemical components were detected in both plasma and urine, and four of them were the parent 123 I-FP-CIT and its metabolites, N-(3-fluoropropyl)-2β-carboxy-3β-(4-iodophenyl)nortropane ( 123 I) ( 123 I-acid), 2β-carboxy-3β-(4-iodophenyl)nortropane ( 123 I) ( 123 I-nor-acid) and 2β-carbomethoxy-3β-(4-iodophenyl)nortropane ( 123 I) ( 123 I-nor-CIT). These four identified radiochemical components occupied about 80% or more in ratio of the radiochemical components in the plasma and urine. In the metabolites of 123 I-FP-CIT, the high polar metabolites- 123 I-acid and 123 I-nor-acid-were found to be the major components, while lipophilic 123 I-nor-CIT was a minor component. Free iodide ( 123 I - ) was not found in the plasma or urine. Thus, the main metabolic reactions which 123 I-FP-CIT undergoes in humans seem to be hydrolysis of the ester bond and N-dealkylation. In vivo deiodination of 123 I-FP-CIT was found to be minimum. Current results suggest that the metabolites of 123 I-FP-CIT hardly influence evaluation of the dopamine transporter in the human brain. (author)
Behaviour of superconductivity energetic characteristics in electron-doped cuprates. A simple model
International Nuclear Information System (INIS)
Kristoffel, N.; Rubin, P.
2008-01-01
A simple model to describe the energetic phase diagram of electron-doped cuprate superconductor is developed. Interband pairing operates between the UHB and the defect states created by doping and supplied by both extincting HB-s. Two defect subbands correspond to the (π,0) and (π/2,π/2) momentum regions. Extended doping quenches the bare normal state gaps (pseudogaps). Maximal transition temperature corresponds to overlapping bands ensemble intersected by the chemical potential. Illustrative results for T c , pseudo- and superconducting gaps are calculated on the whole doping scale. Major characteristic features on the phase diagram are reproduced. Anticipated manifestation of gaps doping dynamics is discussed
Journal of Earth System Science | Indian Academy of Sciences
Indian Academy of Sciences (India)
Home; Journals; Journal of Earth System Science; Volume 123; Issue 5 .... Current products based on Ocean General Circulation Models like ECCO2 ... An assessment of wind forcing impact on a spectral wave model for the Indian Ocean .... variability over India and its subregions using a regional climate model (RegCM3).
Journal of Earth System Science | Indian Academy of Sciences
Indian Academy of Sciences (India)
Home; Journals; Journal of Earth System Science; Volume 123; Issue 2 ... Trend analysis and change point detection of annual and seasonal .... Numerical evaluation of seismic response of shallow foundation on loose silt and silty sand ... complex interactions can be a valuable tool to gain new insights for improved seismic ...
[A Phase 1 study of beta-methyl-p-(123I)-iodophenyl-pentadecanoic acid (123I-BMIPP)].
Torizuka, K; Yonekura, Y; Nishimura, T; Tamaki, N; Uehara, T; Ikekubo, K; Hino, M
1991-07-01
Phase 1 study of beta-methyl-p-(123I)-iodophenylpentadecanoic acid (123I-BMIPP), a new radiopharmaceutical developed for the evaluation of myocardial fatty acid metabolism, was performed in six normal volunteers to evaluate its biodistribution and safety. After intravenous injection of 111 MBq of 123I-BMIPP, the agent accumulated to the myocardium rapidly (5.4 +/- 0.6% at 1.5 hr after injection) and was washed-out slowly (5.1 +/- 0.4% at 3.0hr). 123I-BMIPP demonstrated no significant accumulation to any specific organs other than myocardium, liver and muscle. Myocardium was clearly visualized in the planar and SPECT images obtained 30 min and 3 hrs after injection. The absorption doses from 123I-BMIPP estimated by MIRD method were lower than those from 201Tl in all organs. Neither adverse reactions nor abnormal clinical laboratory findings were found in the safety evaluation. These results suggest 123I-BMIPP is a promising agent for evaluating myocardial fatty acid metabolism.
A single crystal study of RE{sub 14}Co{sub 3}In{sub 3} (RE = Y, Tb, Dy, Ho, Er)
Energy Technology Data Exchange (ETDEWEB)
Zaremba, V.I.; Kalychak, Y.M.; Dzevenko, M.V. [Inorganic Chemistry Dept., Ivan Franko National Univ. of Lviv (Ukraine); Rodewald, U.Ch.; Heying, B.; Poettgen, R. [Inst. fuer Anorganische und Analytische Chemie, Westfaelische Wilhelms-Univ. Muenster (Germany)
2006-01-01
The rare earth-cobalt-indides RE{sub 14}Co{sub 3}In{sub 3} (RE = Y, Tb, Dy, Ho, Er) were prepared in polycrystalline form from the elements by arc-melting. Small single crystals were grown through a special annealing sequence. The compounds were investigated on the basis of X-ray powder and single crystal data: Lu{sub 14}Co{sub 2}In{sub 3} (Gd{sub 14}Co{sub 3}In{sub 2.7}) type, P4{sub 2}/nmc, Z = 4, a = 959.0(1), c = 2319.1(5) pm, wR2 = 0.055, 2289 F{sup 2} values, 65 variables for Y{sub 13.90}Co{sub 2.99}In{sub 3.02}, a = 953.8(1), c = 2315.8(5) pm, wR2 = 0.108, 2357 F{sup 2} values, 65 variables for Tb{sub 13.92}Co{sub 3.01}In{sub 2.92}, a = 949.24(3), c = 2296.5(1) pm, wR2 = 0.129, 2518 F{sup 2} values, 65 variables for Dy{sub 13.90}Co{sub 2.97}In{sub 2.95}, a = 946.3(1), c = 2289.0(5) pm, wR2 = 0.099, 2297 F{sup 2} values, 64 variables for Ho{sub 14}Co{sub 2.80}In{sub 2.89}, and a = 941.0(1), c = 2274.2(5) pm, wR2 = 0.140, 2450 F{sup 2} values, 65 variables for Er{sub 13.83}Co{sub 2.88}In{sub 3.10}. All RE{sub 14}Co{sub 3}In{sub 3} indides show a small degree of In/Co mixing (between 7 and 16% Co) on the 4c In1 site and defects on the 8g Co1 positions (between 84 and 95% Co). Except for the holmium compound, the RE{sub 14}Co{sub 3}In{sub 3} intermetallics also reveal RE/In mixing on the 4c RE1 sites, leading to the refined compositions. The seven crystallographically independent RE sites have between 9 and 10 nearest RE neighbors. The RE{sub 14}Co{sub 3}In{sub 3} structures consist of a complex intergrowth of rare earth based polyhedra. Both cobalt sites have a distorted trigonal-prismatic rare earth coordination. An interesting feature is the In2-In2 dumb-bell with an In2-In2 distance of 300 pm (for Ho{sub 14}Co{sub 2.80}In{sub 2.89}). The crystal chemistry of the RE{sub 14}Co{sub 3}In{sub 3} indides is discussed. (orig.)
The occurrence of rare earth elements in some Finnish mires
Directory of Open Access Journals (Sweden)
Yliruokanen, I.
1995-12-01
Full Text Available The content of the more abundant rare earths (RE (Y, La, Ce, Pr, Nd and Sm in the ash of 399 peat samples from 26 Finnish mires was determined by X-ray fluorescence spectrometry. The content of all rare earths (La-Lu, Y in 29 samples was also determined by spark source mass spectrometry. The median RE contents in peat ashes from areas where the bedrock consists of rapakivi granite, granite or archean gneiss are reported. Detailed data concerning the individual mires are also presented. The highest RE contents were found in samples from rapakivi granite areas where a strong negative Eu anomaly was also observed. The RE contents were in general highest at the basal peat layers.
Li, Lu; Zhou, Pin; Zhang, Hongbo; Meng, Xianglong; Li, Juexiu; Sun, Tonghua
2017-06-01
Rare earth oxides (RE = Ce, La, Sm and Gd) doped ZnO supported on KIT-6 sorbents (RE-ZnO/KIT-6) were synthesized by sol-gel method and their performance for deep removal of H2S (bellow 0.1 ppmv) from gas stream at medium temperature was tested. The RE dopants (except Ce) significantly enhance the deep desulfurization capacity of ZnO/KIT-6 sorbent and maintained higher sulfur uptake capacities upon multiple cycles of regeneration by a simple thermal oxidation in 10 v% of O2 in N2 atmosphere. The results of SAXS, XRD, N2 physisorption, TEM, FIIR, and XPS implied that the KIT-6 structure of loading metal oxides remained intact. It was found that RE could hinder the ZnO crystal ripening during calcination resulted in smaller ZnO particles, enhance the interaction of ZnO and silica matrix to improve the dispersion of active phase on KIT-6. Furthermore, by increasing the outlayer electron density of Zn atom and oxygen transfer ability, the synergistic effect considered to be favorable for RE-ZnO/KIT-6 sulfidation. Even though the performance of improving ZnO dispersion was weaker than that of Sm and Gd, La-ZnO/KIT-6 performs the best deep desulfurizers by changing the surface chemical atmosphere for ZnO. Steam in the gas stream inhibited the capture of H2S by ZnO in the sorbents, in the case of La-ZnO/KIT-6, the steam content should control as lower as 5 v% to ensure the desulfurization efficiency and precision.
Processing and properties of large grain (RE)BCO
International Nuclear Information System (INIS)
Cardwell, D.A.
1998-01-01
The potential of high temperature superconductors to generate large magnetic fields and to carry current with low power dissipation at 77 K is particularly attractive for a variety of permanent magnet applications. As a result large grain bulk (RE)-Ba-Cu-O ((RE)BCO) materials have been developed by melt process techniques in an attempt to fabricate practical materials for use in high field devices. This review outlines the current state of the art in this field of processing, including seeding requirements for the controlled fabrication of these materials, the origin of striking growth features such as the formation of a facet plane around the seed, platelet boundaries and (RE) 2 BaCuO 5 (RE-211) inclusions in the seeded melt grown microstructure. An observed variation in critical current density in large grain (RE)BCO samples is accounted for by Sm contamination of the material in the vicinity of the seed and with the development of a non-uniform growth morphology at ∼4 mm from the seed position. (RE)Ba 2 Cu 3 O 7-δ (RE-123) dendrites are observed to form and bro[en preferentially within the a/b plane of the lattice in this growth regime. Finally, trapped fields in excess of 3 T have been reported in irr[iated U-doped YBCO and (RE) 1+x Ba 2-x Cu 3 O y (RE=Sm, Nd) materials have been observed to carry transport current in fields of up to 10 T at 77 K. This underlines the potential of bulk (RE)BCO materials for practical permanent magnet type applications. (orig.)
Inequivalence of single-particle and population lifetimes in a cuprate superconductor
Energy Technology Data Exchange (ETDEWEB)
Yang, Shuolong [SLAC National Accelerator Lab., Menlo Park, CA (United States); Stanford Univ., Stanford, CA (United States); Sobota, J. A. [SLAC National Accelerator Lab., Menlo Park, CA (United States); Lawrence Berkeley National Lab. (LBNL), Berkeley, CA (United States); Leuenberger, D. [SLAC National Accelerator Lab., Menlo Park, CA (United States); Stanford Univ., Stanford, CA (United States); He, Y. [SLAC National Accelerator Lab., Menlo Park, CA (United States); Stanford Univ., Stanford, CA (United States); Hashimoto, M. [SLAC National Accelerator Lab., Menlo Park, CA (United States); Lu, D. H. [SLAC National Accelerator Lab., Menlo Park, CA (United States); Eisaki, H. [National Institute of Advanced Industrial Science and Technology, Ibaraki (Japan); Kirchmann, P. S. [SLAC National Accelerator Lab., Menlo Park, CA (United States); Shen, Z. -X. [SLAC National Accelerator Lab., Menlo Park, CA (United States); Stanford Univ., Stanford, CA (United States)
2015-06-15
We study optimally doped Bi-2212 (Tc=96 K) using femtosecond time- and angle-resolved photoelectron spectroscopy. Energy-resolved population lifetimes are extracted and compared with single-particle lifetimes measured by equilibrium photoemission. The population lifetimes deviate from the single-particle lifetimes in the low excitation limit by 1–2 orders of magnitude. Fundamental considerations of electron scattering unveil that these two lifetimes are in general distinct, yet for systems with only electron-phonon scattering they should converge in the low-temperature, low-fluence limit. As a result, the qualitative disparity in our data, even in this limit, suggests that scattering channels beyond electron-phonon interactions play a significant role in the electron dynamics of cuprate superconductors.
RITD - Adapting Mars Entry, Descent and Landing System for Earth
Haukka, H.; Heilimo, J.; Harri, A.-M.; Aleksashkin, S.; Koryanov, V.; Arruego, I.; Schmidt, W.; Finchenko, V.; Martynov, M.; Ponomarenko, A.; Kazakovtsev, V.; Martin, S.
2015-10-01
We have developed an atmospheric re-entry and descent system concept based on inflatable hypersonic decelerator techniques that were originally developed for Mars. The ultimate goal of this EU-funded RITD-project (Re-entry: Inflatable Technology Development) was to assess the benefits of this technology when deploying small payloads from low Earth orbits to the surface of the Earth with modest costs. The principal goal was to assess and develop a preliminary EDLS design for the entire relevant range of aerodynamic regimes expected to be encountered in Earth's atmosphere during entry, descent and landing. Low Earth Orbit (LEO) and even Lunar applications envisaged include the use of the EDLS approach in returning payloads of 4-8 kg down to the surface.
Energy Technology Data Exchange (ETDEWEB)
Tada, Hiroshi; Morooka, Keiichi; Arimoto, Kiyoshi; Matsuo, Takiko; Takagi, Kazue; Yanagawa, Etsuko (Toho Univ., Tokyo (Japan). School of Medicine)
1992-09-01
We studied the clinical usefulness of I[sup 123]-IMP SPECT in 50 pediatric patients with CNS disorders, which were categorized into the convulsive disorder group (n=20), the cerebrovascular disorder group (n=10), the acute encephalopathy or CNS infection group (n=10), the metabolic or degenerative disorder group (n=6), the congenital abnormality group (n=2) and the migraine group (n=2). The findings obtained were compared with those of cranial CT. I[sup 123]-IMP SPECT revealed abnormal findings in 45 out of the 50 patients (90%), although cranial CT showed abnormal findings in only 24 patients (48%). This difference was statistically significant (p<0.01). In all groups except the migraine, we could find abnormal findings in more than 90% of the patients. Out of 28 patients without focal findings on the initial CT scanning. I[sup 123]-IMP SPECT showed focal abnormalities in 26 patients (93%). Moreover in many patients with focal neurological abnormalities, we found focal abnormalities of I[sup 123]-IMP SPECT related with neurological abnormalities of the patients. From these findings, we think I[sup 123]-IMP SPECT might be superior to CT scanning in examining a localized lesion. It was found that in many patients with focal abnormalities in CT scanning, I[sup 123]-IMP SPECT showed larger abnormalities in CT scanning. By using I[sup 123]-IMP SPECT we might be able to study the blood perfusional state surrounding the abnormal area shown by CT. In 3 patients with acute cerebrovascular disorders, I[sup 123]-IMP SPECT revealed abnormal findings 3 to 11 days earlier than cranial CT. I[sup 123]-IMP SPECT might be useful for early recognition of the pathological state. From these experiences, we concluded that I[sup 123]-IMP SPECT was useful for studying the pathophysiology of CNS disorders in children. (author).
Production and application of 123I-labeled M-iodobenzylguanidine (123I-MIBG)
International Nuclear Information System (INIS)
Washburn, L.C.; Khosla, R.C.; Williams, C.C.; Gelfand, M.J.; Maxon, H.R.
1993-01-01
For the past two years the authors have been producing 123 I-MIBG for diagnosis and evaluation of neural crest tumors in both pediatric and adult patients. The method of Mock and Weiner (Appl. Radiat. Isot. 39:939-942, 1988) was used. Out of 89 attempted runs, 87 were successful in meeting the 90% radiochemical purity required for patient administration; both failures occurred during the first six months of the project. The 87 runs provided 144 pediatric doses and 48 adult doses. The radiochemical yield, not corrected for decay, was 67.7 ± 10.3% (mean ± S.D.). The radiochemical purity of the successful runs was 99.3 ± 1.3%, with 71 of the 87 runs giving a radiochemical purity of >99%. The radionuclidic purity of the I-123, obtained as sodium [ 123 I]iodide from Nordion International, was 99.985 ± 0.008%. Bacterial endotoxins, determined by the Limulus amebocyte lysate technique, were below the detectable level of 0.31 EU/mL for all batches of 123 I-MIBG. Sterility tests using both trypticase soy broth and fluid thioglycollate medium were negative for all batches except two, which showed growth of nonpathogenic microorganisms probably introduced during inoculation of the culture medium. 123 I-MIBG has thus been reliably prepared in high yield and excellent purity, and it has proved to be a valuable agent for diagnosis and evaluation of neural crest tumors in both children and adults
Renovascular hypertension screening with iodine-123 orthoiodohippurate
International Nuclear Information System (INIS)
Oppenheim, B.E.; Appledorn, C.R.; Mock, B.H.; Yune, H.Y.; Grim, C.E.
1985-01-01
Screening of 123 hypertensive patients for renovascular disease was carried out through renal studies, performed with iodine-123 ortho-iodohippurate (OIH), consisting of 214 studies performed with high-purity 123 I-OIH and 10 studies performed with 123 I-OIH contaminated with 124 I. Standard dynamic renal images and renogram curves were supplemented by functional renal images generated by computer. For the same radiation dose to the bladder, the number of detected photons with contaminated 123 I-OIH is only about one-third of that for high-purity 123 I-OIH so that for comparable studies one must use at least twice the dose with the former agent as compared with the latter. The study was hampered by erratic delivery of 123 I-OIH, which demonstrated the need for a reliable source
Atmospheric acceleration and Earth-expansion deceleration of the Earth rotation
Directory of Open Access Journals (Sweden)
Wenbin Shen
2017-11-01
Full Text Available Previous studies suggest that tidal friction gives rise to the secular deceleration of the Earth rotation by a quantity of about 2.25 ms/cy. Here we just consider additional contributions to the secular Earth rotation deceleration. Atmospheric solar semi-diurnal tide has a small amplitude and certain amount of phase lead. This periodic global air-mass excess distribution exerts a quasi-constant torque to accelerate the Earth's spin rotation. Using an updated atmospheric tide model, we re-estimate the amounts of this atmospheric acceleration torque and corresponding energy input, of which the associated change rate in LOD (length of day is −0.1 ms/cy. In another aspect, evidences from space-geodesy and sea level rise observations suggest that Earth expands at a rate of 0.35 mm/yr in recent decades, which gives rise to the increase of LOD at rate of 1.0 ms/cy. Hence, if the previous estimate due to the tidal friction is correct, the secular Earth rotation deceleration due to tidal friction and Earth expansion should be 3.15 ms/cy.
Trapped magnetic field of a mini-bulk magnet using YBaCuO at 77 K
Fujimoto, Hiroyuki; Kamijo, Hiroki
2001-09-01
Melt-processed rare earth (RE)123 superconductors have a high Jc at 77 K and high magnetic field. Solidification processes for producing (L)RE123 superconductors and pinning centers in the (L)RE123 matrix are effective for obtaining high Jc, leading to high-field application as a superconducting quasi-permanent bulk magnet with the liquid nitrogen refrigeration. One of the promising applications is a superconducting magnet for the magnetically levitated train. We fabricated a mini-superconducting bulk magnet of 200×100 mm2, consisting of 18 bulks, which are a square 33 mm on a side and 10 mm in thickness, and magnetized the mini-magnet by field cooling. The mini-magnet showed the trapped magnetic field of larger than 0.1 T on the surface of the outer vessel of the magnet. The present preliminary study discusses trapped magnetic field properties of the mini-bulk magnet using YBaCuO superconductors at 77 K.
Pair-density waves, charge-density waves, and vortices in high-Tc cuprates
Dai, Zhehao; Zhang, Ya-Hui; Senthil, T.; Lee, Patrick A.
2018-05-01
A recent scanning tunneling microscopy (STM) experiment reports the observation of a charge-density wave (CDW) with a period of approximately 8a in the halo region surrounding the vortex core, in striking contrast to the approximately 4a period CDWs that are commonly observed in the cuprates. Inspired by this work, we study a model where a bidirectional pair-density wave (PDW) with period 8 is at play. This further divides into two classes: (1) where the PDW is a competing state of the d -wave superconductor and can exist only near the vortex core where the d -wave order is suppressed and (2) where the PDW is the primary order, the so-called "mother state" that persists with strong phase fluctuations to high temperature and high magnetic field and lies behind the pseudogap phenomenology. We study the charge-density wave structures near the vortex core in these models. We emphasize the importance of the phase winding of the d -wave order parameter. The PDW can be pinned by the vortex core due to this winding and become static. Furthermore, the period-8 CDW inherits the properties of this winding, which gives rise to a special feature of the Fourier transform peak, namely, it is split in certain directions. There is also a line of zeros in the inverse Fourier transform of filtered data. We propose that these are key experimental signatures that can distinguish between the PDW-driven scenario from the more mundane option that the period-8 CDW is primary. We discuss the pro's and con's of the options considered above. Finally, we attempt to place the STM experiment in the broader context of pseudogap physics of underdoped cuprates and relate this observation to the unusual properties of x-ray scattering data on CDW carried out to very high magnetic field.
2010-01-01
... 10 Energy 2 2010-01-01 2010-01-01 false Test control. 71.123 Section 71.123 Energy NUCLEAR REGULATORY COMMISSION (CONTINUED) PACKAGING AND TRANSPORTATION OF RADIOACTIVE MATERIAL Quality Assurance § 71.123 Test control. The licensee, certificate holder, and applicant for a CoC shall establish a test...
International Nuclear Information System (INIS)
Tada, Hiroshi; Morooka, Keiichi; Arimoto, Kiyoshi; Matsuo, Takiko; Takagi, Kazue; Yanagawa, Etsuko
1992-01-01
We studied the clinical usefulness of I 123 -IMP SPECT in 50 pediatric patients with CNS disorders, which were categorized into the convulsive disorder group (n=20), the cerebrovascular disorder group (n=10), the acute encephalopathy or CNS infection group (n=10), the metabolic or degenerative disorder group (n=6), the congenital abnormality group (n=2) and the migraine group (n=2). The findings obtained were compared with those of cranial CT. I 123 -IMP SPECT revealed abnormal findings in 45 out of the 50 patients (90%), although cranial CT showed abnormal findings in only 24 patients (48%). This difference was statistically significant (p 123 -IMP SPECT showed focal abnormalities in 26 patients (93%). Moreover in many patients with focal neurological abnormalities, we found focal abnormalities of I 123 -IMP SPECT related with neurological abnormalities of the patients. From these findings, we think I 123 -IMP SPECT might be superior to CT scanning in examining a localized lesion. It was found that in many patients with focal abnormalities in CT scanning, I 123 -IMP SPECT showed larger abnormalities in CT scanning. By using I 123 -IMP SPECT we might be able to study the blood perfusional state surrounding the abnormal area shown by CT. In 3 patients with acute cerebrovascular disorders, I 123 -IMP SPECT revealed abnormal findings 3 to 11 days earlier than cranial CT. I 123 -IMP SPECT might be useful for early recognition of the pathological state. From these experiences, we concluded that I 123 -IMP SPECT was useful for studying the pathophysiology of CNS disorders in children. (author)
40 CFR 123.61 - Approval process.
2010-07-01
... 40 Protection of Environment 21 2010-07-01 2010-07-01 false Approval process. 123.61 Section 123... REQUIREMENTS Program Approval, Revision, and Withdrawal § 123.61 Approval process. (a) After determining that a...; and (6) Briefly outline the fundamental aspects of the State's proposed program, and the process for...
Renal function study using I-123-OIH
International Nuclear Information System (INIS)
Yamashita, Masato; Osaka, Yosio; Aikawa, Ichiro
1989-01-01
Twenty-eight renal function studies were performed in 24 patients with renal diseases with I-123 orthoiodohippurate (I-123 OIH). Neither side effects nor abnormal laboratory values were attributable to I-123 OIH. Imaging with Tc-99m diethylene triaminepentaacetic acid (DTPA) was also performed in 20 patients within one week after I-123 imaging. Findings with I-123 OIH and Tc-99m DTPA were similar in all except for two patients. The two patients had received cadaveric renal transplantation. One patient presented with acute tubular necrosis and the other with chronic renal rejection. In these patients, I-123 imaging showed vascular stricture and Tc-99m imaging showed a decreased glomerular function. Because I-123 OIH and Tc-99m DTPA had different pharmacodynamics, combined use of the two imaging agents may be useful in evaluating renal rejection or acute tubular necrosis. (N.K.)
Energy Technology Data Exchange (ETDEWEB)
Ryding, Erik; Rosen, Ingmar [Department of Clinical Neurophysiology, University Hospital, Lund (Sweden); Lindstroem, Mats; Bosson, Peter; Traeskman-Bendz, Lil [Department of Psychiatry, University Hospital, Lund (Sweden); Braadvik, Bjoern; Grabowski, Martin [Department of Neurology, University Hospital, Lund (Sweden)
2004-08-01
{sup 123}I-{beta}-CIT is a radioactive ligand for single-photon emission computed tomography (SPECT) imaging of the pre-synaptic (transporter) re-uptake sites for dopamine (DAT) and serotonin (5HTT), and it is widely used to visualize monoamine turnover. Since {sup 123}I-{beta}-CIT uptake occurs at 5HTT and DAT sites in conjunction with the presence of freely soluble {sup 123}I-{beta}-CIT in brain tissue, adequate separation of these three components is necessary. However, only partial separation is possible with current methods. Two main strategies have previously been used for {sup 123}I-{beta}-CIT component separation, based on the following considerations: (1) the faster uptake rate for 5HTT compared with DAT enables temporal separation by performing 5HTT imaging at 1-2 h and DAT imaging at 20-24 h; (2) blocking the 5HTT re-uptake with citalopram renders {sup 123}I-{beta}-CIT imaging DAT (non-5HTT) specific. In a new analytical model, we combined these two approaches with methods to isolate the passively dissolved {sup 123}I-{beta}-CIT in brain tissue from the monoamine transporter uptake, and to correct the 5HTT and DAT values for concomitant uptake. The new analytical model was used to study brain 5HTT and DAT in 23 normal subjects, with the aim of clarifying the effect of age and sex. A significant correlation between 5HTT and DAT values was found only in the thalamus, indicating successful component separation. Negative correlations between age and DAT were found for basal ganglia, thalami, brain stem and temporal lobes, but not for the frontal, parietal or occipital regions. No correlation with age was found for 5HTT. We found no sex difference for 5HTT or DAT. (orig.)
Rare-earth doping of high T/sub c/ superconducting perovskites
International Nuclear Information System (INIS)
Mc Kinnon, W.R.; Tarascon, J.M.; Greene, L.H.; Hull, G.W.
1987-01-01
In most superconductors, the magnetic moments of rare-earth (Re) ions interact with the conduction electrons and break the Cooper pairs, supressing or destroying superconductivity. But in the perovskite-based superconductors discovered recently, the rare-earth ions are separated from the copper and oxygen where the superconducting electrons are believed to be located. The authors study the effects of rare-earth doping in both the 40K La/sub 2-x/Sr/sub x/CuO/sub 4-y/ system and 90K YBa/sub 2/Cu/sub 3/O/sub 7-x/ system. In these materials, the RE ions only weakly affect superconductivity, and the effects we do see are more strongly correlated with changes in the volume of the crystal than with the magnetism of the rare earths
Impurity scattering effect on charge transport in high-Tc cuprate junctions
International Nuclear Information System (INIS)
Tanaka, Y.; Asano, Y.; Kashiwaya, S.
2004-01-01
It is known that the zero-bias conductance peak (ZBCP) is expected in tunneling spectra of normal-metal/high-Tc cuprate junctions because of the formation of the midgap Andreev resonant states (MARS) at junction interfaces. In the present review, we report the recent theoretical study of impurity scattering effects on the tunneling spectroscopy. In the former part of the present paper, we discuss impurity effects in normal metal. We calculate tunneling conductance for diffusive normal metal (DN)/high Tc cuprate junctions based on the Keldysh Green's function technique. Besides the ZBCP due to the MARS, we can expect ZBCP caused by the different origin, i.e., the coherent Andreev reflection (CAR) assisted by the proximity effect in DN. Their relative importance depends on the angle a between the interface normal and the crystal axis of high-Tc superconductors. At α = 0, we find the ZBCP by the CAR for low transparent junctions with small Thouless energies in DN; this is similar to the case of diffusive normal metal/insulator/s-wave superconductor junctions. Under increase of α from zero to π/4, the contribution of MARS to ZBCP becomes more prominent and the effect of the CAR is gradually suppressed. Such complex spectral features would be observable in conductance spectra of high-Tc junctions at very low temperatures. In the latter part of our paper, we study impurity effects in superconductors. We consider impurities near the junction interface on the superconductor side. The conductance is calculated from the Andreev and the normal reflection coefficients which are estimated by using the single-site approximation in an analytic calculation and by the recursive Green function method in a numerical simulation. We find splitting of the ZBCP in the presence of the time reversal symmetry. Thus the zero-field splitting of ZBCP in the experiment does not perfectly prove an existence of broken time reversal symmetry state
Striatal uptake of I-123-β-CIT and I-123-IBZM in patients with extrapyramidal symptoms
International Nuclear Information System (INIS)
Bettin, S.; Kaempfer, I.; Seese, A.; Schaefer, A.; Reuter, M.; Loessner, J.; Dietrich, J.; Wagner, A.; Knapp, W.H.
1997-01-01
Aim: This pilot study deals with the question whether characteristic changes in local cerebral dopamine transporter function and D 2 -receptor binding capacity can be shown with SPET, in idiopathic Parkinson syndrome (IPS) and secondary Parkinson syndrome (SPS). Methods: In 16 patients (6 with IPS, 6 with SPS except Wilsons's disease, and 4 with Wilson's disease) SPET studies were performed using I-123-β-CIT and I-123-IBZM and a dual-head gamma camera. Images were obtained 20-24 h and 2 h post injection, respectively. For semiquantitative analysis count density ratios of basal ganglia (BG) and cerebellum (CER) were determined for I-123-β-CIT and ratios between BG and medial frontal cortex (MFC) for I-123-IBZM. Results: The BG/CER ratio in the I-123-β-CIT studies averaged 3.04±0.83 in IPS and 7.73±3.28 in SPS (p [de
Li, Fu; Sutherland, May Kung; Yu, Changpu; Walter, Roland B; Westendorf, Lori; Valliere-Douglass, John; Pan, Lucy; Cronkite, Ashley; Sussman, Django; Klussman, Kerry; Ulrich, Michelle; Anderson, Martha E; Stone, Ivan J; Zeng, Weiping; Jonas, Mechthild; Lewis, Timothy S; Goswami, Maitrayee; Wang, Sa A; Senter, Peter D; Law, Che-Leung; Feldman, Eric J; Benjamin, Dennis R
2018-02-01
Treatment choices for acute myelogenous leukemia (AML) patients resistant to conventional chemotherapies are limited and novel therapeutic agents are needed. IL3 receptor alpha (IL3Rα, or CD123) is expressed on the majority of AML blasts, and there is evidence that its expression is increased on leukemic relative to normal hematopoietic stem cells, which makes it an attractive target for antibody-based therapy. Here, we report the generation and preclinical characterization of SGN-CD123A, an antibody-drug conjugate using the pyrrolobenzodiazepine dimer (PBD) linker and a humanized CD123 antibody with engineered cysteines for site-specific conjugation. Mechanistically, SGN-CD123A induces activation of DNA damage response pathways, cell-cycle changes, and apoptosis in AML cells. In vitro , SGN-CD123A-mediated potent cytotoxicity of 11/12 CD123 + AML cell lines and 20/23 primary samples from AML patients, including those with unfavorable cytogenetic profiles or FLT3 mutations. In vivo , SGN-CD123A treatment led to AML eradication in a disseminated disease model, remission in a subcutaneous xenograft model, and significant growth delay in a multidrug resistance xenograft model. Moreover, SGN-CD123A also resulted in durable complete remission of a patient-derived xenograft AML model. When combined with a FLT3 inhibitor quizartinib, SGN-CD123A enhanced the activity of quizartinib against two FLT3-mutated xenograft models. Overall, these data demonstrate that SGN-CD123A is a potent antileukemic agent, supporting an ongoing trial to evaluate its safety and efficacy in AML patients (NCT02848248). Mol Cancer Ther; 17(2); 554-64. ©2017 AACR . ©2017 American Association for Cancer Research.
2010-07-01
... 32 National Defense 5 2010-07-01 2010-07-01 false PA fees. 701.123 Section 701.123 National... OFFICIAL RECORDS AVAILABILITY OF DEPARTMENT OF THE NAVY RECORDS AND PUBLICATION OF DEPARTMENT OF THE NAVY DOCUMENTS AFFECTING THE PUBLIC DON Privacy Program § 701.123 PA fees. The PA fee schedule is only applicable...
Rapid analysis of some rare earth magnets
Energy Technology Data Exchange (ETDEWEB)
Raoot, K N; Raoot, S; Rukmani Desikan, N [Defence Metallurgical Research Lab., Hyderabad (India)
1978-12-01
A simple complexometric method for the quick analysis of the constituent elements in some quaternary rare earth magnets of the type RE-Co-Cu-Fe and RE-Ni-Cu-Fe is described. The technique is based on a total titration, subsequent release of EDTA from rare earth with ammonium fluoride and that from copper (II) with ascorbic acid and thiourea followed by determination of the excess and liberated EDTA by lead nitrate in a weak acid medium using xylenol orange indicator. In another, aliquot iron (III) and rare earth are first masked with sodium fluoride, and copper (II) with ascorbic acid and thiourea before cobalt (II) or nickel (II) is estimated by back titration. Iron is calculated by difference. The new method yields accurate and reproducible results with error not exceeding 1%. A set of three samples can conveniently be analysed in two hours.
Rapid analysis of some rare earth magnets
International Nuclear Information System (INIS)
Raoot, K.N.; Raoot, Sarala; Rukmani Desikan, N.
1978-01-01
A simple complexometric method for the quick analysis of the constituent elements in some quaternary rare earth magnets of the type RE-Co-Cu-Fe and RE-Ni-Cu-Fe is described. The technique is based on a total titration, subsequent release of EDTA from rare earth with ammonium fluoride and that from copper (II) with ascorbic acid and thiourea followed by determination of the excess and liberated EDTA by lead nitrate in a weak acid medium using xylenol orange indicator. In another, aliquot iron (III) and rare earth are first masked with sodium fluoride, and copper (II) with ascorbic acid and thiourea before cobalt (II) or nickel (II) is estimated by back titration. Iron is calculated by difference. The new method yields accurate and reproducible results with error not exceeding 1%. A set of three samples can conveniently be analysed in two hours. (author)
Dynamics of the Sun-Earth-Moon System
Indian Academy of Sciences (India)
The dynamics of the Sun-Earth-Moon system is discussed with special attention to the effects of. Sun's perturbations on the Moon's orbit around the Earth. Important secular effects are the re- gression of the nodes, the advance of the perigee and the increase in the Moon's mean longitude. We discuss the relationship of the ...
International Nuclear Information System (INIS)
Stoffers, Diederick; Booij, Jan; Bosscher, Lisette; Winogrodzka, Ania; Wolters, Erik C.; Berendse, Henk W.
2005-01-01
Previous studies using dopamine transporter single-photon emission computed tomography (SPECT) to try and distinguish between patients with idiopathic Parkinson's disease (IPD) and patients with atypical parkinsonian syndromes (APS) have mainly focussed on patients with an already established clinical diagnosis of several years' duration. Differences in the pattern of striatal involvement between IPD and APS have been found in only few studies. We hypothesized that distinguishing SPECT features might be most pronounced at an early disease stage, and the purpose of the present study was to investigate this hypothesis. The study included 72 patients with an initial clinical diagnosis of IPD, supported by decreased striatal [ 123 I]β-CIT binding on baseline SPECT. In ten patients, the diagnosis was changed to APS over a mean follow-up period of 62 months. We retrospectively compared the patterns of striatal involvement on the baseline SPECT scans between the group of patients (re)diagnosed with APS and the remaining 62 patients in whom a diagnosis of IPD was maintained. In the group of patients with APS, baseline [ 123 I]β-CIT binding in both caudate nuclei was lower than in the group of patients with IPD. In addition, putamen to caudate binding ratios were higher in the group of APS patients. In spite of these differences, individual binding values showed considerable overlap between the groups. [ 123 I]β-CIT SPECT scanning in early-stage, untreated parkinsonian patients revealed a relative sparing of the caudate nucleus in patients with IPD as compared to patients later (re)diagnosed with APS. Nevertheless, the pattern of striatal involvement appears to have little predictive value for a later re-diagnosis of APS in individual cases. (orig.)
Dual structure in the charge excitation spectrum of electron-doped cuprates
Bejas, Matías; Yamase, Hiroyuki; Greco, Andrés
2017-12-01
Motivated by the recent resonant x-ray scattering (RXS) and resonant inelastic x-ray scattering (RIXS) experiments for electron-doped cuprates, we study the charge excitation spectrum in a layered t -J model with the long-range Coulomb interaction. We show that the spectrum is not dominated by a specific type of charge excitations, but by different kinds of charge fluctuations, and is characterized by a dual structure in the energy space. Low-energy charge excitations correspond to various types of bond-charge fluctuations driven by the exchange term (J term), whereas high-energy charge excitations are due to usual on-site charge fluctuations and correspond to plasmon excitations above the particle-hole continuum. The interlayer coupling, which is frequently neglected in many theoretical studies, is particularly important to the high-energy charge excitations.
Imaging Near-Earth Electron Densities Using Thomson Scattering
2009-01-15
geocentric solar magnetospheric (GSM) coordinates1. TECs were initially computed from a viewing loca- tion at the Sun-Earth L1 Lagrange point2 for both...further find that an elliptical Earth orbit (apogee ~30 RE) is a suitable lower- cost option for a demonstration mission. 5. SIMULATED OBSERVATIONS We
Rare Earth Borohydrides—Crystal Structures and Thermal Properties
Directory of Open Access Journals (Sweden)
Christoph Frommen
2017-12-01
Full Text Available Rare earth (RE borohydrides have received considerable attention during the past ten years as possible hydrogen storage materials due to their relatively high gravimetric hydrogen density. This review illustrates the rich chemistry, structural diversity and thermal properties of borohydrides containing RE elements. In addition, it highlights the decomposition and rehydrogenation properties of composites containing RE-borohydrides, light-weight metal borohydrides such as LiBH4 and additives such as LiH.
Evolution of Mg-5Al-0.4Mn microstructure after rare earth elements addition
Directory of Open Access Journals (Sweden)
A. Żydek
2011-04-01
Full Text Available Mg-5Al-0.4Mn-xRE (x = 0, 1, 2, 3 wt.% magnesium alloys were prepared successfully by casting method. The microstructure wasinvestigated by light microscopy. The influence of rare earth (RE elements on the area fraction of eutectic was analysed. The obtainedresults revealed that the as-cast Mg-5Al-0.4Mn alloy consist of α - Mg matrix and eutectic α + γ (where γ is Mg17Al12. However, whilerare earth elements were added to the Mg-Al type alloy, Al11RE3 precipitates were formed. The amount of the Al11RE3 precipitatesincreased with increasing addition of RE, but the amount of γ - Mg17Al12 decreased.
Dosimetry of iodine-123 for newborn and infant
International Nuclear Information System (INIS)
Guilhem, M.T.; Therain, F.
1987-01-01
Iodine-123 ( 123 I) is a radionuclide of choice of neonatal hypothyroidism diagnosis. It is important to know infant main organs adsorbed doses during a thyroid scan with 123 I. Absorbed doses are already available for adults: for infants, they must be transformed taking account of organs sizes and inter-organs distances. Calculations are done for commercially available 123 I(p,2n) and 123 I(p,5n). Important contamination of 124 I in 123 I(p,2n) increases considerably the absorbed-dose during thyroid scan of a newborn (the ratio 124 I/ 123 I doubles every 15h). For routinely used activities, thyroid absorbed dose, 24 h after end of production, is fifteen times higher with 123 I(p,5n) than with 99m Tc: for one month old child; total body absorbed dose is of the same order of magnitude [fr
Thermal transport in cuprates, cobaltates, and manganites
International Nuclear Information System (INIS)
Berggold, K.
2006-09-01
The subject of this thesis is the investigation of the thermal transport properties of three classes of transition-metal oxides: Cuprates, cobaltates, and manganites. The layered cuprates R 2 CuO 4 with R=La, Pr, Nd, Sm, Eu, and Gd show an anomalous thermal conductivity κ. Two maxima of κ are observed as a function of temperature for a heat current within the CuO 2 planes, whereas for a heat current perpendicular to the CuO 2 planes only a conventional phononic low-temperature maximum of κ is present. Evidence is provided that the high-temperature maximum is caused by heat-carrying excitations on the CuO 2 square lattice. Moreover, it is shown that the complex low-temperature and magnetic-field behavior of κ in Nd 2 CuO 4 is most likely caused by additional phonon scattering rather than by heat-carrying Nd magnons, as it was proposed in the literature. In the cobaltates RCoO 3 with R=La, Pr, Nd, and Eu, a temperature-induced spin-state transition of the Co 3+ ions occurs. It is shown that the additional lattice disorder caused by the random distribution of populated higher spin states causes a large suppression of the thermal conductivity of LaCoO 3 for T>25 K. The effect is much weaker in PrCoO 3 and NdCoO 3 due to the increased spin gap. A quantitative analysis of the responsible mechanisms based on EuCoO 3 as a reference compound is provided. A main result is that the static disorder is sufficient to explain the suppression of κ. No dynamical Jahn-Teller distortion, as proposed in the literature, is necessary to enhance the scattering strength. Below 25 K, k is mainly determined by resonant phonon scattering on paramagnetic impurity levels, e.g. caused by oxygen non-stoichiometry. Such a suppression of the thermal conductivity by resonant scattering processes is e.g. known from Holmium ethylsulfate. This effect is most pronounced in LaCoO 3 , presumably due to magnetic polaron formation. In the doped compounds La 1-x Sr x CoO 3 with 0≤x≤0.25, a large
Coherence and pairing in a doped Mott insulator: application to the cuprates.
Senthil, T; Lee, Patrick A
2009-08-14
The issues of single particle coherence and its interplay with singlet pairing are studied within the slave boson gauge theory of a doped Mott insulator. Prior work by one of us [T. Senthil, Phys. Rev. B 78, 045109 (2008)10.1103/PhysRevB.78.045109] showed that the coherence scale below which Landau quasiparticles emerge is parametrically lower than that identified in the slave boson mean field theory. Here we study the resulting new non-Fermi liquid intermediate temperature regime characterized by a single particle scattering rate that is linear in temperature (T). In the presence of a d-wave pair amplitude, this leads to a pseudogap state with T-dependent Fermi arcs near the nodal direction. Implications for understanding the cuprates are discussed.
Industrial system for producing iodine-123
International Nuclear Information System (INIS)
Brantley, J.C.
1985-01-01
An industrial system to produce iodine-123 required a complex set of steps involving new approaches by the Food and Drug Administration, difficult distribution procedures, and evidence from potential users that either very pure iodine-123 or inexpensive iodine-123 is needed. Industry has shown its willingness to invest in new radionuclides but needs strong evidence as to product potential to justify those investments
Composition and local bonding in RE-Si-M-O-N (M=Mg, Al ; RE=La, Lu) glasses
Energy Technology Data Exchange (ETDEWEB)
Fouquet-Parry, V. [Service de Physique et de Chimie des Surfaces et des Interfaces, DSM/DRECAM/SPCSI, CEA Saclay, 91191 Gif sur Yvette Cedex (France); Paumier, F. [Laboratoire de Metallurgie Physique - UMR 6630 CNRS, Department of Materials Sciences, University of Poitiers (France); Guittet, M.J. [Service de Physique et de Chimie des Surfaces et des Interfaces, DSM/DRECAM/SPCSI, CEA Saclay, 91191 Gif sur Yvette Cedex (France); Gautier-Soyer, M. [Service de Physique et de Chimie des Surfaces et des Interfaces, DSM/DRECAM/SPCSI, CEA Saclay, 91191 Gif sur Yvette Cedex (France)], E-mail: mgautiersoyer@cea.fr; Satet, R.; Hoffmann, M.J. [Institut fuer Keramik im Maschinenbau, Universitaet Karlsruhe (Thailand), Haid-und-Neu-Strasse 7, D 76131 Karlsruhe (Germany); Becher, P.F.; Painter, G.S. [Metals and Ceramics Division, Oak Ridge National Laboratory, Oak Ridge, TN (United States)
2008-05-30
Two series of oxynitride glasses, RE-Si-Mg-O-N (M=Mg, Al ; RE=La, Lu), have been studied by X-Ray photoelectron spectroscopy (XPS). The oxygen 1s photoelectron lineshape reveals a striking difference depending on the rare earth, both in the Mg series and in the Al series. Specifically, the oxygen 1s photoelectron lines of the La doped glasses are broader than the ones of the Lu doped glasses. This result is an experimental evidence that Lu has a larger affinity for oxygen versus nitrogen than La, as theoretically predicted by the first-principles calculations by Painter et al.
Electromagnetic response in kinetic energy driven cuprate superconductors: Linear response approach
International Nuclear Information System (INIS)
Krzyzosiak, Mateusz; Huang, Zheyu; Feng, Shiping; Gonczarek, Ryszard
2010-01-01
Within the framework of the kinetic energy driven superconductivity, the electromagnetic response in cuprate superconductors is studied in the linear response approach. The kernel of the response function is evaluated and employed to calculate the local magnetic field profile, the magnetic field penetration depth, and the superfluid density, based on the specular reflection model for a purely transverse vector potential. It is shown that the low temperature magnetic field profile follows an exponential decay at the surface, while the magnetic field penetration depth depends linearly on temperature, except for the strong deviation from the linear characteristics at extremely low temperatures. The superfluid density is found to decrease linearly with decreasing doping concentration in the underdoped regime. The problem of gauge invariance is addressed and an approximation for the dressed current vertex, which does not violate local charge conservation is proposed and discussed.
Infrared absorption spectra of various doping states in cuprate superconductors
International Nuclear Information System (INIS)
Yonemitsu, K.; Bishop, A.R.; Lorenzana, J.
1992-01-01
Doping states in a two-dimensional three-band extended Peierls-Hubbard model was investigated within inhomogeneous Hartree-Fock and random phase approximation. They are very sensitive to small changes of interaction parameters and their distinct vibrational and optical absorption spectra can be used to identify different doping states. For electronic parameters relevant to cuprate superconductors, as intersite electron-phonon interaction strength increases, the doping state changes from a Zhang-Rice state to a covalent molecular singlet state accompanied by local quenching of the Cu magnetic moment and large local lattice distortion in an otherwise undistorted antiferromagnetic background. In a region where both intersite electron-phonon interaction and on-site electron-electron repulsion are large, we obtain new stable global phases including a bond-order-wave state and a mixed state of spin-Peierls bonds and antiferromagnetic Cu spins, as well as many metastable states. Doping in the bond-order-wave region induces separation of spin and charge. 9 refs
Redistribution of phase fluctuations in a periodically driven cuprate superconductor
Energy Technology Data Exchange (ETDEWEB)
Hoeppner, Robert; Zhu, Beilei; Rexin, Tobias [Zentrum fuer Optische Quantentechnologien und Institut fuer Laserphysik, Hamburg (Germany); Mathey, Ludwig [Zentrum fuer Optische Quantentechnologien und Institut fuer Laserphysik, Hamburg (Germany); The Hamburg Centre for Ultrafast Imaging, Hamburg (Germany); Cavalleri, Andrea [Max Planck Institute for the Structure and Dynamics of Matter, Hamburg (Germany); Department of Physics, Oxford University, Clarendon Laboratory, Parks Road, Oxford (United Kingdom)
2015-07-01
We study the thermally fluctuating state of a bi-layer cuprate superconductor under the periodic action of a staggered field oscillating at optical frequencies. This analysis distills essential elements of the recently discovered phenomenon of light enhanced coherence in YBCO, which was achieved by periodically driving infrared active apical oxygen distortions. The effect of a staggered periodic perturbation is studied using a Langevin description of driven, coupled Josephson junctions, which represent two neighboring pairs of layers and their two plasmons. We demonstrate that the external driving leads to a suppression of phase fluctuations of the low-energy plasmon, an effect which is amplified via the resonance of the high energy plasmon, with a striking suppression of the low-energy fluctuations, as visible in the power spectrum. We also find that this effect acts onto the in-plane fluctuations, which are reduced on long length scales and we discuss the behavior of vortices in the ab-planes and across the weakly coupled junctions.
Prospects for trivalent rare earth molecular vapor lasers for fusion
International Nuclear Information System (INIS)
Krupke, W.F.
1976-01-01
The dynamical properties of three types of RE 3+ molecular vapors were considered: (1) rare earth trihalogens, (2) rare earth trihalogens complexed with transition metal trihalogens, and (3) rare earth chelates. Radiative and nonradiative (unimolecular and bimolecular) transition probabilities have been calculated using phenomenological models predicted on the unique electronic structure of the triply ionized RE ion (well shielded ground electronic configuration of equivalent of electrons). Although all the lanthanide ions have been treated in some detail, specific results are presented for the Nd 3+ and Tb 3+ ions to illustrate the systematics of these vapors as a class of new laser media. Once verified, these phenomenological models will provide a powerful tool for the directed experimental exploration of these systems. Because of the structural similarity to the triply ionized actinides, comments offered here for the lanthanide rare earth series generally apply to gaseous actinide lasers which are also under consideration
18 CFR 284.123 - Rates and charges.
2010-04-01
... 18 Conservation of Power and Water Resources 1 2010-04-01 2010-04-01 false Rates and charges. 284.123 Section 284.123 Conservation of Power and Water Resources FEDERAL ENERGY REGULATORY COMMISSION... AUTHORITIES Certain Transportation by Intrastate Pipelines § 284.123 Rates and charges. (a) General rule...
Energy Technology Data Exchange (ETDEWEB)
Dabre, K.V. [Department of Physics, Arts, Commerce and Science College, Koradi, Nagpur 441111 (India); Park, K. [Faculty of Nanotechnology and Advanced Materials Engineering, Sejong University, Seoul 143-747 (Korea, Republic of); Dhoble, S.J., E-mail: sjdhoble@rediffmail.com [Department of Physics, R.T.M. Nagpur University, Nagpur 440033 (India)
2014-12-25
Graphical abstract: CIE chromaticity coordinate diagram (1931) indicating different colors of Sr{sub 2}ZnWO{sub 6}:RE{sup 3+} (RE = Eu (a), Dy (b and c), Sm (d–f) and Pr (g and h)) phosphor under different excitation 466 nm (a), 312 nm (b), 454 nm (c), 313 nm (d), 408 nm (e), 482 nm (f), 315 nm (g) and 450 nm (h). - Highlights: • Microcrystalline Sr{sub 2}ZnWO{sub 6}:RE{sup 3+} (RE = Eu, Dy, Sm and Pr) phosphors were synthesized by solid state method. • Photoluminescence properties of phosphor were investigated. • Color of the phosphor for different excitation has been verified by chromaticity diagram. • The host absorption and energy transfer were investigated. - Abstract: The novel microcrystalline Sr{sub 2}ZnWO{sub 6}:RE{sup 3+} (RE = Eu, Dy, Sm and Pr) phosphors were synthesized by solid-state reaction method at 1250 °C and their photoluminescence properties were investigated. The Eu{sup 3+} and Dy{sup 3+} activated phosphors show intense red (616 nm) and yellow (574 nm) emission respectively; which indicate that the rare earth ions are substituted at non-centrosymmetric site in the host lattice. Near white (Dy{sup 3+}) and reddish-orange (Sm{sup 3+}) emissions of rare earth ions in the host lattice show strong host absorption and energy transfer from the host to activator ion. Pr{sup 3+} activated phosphor shows a series of emission peaks in the visible region with the most intense peak in the blue region at 491 and 499 nm.
Energy Technology Data Exchange (ETDEWEB)
Johnston, S.; /Waterloo U. /SLAC; Lee, W.S.; /Stanford U., Geballe Lab. /SLAC; Nowadnick, E.A.; /SLAC /Stanford U., Phys. Dept.; Moritz, B.; /SLAC /North Dakota U.; Shen, Z.-X.; /Stanford U., Geballe Lab. /SLAC /Stanford U., Phys. Dept. /Stanford U., Appl. Phys. Dept.; Devereaux, T.P.; /Stanford U., Geballe Lab. /SLAC
2010-02-15
In this paper we present a review of bosonic renormalization effects on electronic carriers observed from angle-resolved photoemission spectra in the cuprates. Specifically, we discuss the viewpoint that these renormalizations represent coupling of the electrons to the lattice and review how materials dependence, such as the number of CuO{sub 2} layers, and doping dependence can be understood straightforwardly in terms of several aspects of electron-phonon coupling in layered correlated materials.
2010-10-01
... 49 Transportation 1 2010-10-01 2010-10-01 false Restrooms. 38.123 Section 38.123 Transportation Office of the Secretary of Transportation AMERICANS WITH DISABILITIES ACT (ADA) ACCESSIBILITY... measured to the top of the toilet seat. Seats shall not be sprung to return to a lifted position. (3) A...
19 CFR 123.31 - Merchandise in transit.
2010-04-01
... 19 Customs Duties 1 2010-04-01 2010-04-01 false Merchandise in transit. 123.31 Section 123.31... TREASURY CUSTOMS RELATIONS WITH CANADA AND MEXICO Shipments in Transit Through the United States § 123.31 Merchandise in transit. (a) From one contiguous country to another. Merchandise may be transported in transit...
19 CFR 123.21 - Merchandise in transit.
2010-04-01
... 19 Customs Duties 1 2010-04-01 2010-04-01 false Merchandise in transit. 123.21 Section 123.21... TREASURY CUSTOMS RELATIONS WITH CANADA AND MEXICO Shipments in Transit Through Canada or Mexico § 123.21 Merchandise in transit. (a) Status. Merchandise may be transported from one port to another in the United...
29 CFR 780.123 - Raising of bees.
2010-07-01
... 29 Labor 3 2010-07-01 2010-07-01 false Raising of bees. 780.123 Section 780.123 Labor Regulations... Raising of Livestock, Bees, Fur-Bearing Animals, Or Poultry § 780.123 Raising of bees. The term “raising of * * * bees” refers to all of those activities customarily performed in connection with the...
Cermets based on rhenium and rare earth element oxides
International Nuclear Information System (INIS)
Varfolomeev, M.B.; Velichko, A.V.; Zajtseva, L.L.; Shishkov, N.V.
1977-01-01
The reduction of perrhenates of rare earth elements and of yttrium by hydrogen and the subsequent sintering have yielded cermets based on rhenium and rare earth element oxides inherent in which are more disperse and homogeneous structures than those of the ''molecular'' rare earth element-Tc cermets. The dispersity of cermets increases in the rare earth elements series from La to Lu. The microhardness of the Re phase in cermets is 490 kgf/mm 2 ; the total microhardness of a cermet is substantially higher
Model Evidence of a Superconducting State with a Full Energy Gap in Small Cuprate Islands
Black-Schaffer, Annica M.; Golubev, Dmitri S.; Bauch, Thilo; Lombardi, Floriana; Fogelström, Mikael
2013-05-01
We investigate subdominant order parameters stabilizing at low temperatures in nanoscale high-Tc cuprate islands, motivated by the recent observation of a fully gapped state in nanosized YBa2Cu3O7-δ [D. Gustafsson et al., Nature Nanotech. 8, 25 (2013)]. Using complementary quasiclassical and tight-binding Bogoliubov-de Gennes methods, we show on distinctly different properties dependent on the symmetry being dx2-y2+is or dx2-y2+idxy. We find that a surface-induced dx2-y2+is phase creates a global spectroscopic gap which increases with an applied magnetic field, consistent with experimental observation.
Imandoust, Aidin
The origin of texture components associated with rare-earth (RE) element additions in wrought magnesium (Mg) alloys is a long-standing problem in magnesium technology. The objective of this research is to identify the mechanisms accountable for rare-earth texture during dynamic recrystallization (DRX). Towards this end, we designed binary Mg-Cerium and Mg-Gadolinium alloys along with complex alloy compositions containing zinc, yttrium and Mischmetal. Binary alloys along with pure Mg were designed to individually investigate their effects on texture evolutions, while complex compositions are designed to develop randomized texture, and be used in automotive and aerospace applications. We selected indirect extrusion to thermo-mechanically process our materials. Different extrusion ratios and speeds were designed to produce partially and fully recrystallized microstructures, allowing us to analyze DRX from its early stages to completion. X-ray diffraction, electron backscattered diffraction (EBSD) and transmission electron microscopy (TEM) were used to conduct microstructure and texture analyses. Our analyses revealed that rare-earth elements in zinc-containing magnesium alloys promote discontinuous dynamic recrystallization at the grain boundaries. During nucleation, the effect of rare earth elements on orientation selection was explained by the concomitant actions of multiple Taylor axes in the same grain. Isotropic grain growth was observed due to rare earth elements segregating to grain boundaries, which lead to texture randomization. The nucleation in binary Mg-RE alloys took place by continuous formation of necklace structures. Stochastic relaxation of basal and non-basal dislocations into low-angle grain boundaries produced chains of embryos with nearly random orientations. Schmid factor analysis showed a lower net activation of dislocations in RE textured grains compared to ones on the other side of the stereographic triangle. Lower dislocation densities within
International Nuclear Information System (INIS)
Helm, Toni
2013-01-01
In the present work the normal-state properties of the electron-doped cuprate superconductor Nd 2-x Ce x CuO 4 (NCCO) are investigated for a broad doping range, covering almost the whole phase diagram of this material. Magnetotransport measurements in the world's highest non-destructive magnetic fields were used as a spectroscopic tool for probing the electronic structure of single-crystalline NCCO as a function of the carrier concentration x. Quantum and semiclassical oscillations in the magnetoresistance provided new insights into various properties of the Fermi surface and the nature of the ground state in the system. The detailed investigations of the field- and temperature-dependent transport and its dependence on the field orientation have revealed a close correlation between symmetry-breaking ordering instabilities and the superconducting state.
Energy Technology Data Exchange (ETDEWEB)
Helm, Toni
2013-09-18
In the present work the normal-state properties of the electron-doped cuprate superconductor Nd{sub 2-x}Ce{sub x}CuO{sub 4} (NCCO) are investigated for a broad doping range, covering almost the whole phase diagram of this material. Magnetotransport measurements in the world's highest non-destructive magnetic fields were used as a spectroscopic tool for probing the electronic structure of single-crystalline NCCO as a function of the carrier concentration x. Quantum and semiclassical oscillations in the magnetoresistance provided new insights into various properties of the Fermi surface and the nature of the ground state in the system. The detailed investigations of the field- and temperature-dependent transport and its dependence on the field orientation have revealed a close correlation between symmetry-breaking ordering instabilities and the superconducting state.
Energy Technology Data Exchange (ETDEWEB)
Helm, Toni
2013-09-18
In the present work the normal-state properties of the electron-doped cuprate superconductor Nd{sub 2-x}Ce{sub x}CuO{sub 4} (NCCO) are investigated for a broad doping range, covering almost the whole phase diagram of this material. Magnetotransport measurements in the world's highest non-destructive magnetic fields were used as a spectroscopic tool for probing the electronic structure of single-crystalline NCCO as a function of the carrier concentration x. Quantum and semiclassical oscillations in the magnetoresistance provided new insights into various properties of the Fermi surface and the nature of the ground state in the system. The detailed investigations of the field- and temperature-dependent transport and its dependence on the field orientation have revealed a close correlation between symmetry-breaking ordering instabilities and the superconducting state.
Clinical utility of N-isopropyl-p-[123I] iodoamphetamine (123I-IMP) for SPECT in epileptic children
International Nuclear Information System (INIS)
Taki, Kuniyasu; Seto, Hikaru; Futatsuya, Ryusuke; Kakishita, Masao; Seki, Hiroyasu.
1989-01-01
A regional cerebral perfusion study was performed in epileptic children using single photon emission computed tomography (SPECT) and N-isopropyl-p-[ 123 I] iodoamphetamine ( 123 I-IMP). A total of 22 patients with epilepsy underwent both a 123 I-IMP brain perfusion study and X-ray CT. Eighteen had positive and four had negative perfusion study results. Of the eighteen patients with positive perfusion study results, two were positive on X-ray CT. In these two patients, the areas of perfusion defects were larger than those of low density on X-ray CT. In only four patients did the areas of perfusion defects correspond to the sites of abnormal EEG. In conclusion, 123 I-IMP perfusion study is of great clinical value in pediatric epileptic cases. (author)
Production of 123 I for medical diagnosis application
International Nuclear Information System (INIS)
Britto, J.L.Q. de.
1982-01-01
A method for production of carrier free 123 I with high radionuclidic purity in which the processing is done remotely was developed at Instituto de Engenharia Nuclear in Rio de Janeiro. The 123 I is produced in the decay of 123 Xe which is obtained through the reaction 122 Te ( 3 He, 2 n) 123 Xe with 30 MeV 3 He beams of IEN's variable energy cyclotron. The irradiated natural Te O 2 target is heated in a furnace at 675 0 C and the diffused out 123 Xe is adsorbed in a copper trap maintained at -196 0 C. The 123 Xe is allowed to decay during 6.3 hours and the 123 I produced washed out of the trap with a 0.1 N solution of NaOH. All the process is remotely controlled by using electric and pneumatic systems as well as manipulators and tongs. The quality control was achieved by atomic absorption and gamma-ray spectroscopy. (author)
Thermal transport in cuprates, cobaltates, and manganites
Energy Technology Data Exchange (ETDEWEB)
Berggold, K.
2006-09-15
The subject of this thesis is the investigation of the thermal transport properties of three classes of transition-metal oxides: Cuprates, cobaltates, and manganites. The layered cuprates R{sub 2}CuO{sub 4} with R=La, Pr, Nd, Sm, Eu, and Gd show an anomalous thermal conductivity {kappa}. Two maxima of {kappa} are observed as a function of temperature for a heat current within the CuO{sub 2} planes, whereas for a heat current perpendicular to the CuO{sub 2} planes only a conventional phononic low-temperature maximum of {kappa} is present. Evidence is provided that the high-temperature maximum is caused by heat-carrying excitations on the CuO{sub 2} square lattice. Moreover, it is shown that the complex low-temperature and magnetic-field behavior of {kappa} in Nd{sub 2}CuO{sub 4} is most likely caused by additional phonon scattering rather than by heat-carrying Nd magnons, as it was proposed in the literature. In the cobaltates RCoO{sub 3} with R=La, Pr, Nd, and Eu, a temperature-induced spin-state transition of the Co{sup 3+} ions occurs. It is shown that the additional lattice disorder caused by the random distribution of populated higher spin states causes a large suppression of the thermal conductivity of LaCoO{sub 3} for T>25 K. The effect is much weaker in PrCoO{sub 3} and NdCoO{sub 3} due to the increased spin gap. A quantitative analysis of the responsible mechanisms based on EuCoO{sub 3} as a reference compound is provided. A main result is that the static disorder is sufficient to explain the suppression of {kappa}. No dynamical Jahn-Teller distortion, as proposed in the literature, is necessary to enhance the scattering strength. Below 25 K, k is mainly determined by resonant phonon scattering on paramagnetic impurity levels, e.g. caused by oxygen non-stoichiometry. Such a suppression of the thermal conductivity by resonant scattering processes is e.g. known from Holmium ethylsulfate. This effect is most pronounced in LaCoO{sub 3}, presumably due to
Phonon anomalies in trilayer high-Tc cuprate superconductors
International Nuclear Information System (INIS)
Dubroka, Adam; Munzar, Dominik
2004-01-01
We present an extension of the model proposed recently to account for dramatic chAes below T c (anomalies) of some c-axis polarized infrared-active phonons in bilayer cuprate superconductors, that applies to trilayer high-T c compounds. We discuss several types of phonon anomalies that can occur in these systems and demonstrate that our model is capable of explaining the spectral chAes occurring upon entering the superconducting state in the trilayer compound Tl 2 Ba 2 Ca 2 Cu 3 O 10 . The low-temperature spectra of this compound obtained by Zetterer and coworkers display an additional broad absorption band, similar to the one observed in underdoped YBa 2 Cu 3 O 7-δ and Bi 2 Sr 2 CaCu 2 O 8 . In addition, three phonon modes are strongly anomalous. We attribute the absorption band to the transverse Josephson plasma resonance, similar to that of the bilayer compounds. The phonon anomalies are shown to result from a modification of the local fields induced by the formation of the resonance. The spectral chAes in Tl 2 Ba 2 Ca 2 Cu 3 O 10 are compared with those occurring in Bi 2 Sr 2 Ca 2 Cu 3 O 10 , reported recently by Boris and coworkers
Magnetic excitations and amplitude fluctuations in insulating cuprates
Chelwani, N.; Baum, A.; Böhm, T.; Opel, M.; Venturini, F.; Tassini, L.; Erb, A.; Berger, H.; Forró, L.; Hackl, R.
2018-01-01
We present results from light scattering experiments on three insulating antiferromagnetic cuprates, YBa2Cu3O6.05 , Bi2Sr2YCu2O8 +δ , and La2CuO4 as a function of polarization and excitation energy using samples of the latest generation. From the raw data we derive symmetry-resolved spectra. The spectral shape in B1 g symmetry is found to be nearly universal and independent of excitation energy. The spectra agree quantitatively with predictions by field theory [Eur. Phys. J. B 88, 237 (2015), 10.1140/epjb/e2015-60438-1] facilitating the precise extraction of the Heisenberg coupling J . In addition, the asymmetric lineshape on the high-energy side is found to be related to amplitude fluctuations of the magnetization. In La2CuO4 alone, minor contributions from resonance effects may be identified. The spectra in the other symmetries are not universal. The variations may be traced back to weak resonance effects and extrinsic contributions. For all three compounds we find support for the existence of chiral excitations appearing as a continuum in A2 g symmetry having an onset slightly below 3 J . In La2CuO4 an additional isolated excitation appears on top of the A2 g continuum.
Directory of Open Access Journals (Sweden)
Yucel Yildirim
2011-09-01
Full Text Available A generic theory of the quasiparticle superconducting gap in underdoped cuprates is derived in the strong-coupling limit, and found to describe the experimental “second gap” in absolute scale. In drastic contrast to the standard pairing gap associated with Bogoliubov quasiparticle excitations, the quasiparticle gap is shown to originate from anomalous kinetic (scattering processes, with a size unrelated to the pairing strength. Consequently, the k dependence of the gap deviates significantly from the pure d_{x^{2}-y^{2}} wave of the order parameter. Our study reveals a new paradigm for the nature of the superconducting gap, and is expected to reconcile numerous apparent contradictions among existing experiments and point toward a more coherent understanding of high-temperature superconductivity.
Energy Technology Data Exchange (ETDEWEB)
Ahlers, Mareike
2010-02-22
During this work rare earth solvates with nitrate and perchlorate anions have been investigated. All compounds have been structurally characterized and analyzed using thermal gravimetric analysis. The decomposition residues were analyzed using powder diffraction methods. Almost all compounds showed a characteristically intense exothermic decomposition step during the thermal decomposition, most likely caused by an intramolecular redox reaction between the nitrate or perchlorate anion respectively and the organic solvent molecules. The nitrates RE(NO{sub 3}){sub 3}(CH(OCH{sub 3}){sub 3}){sub 2} (RE = Sm, Eu) were isolated and characterized for the first time as the intermediate of the dehydration reaction with trimethyl orthoformate. The known compound group of dimethoxyethane solvates was then expanded with RE(NO{sub 3}){sub 3}(O{sub 2}C{sub 4}H{sub 10}) (RE = La, Sm, Eu). Considering the possible use as precursor material the already described neodymium compound is also discussed. The thermal decomposition of these compounds yields the respective cubic rare earth oxide and shows the typical intense exothermic decomposition reaction. A variety of different precursor system based on nitrate solvates for the deposition of rare earth oxide layers on a silicon surface was developed and investigated in collaboration with the group of Prof. Dr. Al-Shamery (Univ. Oldenburg). Ultra thin films on a H-Si(111) surface were obtained via the deposition of the precursor, which was dissolved in organic solvents. An oxide layer was detected after the heating of the sample. The film thickness was measured as < 10 nm, whereas the thickness of the film was controlled by the concentration of the precursor solution. Sm(ClO{sub 4}){sub 3}(CH(OCH{sub 3}){sub 3}){sub 3} was isolated and characterized for the first time as the intermediate of the dehydration reaction with trimethyl orthoformate. Eu(ClO{sub 4}){sub 3}(CH(OCH{sub 3}){sub 3}){sub 2}(MeOH){sub 2} was obtained without
Sensing Using Rare-Earth-Doped Upconversion Nanoparticles
Hao, Shuwei; Chen, Guanying; Yang, Chunhui
2013-01-01
Optical sensing plays an important role in theranostics due to its capability to detect hint biochemical entities or molecular targets as well as to precisely monitor specific fundamental psychological processes. Rare-earth (RE) doped upconversion nanoparticles (UCNPs) are promising for these endeavors due to their unique frequency converting capability; they emit efficient and sharp visible or ultraviolet (UV) luminescence via use of ladder-like energy levels of RE ions when excited at near ...
Analysis of heavy alloying elements segregation in gravity cast experimental Mg-Al-Zn-RE alloy
Directory of Open Access Journals (Sweden)
A. Żydek
2010-01-01
Full Text Available Microstructure of experimental AZ91 alloy with an addition of rare earth elements (RE at a level of 4 wt.% was examined by means of light microscopy. The investigated AZ91 + 4 wt.% RE alloy was fabricated by adding cerium rich mish metal to molten commercial AZ91 alloy. In the microstructure of the resulting alloy, besides α solid solution, α + γ eutectic and discontinuous precipitates of γ phase, also the Al11RE3 phase with needle-like morphology and the polygonal Al10RE2Mn7 phase were revealed. No segregation of rare earth elements was found in the investigated gravity cast alloy, which was confirmed by statistical analysis of cerium concentrations in selected parts of the cast. Similar results were obtained for manganese. Ce and Mn concentrations were determined by a spectrophotometric method.
Simulation of precipitation and strengthening in MG-RE alloys
Liu, Hong
2017-01-01
Magnesium - rare earth (Mg-RE) alloys have received considerable attention in the past decades for wider applications in the aerospace industry due to their relatively high strength and excellent creep resistance. Most rare-earth containing magnesium alloys, such as Mg-Y, Mg-Gd, and Mg-Y-Nd, are precipitation hardenable. A technical barrier to the wider applications of such alloys is the lack of a sufficiently large age hardening response. To further improve this response, an improved underst...
RITD - Re-entry: Inflatable Technology Development in Russian Collaboration
Heilimo, J.; Harri, A.-M.; Aleksashkin, S.; Koryanov, V.; Arruego, I.; Schmidt, W.; Haukka, H.; Finchenko, V.; Martynov, M.; Ostresko, B.; Ponomarenko, A.; Kazakovtsev, V.; Martin, S.; Siili, T.
2014-04-01
A new generation of inflatable Entry, Descent and Landing System (EDLS) for Mars has been developed. It is used in both the initial atmospheric entry and atmospheric descent before the semi-hard impact of the penetrator into Martian surface. The EDLS applicability to Earth's atmosphere is studied by the EU/RITD [1] project. Project focuses on the analysis and tests of the transonic behaviour of this compact and light weight payload entry system at the Earth re-entry.
Rhenium Complexes Based on 2-Pyridyl-1,2,3-triazole Ligands: A New Class of CO2 Reduction Catalysts.
Ching, H Y Vincent; Wang, Xia; He, Menglan; Perujo Holland, Noemi; Guillot, Régis; Slim, Cyrine; Griveau, Sophie; Bertrand, Hélène C; Policar, Clotilde; Bedioui, Fethi; Fontecave, Marc
2017-03-06
A series of [Re(N^N)(CO) 3 (X)] (N^N = diimine and X = halide) complexes based on 4-(2-pyridyl)-1,2,3-triazole (pyta) and 1-(2-pyridyl)-1,2,3-triazole (tapy) diimine ligands have been prepared and electrochemically characterized. The first ligand-based reduction process is shown to be highly sensitive to the nature of the isomer as well as to the substituents on the pyridyl ring, with the peak potential changing by up to 700 mV. The abilities of this class of complexes to catalyze the electroreduction and photoreduction of CO 2 were assessed for the first time. It is found that only Re pyta complexes that have a first reduction wave with a peak potential at ca. -1.7 V vs SCE are active, producing CO as the major product, together with small amounts of H 2 and formic acid. The catalytic wave that is observed in the CVs is enhanced by the addition of water or trifluoroethanol as a proton source. Long-term controlled potential electrolysis experiments gave total Faradaic yield close to 100%. In particular, functionalization of the triazolyl ring with a 2,4,6-tri-tert-butylphenyl group provided the catalyst with a remarkable stability.
International Nuclear Information System (INIS)
Chu, C.W.; Hor, P.H.; Lin, J.G.; Xiong, Q.; Huang, Z.J.; Meng, R.L.; Xue, Y.Y.; Jean, Y.C.
1991-01-01
The superconducting transition temperature (T c ) has been measured in YBa 2 Cu 3 O 6.7 , YBa 2 Cu 3 O 7 , Y 2 Ba 4 Cu 7 O 15 , YBa 2 Cu 4 O 8 , Tl 2 Ba 2 Ca n-1 Cu n O n+4-δ , La 2-x Sr x CuO 4 , and La 2-x Ba x CuO 4 under high pressures. The pressure effect on the positron lifetime (τ) has also been determined in the first four compounds. Based on these and other high pressure data, the authors suggest that (1) all known cuprate high temperature superconductors (HTS's) may be no more than mere modifications of either 214-T, 214-T', 123, or a combination of 214-T' and 123, (2) a nonmonotonic T c -behavior may govern the T c -variation of all hole cuprate HTS's and (3) pressure can induce charge transfer leading to a T c -change. The implications of these suggestions will also be discussed
Evolution des quasiparticules nodales du cuprate supraconducteur YBa2Cu3Oy en conductivite thermique
Rene de Cotret, Samuel
Ce memoire presente des mesures de conductivite thermique sur les supraconducteurs YBCO et Tl-2201 afin de statuer sur la presence possible d'un point critique quantique (QCP) dans le diagramme de phase de cuprates. Ce point critique quantique serait a l'origine de la reconstruction de la surface de Fermi, d'un large cylindre de trous en de petites poches de trous et d'electrons. La conductivite thermique dans le regime T → 0 permet d'extraire une quantite purement electronique liee aux vitesses de Fermi et du gap, au noeud. Une discontinuite dans cette quantite pourrait signaler la traversee du dopage critique qui reconstruit la surface de Fermi. Plusieurs sondes experimentales distinguent une transition de phase ou un crossover a T* a temperature finie. D'autres sondes mettent en evidence une transition de phase sous l'effet d'un champ magnetique. La presence ou non de cet ordre, a temperature et champ magnetique nul questionne la communaute depuis plusieurs annees. Dans cette etude, nous detectons une variation brusque de kappa0/T a p = 0.18 dans YBCO et a p = 0.20 dans Tl-2201. Ces sauts sont interpretes comme un signe de la transition a temperature nulle et sont en faveur d'un QCP. Le manque de donnees d'un meme materiau a ces dopages ne permet pas de valider hors de tout doute l'existence d'un point critique quantique. Le modele theorique YRZ decrit aussi bien les donnees de conductivite thermique. Des pistes de travaux experimentaux a poursuivre sont proposees pour determiner la presence ou non du QCP de facon franche. Mots-cles : Supraconducteurs, cuprates, conductivite thermique, point critique quantique.
International Nuclear Information System (INIS)
Uchiyama, Mayuki; Sue, Hironari; Fukumitsu, Nobuyoshi; Mori, Yutaka; Kawakami, Kenji
1997-01-01
123 I-Iomazenil ( 123 I-IMZ) and 123 I-IMP imaging were performed in 5 patients with anxiety disorder (PAD) and 6 normal volunteers (NV). On 123 I-IMZ delayed imaging, the 2 PAD showed abnormally decreased findings. In anxiety disorder, decreased accumulation on 123 I-IMZ delayed images was seen in left hippocampus and parahippocampal gyrus in one patient, in right frontal and temporal lobe and left occipital pole in the other. Compared with NV, PAD had lower 123 I-IMZ uptake on delayed image in right upper and left lower frontal cortices, indicating the involvement of the benzodiazepine receptor complex in anxiety disorder. Compared with grading for anxiety disorder with Hamilton anxiety scale (HAS) and delayed to early count ratios of 123 I-IMZ, negative correlation (R 123 I-IMP image, positive correlation (R>0.7) was recognized in the hippocampus, the parahippocampal gyrus, the lower outer temporal cortex and the lower frontal cortex. (author)
RE-Ba-Cu-O for high functional superconducting permanent magnet
International Nuclear Information System (INIS)
Yoo, S.I.; Higuchi, T.; Sakai, N.; Murakami, M.; Fujimoto, H.
1998-01-01
Among various potential applications of melt-textured RE-Ba-Cu-O (REBCO, RE: rare earth elements) superconductors, we have examined the bulk application as the superconducting permanent magnet, especially for the magnetically-levitated (MAGLEV) train. Compared with Y-Ba-Cu-O (YBCO), oxygen-controlled melt-growth (OCMG)-processed LREBCO (LRE: light rare earth elements) bulk superconductors are more promising for this application because of larger critical current density (J c ) values in high field and higher irreversibility field (B irr ) within the range of the liquid nitrogen refrigeration (63-77 K), implying that even higher trapped fields (B t ) are achievable in principle. In this paper, material requirements of superconducting bulks for the MAGLEV train are first presented and then processing aspects for the fabrication of good LREBCO bulks are described. (orig.)
40 CFR 123.3 - Coordination with other programs.
2010-07-01
... 40 Protection of Environment 21 2010-07-01 2010-07-01 false Coordination with other programs. 123.3 Section 123.3 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) WATER PROGRAMS STATE PROGRAM REQUIREMENTS General § 123.3 Coordination with other programs. Issuance of State permits...
Labeling of indocyanine green with carrier-free iodine-123
International Nuclear Information System (INIS)
Ansari, A.N.; Lambrecht, R.M.; Redvanly, C.S.; Wolf, A.P.
1976-01-01
The method is described for labeling indocyanine green (ICG) with carrier-free iodine-123 by condensing xenon-123 on crystals of ICG followed by permitting decay of the 123 Xe a sufficient length of time to produce 123 I-electronically excited ions and atoms which subsequently label ICG. 4 claims, no drawings
Quantitative SPECT reconstruction of iodine-123 data
International Nuclear Information System (INIS)
Gilland, D.R.; Jaszczak, R.J.; Greer, K.L.; Coleman, R.E.
1991-01-01
Many clinical and research studies in nuclear medicine require quantitation of iodine-123 ( 123 I) distribution for the determination of kinetics or localization. The objective of this study was to implement several reconstruction methods designed for single-photon emission computed tomography (SPECT) using 123 I and to evaluate their performance in terms of quantitative accuracy, image artifacts, and noise. The methods consisted of four attenuation and scatter compensation schemes incorporated into both the filtered backprojection/Chang (FBP) and maximum likelihood-expectation maximization (ML-EM) reconstruction algorithms. The methods were evaluated on data acquired of a phantom containing a hot sphere of 123 I activity in a lower level background 123 I distribution and nonuniform density media. For both reconstruction algorithms, nonuniform attenuation compensation combined with either scatter subtraction or Metz filtering produced images that were quantitatively accurate to within 15% of the true value. The ML-EM algorithm demonstrated quantitative accuracy comparable to FBP and smaller relative noise magnitude for all compensation schemes
Digital Earth 2020: Towards the vision for the next decade
Craglia, M.; Bie, de K.; Jackson, D.; Pesaresi, M.; Remetey-Fulopp, G.; Wang, C.; Annoni, A.; Bian, L.; Campbell, F.; Skidmore, A.K.; Woodgate, P.
2012-01-01
This position paper is the outcome of a brainstorming workshop organised by the International Society for Digital Earth (ISDE) in Beijing in March 2011. It argues that the vision of Digital Earth (DE) put forward by Vice-President Al Gore 13 years ago needs to be re-evaluated in the light of the
New investigations of the guanine trichloro cuprate(II) complex crystal
Fabijanić, Ivana; Matković-Čalogović, Dubravka; Pilepić, Viktor; Ivanišević, Irena; Mohaček-Grošev, Vlasta; Sanković, Krešimir
2017-01-01
Crystals of the guanine trichloro cuprate(II) complex, (HGua)2[Cu2Cl6]·2H2O (HGua = protonated guanine), were prepared and analysed by spectroscopic (IR, Raman) and computational methods. A new single-crystal X-ray diffraction analysis was conducted to obtain data with lower standard uncertainties than those in the previously published structure. Raman and IR spectroscopy and quantum-mechanical analysis gave us new insight into the vibrational states of the (HGua)2[Cu2Cl6]·2H2O crystal. The vibrational spectra of the crystal were assigned by performing a normal coordinate analysis for a free dimer with a centre of inversion as the only symmetry element. The stretching vibration observed at 279 cm-1 in the infrared spectrum corresponds to the N-Cu bond. The noncovalent interaction (NCI) plots and quantum theory of atoms in molecules (QTAIM) analysis of the electron density obtained from periodic DFT calculations elucidated the interactions that exist within the crystal structure. Closed-shell ionic attractions, as well as weak and medium strength hydrogen bonds, prevailed in the crystal packing.
Vishik, I. M.
2018-06-01
In the course of seeking the microscopic mechanism of superconductivity in cuprate high temperature superconductors, the pseudogap phase— the very abnormal ‘normal’ state on the hole-doped side— has proven to be as big of a quandary as superconductivity itself. Angle-resolved photoemission spectroscopy (ARPES) is a powerful tool for assessing the momentum-dependent phenomenology of the pseudogap, and recent technological developments have permitted a more detailed understanding. This report reviews recent progress in understanding the relationship between superconductivity and the pseudogap, the Fermi arc phenomena, and the relationship between charge order and pseudogap from the perspective of ARPES measurements.
Orientering og banelægning med Google Earth og Condes
DEFF Research Database (Denmark)
Jørgensen, Henrik Taarsted; Piaster, Thomas Gabriel
2011-01-01
Et e-læringsmodul på Danmarks undervisningsportal, som handler om hvordan man kan arbejde med banelægning indenfor o-løb. Med udgangspunkt i de to gratisprogrammer Google Earth og Condes lærer man gennem modulet, hvordan man indtegner poster og hvordan eleverne kan gøre det samme.......Et e-læringsmodul på Danmarks undervisningsportal, som handler om hvordan man kan arbejde med banelægning indenfor o-løb. Med udgangspunkt i de to gratisprogrammer Google Earth og Condes lærer man gennem modulet, hvordan man indtegner poster og hvordan eleverne kan gøre det samme....
International Nuclear Information System (INIS)
Schindler, G.; Seebacher, B.
1989-01-01
The authors report on investigations into the impact of the rare earths (RE) as given in the title on the ceramic microstructure and the critical current density j c in the superconductor system REBa 2 Cu 3 O x . With RE = Sm, Eu, or Gd, the material is homogeneous in phase and crystallizes in platelets with maximum sizes of up to 350 μm. Material with RE = Y, Dy, or Ho exhibits grain sizes up to 500 μm, and a low amount of phase inhomogeneities. The critical currents measured are between 25 Acm -2 and 290 Acm -2 at 77 K, without external field. The highest values are found in systems with RE = Eu or Gd. (orig.) [de
Ginkgo biloba extract alters the binding of the sodium [123I] iodide (Na123I) on blood constituents
International Nuclear Information System (INIS)
Aleixo, Luiz Cláudio Martins; Moreno, Silvana Ramos Farias; Freitas, Rosimeire de Souza; Thomaz, Hélio; Santos-Filho, Sebastião David
2012-01-01
We evaluated the in vitro effect of an aqueous extract of Ginkgo biloba (EGb) on the distribution in blood cells (BC) and plasma (P) and on the binding of Na 123 I to the blood constituents using precipitation with trichloroacetic acid. The radioactivity percentages insoluble (SF) and insoluble fraction (IF) of blood constituents were determined. The EGb interfered (p 123 I in the P (from 69.64 to 86.13) and BC (from 30.36 to 13.87) and altered the fixation of the Na 123 I in IF-P and in IF-BC. - Highlights: ► Interaction between the Ginkgo biloba and blood constituents radiolabeled. ► Modification of the binding of sodium iodide (Na 123 I) to the blood constituents. ► This alteration should have influence in a diagnosis of nuclear medicine.
10 CFR 1040.123 - Consolidated or joint hearings.
2010-01-01
... ACTIVITIES Enforcement Opportunity for Hearing § 1040.123 Consolidated or joint hearings. In cases in which... 10 Energy 4 2010-01-01 2010-01-01 false Consolidated or joint hearings. 1040.123 Section 1040.123... departments or agencies, where applicable, provide for the conduct of consolidated or joint hearings and for...
International Nuclear Information System (INIS)
Dougan, H.; Vincent, J.S.; Lyster, D.M.
1989-01-01
The present work explores the basic reactions necessary for the preparation of [ 123 I] 15-(paraiodophenyl)-pentadecanoic acid (IPPA) from organo mercury compounds. It was found that the essential reactions occur readily and with good yield. The steps were as follows: phenyl pentadecanoic acid or its ethyl ester may be mercurated using Hg(TFA) 2 in TFA solvent, and the para-chloromercury compounds may be recovered. [ 123 I] radioiodination may be carried out in a variety of solvents in the presence of chloramine T. When radioiodination was conducted at room temperature the isomeric purity of the ester or fatty acid was found to be 99.9% para. The results indicate that poor solubility of certain mercurated pentadecanoic acid compounds will limit the development of a kit for [ 123 I]IPPA. (author) 16 refs.; 2 tabs
d-Wave density waves in high Tc cuprates and CeCoIn5
International Nuclear Information System (INIS)
Maki, Kazumi; Dora, Balazs; Vanyolos, Andras; Virosztek, Attila
2007-01-01
Unconventional density waves (UDW) have a long history starting with the speculation of Halperin and Rice in 1968. However, a more realistic approach started around 1999 in order to clarify the nature of the pseudogap in the underdoped region of hole-doped high T c cuprates. Also d-wave density waves (dDW) evolved from early unrealistic 2D model with Z 2 symmetry to more realistic 3D mean-field condensate with U(1) gauge symmetry. More recently, the giant Nernst effect and the angle dependent magnetoresistance in LSCO, YBCO, Bi2212 and CeCoIn 5 are successfully described in terms of dDW, where the Landau quantization of the quasiparticle spectrum in dDW in a magnetic field (the Nersesyan effect) plays the crucial role
The modulation and reconstruction of a BiO layer of cuprate Bi2212
International Nuclear Information System (INIS)
Fan Wei; Zeng, Z
2011-01-01
Studies based on ab initio density functional theory show that the modulated structures of BiO surfaces of cuprate Bi2212 superconductors are spontaneously formed and closely related to the reconstructions of BiO surfaces. The reconstructions of BiO layers occur both on the surface and in the bulk, accompanied with the formations of BiO-zigzag chains and Bi 2 O 2 quadrilaterals. The structural modulations of the BiO surface are along the b axis, perpendicular to the BiO-zigzag chains along the a axis. Our calculations provide a unified understanding of the formation of modulating structures in Bi2212. Another interesting result is that electronic structures of BiO surfaces are significantly influenced by the CuO 2 layer beneath because of the structural modulations and reconstructions.
Energy Technology Data Exchange (ETDEWEB)
Stoffers, Diederick [VU University Medical Center, Institute for Clinical and Experimental Neurosciences, P.O. Box 7057, MB, Amsterdam (Netherlands); Vrije Universiteit, Department of Clinical Neuropsychology, Amsterdam (Netherlands); Booij, Jan [University of Amsterdam, Department of Nuclear Medicine, Academic Medical Center (Netherlands); Bosscher, Lisette; Winogrodzka, Ania; Wolters, Erik C.; Berendse, Henk W. [VU University Medical Center, Institute for Clinical and Experimental Neurosciences, P.O. Box 7057, MB, Amsterdam (Netherlands)
2005-06-01
Previous studies using dopamine transporter single-photon emission computed tomography (SPECT) to try and distinguish between patients with idiopathic Parkinson's disease (IPD) and patients with atypical parkinsonian syndromes (APS) have mainly focussed on patients with an already established clinical diagnosis of several years' duration. Differences in the pattern of striatal involvement between IPD and APS have been found in only few studies. We hypothesized that distinguishing SPECT features might be most pronounced at an early disease stage, and the purpose of the present study was to investigate this hypothesis. The study included 72 patients with an initial clinical diagnosis of IPD, supported by decreased striatal [{sup 123}I]{beta}-CIT binding on baseline SPECT. In ten patients, the diagnosis was changed to APS over a mean follow-up period of 62 months. We retrospectively compared the patterns of striatal involvement on the baseline SPECT scans between the group of patients (re)diagnosed with APS and the remaining 62 patients in whom a diagnosis of IPD was maintained. In the group of patients with APS, baseline [{sup 123}I]{beta}-CIT binding in both caudate nuclei was lower than in the group of patients with IPD. In addition, putamen to caudate binding ratios were higher in the group of APS patients. In spite of these differences, individual binding values showed considerable overlap between the groups. [{sup 123}I]{beta}-CIT SPECT scanning in early-stage, untreated parkinsonian patients revealed a relative sparing of the caudate nucleus in patients with IPD as compared to patients later (re)diagnosed with APS. Nevertheless, the pattern of striatal involvement appears to have little predictive value for a later re-diagnosis of APS in individual cases. (orig.)
Sythesis of rare earth metal - GIC graphite intercalation compound in molten chloride system
International Nuclear Information System (INIS)
Ito, Masafumi; Hagiwara, Rika; Ito, Yasuhiko
1994-01-01
Graphite intercalation compounds of ytterbium and neodymium have been prepared by interacting graphite and metals in molten chlorides. These rare earth metals can be suspended in molten chlorides in the presence of trichlorides via disproportionation reaction RE(0) + RE(III) = 2RE(II) at lower than 300 degC. Carbides-free compounds are obtained in these systems. (author)
Adachi, Shintaro; Usui, Tomohiro; Kosugi, Kenta; Sasaki, Nae; Sato, Kentaro; Fujita, Masaki; Yamada, Kazuyoshi; Fujii, Takenori; Watanabe, Takao
In high superconducting transition temperature (high-Tc) cuprates, it is empirically known that Tc increases on increasing the number of CuO2 planes in a unit cell n from 1 to 3. Bi-family cuprates are ideal for investigating the microscopic mechanism involved. However, it is difficult to grow tri-layered Bi-2223, probably owing to its narrow crystallization field. Here, we report improved crystal growth of this compound using the TSFZ method under conditions slightly different from those in an earlier report [J. Cryst. Growth 223, 175 (2001)]. A Bi-rich feed-rod composition of Bi2.2Sr1.9Ca2Cu3Oy and a slightly oxygen-reduced atmosphere (mixed gas flow of O2 (10%) and Ar (90%)) were adopted for the crystal growth. In addition, to increase the supersaturation of the melts, we applied a large temperature gradient along the solid-liquid interface by shielding a high-angle light beam using Al foil around the quartz tube. In this way, we succeeded in preparing large (2 × 2 × 0 . 05 mm3) and high-quality (almost 100% pure) Bi-2223 single crystals. Hirosaki University Grant for Exploratory Research by Young Scientists and Newly-appointed Scientists.
Energy Technology Data Exchange (ETDEWEB)
Mesot, J [Paul Scherrer Inst. (PSI), Villigen (Switzerland)
1992-11-01
Superconductivity in the cuprates is believed to be controlled by the density of mobile charges in the CuO[sub 2] planes. In particular, the charge transfer process from the chains to the planes seems to play an important role. Consequently, it is crucial to observe directly the influence of different types of perturbations on the electronic structure of these compounds. The crystal field (CF) spectroscopy of the rare earth allows us to make these observations, since in the perovskite-type compounds YBa[sub 2]Cu[sub 3]O[sub x](123) and YBa[sub 2]Cu[sub 4]O[sub 8](1248) the replacement of the Y ions by most of the magnetic rare-earth (R) ions does not have a detrimental effect on the superconductivity. The (2J+1)-fold degeneracy of the ground-state J-multiplet of the R ions will be partially lifted under the action of the CF potential created by the neighbouring atoms. By means of inelastic neutron scattering experiments it is possible to observe directly the transitions between the CF states. This means that we can obtain useful information on both the structural and the charge distribution parameters in the vicinity of the R ion. In the 123 and 1248 systems, the R ions are sandwiched between two CuO[sub 2] planes, thus the CF interaction at the R sites constitutes an ideal probe of the local symmetry and charge distribution of the superconducting planes. In the first part of this work, we discuss the importance of the intermediate coupling and J mixing effects on the determination of the CF parameters of the 123 compounds. In order to quantify the charge transfer process from the chains to the planes, we performed a detailed analysis of the CF of Er[sup 3+] in the 123 and 248 compounds under the following conditions: oxygen deficiency, Zn and Ni doping of the Cu sites, external pressure and fast neutron irradiation. In parallel, we present conclusions obtained from diffraction experiments. (author) figs., tabs., 113 refs.
Energy Technology Data Exchange (ETDEWEB)
Mesot, J
1992-01-01
Superconductivity in the cuprates is believed to be controlled by the density of mobile charges in the CuO[sub 2] planes. In particular, the charge transfer process from the chains to the planes seems to play an important role. Consequently, it is crucial to observe directly the influence of different types of perturbations on the electronic structure of these compounds. The crystal field (CF) spectroscopy of the rare earth allows us to make these observations, since in the perovskite-type compounds YBa[sub 2]Cu[sub 3]O[sub x](123) and YBa[sub 2]Cu[sub 4]O[sub 8](1248) the replacement of the Y ions by most of the magnetic rare-earth (R) ions does not have a detrimental effect on the superconductivity. The (2J+1)-fold degeneracy of the ground-state J-multiplet of the R ions will be partially lifted under the action of the CF potential created by the neighbouring atoms. By means of inelastic neutron scattering experiments it is possible to observe directly the transitions between the CF states. This means that we can obtain useful information on both the structural and the charge distribution parameters in the vicinity of the R ion. In the 123 and 1248 system, the R ions are sandwiched between two CuO[sub 2] planes, thus the CF interaction at the R sites constitutes an ideal probe of the local symmetry and charge distribution of the superconducting planes. In the first part of this work, we discuss the importance of the intermediate coupling and J mixing effects on the determination of the CF parameters of the 123 compounds. In order to quantify the charge transfer process from the chains to the planes, we performed a detailed analysis of the CF of Er[sup 3+] in the 123 and 248 compounds. In parallel, we present the conclusions obtained from diffraction experiments. Another interesting result concerns the anomalous behaviour of the lowest lying CF transition. (author) figs., tabs., 113 refs.
Energy Technology Data Exchange (ETDEWEB)
Mesot, J [Paul Scherrer Inst. (PSI), Villigen (Switzerland)
1992-11-01
Superconductivity in the cuprates is believed to be controlled by the density of mobile charges in the CuO{sub 2} planes. In particular, the charge transfer process from the chains to the planes seems to play an important role. Consequently, it is crucial to observe directly the influence of different types of perturbations on the electronic structure of these compounds. The crystal field (CF) spectroscopy of the rare earth allows us to make these observations, since in the perovskite-type compounds YBa{sub 2}Cu{sub 3}O{sub x}(123) and YBa{sub 2}Cu{sub 4}O{sub 8}(1248) the replacement of the Y ions by most of the magnetic rare-earth (R) ions does not have a detrimental effect on the superconductivity. The (2J+1)-fold degeneracy of the ground-state J-multiplet of the R ions will be partially lifted under the action of the CF potential created by the neighbouring atoms. By means of inelastic neutron scattering experiments it is possible to observe directly the transitions between the CF states. This means that we can obtain useful information on both the structural and the charge distribution parameters in the vicinity of the R ion. In the 123 and 1248 systems, the R ions are sandwiched between two CuO{sub 2} planes, thus the CF interaction at the R sites constitutes an ideal probe of the local symmetry and charge distribution of the superconducting planes. In the first part of this work, we discuss the importance of the intermediate coupling and J mixing effects on the determination of the CF parameters of the 123 compounds. In order to quantify the charge transfer process from the chains to the planes, we performed a detailed analysis of the CF of Er{sup 3+} in the 123 and 248 compounds under the following conditions: oxygen deficiency, Zn and Ni doping of the Cu sites, external pressure and fast neutron irradiation. In parallel, we present conclusions obtained from diffraction experiments. (author) figs., tabs., 113 refs.
International Nuclear Information System (INIS)
Mesot, J.
1992-11-01
Superconductivity in the cuprates is believed to be controlled by the density of mobile charges in the CuO 2 planes. In particular, the charge transfer process from the chains to the planes seems to play an important role. Consequently, it is crucial to observe directly the influence of different types of perturbations on the electronic structure of these compounds. The crystal field (CF) spectroscopy of the rare earth allows us to make these observations, since in the perovskite-type compounds YBa 2 Cu 3 O x (123) and YBa 2 Cu 4 O 8 (1248) the replacement of the Y ions by most of the magnetic rare-earth (R) ions does not have a detrimental effect on the superconductivity. The (2J+1)-fold degeneracy of the ground-state J-multiplet of the R ions will be partially lifted under the action of the CF potential created by the neighbouring atoms. By means of inelastic neutron scattering experiments it is possible to observe directly the transitions between the CF states. This means that we can obtain useful information on both the structural and the charge distribution parameters in the vicinity of the R ion. In the 123 and 1248 systems, the R ions are sandwiched between two CuO 2 planes, thus the CF interaction at the R sites constitutes an ideal probe of the local symmetry and charge distribution of the superconducting planes. In the first part of this work, we discuss the importance of the intermediate coupling and J mixing effects on the determination of the CF parameters of the 123 compounds. In order to quantify the charge transfer process from the chains to the planes, we performed a detailed analysis of the CF of Er 3+ in the 123 and 248 compounds under the following conditions: oxygen deficiency, Zn and Ni doping of the Cu sites, external pressure and fast neutron irradiation. In parallel, we present conclusions obtained from diffraction experiments. (author) figs., tabs., 113 refs
Near-Earth Reconnection Ejecta at Lunar Distances
Runov, A.; Angelopoulos, V.; Artemyev, A.; Lu, S.; Zhou, X.-Z.
2018-04-01
Near-Earth magnetotail reconnection leads to formation of earthward and tailward directed plasma outflows with an increased north-south magnetic field strength(|Bz|) at their leading edges. We refer to these regions of enhanced |Bz| and magnetic flux transport Ey as reconnection ejecta. They are composed of what have been previously referred to as earthward dipolarizing flux bundles (DFBs) and tailward rapid flux transport (RFT) events. Using two-point observations of magnetic and electric fields and particle fluxes by the Acceleration, Reconnection, Turbulence, and Electrodynamics of Moon's Interaction with the Sun probes orbiting around Moon at geocentric distances R ˜ 60RE, we statistically studied plasma moments and particle energy spectra in RFTs and compared them with those observed within DFBs in the near-Earth plasma sheet by the Time History of Events and Macroscale Interactions during Substorms probes. We found that the ion average temperatures and spectral slopes in RFTs at R ˜ 60RE are close to those in DFBs observed at 15 balance, the average RFT ion temperature corresponds to a lobe field BL˜20 nT. This leads us to suggest that the ion population within the tailward ejecta originated in the midtail plasma sheet at 20≤R≤30RE and propagated to the Acceleration, Reconnection, Turbulence, and Electrodynamics of Moon's Interaction with the Sun location without undergoing any further energy gain. Conversely, electron temperatures in DFBs at 15 < R < 25RE are a factor of 2.5 higher than those in RFTs at R ˜ 60RE.
THE EFFECTS OF RARE EARTHS ON ACTIVITY AND SURFACE ...
African Journals Online (AJOL)
A series of Ru-RE/γ-AL2O3 (RE = Ce, Pr, La, Sm, Tb or Gd) and Ru/γ-AL2O3 catalysts were prepared by impregnation method. The influence of rare earths on the catalytic performance of Ru/γ-AL2O3 catalyst for the water gas shift reaction was studied. The catalysts were characterized by X-ray diffraction (XRD), ...
Directory of Open Access Journals (Sweden)
Mona A. Hosny
2012-01-01
Full Text Available We present a short and efficient synthesis of the title compounds starting with cheap and readily available camphor and derivatives of acetophenone. The optimized sequence allows the large-scale preparation of this new type of synthesis in a few steps. New 1,2,3-thiadiazole and 1,2,3-diazaphosphole derivatives 11-20, were prepared from the ketones 1-5 via the corresponding semicarbazones 6-10. The Hurd-Mori and Lalezari methods were used, respectively, for the preparation of these 1,2,3-thiadiazole and 1,2,3-diazaphospholene derivatives. These derivatives exhibit anticancer effect due to their high potential biological activity.
Superconducting fluctuations and pseudogap in high-Tc cuprates
Directory of Open Access Journals (Sweden)
Alloul H.
2012-03-01
Full Text Available Large pulsed magnetic fields up to 60 Tesla are used to suppress the contribution of superconducting fluctuations (SCF to the ab-plane conductivity above Tc in a series of YBa2Cu3O6+x. These experiments allow us to determine the field Hc’(T and the temperature Tc’ above which the SCFs are fully suppressed. A careful investigation near optimal doping shows that Tc’ is higher than the pseudogap temperature T*, which is an unambiguous evidence that the pseudogap cannot be assigned to preformed pairs. Accurate determinations of the SCF contribution to the conductivity versus temperature and magnetic field have been achieved. They can be accounted for by thermal fluctuations following the Ginzburg-Landau scheme for nearly optimally doped samples. A phase fluctuation contribution might be invoked for the most underdoped samples in a T range which increases when controlled disorder is introduced by electron irradiation. Quantitative analysis of the fluctuating magnetoconductance allows us to determine the critical field Hc2(0 which is found to be be quite similar to Hc’ (0 and to increase with hole doping. Studies of the incidence of disorder on both Tc’ and T* allow us to to propose a three dimensional phase diagram including a disorder axis, which allows to explain most observations done in other cuprate families.
Developments with melt spun RE-Fe-B powder for bonded magnets
International Nuclear Information System (INIS)
Brown, D.N.; Chen, Z.; Guschl, P.; Campbell, P.
2006-01-01
Rapidly quenched isotropic rare earth iron boride (RE-Fe-B) powders have found many applications throughout the electronics, automotive and white goods industries. The magnetic performance, thermal stability, corrosion resistance and processability of a powder are important factors when selecting a RE-Fe-B powder for a particular application. For electronic devices that operate at ambient temperatures, high remanence (B r ) tends to be a priority and RE 2 Fe 14 B/α-Fe nanocomposite powder magnets are favoured. Alternatively, automotive applications tend to require greater thermal stability and corrosion resistance, which are satisfied by single-phase RE 2 Fe 14 B powder magnets with higher intrinsic coercivity (H ci ). This article reviews the performance of commercially available rapidly solidified RE-Fe-B powders and recent developments made to address the demands of applications
Mono-domain YBa2Cu3Oy superconductor fabrics prepared by an infiltration process
International Nuclear Information System (INIS)
Sudhakar Reddy, E.; Noudem, J.G.; Tarka, M.; Schmitz, G.J.
2000-01-01
A novel process for the fabrication of a new form of YBa 2 Cu 3 O y (123) superconducting material, with the dimensions of a thick film and the microstructure of a melt-textured single-domain bulk is described. The process allows the fabrication of 123 as a self-supporting fabric or as a thick film on various substrate materials. The process, which is generic and economical, uses commercially available Y 2 O 3 fabrics as a precursor material. The Y 2 O 3 cloth is infiltrated with barium cuprates and copper oxides from a liquid-phase source, then converted into Y 2 BaCuO 5 (211) phase and eventually to 123. The nucleation and growth of the 123 phase is controlled by seeding the cloth with an oriented heterogeneous MgO or Nd123 seed. Interesting application areas for the new form of the 123 mono-domain fabric are discussed. (author)
Thermochemical properties of rare earth complexes with salicylic acid
International Nuclear Information System (INIS)
Yang Xuwu; Sun Wujuan; Ke Congyu; Zhang Hangguo; Wang Xiaoyan; Gao Shengli
2007-01-01
Fourteen rare earth complexes with salicylic acid RE(HSal) 3 .nH 2 O (HSal = C 7 H 5 O 3 ; RE = La-Sm, n = 2; RE = Eu-Lu, n = 1) were synthesized and characterized by elemental analysis, and their thermal decomposition mechanism were studied with TG-DTG technology. The constant-volume combustion energies of complexes, Δ c U, were determined by a precise rotating-bomb calorimeter at 298.15 K. Their standard molar enthalpies of combustion, Δ c H m 0 , and standard molar enthalpies of formation, Δ f H m o , were calculated
2010-04-01
... 27 Alcohol, Tobacco Products and Firearms 1 2010-04-01 2010-04-01 false Export marks. 28.123..., or Transportation to a Manufacturing Bonded Warehouse § 28.123 Export marks. (a) General. In addition... filled under the provisions of part 24 of this chapter, the proprietor shall mark the word “Export” on...
Energy Technology Data Exchange (ETDEWEB)
Sanders, M.B.; Baroudi, K.M.; Krizan, J.W.; Mukadam, O.A.; Cava, R.J. [Department of Chemistry, Princeton University, Princeton, NJ (United States)
2016-10-15
The crystal structures and magnetic properties of RE{sub 3}Sb{sub 3}Mg{sub 2}O{sub 14} (RE = La, Pr, Sm, Eu, Tb, Ho) with a perfect kagome lattice are presented and compared to RE{sub 3}Sb{sub 3}Zn{sub 2}O{sub 14}. Rietveld structure refinements were performed using X-ray diffraction data, indicating that the layered compounds are fully structurally ordered. The compounds crystallize in a rhombohedral supercell of the cubic pyrochlore structure, in the space group R-3m. Magnetic susceptibility measurements show no signs of magnetic ordering above 2 K. The RE{sub 3}Sb{sub 3}Mg{sub 2}O{sub 14} family is similar to that of RE{sub 3}Sb{sub 3}Zn{sub 2}O{sub 14}; however, the series reported here features a fully ordered distribution of cations in both the nonmagnetic antimony and magnetic rare earth kagome lattices. Unlike the offsite disorder that Zn{sup 2+} experiences in RE{sub 3}Sb{sub 3}Zn{sub 2}O{sub 14}, the magnesium sites in RE{sub 3}Sb{sub 3}Mg{sub 2}O{sub 14} are completely ordered. Here we compare the magnetic properties in both series of kagome compounds to determine how significant Zn{sup 2+}'s positional ordering is within this structure type. The compounds reported here appear to be relatively defect-free and are therefore model systems for investigating magnetic frustration on an ideal 2D rare earth kagome lattice. (copyright 2016 WILEY-VCH Verlag GmbH and Co. KGaA, Weinheim)
A new series of rhenium VII compounds: sodium-rare earth perrhenates
International Nuclear Information System (INIS)
Slimane, Z.A.A.; Silvestre, J.-P.; Freundlich, William
1978-01-01
Synthesis by solid state reaction or in aqueous solution and radiocrystallographical study of the hexagonal sodium-rare earth perrhenates NaLn(ReO 4 ) 4 (Ln=La, Nd, Sm, Eu, Gd, Er) and of the tetragonal tetrahydrates NaLn(ReO 4 ) 4 , 4H 2 O (Ln=Eu, Gd, Er, Lu) [fr
Lightcurve Analysis for Four Near-Earth Asteroids
Birtwhistle, Peter
2018-04-01
Lightcurves are reported for four near-Earth asteroids observed from Great Shefford Observatory during close approaches between 2010 January and 2017 November: 2000 RE52, 2008 YZ32, 2017 UK8, and 2017 VD. 2008 YZ32 is a large superfast rotator.
How to Cloud for Earth Scientists: An Introduction
Lynnes, Chris
2018-01-01
This presentation is a tutorial on getting started with cloud computing for the purposes of Earth Observation datasets. We first discuss some of the main advantages that cloud computing can provide for the Earth scientist: copious processing power, immense and affordable data storage, and rapid startup time. We also talk about some of the challenges of getting the most out of cloud computing: re-organizing the way data are analyzed, handling node failures and attending.
Neutron diffraction studies on structural and magnetic properties of RE2NiGe3 (RE=La, Ce)
International Nuclear Information System (INIS)
Kalsi, Deepti; Rayaprol, S.; Siruguri, V.; Peter, Sebastian C.
2014-01-01
We report the crystallographic properties of RE 2 NiGe 3 (RE=La, Ce) synthesized by arc melting. Rietveld refinement on the powder neutron diffraction (ND) data suggest both compounds are isostructural and crystallize in the non-centrosymmetric Er 2 RhSi 3 type structure having hexagonal space group P6 ¯ 2c. In the crystal structure of RE 2 NiGe 3 , two dimensional arrangements of nickel and germanium atoms lead to the formation of hexagonal layers with rare earth atoms sandwiched between them. Magnetic susceptibility measurements performed in low fields exhibit antiferromagnetic ordering in cerium compound around (T o =) 3.2 K. Neutron diffraction measurements at 2.8 K (i.e., at T
21 CFR 123.7 - Corrective actions.
2010-04-01
... of their HACCP plans in accordance with § 123.6(c)(5), by which they predetermine the corrective... in accordance with § 123.10, to determine whether the HACCP plan needs to be modified to reduce the risk of recurrence of the deviation, and modify the HACCP plan as necessary. (d) All corrective actions...
27 CFR 31.123 - New corporation.
2010-04-01
... 27 Alcohol, Tobacco Products and Firearms 1 2010-04-01 2010-04-01 false New corporation. 31.123... Requiring Registration As A New Business § 31.123 New corporation. Where a new corporation is formed to take over and conduct the business of one or more corporations that have registered under this part, the new...
International Nuclear Information System (INIS)
Ozawa, Masakuni; Onoe, Ryota; Kato, Hajime
2006-01-01
Formation and thermal decomposition of rare earth (RE = La, Ce, Pr) hydroxides and oxides by homogeneous precipitation using hexamethylenetetramine. The precipitatates were examined using thermal gravimetry and differential thermal analysis, infrared spectrometry and X-ray diffraction. The as-precipitated powders from the present process were La(OH) 3 , CeO 2 , Pr(OH) 3 . In the case of Ce, a cubic fluorite phase of cerium dioxide was directly obtained. The lanthanum trihydroxide decomposed to oxides via three steps. Two-step dehydration decomposition behavior at 340 and 500 o C was observed as La(OH) 3 → LaOOH + H 2 O and 2LaOOH → La 2 O 3 + H 2 O. The activation energy (ΔH) for dehydration was 240 and 244 kJ/mol, respectively. The additional decomposition of carbonate-containing species was observed at 670 o C with ΔH of 390 kJ/mol. Pr(OH) 3 did not show additional TGA profile of carbonate decomposition. Since no carbonate species form in solution during the HMT precipitation (hydrolysis of this molecule), the difference between La and Pr depends on the strength of basicity in the reaction with CO 2 after precipitation
Production of 123I for medical use with small accelerators
International Nuclear Information System (INIS)
Beyer, G.J.; Pimentel, G.; Solin, O.; Heselius, S.J.; Taka, T.
1988-01-01
The possibilities of 123 I production with small accelerators are discussed. Among the possible nuclear reactions the 122 Te(d,n) 123 I and the 123 Te(p,n) 123 I reaction are of particular interest for those institutions, who do not run a cyclotron with particle energies for protons above 18-20 MeV. The use of TeO 2 as target material is advantaged over Te. The 123 I preparations contain resonable amounts of 130 I and 124 I. The most 'dangerous' impurity is 130 I due to its high energy gamma radiation. Nevertheless, high quality imagings may be obtained using medium or high energy collimators loosing some of the advantages of 123 I. The proposed approach is the only way to make 123 I available for a number of institutions or countries running small cyclotrons and for which commercial 123 I is difficult or impossible to obtain for economical or geographical reasons. (author)
Directory of Open Access Journals (Sweden)
Das Tanmoy
2012-03-01
Full Text Available We show that, by using the unit-cell transformation between 1 Fe per unit cell to 2 Fe per unit cell, one can qualitatively understand the pairing symmetry of several families of iron-based superconductors. In iron-pnictides and iron-chalcogenides, the nodeless s±-pairing and the resulting magnetic resonance mode transform nicely between the two unit cells, while retaining all physical properties unchanged. However, when the electron-pocket disappears from the Fermi surface with complete doping in KFe2As2, we find that the unit-cell invariant requirement prohibits the occurrence of s±-pairing symmetry (caused by inter-hole-pocket nesting. However, the intra-pocket nesting is compatible here, which leads to a nodal d-wave pairing. The corresponding Fermi surface topology and the pairing symmetry are similar to Ce-based heavy-fermion superconductors. Furthermore, when the Fermi surface hosts only electron-pockets in KyFe2-xSe2, the inter-electron-pocket nesting induces a nodeless and isotropic d-wave pairing. This situation is analogous to the electron-doped cuprates, where the strong antiferromagnetic order creates similar disconnected electron-pocket Fermi surface, and hence nodeless d-wave pairing appears. The unit-cell transformation in KyFe2-xSe2 exhibits that the d-wave pairing breaks the translational symmetry of the 2 Fe unit cell, and thus cannot be realized unless a vacancy ordering forms to compensate for it. These results are consistent with the coexistence picture of a competing order and nodeless d-wave superconductivity in both cuprates and KyFe1.6Se2.
IrSr2TbCu2O8, a high-pressure metamagnetic cuprate: Structure, microstructure and properties
International Nuclear Information System (INIS)
Dos Santos-Garcia, A.J.; Duijn, J. van; Saez-Puche, R.; Heymann, G.; Huppertz, H.; Alario-Franco, M.A.
2008-01-01
The synthesis, structure and microstructure of the IrSr 2 TbCu 2 O 8 cuprate showing metamagnetic properties are described. The sample was prepared at high temperatures and pressures up to 9.2 GPa. The structure is tetragonal, showing a 1212 type structure, that derives from the classical YBaCuO superconductor structure, replacing the tetracoordinated square planar copper [Cu-O 4 ] in the 'chains' by octahedral [Ir-O 6 ] groups that form a perovskite-like layer in the basal plane of the unit cell. A 'simple' cell, ∼a p xa p x3a p , where a p is the basic perovskite unit cell parameter (a p ∼3.8 A), is supported by X-ray powder diffraction (XRD) and a so-called 'diagonal' one, ∼√2a p x√2a p x3a p , by SAED; a microdomain texture of latter cell and a series of very interesting extended defects have been observed by HREM. Magnetic susceptibility measurements show a magnetic transition, T N ∼6 K, with negative Weiss temperature, that indicates antiferromagnetic interactions among the Tb moments. The magnetic structure has been determined by neutron diffraction. A detailed magnetic study has revealed a metamagnetic behavior, something not previously observed in this type of cuprates. Specific heat and resistivity measurements have also been performed to characterize the transition. - Graphical abstract: Reconstructed image from the SAED of the long c tetragonal axis (3a p ) of a IrSr 2 TbCu 2 O 8 crystal. A unit cell picture is included for comparison. Display Omitted
Rare earths in iron and steelmaking and gaseous desulphurisation
International Nuclear Information System (INIS)
Kay, D.A.R.; Subramanian, S.V.; Meng, V.; Kumar, R.V.
1985-01-01
Rare earth (RE) additions, either as mischmetal or rare earth silicide, are used in many ladle treatment processes in modern ferrous metallurgy. In ironmaking they provide the basis for the control of graphite morphology in cast irons and in steelmaking additions are made to aluminum-killed steels for desulphurisation and the control of inclusion composition and morphology. Rare earth oxides may also be used in the desulphurisation of medium calorific value gaseous fuels and stack gases. In this paper, Ce-S-O and La-S-O phase stability diagrams are used to determine the role of the rare earths in the external processing of iron and steel, and gaseous desulphurisation
Energy Technology Data Exchange (ETDEWEB)
Octaviano, E.S.; Levada, C.L.; Missiato, O., E-mail: esoctaviano@if.sc.usp.br [Academia da Forca Aerea, Campo Fontenelle, Pirassununga , SP (Brazil). Div. de Ensino; Semenzato, M.J.; Silva, R.A.; Andreeta, J.P. [Universidade de Sao Paulo (USP), Sao Carlos, SP (Brazil). Instituto de Fisica
2009-07-01
A desirable alternative for a faster development, characterization and application of material of technological interest has been the growth of single crystal fibers by LHPG - Laser Heated Pedestal Growth. In this work it was reported the growth of pure, doped and gradient single crystal fibers of the chemical formulation REMO{sub 4} (M = Nb e Ta, e RE= Rare Earth), characterized through primary techniques such as X-Ray and optical spectroscopy. (author)
Rare earth minerals and resources in the world
Energy Technology Data Exchange (ETDEWEB)
Kanazawa, Yasuo [Human Resource Department, National Institute of Advanced Industrial Science and Technology (AIST), 1-1-1 Umezono, Tsukuba 305-8568 (Japan)]. E-mail: y.kanazawa@aist.go.jp; Kamitani, Masaharu [Institute for Geo-Resources and Environment, National Institute of Advanced Industrial Science and Technology (AIST), 1-1-1 Higashi, Tsukuba 305-8567 (Japan)
2006-02-09
About 200 rare earth (RE) minerals are distributed in a wide variety of mineral classes, such as halides, carbonates, oxides, phosphates, silicates, etc. Due to the large ionic radii and trivalent oxidation state, RE ions in the minerals have large coordination numbers (c.n.) 6-10 by anions (O, F, OH). Light rare earth elements (LREEs) tend to occupy the larger sites of 8-10 c.n. and concentrate in carbonates and phosphates. On the other hand, heavy rare earth elements (HREEs) and Y occupy 6-8 c.n. sites and are abundant in oxides and a part of phosphates. Only a few mineral species, such as bastnaesite (Ce,La)(CO{sub 3})F, monazite (Ce,La)PO{sub 4}, xenotime YPO{sub 4}, and RE-bearing clay have been recovered for commercial production. Bayan Obo, China is the biggest RE deposit in the world. One of probable hypotheses for ore geneses is that the deposit might be formed by hydrothermal replacement of carbonate rocks of sedimentary origin. The hydrothermal fluid may be derived from an alkaline-carbonatite intrusive series. Following Bayan Obo, more than 550 carbonatite/alkaline complex rocks constitute the majority of the world RE resources. The distribution is restricted to interior and marginal regions of continents, especially Precambrian cratons and shields, or related to large-scale rift structures. Main concentrated areas of the complexes are East African rift zones, northern Scandinavia-Kola peninsula, eastern Canada and southern Brazil. Representative sedimentary deposits of REE are placer- and conglomerate-types. The major potential countries are Australia, India, Brazil, and Malaysia. Weathered residual deposits have been formed under tropical and sub-tropical climates. Bauxite and laterite nickel deposit are the representative. Ion adsorption clay without radioactive elements is known in southern China. Weathering processes concentrate REE in a particular clay mineral-layer in the weathered crusts whose source were originally REE-rich rocks like granite
Rare earth minerals and resources in the world
International Nuclear Information System (INIS)
Kanazawa, Yasuo; Kamitani, Masaharu
2006-01-01
About 200 rare earth (RE) minerals are distributed in a wide variety of mineral classes, such as halides, carbonates, oxides, phosphates, silicates, etc. Due to the large ionic radii and trivalent oxidation state, RE ions in the minerals have large coordination numbers (c.n.) 6-10 by anions (O, F, OH). Light rare earth elements (LREEs) tend to occupy the larger sites of 8-10 c.n. and concentrate in carbonates and phosphates. On the other hand, heavy rare earth elements (HREEs) and Y occupy 6-8 c.n. sites and are abundant in oxides and a part of phosphates. Only a few mineral species, such as bastnaesite (Ce,La)(CO 3 )F, monazite (Ce,La)PO 4 , xenotime YPO 4 , and RE-bearing clay have been recovered for commercial production. Bayan Obo, China is the biggest RE deposit in the world. One of probable hypotheses for ore geneses is that the deposit might be formed by hydrothermal replacement of carbonate rocks of sedimentary origin. The hydrothermal fluid may be derived from an alkaline-carbonatite intrusive series. Following Bayan Obo, more than 550 carbonatite/alkaline complex rocks constitute the majority of the world RE resources. The distribution is restricted to interior and marginal regions of continents, especially Precambrian cratons and shields, or related to large-scale rift structures. Main concentrated areas of the complexes are East African rift zones, northern Scandinavia-Kola peninsula, eastern Canada and southern Brazil. Representative sedimentary deposits of REE are placer- and conglomerate-types. The major potential countries are Australia, India, Brazil, and Malaysia. Weathered residual deposits have been formed under tropical and sub-tropical climates. Bauxite and laterite nickel deposit are the representative. Ion adsorption clay without radioactive elements is known in southern China. Weathering processes concentrate REE in a particular clay mineral-layer in the weathered crusts whose source were originally REE-rich rocks like granite and
Rhodamine-123: a p-glycoprotein marker complex with sodium lauryl sulfate.
Al-Mohizea, Abdullah M; Al-Jenoobi, Fahad Ibrahim; Alam, Mohd Aftab
2015-03-01
Aim of this study was to investigate the role of sodium lauryl sulfate (SLS) as P-glycoprotein inhibitor. The everted rat gut sac model was used to study in-vitro mucosal to serosal transport of Rhodamine-123 (Rho-123). Surprisingly, SLS decreases the serosal absorption of Rho-123 at all investigated concentrations. Investigation reveals complex formation between Rhodamine-123 and sodium lauryl sulfate. Interaction profile of SLS & Rho-123 was studied at variable SLS concentrations. The SLS concentration higher than critical micelle concentration (CMC) increases the solubility of Rho-123 but could not help in serosal absorption, on the contrary the absorption of Rho-123 decreased. Rho-123 and SLS form pink color complex at sub-CMC. The SLS concentrations below CMC decrease the solubility of Rho-123. For further studies, Rho-123 & SLS complex was prepared by using solvent evaporation technique and characterized by using differential scanning calorimeter (DSC). Thermal analysis also proved the formation of complex between SLS & Rho-123. The P values were found to be significant (<0.05) except group comprising 0.0001% SLS, and that is because 0.0001% SLS is seems to be very low to affect the solubility or complexation of Rho-123.
A Study on Electrochemical Reduction of Rare Earth Oxides in Molten LiCl-Li2O Salt
International Nuclear Information System (INIS)
Lee, Min Woo; Jeong, Sang Mun; Lee, See Hoon; Sohn, Jung Min
2016-01-01
In this study, the electrochemical reduction of RE 2 O 3 (RE = Nd or Ce) has been conducted via co-reduction NiO to increase the reduction degree of the rare earth oxides in molten molten LiCl containing 1wt% Li 2 O. The electrochemical reduction behavior of the mixed RE 2 O 3 -NiO oxide has been investigated and the reduction path of RE 2 O 3 has been proposed. An electorchemical spent fuel processing technology, pyroprocessing, has been developed for recycling of spent fuel to be applied to a sodium-cooled fast reactor. The spent fuel is reduced in the oxide reduction process. It is well known that the rare earth oxides are hardly reduced due to their electrochemical and thermodynamic stability. The rare earth oxides unreduced in the reduction process can cause problems via reaction with UCl 3 in the electrorefiner. To tackle those problems, the electrochemical reduction of rare earth oxide has been conducted via co-reduction of NiO in LiCl molten salt containing 1 wt% Li 2 O. The reduction of the oxide mixture starts from the reduction of NiO to Ni, followed by that of RE 2 O 3 on the produced Ni to form intermetallic RENi 5 . The mixed oxide pellets were successfully reduced to the RENi5 alloy by constant electrolysis at 3.0 V at 650 .deg. C. The crucial aspect to these results is that the thermodynamically stable rare-earth oxide, Nd 2 O 3 was successfully converted to the metal in the presence of NiO.
Myocardial scintigraphy with I-123 labeled fatty acids
International Nuclear Information System (INIS)
Dudczak, R.
1983-01-01
This study presents experimental and clinical data in the use of I-123 labeled aromatic and aliphatic fatty acids. I-123 p-phenylpentadecanoic acid (p-IPPA) and I-123 heptadecanoic acid (HDA) were applied for myocardial scintigraphy. The feasibility of p-IPPA and HDA for myocardial scintigraphy was substantiated in animal experiments. Clinical studies were performed in patients with coronary artery disease (CAD) and cardiomyopathy (CMP). In CAD the results of fatty acid studies were compared with those of Tl-201. I-123 labeled fatty acids proved to be a useful tool for myocardial scintigraphy. The possibility to evaluate non invasively the myocardial metabolic function in man may add a complementary diagnostic tool in the clinical follow up of patients with heart disease. In CAD studies with I-123 p-IPPA and I-123 HDA might provide a means to assess the degree of myocardial viability and to identify a subgroup of patients who are at increased risk for irreversible myocardial damage. In patients with CMP it is probable that these studies may be used as a means of separating groups of patients with this disease. (Author)
Fujita, Kazuhiro; Schmidt, Andrew R.; Kim, Eun-Ah; Lawler, Michael J.; Lee, Dung Hai; Davis, J. C.; Eisaki, Hiroshi; Uchida, Shin-ichi
2012-01-01
One of the key motivations for the development of atomically resolved spectroscopic imaging scanning tunneling microscopy (SI-STM) has been to probe the electronic structure of cuprate high temperature superconductors. In both the d-wave superconducting (dSC) and the pseudogap (PG) phases of underdoped cuprates, two distinct classes of electronic states are observed using SI-STM. The first class consists of the dispersive Bogoliubov quasiparticles of a homogeneous d-wave superconductor. These are detected below a lower energy scale |E|=Δ0 and only upon a momentum space (k-space) arc which terminates near the lines connecting k=±(π/a0,0) to k=±(0,π/a0). Below optimal doping, this ``nodal'' arc shrinks continuously with decreasing hole density. In both the dSC and PG phases, the only broken symmetries detected in the |E|≤Δ0 states are those of a d-wave superconductor. The second class of states occurs at energies near the pseudogap energy scale |E|˜ Δ1 which is associated conventionally with the ``antinodal'' states near k=±(π/a0,0) and k=±(0,π/a0). We find that these states break the expected 90°-rotational (C4) symmetry of electronic structure within CuO2 unit cells, at least down to 180°-rotational (C2) symmetry (nematic) but in a spatially disordered fashion. This intra-unit-cell C4 symmetry breaking coexists at |E|˜Δ1 with incommensurate conductance modulations locally breaking both rotational and translational symmetries (smectic). The characteristic wavevector Q of the latter is determined, empirically, by the k-space points where Bogoliubov quasiparticle interference terminates, and therefore evolves continuously with doping. The properties of these two classes of |E|˜Δ1 states are indistinguishable in the dSC and PG phases. To explain this segregation of k-space into the two regimes distinguished by the symmetries of their electronic states and their energy scales |E|˜Δ1 and |E|≤Δ0, and to understand how this impacts the electronic
Ion chemistry of 1H-1,2,3-triazole.
Ichino, Takatoshi; Andrews, Django H; Rathbone, G Jeffery; Misaizu, Fuminori; Calvi, Ryan M D; Wren, Scott W; Kato, Shuji; Bierbaum, Veronica M; Lineberger, W Carl
2008-01-17
A combination of experimental methods, photoelectron-imaging spectroscopy, flowing afterglow-photoelectron spectroscopy and the flowing afterglow-selected ion flow tube technique, and electronic structure calculations at the B3LYP/6-311++G(d,p) level of density functional theory (DFT) have been employed to study the mechanism of the reaction of the hydroxide ion (HO-) with 1H-1,2,3-triazole. Four different product ion species have been identified experimentally, and the DFT calculations suggest that deprotonation by HO- at all sites of the triazole takes place to yield these products. Deprotonation of 1H-1,2,3-triazole at the N1-H site gives the major product ion, the 1,2,3-triazolide ion. The 335 nm photoelectron-imaging spectrum of the ion has been measured. The electron affinity (EA) of the 1,2,3-triazolyl radical has been determined to be 3.447 +/- 0.004 eV. This EA and the gas-phase acidity of 2H-1,2,3-triazole are combined in a negative ion thermochemical cycle to determine the N-H bond dissociation energy of 2H-1,2,3-triazole to be 112.2 +/- 0.6 kcal mol-1. The 363.8 nm photoelectron spectroscopic measurements have identified the other three product ions. Deprotonation of 1H-1,2,3-triazole at the C5 position initiates fragmentation of the ring structure to yield a minor product, the ketenimine anion. Another minor product, the iminodiazomethyl anion, is generated by deprotonation of 1H-1,2,3-triazole at the C4 position, followed by N1-N2 bond fission. Formation of the other minor product, the 2H-1,2,3-triazol-4-ide ion, can be rationalized by initial deprotonation of 1H-1,2,3-triazole at the N1-H site and subsequent proton exchanges within the ion-molecule complex. The EA of the 2H-1,2,3-triazol-4-yl radical is 1.865 +/- 0.004 eV.
International Nuclear Information System (INIS)
Jia, Li-Ping; Zhang, Qiang; Yan, Bing
2014-01-01
Graphical abstract: Lanthanide ions doped bare earth rare earth fluoride nanocrystals are synthesized by hydrothermal technology and characterized. The down/up-conversion luminescence of them are discussed. - Highlights: • Mixed hydrothermal system H 2 O–OA (EDA)–O-A(LO-A) is used for synthesis. • Barium rare earth fluoride nanocrystals are synthesized comprehensively. • Luminescence for down-conversion and up-conversion are obtained for these systems. - Abstract: Mixed hydrothermal system H 2 O–OA (EDA)–O-A(LO-A) is developed to synthesize barium rare earth fluorides nanocrystals (OA = oleylamine, EDA = ethylenediamine, O-A = oleic acid and LO-A = linoleic acid). They are presented as BaREF 5 (RE = Ce, Pr, Nd, Eu, Gd, Tb, Dy, Y, Tm, Lu) and Ba 2 REF 7 (RE = La, Sm, Ho, Er, Yb). The influence of reaction parameters (rare earth species, hydrothermal system and temperature) is checked on the phase and shape evolution of the fluoride nanocrystals. It is found that reaction time and temperature of these nanocrystals using EDA (180 °C, 6 h) is lower than those of them using OA (220 °C, 10 h). The photoluminescence properties of these fluorides activated by some rare earth ions (Nd 3+ , Eu 3+ , Tb 3+ ) are studied, and especially up-conversion luminescence of the four fluoride nanocrystal systems (Ba 2 LaF 7 :Yb, Tm(Er), Ba 2 REF 7 :Yb, Tm(Er) (RE = Gd, Y, Lu)) is observed
New method of synthesis and physical properties of thick superconducting Er-123 films
International Nuclear Information System (INIS)
Muralidhar, M.; Sakai, N.; Machi, T.; Miyajiri, T.; Hirabayashi, I.; Tanaka, S.
2008-01-01
We have developed a low-cost, short time manufacturing process using a novel method, starting from a mixture of Er 2 BaO 4 , BaCuO 2 , and CuO, with an excess of Er at expense of Ba. Several micrometers thick films were prepared by the screen-printing technique, spreading the mixture paste on silver substrates, processed then in Ar-1% O 2 atmosphere. Using a double-step annealing process, we obtained good quality Er-123 thick films on silver substrates, with T c (onset) 92 K. Formation of large flat grains was observed by scanning electron microscope. According to XRD analysis, the films were preferentially c-axis oriented. The magnetic (induced), self-field J c measured at 77 K was above 32 kA/cm 2 . We observed a strong dependence of the transport current, I c , on the grain size. The maximum I c at 77 K as high as 10 A was observed in the sample with the average grain size around 40 μm. The present results indicate that our technology, enabling preparation of large-area superconducting thick films on Ag-based substrates in short processing times, is relatively cheap and appropriate for utilization in long-length RE-123 silver sheath wire production for commercial applications
DEFF Research Database (Denmark)
Gammelgaard Nielsen, Anders
2011-01-01
The assignment known as ‘Earth and sky’ is the final first year course at Unit 1a. The aim of the assignment is to strengthen the student’s abilities to manage a project process individu- ally. The process involves develop- ing the ability to make independent decisions.The point of departure...... for the ‘Earth and sky’ assignment is ex- perience students acquired during their group study tour to Austra- lia. Building in particular on the re- search conducted on the Sydney Opera House and the architectur- al principles of spatial creation that this building represents....
Plasmon-phonon pairing mechanism and superconducting state parameters in layered mercury cuprates
International Nuclear Information System (INIS)
Varshney, D.; Tosi, M.P.
1999-06-01
An effective two-dimensional dynamic interaction is developed which incorporated screening of holes by plasmons and by optical phonons to discuss the nature of the pairing mechanism leading to superconductivity in layered mercury cuprates. The system is treated as an ionic solid containing layers of charge carriers and a model dielectric function is set up which fulfils the appropriate sum rules on the electronic and ionic polarizabilities. The values of the coupling strength and of the Coulomb interaction parameter indicate that the superconductor is in the strong coupling regime with effective screening of the charge carriers. The superconducting transition temperature of optically doped HgBa 2 CuO 4+δ is estimated as 94 K from Kresin's strong coupling theory and the energy gap ratio is substantially larger than the BCS value. The value of the isotope exponent is severely reduced below the BCS value. The implications of the model and its analysis are discussed. (author)
Raman scattering in cuprate superconductors : an analysis in the spin bag model
International Nuclear Information System (INIS)
Behera, S.N.; Gaitonde, D.M.
1992-01-01
The spin bag model for the high temperature superconductivity (SC) in the cuprates is reformulated, so that the spin density wave (SDW) collective mode mediated pairing interaction between the doped charge carriers, has a formal similarity to the usual phonon mediated BCS mechanism. The collective modes of the spin bag superconductor are calculated and the spectral density function for the amplitude mode is plotted. The self energy and the spectral density function of an optic phonon are calculated in the spin bag superconducting state. The spectral density function does not couple to the SDW-amplitude mode. A low frequency is shown to harden while the high frequency (greater than the SC-gap) one softens; which are features in qualitative agreement with the behaviour seen in the Raman data. When the phonon frequency is larger than the SC-gap, its spectral function shows a low frequency weak peak, attributed to the SC-gap excitation which is not observed experimentally. (author). 21 refs., 3 figs
Simple die pressing for making artificial holes in single-grain Gd1.5Ba2Cu3O7−y superconductors
International Nuclear Information System (INIS)
Kim, K-M; Park, S-D; Jun, B-H; Kim, C-J; Ko, T K
2012-01-01
The presence of artificial holes in single-grain REBa 2 Cu 3 O 7−y (RE123, RE: rare-earth elements) bulk superconductors can facilitate oxygen diffusion into superconducting grains through the increased surface area. In addition to the enhancement of oxygen diffusion, the mechanical properties and thermal conductivity of bulk superconductors can be improved by filling holes with a metallic conductive phase. This study presents a new and simple hole-making process for single-grain RE123 bulk superconductors. Artificial holes 3 or 5 mm in diameter were made for Gd 1.5 Ba 2 Cu 3 O 7−y (Gd1.5) powder compacts prior to the sintering/melt growth process using specially designed pressing dies. The die pressing neither induced cracking in powder compacts nor influenced thermal procedures for the Gd123 growth. Single-grain Gd1.5 bulk superconductors with holes were successfully fabricated by a top-seeded melt growth (TSMG) process using Gd1.5 powder compacts with holes. The die pressing was proven as a time-saving process in comparison with the conventional method which makes holes in sintered or melt-processed hard bodies by mechanical drilling. The detailed fabrication process of single-grain Gd1.5 bulk superconductor with holes, magnetic levitation forces, and magnetic flux density, estimated for the single-grain Gd123 bulk superconductors with holes, are reported. (paper)
Antiferromagnetic and superconducting gaps and their interrelation in high-Tc cuprates
International Nuclear Information System (INIS)
Arrigoni, E.; Zacher, M.G.; Eckl, T.; Hanke, W.
2003-01-01
We propose a phenomenological model, comprising a microscopic SO(5) model plus the on-site Hubbard interaction U (projected SO(5) model) to understand the interrelation between the d-wave-gap modulation observed by recent angle-resolved photoemission experiments in the insulating antiferromagnet Ca 2 CuO 2 Cl 2 and the d-wave gap of high-T c superconducting materials. The on-site interaction U is important in order to produce a Mott gap of the correct order of magnitude, which would be absent in an exact SO(5) theory. The projected SO(5)-model explains the gap characteristics, namely both the symmetry and the different order of magnitude of the gap modulations between the AF and the SCc phases. Furthermore, it is shown that the projected SO(5) theory can provide an explanation for a recent observation [E. Pavarini et al., Phys. Rev. Lett. 87, 47003 (2001)], i. e. that the maximum T c observed in a large variety of high-T c cuprates scales with the next-nearest-neighbor hopping matrix element t'. (Abstract Copyright [2003], Wiley Periodicals, Inc.)
Hot seeding using large Y-123 seeds
International Nuclear Information System (INIS)
Scruggs, S J; Putman, P T; Zhou, Y X; Fang, H; Salama, K
2006-01-01
There are several motivations for increasing the diameter of melt textured single domain discs. The maximum magnetic field produced by a trapped field magnet is proportional to the radius of the sample. Furthermore, the availability of trapped field magnets with large diameter could enable their use in applications that have traditionally been considered to require wound electromagnets, such as beam bending magnets for particle accelerators and electric propulsion. We have investigated the possibility of using large area epitaxial growth instead of the conventional point nucleation growth mechanism. This process involves the use of large Y123 seeds for the purpose of increasing the maximum achievable Y123 single domain size. The hot seeding technique using large Y-123 seeds was employed to seed Y-123 samples. Trapped field measurements indicate that single domain samples were indeed grown by this technique. Microstructural evaluation indicates that growth can be characterized by a rapid nucleation followed by the usual peritectic grain growth which occurs when large seeds are used. Critical temperature measurements show that no local T c suppression occurs in the vicinity of the seed. This work supports the suggestion of using an iterative method for increasing the size of Y-123 single domains that can be grown
12 CFR 225.123 - Activities closely related to banking.
2010-01-01
... 12 Banks and Banking 3 2010-01-01 2010-01-01 false Activities closely related to banking. 225.123 Section 225.123 Banks and Banking FEDERAL RESERVE SYSTEM (CONTINUED) BOARD OF GOVERNORS OF THE FEDERAL... Holding Companies Interpretations § 225.123 Activities closely related to banking. (a) Effective June 15...
Labeling and quality control of 123I-MIBG
International Nuclear Information System (INIS)
Figols de Barboza, Marycel Rosa
2002-01-01
This report describes a method to facilitate routine production of 123 I-MIBG in Radiopharmacy Centre of IPEN-CNEN/SP. Iodine-123 radioisotope is produced in the form of sodium iodide in Cyclone-30 (IBA) at IPEN-CNEN/SP through proton irradiation of gaseous 124 Xe target. The labelling procedure uses MIBG-sulphate and leads to 123 I-MIBG with radiochemical purity at least 98% and specific activity of 300-380 MBq/mg
Lifescience Database Archive (English)
Full Text Available SF (Link to library) SFC123 (Link to dictyBase) - - - Contig-U16368-1 SFC123E (Link...) Clone ID SFC123 (Link to dictyBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U16368-1 Ori...CVPHHDGCGNIQCPWGHYCVNEHGKCRCVPHRPPPRPPVDQCRNQHCPH GYSCRVIKGCATCVRDARPPHNLCRGFGCPEGSHCEVLEKHPVCVRNHVPPHPPPPPQIC GSVNCGPGYICT...CRCVPHRPPPRPPVDQCRNQHCPH GYSCRVIKGCATCVRDARPPHNLCRGFGCPEGSHCEVLEKHPVCVRNHVPPHPPPPPQIC GSVNCGPGYICTIINGHPTCIR...(bits) Value N D13973 |D13973.1 Dictyostelium discoideum DNA for Dp87 protein, complete cds. 1643 0.0 5 BJ17
International Nuclear Information System (INIS)
Hara, Masafumi; Tomiguchi, Seiji; Kojima, Akihiro; Nakashima, Rumi; Ooyama, Youichi; Takahashi, Mutsumasa; Matsumoto, Masanori.
1994-01-01
123 I-IMP clearance on dynamic lung scintigraphy was studied by two exponential compartments analysis in order to evaluate the effects of aging and smoking on the pulmonary function. Twenty-four patients (14 smokers and 10 non-smokers), referred for 123 I-IMP brain perfusion study, underwent lung dynamic scintigraphy for 42 min immediately after 123 I-IMP injection. In the non-smoking group 123 I-IMP lung clearance was delayed with aging. A significant correlation was found between aging and clearance rate in the lung. There was also a significant difference in the clearance rates between smoker and non-smoker groups. These findings suggest that smoking and aging affect the pulmonary function. (author)
Recent developments in the field of 123I-radiopharmaceuticals
International Nuclear Information System (INIS)
Machulla, H.J.; Knust, E.J.
1984-01-01
Due to its advantageous nuclear physical properties iodine-123 is an excellent label for radiopharmaceuticals very well suited for measurements by γ-cameras and single-photon emission tomography. The development of 123 I-radiopharmaceuticals should be based on a clear biochemical concept, reliable labelling procedures and careful pharmacokinetic studies in order to evaluate the physiological behaviour of the radioiodinated compounds being analogues of metabolic substrates. The development of 123 I-labelled fatty acids and biogenic amines clearly proved the successful use of 123 I for labelling compounds applied in medical diagnosis. (orig.) [de
40 CFR 123.46 - Individual control strategies.
2010-07-01
... 40 Protection of Environment 21 2010-07-01 2010-07-01 false Individual control strategies. 123.46... PROGRAM REQUIREMENTS Transfer of Information and Permit Review § 123.46 Individual control strategies. (a..., approval, and implementation an individual control strategy for each point source identified by the State...
Preparing rare earth-silicon-iron-aluminum alloys
International Nuclear Information System (INIS)
Marchant, J.D.; Morrice, E.; Herve, B.P.; Wong, M.M.
1980-01-01
As part of its mission to assure the maximum recovery and use of the Nation's mineral resources, the Bureau of Mines, investigated an improved procedure for producing rare earth-silicon alloys. For example, a charge consisting of 681 grams of mixed rare-earth oxides, 309 grams of ferrosilicon (75 wt-pct Si), and 182 grams of aluminum metal along with a flux consisting of 681 grams of CaO and 45 grams of MgO was reacted at 1500 0 C in an induction furnace. Good slag-metal separation was achieved. The alloy product contained, in weight-percent, 53 RE, 28 Si, 11 Fe, and 4 Al with a rare earth recovery of 80 pct. In current industrial practice rare earth recoveries are usually about 60 pct in alloy products that contain approximately 30 wt-pct each of rare earths and silicon. Metallurgical evaluations showed the alloys prepared in this investigation to be as effective in controlling the detrimental effect of sulfur in steel and cast iron as the commercial rare earth-silicon-iron alloys presently used in the steel industry
Thermochemical Properties of the Complexes RE(HSal)3·2H2O (RE=La, Ce, Pr, Nd, Sm)
Institute of Scientific and Technical Information of China (English)
无
2006-01-01
Five solid rare earth salicylate complexes were synthesized by low hydrated lathanide chloride and salicylic acid. The complexes in this experiment were identified as the general formula RE(Hsal)3·2H2O(RE=La, Ce, Pr, Nd, Sm) by elemental analysis and EDTA volumetric analysis. IR spectra of the complexes show that carboxyl of salicylic acid coordinates to RE3+ ions. Electrochemical behaviors of the complexes on the glass-carbon electrode were researched with cyclic voltammetry (CV). It is indicated that the electrochemical process of the complexes is a one-electron redox process and the electrochemical reversibility of complexes is less than that of the lanthanide chlorides. The constant-volume combustion energies of complexes, ΔcU, were determined with a precise rotating-bomb calorimeter at 298.15 K. Their standard molar enthalpies of combustion, ΔcHθm, and standard molar enthalpies of formation, ΔfHθm, were calculated.
Investigation of 123I production using electron accelerator
International Nuclear Information System (INIS)
Avetisyan, Albert; Avagyan, Robert; Dallakyan, Ruben; Avdalyan, Gohar; Dobrovolsky, Nikolay; Gavalyan, Vasak; Kerobyan, Ivetta; Harutyunyan, Gevorg
2017-01-01
The possibility of 123 I isotope production with the help of the high-intensity bremsstrahlung photons produced by the electron beam of the LUE50 linear electron accelerator at the A.I. Alikhanyan National Science Laboratory (Yerevan Physics Institute [YerPhI]) is considered. The production method has been established and shown to be successful. The 124 Xe(γ,n) 123 Xe → 123 I nuclear reaction has been investigated and the cross-section was calculated by nuclear codes TALYS 1.6 and EMPIRE 3.2. The optimum parameter of the thickness of the target was determined by GEANT4 code. For the normalized yield of 123 I, the value of 143 Bq/(mg·μA·h) has been achieved.
Energy Technology Data Exchange (ETDEWEB)
Uchiyama, Mayuki; Sue, Hironari; Fukumitsu, Nobuyoshi; Mori, Yutaka; Kawakami, Kenji [Jikei Univ., Tokyo (Japan). School of Medicine
1997-01-01
{sup 123}I-Iomazenil ({sup 123}I-IMZ) and {sup 123}I-IMP imaging were performed in 5 patients with anxiety disorder (PAD) and 6 normal volunteers (NV). On {sup 123}I-IMZ delayed imaging, the 2 PAD showed abnormally decreased findings. In anxiety disorder, decreased accumulation on {sup 123}I-IMZ delayed images was seen in left hippocampus and parahippocampal gyrus in one patient, in right frontal and temporal lobe and left occipital pole in the other. Compared with NV, PAD had lower {sup 123}I-IMZ uptake on delayed image in right upper and left lower frontal cortices, indicating the involvement of the benzodiazepine receptor complex in anxiety disorder. Compared with grading for anxiety disorder with Hamilton anxiety scale (HAS) and delayed to early count ratios of {sup 123}I-IMZ, negative correlation (R<-0.7) was recognized hippocampus and parahippocampal gyrus, frontal and occipital cortices. Compared between HAS and the count ratio to the cerebellum on {sup 123}I-IMP image, positive correlation (R>0.7) was recognized in the hippocampus, the parahippocampal gyrus, the lower outer temporal cortex and the lower frontal cortex. (author)
Monte Carlo studies of diamagnetism and charge density wave order in the cuprate pseudogap regime
Hayward Sierens, Lauren; Achkar, Andrew; Hawthorn, David; Melko, Roger; Sachdev, Subir
2015-03-01
The pseudogap regime of the hole-doped cuprate superconductors is often characterized experimentally in terms of a substantial diamagnetic response and, from another point of view, in terms of strong charge density wave (CDW) order. We introduce a dimensionless ratio, R, that incorporates both diamagnetic susceptibility and the correlation length of CDW order, and therefore reconciles these two fundamental characteristics of the pseudogap. We perform Monte Carlo simulations on a classical model that considers angular fluctuations of a six-dimensional order parameter, and compare our Monte Carlo results for R with existing data from torque magnetometry and x-ray scattering experiments on YBa2Cu3O6+x. We achieve qualitative agreement, and also propose future experiments to further investigate the behaviour of this dimensionless ratio.
Characterization of magnetization processes in nanostructured rare earth-transition metal films
International Nuclear Information System (INIS)
Zheng Guangping; Zhan Yangwen; Liu Peng; Li Mo
2003-01-01
We synthesize rare earth-transition metal (RE-TM) amorphous films using the electrodeposition method (RE=Nd, Gd and TM=Co). Nanocrystructured RE-TM films are prepared by thermal treatment of as-synthesized films below the glass-crystal transition temperature. Based on the magnetoelastic effect, the magnetization processes in nanostructured samples are characterized by acoustic internal friction measurements using the vibrating-reed technique. Since internal friction and the Young's modulus are sensitive to grain boundary and magnetic domains movement, this technique seems to characterize the effects of nanostructures on the magnetization processes in RE-TM films well. We find that the magnetoelastic effect in nanostructured RE-TM film increases with an increase in grain size
7 CFR 1955.123 - Sale procedures (chattel).
2010-01-01
... 7 Agriculture 14 2010-01-01 2009-01-01 true Sale procedures (chattel). 1955.123 Section 1955.123 Agriculture Regulations of the Department of Agriculture (Continued) RURAL HOUSING SERVICE, RURAL BUSINESS... be notified of the opportunity to appeal in accordance with subpart B of part 1900 of this chapter...
40 CFR 123.23 - Attorney General's statement.
2010-07-01
... 40 Protection of Environment 21 2010-07-01 2010-07-01 false Attorney General's statement. 123.23... PROGRAM REQUIREMENTS State Program Submissions § 123.23 Attorney General's statement. (a) Any State that seeks to administer a program under this part shall submit a statement from the State Attorney General...
9 CFR 113.123 - Salmonella Dublin Bacterin.
2010-01-01
... 9 Animals and Animal Products 1 2010-01-01 2010-01-01 false Salmonella Dublin Bacterin. 113.123... Inactivated Bacterial Products § 113.123 Salmonella Dublin Bacterin. Salmonella Dublin Bacterin shall be prepared from a culture of Salmonella dublin which has been inactivated and is nontoxic. Each serial of...
Energy Technology Data Exchange (ETDEWEB)
Henggeler, W [Paul Scherrer Inst. (PSI), Villigen (Switzerland)
1997-12-31
Cuprate materials containing rare earth ions were studied. The main experimental tools were inelastic and elastic neutron scattering techniques. Some {mu}SR, susceptibility and specific heat measurements were also performed. One aim was to learn more about the crystalline environment of the rare earth ions in these substances via the crystalline electric field (CEF) interaction. Furthermore, we investigated the correlations of the magnetic moments of these ions by a determination of the dispersion of the CEF excitations. The theory that is essential for the understanding of this work is outlined. The instruments on which the experiments have been performed are presented. We show the measurements of the CEF excitations of Ho{sup 3+} in Y{sub 0.99}Ho{sub 0.01}Ba{sub 2}Cu{sub 3}O{sub 6+x}. The Ho ions represent ideal local probes to examine changes of the charge distribution in the copper oxide planes upon doping with oxygen. To prevent any influence of the Ho-Ho exchange interaction on the CEF excitations we performed the experiments on substances containing only one percent of Ho. Our results show that for all the intermediately doped compounds the charge distribution is very inhomogeneous. For all the highly doped samples we observe a line asymmetry for which several possible origins are discussed. We examine the Pr{sup 3+} CEF excitations in the Pr{sub 2-x}Ce{sub x}CuO{sub 4(-{delta})} (0{<=}x{<=}0.2)-substances. Our results show a coexistence of different environments of the Pr ions in all the doped compounds. We try to describe these inhomogeneities with the help of a model. We used the {mu}SR-technique on some of these samples in order to learn more about the oxygen reduction process. Finally, we performed inelastic neutron scattering experiments on Pr{sub 1.86}Ce{sub 0.14}CuO{sub 4} single crystal, which allowed a direct determination of the coupling constants between the magnetic moments of the Pr ions. (author) figs., tabs., 93 refs.
Energy Technology Data Exchange (ETDEWEB)
Henggeler, W. [Paul Scherrer Inst. (PSI), Villigen (Switzerland)
1996-12-31
Cuprate materials containing rare earth ions were studied. The main experimental tools were inelastic and elastic neutron scattering techniques. Some {mu}SR, susceptibility and specific heat measurements were also performed. One aim was to learn more about the crystalline environment of the rare earth ions in these substances via the crystalline electric field (CEF) interaction. Furthermore, we investigated the correlations of the magnetic moments of these ions by a determination of the dispersion of the CEF excitations. The theory that is essential for the understanding of this work is outlined. The instruments on which the experiments have been performed are presented. We show the measurements of the CEF excitations of Ho{sup 3+} in Y{sub 0.99}Ho{sub 0.01}Ba{sub 2}Cu{sub 3}O{sub 6+x}. The Ho ions represent ideal local probes to examine changes of the charge distribution in the copper oxide planes upon doping with oxygen. To prevent any influence of the Ho-Ho exchange interaction on the CEF excitations we performed the experiments on substances containing only one percent of Ho. Our results show that for all the intermediately doped compounds the charge distribution is very inhomogeneous. For all the highly doped samples we observe a line asymmetry for which several possible origins are discussed. We examine the Pr{sup 3+} CEF excitations in the Pr{sub 2-x}Ce{sub x}CuO{sub 4(-{delta})} (0{<=}x{<=}0.2)-substances. Our results show a coexistence of different environments of the Pr ions in all the doped compounds. We try to describe these inhomogeneities with the help of a model. We used the {mu}SR-technique on some of these samples in order to learn more about the oxygen reduction process. Finally, we performed inelastic neutron scattering experiments on Pr{sub 1.86}Ce{sub 0.14}CuO{sub 4} single crystal, which allowed a direct determination of the coupling constants between the magnetic moments of the Pr ions. (author) figs., tabs., 93 refs.
Energy Technology Data Exchange (ETDEWEB)
Schneider, Lilli; Kuepper, Karsten [Physics Department, University of Osnabrueck (Germany); Rinkel, Thorben; Haase, Markus [Institute of Chemistry, University of Osnabrueck (Germany); Chrobak, Artur [Institute of Physics, University of Silesia (Poland)
2014-07-01
Rare earth (RE) based nanoparticles of type NaREF{sub 4} have attracted lot of attention in the last few years due to their upconverting luminescence. Here, we want to concentrate on electronic and magnetic properties of NaREF{sub 4}/NaGdF{sub 4} nanocrystals, since the magnetic behaviour of these fluorescent nanoparticles are of utmost importance from fundamental and applicative point of view as well. Hexagonal β-phase nanocrystals (3-22 nm) were prepared and characterized by X-ray powder diffraction (XRD) and transmission electron microscopy (TEM). A detailed study of the electronic structure and magnetic coupling phenomena of the different core-shell nanoparticles is performed using X-ray photoelectron spectroscopy (XPS), magnetometry (SQUID) and X-ray magnetic circular dichroism (XMCD). First SQUID measurements of NaEuF{sub 4}/NaGdF{sub 4} core-shell nanoparticles show butterfly shaped hysteresis loops at low temperature (2 K) in contrast to superparamagnetic behaviour observed for the corresponding ''pure'' NaEuF{sub 4} and NaGdF{sub 4} nanoparticles.
International Nuclear Information System (INIS)
Cursino, Ana Cristina Trindade; Rives, Vicente; Arizaga, Gregorio Guadalupe Carbajal; Trujillano, Raquel; Wypych, Fernando
2015-01-01
Rare earth (RE = Eu, Y and Tb) and zinc layered hydroxide salts intercalated with nitrate anions were synthesized, followed by exchange with 2-aminobenzoate. The UV absorption ability was improved after intercalation/grafting in relation to that shown by the parent material. - Highlights: • Rare earth (RE = Eu, Y and Tb) and zinc layered hydroxide were synthesized. • Intercalated nitrate anions were exchanged by 2-aminobenzoate. • In all the 2-aminobenzoate containing compounds, the grafting reaction was detected. • The UV absorption ability was improved after the exchange reactions. • Rare earth hydroxide salts are potential matrixes to produce luminescent materials. - Abstract: Rare earth (RE = Eu, Y and Tb) and zinc layered hydroxide salts intercalated with nitrate anions were synthesized, followed by exchange with 2-aminobenzoate. The obtained compounds were characterized by powder X-ray diffraction (PXRD), Fourier transform infrared (FTIR) and ultraviolet visible (UV–vis) spectroscopies, fluorescence measurements and thermal analysis (TGA/DTA). The results from FTIR spectroscopy suggest a direct coordination of 2-aminobenzoate to the metal cations of the inorganic layered structure. The organic derivative products from the intercalation reactions absorb a broader range of UV-light in relation to that shown by the parent material; the photoluminescence measurements present a strong violet, blue and green luminescence under UV-light excitation for layered compounds with, Zn, Y and Tb, respectively. Rare earth hydroxide salts (RE-LHS) are potential alternative matrices for the immobilization of organic species to produce luminescent materials
Energy Technology Data Exchange (ETDEWEB)
Cursino, Ana Cristina Trindade, E-mail: anacursino@ufpr.br [CEPESQ – Research Centre of Applied Chemistry, Department of Chemistry, Universidade Federal do Paraná – P.O. Box 19081, 81531-980 Curitiba, PR (Brazil); Rives, Vicente, E-mail: vrives@usal.es [GIR-QUESCAT – Department of Inorganic Chemistry, Universidad de Salamanca, Plaza de la Merced S/N, 37998 Salamanca (Spain); Arizaga, Gregorio Guadalupe Carbajal, E-mail: gregoriocarbajal@yahoo.com.mx [Universidad de Guadalajara, Department of Chemistry, Boulevard Marcelino García Barragán 1421, C.P. 44430 Guadalajara, Jalisco (Mexico); Trujillano, Raquel, E-mail: rakel@usal.es [GIR-QUESCAT – Department of Inorganic Chemistry, Universidad de Salamanca, Plaza de la Merced S/N, 37998 Salamanca (Spain); Wypych, Fernando, E-mail: wypych@ufpr.br [CEPESQ – Research Centre of Applied Chemistry, Department of Chemistry, Universidade Federal do Paraná – P.O. Box 19081, 81531-980 Curitiba, PR (Brazil)
2015-10-15
Rare earth (RE = Eu, Y and Tb) and zinc layered hydroxide salts intercalated with nitrate anions were synthesized, followed by exchange with 2-aminobenzoate. The UV absorption ability was improved after intercalation/grafting in relation to that shown by the parent material. - Highlights: • Rare earth (RE = Eu, Y and Tb) and zinc layered hydroxide were synthesized. • Intercalated nitrate anions were exchanged by 2-aminobenzoate. • In all the 2-aminobenzoate containing compounds, the grafting reaction was detected. • The UV absorption ability was improved after the exchange reactions. • Rare earth hydroxide salts are potential matrixes to produce luminescent materials. - Abstract: Rare earth (RE = Eu, Y and Tb) and zinc layered hydroxide salts intercalated with nitrate anions were synthesized, followed by exchange with 2-aminobenzoate. The obtained compounds were characterized by powder X-ray diffraction (PXRD), Fourier transform infrared (FTIR) and ultraviolet visible (UV–vis) spectroscopies, fluorescence measurements and thermal analysis (TGA/DTA). The results from FTIR spectroscopy suggest a direct coordination of 2-aminobenzoate to the metal cations of the inorganic layered structure. The organic derivative products from the intercalation reactions absorb a broader range of UV-light in relation to that shown by the parent material; the photoluminescence measurements present a strong violet, blue and green luminescence under UV-light excitation for layered compounds with, Zn, Y and Tb, respectively. Rare earth hydroxide salts (RE-LHS) are potential alternative matrices for the immobilization of organic species to produce luminescent materials.
International Nuclear Information System (INIS)
Zaanen, J.; Horbach, M.L.; van Saarloos, W.
1996-01-01
Evidence is accumulating that the electron liquid in the cuprate superconductors is characterized by many-hole correlations of the charged magnetic domain-wall type. Here we focus on the strong-coupling limit where all holes are bound to domain walls. We assert that at high temperatures a classical domain-wall fluid is realized and show that the dynamics of such a fluid is characterized by spatial and temporal crossover scales set by temperature itself. The fundamental parameters of this fluid are such that the domain-wall motions dominate the low-frequency spin fluctuations and we derive predictions for the behavior of the dynamical magnetic susceptibility. We argue that a crossover occurs from a high-temperature classical to a low-temperature quantum regime, in direct analogy with helium. We discuss some general characteristics of the domain-wall quantum liquid, realized at low temperatures. copyright 1996 The American Physical Society
Gabovich, Alexander M.; Voitenko, Alexander I.
2016-10-01
The state of the art concerning tunnel measurements of energy gaps in cuprate oxides has been analyzed. A detailed review of the relevant literature is made, and original results calculated for the quasiparticle tunnel current J(V) between a metallic tip and a disordered d-wave superconductor partially gapped by charge density waves (CDWs) are reported, because it is this model of high-temperature superconductors that becomes popular owing to recent experiments in which CDWs were observed directly. The current was calculated suggesting the scatter of both the superconducting and CDW order parameters due to the samples' intrinsic inhomogeneity. It was shown that peculiarities in the current-voltage characteristics inherent to the case of homogeneous superconducting material are severely smeared, and the CDW-related features transform into experimentally observed peak-dip-hump structures. Theoretical results were used to fit data measured for YBa2Cu3O7-δ and Bi2Sr2CaCu2O8+δ. The fitting demonstrated a good qualitative agreement between the experiment and model calculations. The analysis of the energy gaps in high-Tc superconductors is important both per se and as a tool to uncover the nature of superconductivity in cuprates not elucidated so far despite of much theoretical effort and experimental progress.
16 CFR 1.23 - Quantity limit rules.
2010-01-01
... 16 Commercial Practices 1 2010-01-01 2010-01-01 false Quantity limit rules. 1.23 Section 1.23 Commercial Practices FEDERAL TRADE COMMISSION ORGANIZATION, PROCEDURES AND RULES OF PRACTICE GENERAL... Robinson-Patman Act. These rules have the force and effect of law. [32 FR 8444, June 13, 1967. Redesignated...
Modulation-free bismuth-lead cuprate superconductors: BiPbSr1+xL1-xCuO6 and BiPbSr2Y1-xCaxCu2O8
International Nuclear Information System (INIS)
Manivannan, V.; Gopalakrishnan, J.; Rao, C.N.R.
1991-01-01
Modulation-free BiPbSrLCuO 6 (L=La, Pr, Nd) and BiPbSr 2 YCu 2 O 8 , which are isotypic with the n=1 and 2 members of the Bi 2 Sr 2 Ca n-1 Cu n O 2n+4 family, have been prepared and characterized. These parent compounds are nonsuperconducting, but when doped with holes by substitution chemistry give modulation-free superconducting cuprates of the general formulas BiPbSr 1+xL1-x CuO 6 and BiPbSr 2 Y 1-x Ca x Cu 2 O 8 , exhibiting maximum T c 's of 24 and 85 K, respectively. Significantly, the hole concentration at the maximum T c is 0.12 in the cuprate family with a single Cu-O layer and 0.22 in that with two Cu-O layers
V123 Beam Synchronous Encoder Module
International Nuclear Information System (INIS)
Kerner, T.; Conkling, C. R.; Oerter, B.
1999-01-01
The V123 Synchronous Encoder Module transmits events to distributed trigger modules and embedded decoders around the RHIC rings where they are used to provide beam instrumentation triggers [1,2,3]. The RHIC beam synchronous event link hardware is mainly comprised of three VMEbus board designs, the central input modules (V201), and encoder modules (V123), and the distributed trigger modules (V124). Two beam synchronous links, one for each ring, are distributed via fiberoptic and fanned out via twisted wire pair cables. The V123 synchronizes with the RF system clock derived from the beam bucket frequency and a revolution fiducial pulse. The RF system clock is used to create the beam synchronous event link carrier and events are synchronized with the rotation fiducial. A low jitter RF clock is later recovered from this carrier by phase lock loops in the trigger modules. Prioritized hardware and software triggers fill up to 15 beam event code transmission slots per revolution while tracking the ramping RF acceleration frequency and storage frequency. The revolution fiducial event is always the first event transmitted which is used to synchronize the firing of the abort kicker and to locate the first bucket for decoders distributed about the ring
Energy Technology Data Exchange (ETDEWEB)
Ozawa, Masakuni [Ceramics Research Laboratory, Nagoya Institute of Technology, Tajimi, 507-0071 Gifu (Japan)]. E-mail: ozawa@crl.nitech.ac.jp; Onoe, Ryota [Ceramics Research Laboratory, Nagoya Institute of Technology, Tajimi, 507-0071 Gifu (Japan); Kato, Hajime [Ceramics Research Laboratory, Nagoya Institute of Technology, Tajimi, 507-0071 Gifu (Japan)
2006-02-09
Formation and thermal decomposition of rare earth (RE = La, Ce, Pr) hydroxides and oxides by homogeneous precipitation using hexamethylenetetramine. The precipitatates were examined using thermal gravimetry and differential thermal analysis, infrared spectrometry and X-ray diffraction. The as-precipitated powders from the present process were La(OH){sub 3}, CeO{sub 2}, Pr(OH){sub 3}. In the case of Ce, a cubic fluorite phase of cerium dioxide was directly obtained. The lanthanum trihydroxide decomposed to oxides via three steps. Two-step dehydration decomposition behavior at 340 and 500 {sup o}C was observed as La(OH){sub 3} {sup {yields}} LaOOH + H{sub 2}O and 2LaOOH {sup {yields}} La{sub 2}O{sub 3} + H{sub 2}O. The activation energy ({delta}H) for dehydration was 240 and 244 kJ/mol, respectively. The additional decomposition of carbonate-containing species was observed at 670 {sup o}C with {delta}H of 390 kJ/mol. Pr(OH){sub 3} did not show additional TGA profile of carbonate decomposition. Since no carbonate species form in solution during the HMT precipitation (hydrolysis of this molecule), the difference between La and Pr depends on the strength of basicity in the reaction with CO{sub 2} after precipitation.
Treglia, Giorgio; Cason, Ernesto; Cortelli, Pietro; Gabellini, Anna; Liguori, Rocco; Bagnato, Antonio; Giordano, Alessandro; Fagioli, Giorgio
2014-01-01
To compare myocardial sympathetic imaging using (123)I-Metaiodobenzylguanidine (MIBG) scintigraphy and striatal dopaminergic imaging using (123)I-Ioflupane (FP-CIT) single photon emission computed tomography (SPECT) in patients with suspected Lewy body diseases (LBD). Ninety-nine patients who performed both methods within 2 months for differential diagnosis between Parkinson's disease (PD) and other parkinsonism (n = 68) or between dementia with Lewy bodies (DLB) and other dementia (n = 31) were enrolled. Sensitivity, specificity, accuracy, positive and negative predictive values of both methods were calculated. For (123) I-MIBG scintigraphy, the overall sensitivity, specificity, accuracy, positive and negative predictive values in LBD were 83%, 79%, 82%, 86%, and 76%, respectively. For (123)I-FP-CIT SPECT, the overall sensitivity, specificity, accuracy, positive and negative predictive values in LBD were 93%, 41%, 73%, 71%, and 80%, respectively. There was a statistically significant difference between these two methods in patients without LBD, but not in patients with LBD. LBD usually present both myocardial sympathetic and striatal dopaminergic impairments. (123)I-FP-CIT SPECT presents high sensitivity in the diagnosis of LBD; (123)I-MIBG scintigraphy may have a complementary role in differential diagnosis between PD and other parkinsonism. These scintigraphic methods showed similar diagnostic accuracy in differential diagnosis between DLB and other dementia. Copyright © 2012 by the American Society of Neuroimaging.
X-ray Absorption Spectroscopy of the Rare Earth orthophosphates
International Nuclear Information System (INIS)
Shuh, D.K.; Terminello, L.J.; Boatner, L.A.; Abraham, M.M.
1993-06-01
X-ray Absorption Spectroscopy (XAS) of the Rare Earth (RE) 3d levels yields sharp peaks near the edges as a result of strong, quasi-atomic 3d 10 4f n → 3d- 9 4f n+1 transitions and these transitions exhibit a wealth of spectroscopic features. The XAS measurements of single crystal REPO 4 (RE = La, Ce, Pr, Nd, Sm, Eu, Gd, Tb, Dy, Er) at the 3d edge were performed in the total yield mode at beam line 8-2 at the Stanford Synchrotron Radiation Laboratory (SSRL). The XAS spectra of the RE ions in the orthophosphate matrix generally resemble the XAS of the corresponding RE metal. This is not unexpected and emphasizes the major contribution of the trivalent state to the electronic transitions at the RE 3d edges. These spectra unequivocally identify the transitions originating from well-characterized RE cores and correlate well with previous theoretical investigations
50 CFR 14.123 - Care in transit.
2010-10-01
... 50 Wildlife and Fisheries 1 2010-10-01 2010-10-01 false Care in transit. 14.123 Section 14.123 Wildlife and Fisheries UNITED STATES FISH AND WILDLIFE SERVICE, DEPARTMENT OF THE INTERIOR TAKING... transit. (a) A primate shall be observed for signs of distress and given food and water according to the...
27 CFR 22.123 - Losses on premises.
2010-04-01
... 27 Alcohol, Tobacco Products and Firearms 1 2010-04-01 2010-04-01 false Losses on premises. 22.123... OF THE TREASURY LIQUORS DISTRIBUTION AND USE OF TAX-FREE ALCOHOL Losses § 22.123 Losses on premises. (a) Recording of losses. A permittee shall determine and record, in the records prescribed by subpart...
17 CFR 12.3 - Business address; hours.
2010-04-01
... REPARATIONS General Information and Preliminary Consideration of Pleadings § 12.3 Business address; hours. The... 17 Commodity and Securities Exchanges 1 2010-04-01 2010-04-01 false Business address; hours. 12.3..., DC 20581. It is open each day, except Saturdays, Sundays, and legal public holidays, from 8:15 a.m...
Energy Technology Data Exchange (ETDEWEB)
Qu, Yan-rong; Lin, Xue-mei; Wang, Ai-ling; Wang, Zhong-xia; Kang, Jie; Chu, Hai-bin, E-mail: binghai99@gmail.com; Zhao, Yong-liang, E-mail: hxzhaoyl@163.com
2014-10-15
Twelve kinds of rare earth complexes were synthesized using halo-benzoic acid as anion ligand and Sm{sup 3+} and Dy{sup 3+} as central ions, respectively. The complexes were characterized by elemental analysis, rare earth coordination titration and electrospray ionization mass spectra, from which the compositions of the complexes were confirmed to be RE(p-FBA){sub 3}·H{sub 2}O, RE(p-ClBA){sub 3}·2H{sub 2}O, RE(p-BrBA){sub 3}·H{sub 2}O, RE(o-FBA){sub 3}·2H{sub 2}O, RE(o-ClBA){sub 3}·H{sub 2}O, RE(o-BrBA){sub 3}·H{sub 2}O (RE=Sm{sup 3+}, Dy{sup 3+}). Besides, IR spectra and UV–visible absorption spectroscopy indicated that the carboxyl oxygen atoms of ligands coordinated to the rare earth ions. Moreover, Ag@SiO{sub 2} core–shell nanoparticles (NPs) were prepared via a modified Stöber method. The average diameters of silver cores were typically between 60 nm and 70 nm, and the thicknesses of the SiO{sub 2} shells were around 10 nm, 15 nm and 25 nm, respectively. The influence of Ag@SiO{sub 2} NPs on the luminescence properties of the rare earth complexes showed that the luminescence intensities of rare earth complexes were enhanced remarkably. As the thickness of SiO{sub 2} shell increases in the range of 10–25 nm, the effect of metal-enhanced fluorescence become obvious. The mechanism of the changes of the fluorescence intensity is also discussed. - Highlights: • Among 10–25 nm, the thicker the shell thickness, the better the fluorescence effect. • The strong the intensity of the pure complexes, the smaller the multiple enhanced. • The intensity of Sm(p-BrBA){sub 3}·H{sub 2}O is the strongest among Sm(p-XBA){sub 3}·nH{sub 2}O complexes. • The intensity of Dy(p-ClBA){sub 3}·2H{sub 2}O is the strongest among Dy(p-XBA){sub 3}·nH{sub 2}O complexes. • When halogen is in o-position, the intensity of RE(o-ClBA){sub 3}·H{sub 2}O is the strongest.
International Nuclear Information System (INIS)
Kuang Qin; Lin Zhiwei; Lian Wei; Jiang Zhiyuan; Xie Zhaoxiong; Huang Rongbin; Zheng Lansun
2007-01-01
In this paper, we report a versatile synthetic method of ordered rare-earth metal (RE) oxide nanotubes. RE (RE=Y, Ce, Pr, Nd, Sm, Eu, Gd, Tb, Dy, Ho, Er, Yb) oxide nanotubes were successfully prepared from corresponding RE nitrate solution via the sol-gel method assisted with porous anodic aluminum oxide (AAO) templates. Scanning electron microscopy (SEM), transmission electron microscopy (TEM), high-resolution TEM, and X-ray diffraction (XRD) have been employed to characterize the morphology and composition of the as-prepared nanotubes. It is found that as-prepared RE oxides evolve into bamboo-like nanotubes and entirely hollow nanotubes. A new possible formation mechanism of RE oxide nanotubes in the AAO channels is proposed. These high-quantity RE oxide nanotubes are expected to have promising applications in many areas such as luminescent materials, catalysts, magnets, etc. - Graphical abstract: A versatile synthetic method for the preparation of ordered rare-earth (RE) oxide nanotubes is reported, by which RE (RE=Y, Ce, Pr, Nd, Sm, Eu, Gd, Tb, Dy, Ho, Er, Yb) oxide nanotubes were successfully prepared from corresponding RE nitrate solution via the sol-gel method assisted with porous anodic aluminum oxide (AAO) templates
Fujita, Masaki; Tsutsumi, Kenji; Miura, Tomohiro; Danilkin, Sergey
2018-03-01
We studied Ca-doping effect on spin correlations in T‧-structured cuprate oxide RE2CuO4 (RE: rear earth) with growing a sizable single crystal of Pr2‑x Ca x CuO4 (x=0.05 and 0.10) as well as synthesizing powder samples of Pr1.90Ca0.10CuO4 and Eu1.90Ca0.10CuO4. In the all as-prepared and annealed samples, no evidence of shielding signal associated with superconductivity was observed by magnetic susceptibility measurement. Elastic neutron scattering measurements on the as-grown Pr1.90Ca0.10CuO4 clarified the existence of long-ranged magnetic order with commensurate spin correlation. The ordering temperature was determined to be ∼290K, which is comparable to Néel temperature in the parent compound of Pr2CuO4. The existence of commensurate low-energy spin excitation was also confirmed by inelastic neutron scattering measurements for the annealed Pr1.95Ca0.05CuO4. These results strongly suggest a negligible Ca-doping effect on the physical properties in T‧-RE2CuO4, which is quite different from the drastic doping evolution of magnetism in T -RE2CuO4.
Song, Dongjoon; Han, Garam; Kyung, Wonshik; Seo, Jeongjin; Cho, Soohyun; Kim, Beom Seo; Arita, Masashi; Shimada, Kenya; Namatame, Hirofumi; Taniguchi, Masaki; Yoshida, Y.; Eisaki, H.; Park, Seung Ryong; Kim, C.
2017-03-01
We performed annealing and angle resolved photoemission spectroscopy studies on electron-doped cuprate Pr1 -xLaCex CuO4 -δ (PLCCO). It is found that the optimal annealing condition is dependent on the Ce content x . The electron number (n ) is estimated from the experimentally obtained Fermi surface volume for x =0.10 , 0.15 and 0.18 samples. It clearly shows a significant and annealing dependent deviation from the nominal x . In addition, we observe that the pseudo-gap at hot spots is also closely correlated with n ; the pseudogap gradually closes as n increases. We established a new phase diagram of PLCCO as a function of n . Different from the x -based one, the new phase diagram shows similar antiferromagnetic and superconducting phases to those of hole doped ones. Our results raise a possibility for absence of disparity between the phase diagrams of electron- and hole-doped cuprates
Separation of rare-earth (RE) ions by flotation with the aid of citric acid and hexadecylamine
International Nuclear Information System (INIS)
Skrylev, L.D.; Sazonova, V.F.; Pavlenko, S.N.; Karpenko, L.I.
1989-01-01
The aim of the present work was to develop further the flotation method for separating RE ions, namely, to examine the possibility of separating Re ions by converting them into citrate complexes and subsequently binding them with the aid of hexadecylamine in difficultly soluble and easily floatable compounds, sublates. Thus, these investigations showed that it is possible in principle to separate RE ions by conversion into citrate complexes followed by flotation separation of the latter from solutions with the aid of hexadecylamine
A Study on Electrochemical Reduction of Rare Earth Oxides in Molten LiCl-Li{sub 2}O Salt
Energy Technology Data Exchange (ETDEWEB)
Lee, Min Woo; Jeong, Sang Mun; Lee, See Hoon [Chungbook National University, Chungju (Korea, Republic of); Sohn, Jung Min [Chonbuk National University, Jeonju (Korea, Republic of)
2016-05-15
In this study, the electrochemical reduction of RE{sub 2}O{sub 3} (RE = Nd or Ce) has been conducted via co-reduction NiO to increase the reduction degree of the rare earth oxides in molten molten LiCl containing 1wt% Li{sub 2}O. The electrochemical reduction behavior of the mixed RE{sub 2}O{sub 3}-NiO oxide has been investigated and the reduction path of RE{sub 2}O{sub 3} has been proposed. An electorchemical spent fuel processing technology, pyroprocessing, has been developed for recycling of spent fuel to be applied to a sodium-cooled fast reactor. The spent fuel is reduced in the oxide reduction process. It is well known that the rare earth oxides are hardly reduced due to their electrochemical and thermodynamic stability. The rare earth oxides unreduced in the reduction process can cause problems via reaction with UCl{sub 3} in the electrorefiner. To tackle those problems, the electrochemical reduction of rare earth oxide has been conducted via co-reduction of NiO in LiCl molten salt containing 1 wt% Li{sub 2}O. The reduction of the oxide mixture starts from the reduction of NiO to Ni, followed by that of RE{sub 2}O{sub 3} on the produced Ni to form intermetallic RENi{sub 5}. The mixed oxide pellets were successfully reduced to the RENi5 alloy by constant electrolysis at 3.0 V at 650 .deg. C. The crucial aspect to these results is that the thermodynamically stable rare-earth oxide, Nd{sub 2}O{sub 3} was successfully converted to the metal in the presence of NiO.
Recycling of the rare earth oxides from spent rechargeable batteries using waste metallurgical slags
Directory of Open Access Journals (Sweden)
Tang K.
2013-01-01
Full Text Available A high temperature process for recycling spent nickel-metal hydride rechargeable batteries has been recently developed at SINTEF/NTNU. The spent battery modules were first frozen with liquid nitrogen for the de-activation and brittle fracture treatment. The broken steel scraps and plastics were then separated by the mechanical classification and magnetic separation. The remaining positive and negative electrodes, together with the polymer separator, were heated to 600-800oC in order to remove the organic components and further separate the Ni-based negative electrode. XRF analyses indicate that the heat-treated materials consist mainly of nickel, rare earth and cobalt oxides. The valuable rare earth oxides were further recovered by the high-temperature slagging treatment. The waste metallurgical slags, consist mainly of SiO2 and CaO, were used as the rare earth oxide absorbent. After the high temperature slagging treatment, over 98% of nickel and cobalt oxides were reduced to the metal phase; meanwhile almost all rare earth oxides remain in the molten slags. Furthermore, EPMA and XRF analyses of the slag samples indicate that the rare earth oxides selectively precipitate in the forms of solid xSiO2•yCaO•zRe2O3. The matrix of slag phase is Re2O3 deficient, typically being less than 5 wt%. This provides a sound basis to further develop the high-temperature process of concentrating the Re2O3 oxides in slags.
Interplay of superconductivity and magnetism in presence of inter sub-lattice effect in cuprates
International Nuclear Information System (INIS)
Bishoyi, K.C.; Mohapatra, S.P.; Rout, G.C.
2010-01-01
In the present communication, we report a model Hamiltonian to study the interplay between the two long range orders of anti-ferromagnetism (AFM) and superconductivity (SC) in cuprate superconductors in presence of the intersite pairing effect. The BCS type but non-phonon pairing mechanism is considered among the electrons of two equivalent Cu sites. The pairing among the electrons of two nearest neighbour non-equivalent Cu sites is included in the Hamiltonian and its effect on the interplay of SC and AFM is investigated. The Hamiltonian is solved by the Green's function method and the corresponding gap equations are calculated and solved self-consistently. The influence of model parameters like AFM coupling (λ), SC coupling (λ 1 ) and the coupling (λ 2 ) for intersite superconducting interactions on the gaps (SC and AFM) are studied numerically and the results are reported. (author)
Ohnishi, Ryota; Nakajima, Masamichi; Miyasaka, Shigeki; Tajima, Setsuko; Adachi, Tadashi; Ohgi, Taro; Takahashi, Akira; Koike, Yoji
2018-04-01
A recent progress of reduction process for electron-doped cuprates enabled us to get superconducting samples at very low doping levels. In order to clarify the electronic state of strongly reduced Pr1.3-xLa0.7CexCuO4+δ (x = 0.05, 0.10) which exhibit high Tc (˜27 K) superconductivity, we have measured their optical spectra. The reflectivity of these samples was found much higher than the published data for the moderately reduced and non-superconducting samples with the same Ce concentrations. Moreover, the estimated effective electron numbers Neff for x = 0.05 and 0.10 were close to that of the optimally doped and superconducting sample with x = 0.15. Given that the parent compound is a Mott insulator, these results indicate that in the electron-doped cuprates only a small amount of carrier doping changes the system to a high Tc superconductor with a large Fermi surface. At low temperatures, a broad mid-infrared peak appeared even in the superconducting samples.
Medical necessity for shorter lived radionuclides, specifically pure Iodine-123
International Nuclear Information System (INIS)
DeNardo, G.L.; DeNardo, S.J.; Hines, H.H.; Lagunas-Solar, M.C.; Jungerman, J.A.
1985-01-01
Iodine-123 has physical and radiochemical characteristics ideal for most tracer procedures performed in patients. Its use is generally preferable to the use of 131 I for diagnosis. The potential for 123 I can be realized only if a radiopharmaceutical of lesser radionuclide contamination is generally and economically available. Iodine-123 produced by direct methods has significant disadvantages relative to quality of procedure and radiation dosimetry. Our experience with 123 I(p,5n) during the past 12 years causes us to vigorously encourage general availability of an 123 I radiopharmaceutical of this quality. Using this product, the authors have prepared radiopharmaceuticals for use in the study of cancer, coagulation, and renal and thyroid diseases
Directory of Open Access Journals (Sweden)
Szymanek M.
2015-12-01
Full Text Available The aim of the studies described in this article was to present the effect of rare earth elements on aluminium alloys produced by an unconventional casting technique. The article gives characteristics of the thin strip of Al-Si-RE alloy produced by Rapid Solidification (RS. The effect of rare earth elements on structure refinement, i.e. on the size of near-eutectic crystallites in an aluminium-silicon alloy, was discussed. To determine the size of crystallites, the Scherrer X-ray diffraction method was used. The results presented capture relationships showing the effect of variable casting parameters and chemical composition on microstructure of the examined alloys. Rapid Solidification applied to Al-Si alloys with the addition of mischmetal (Ce, La, Ne, Pr refines their structure.
40 CFR 90.123 - Denial, revocation of certificate of conformity.
2010-07-01
... conformity. 90.123 Section 90.123 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) AIR... Emission Standards and Certification Provisions § 90.123 Denial, revocation of certificate of conformity... conformity if the Administrator finds any one of the following infractions to be substantial: (1) The engine...
Radioiodinated Rhodamine-123: a potential cationic hepatobiliary imaging agent
International Nuclear Information System (INIS)
Moonen, P.; Gorree, G.C.M.; Hoekstra, A.
1987-01-01
The labelling of the cationic dye Rhodamine-123 with 125 I is described. The biodistribution of the iodinated Rhodamine-123 has been determined at different time intervals after intravenous injection into fasted rats. It turned out that the dye is predominantly cleared by the liver and discharged into the bile. The bile acid taurocholate did not enhance the rate of excretion of 125 I-Rhodamine-123. (author)
Scintillation property of rare earth-free SnO-doped oxide glass
Masai, Hirokazu; Yanagida, Takayuki; Fujimoto, Yutaka; Koshimizu, Masanori; Yoko, Toshinobu
2012-01-01
The authors have demonstrated scintillation of rare earth (RE)-free Sn-doped oxide glass by excitation of ionizing radiation. It is notable that light emission is attained for RE-free transparent glass due to s[2]-sp transition of Sn[2+] centre and the emission correlates with the excitation band at 20 eV. We have also demonstrated that excitation band of emission centre can be tuned by the chemical composition of the host glass. The present result is valuable not only for design of RE-free i...
21 CFR 123.11 - Sanitation control procedures.
2010-04-01
... records are subject to the requirements of § 123.9. (d) Relationship to HACCP plan. Sanitation controls may be included in the HACCP plan, required by § 123.6(b). However, to the extent that they are monitored in accordance with paragraph (b) of this section they need not be included in the HACCP plan, and...
Imaging with 123I labelled fatty acids
International Nuclear Information System (INIS)
Dudczak, R.
1985-01-01
This report describes the clinical results obtained with radioiodinated aromatic and aliphatic fatty acids. The radiopharmaceuticals were 123 I labelled p-phenylpentadecanoic (p-IPPA) and 123 I labelled heptadecanoic acid (HDA). The possibility to evaluate the myocardial metabolic function in man noninvasively add a complementary diagnostic tool in the clinical follow-up of patients with heart disease. (Auth.)
Human absorbed dose calculations for 123I labeled phenyl pentadecanoic acid
International Nuclear Information System (INIS)
Kulkarni, P.V.; Clark, G.; Corbett, J.R.; Willerson, J.T.; Parkey, R.W.
1986-01-01
I-123 labeled fatty acids have been proposed for studying myocardial metabolism by scintigraphic methods. With the availability of clean I-123 and the advent of single photon emission tomography, I-123 labeled fatty acids would be well suited to study regional myocardial viability or metabolism in humans. The authors have studied I-125 and I-123 labeled iodophenyl pentadecanoic acid (IPPA) in rats and dogs. Clinical studies are in progress with I-123 (IPPA). They have studied the pharmacokinetics of this tracer in male Sprague-Dawley rats at 0.25, 0.5, 1, 3, 6, and 24 hours postinjection. The cumulated doses, due to both pure I-123 and a version contaminated with 1.4% I-125, in various organs and the total body in humans are estimated. The average dose to organs for humans injected with I-123 IPPA with pure I-123 and contaminated I-123 respectively, are (rads to organ per mCi injected): heart wall (0.0507, 0.0514), liver (0.0792, 0.0875), kidneys (0.0479, 0.0561), thyroid (0.0517, 0.0638), ovaries (0.0427, 0.0561), testes (0.0307, 0.0309), total body (0.0386, 0.0392). 12 references, 9 figures, 5 tables
Magnetotail Fast Flow Occurrence Rate and Dawn-Dusk Asymmetry at XGSM ˜ -60 RE
Kiehas, S. A.; Runov, A.; Angelopolos, V.; Hietala, H.; Korovinksiy, D.
2018-03-01
As a direct result of magnetic reconnection, plasma sheet fast flows act as primary transporter of mass, flux, and energy in the Earth's magnetotail. During the last decades, these flows were mainly studied within XGSM>-60RE, as observations near or beyond lunar orbit were limited. By using 5 years (2011-2015) of ARTEMIS (Acceleration, Reconnection, Turbulence, and Electrodynamics of the Moons Interaction with the Sun) data, we statistically investigate earthward and tailward flows at around 60 RE downtail. A significant fraction of fast flows is directed earthward, comprising 43% (vx>400 km/s) to 56% (vx>100 km/s) of all observed flows. This suggests that near-Earth and midtail reconnection are equally probable of occurring on either side of the ARTEMIS downtail distance. For fast convective flows (v⊥x>400 km/s), this fraction of earthward flows is reduced to about 29%, which is in line with reconnection as source of these flows and a downtail decreasing Alfvén velocity. More than 60% of tailward convective flows occur in the dusk sector (as opposed to the dawn sector), while earthward convective flows are nearly symmetrically distributed between the two sectors for low AL (>-400 nT) and asymmetrically distributed toward the dusk sector for high AL (infer that near-Earth reconnection is preferentially located at dusk, whereas midtail reconnection (X >- 60RE) is likely symmetric across the tail during weak substorms and asymmetric toward the dusk sector for strong substorms, as the dawn-dusk asymmetric nature of reconnection onset in the near-Earth region progresses downtail.
Dynamic myocardial scintigraphy with 123I-labelled free fatty acids
International Nuclear Information System (INIS)
Wall, E.E. van der.
1981-01-01
In this thesis, long-chain radioiodinated free fatty acids ( 123 I-FFA), 16-iodo- 123 I-cis-Δ 9 -hexadecenoic acid ( 123 I-HA) and 17-iodo- 123 I-heptade-canoic acid ( 123 I-Hsup(o)A), were employed for myocardial scintigraphy in patients with coronary artery disease. The results indicate that clearance of 123 I-FFA from the myocardium is dependent on the nature of ischemic injury. Clearance is delayed if the injury is reversible and accelerated in case of irreversible ischemia. Mechanisms responsible for divergent behaviour of FFA in patients with acute myocardial infarction versus patients with angina pectoris are purely speculative. This differential clearance from normally perfused, transiently ischemic and infarcted myocardium has practical application. The test provides a means to assess the nature of ischemic injury rapidly. These findings may have major consequences for logical management of patients presenting with chest pain and suspected coronary artery disease. (Auth.)
Addressing Rare-Earth Element Criticality: An Example from the Aviation Industry
Ku, Anthony Y.; Dosch, Christopher; Grossman, Theodore R.; Herzog, Joseph L.; Maricocchi, Antonio F.; Polli, Drew; Lipkin, Don M.
2014-11-01
Rare-earth (RE) elements are enablers for a wide range of technologies, including high-strength permanent magnets, energy-efficient lighting, high-temperature thermal barrier coatings, and catalysts. While direct material substitution is difficult in many of these applications because of the specific electronic, optical, or electrochemical properties imparted by the individual rare-earth elements, we describe an example from the aviation industry where supply chain optimization may be an option. Ceramic matrix composite engine components require environmental barrier coatings (EBCs) to protect them from extreme temperatures and adverse reactions with water vapor in the hot gas path. EBC systems based on rare-earth silicates offer a unique combination of environmental resistance, thermal expansion matching, thermal conductivity, and thermal stability across the service temperature window. Several pure rare-earth silicates and solid solutions have been demonstrated in EBC applications. However, all rely on heavy rare-earth elements (HREEs) for phase stability. This article considers the possibility of using separation tailings containing a mixture of HREEs as a source material in lieu of using the high-purity HREE oxides. This option arises because the desired properties of RE-silicate EBCs derive from the average cation size rather than the electronic properties of the individual rare-earth cations. Because separation tailings have not incurred the costs associated with the final stages of separation, they offer an economical alternative to high-purity oxides for this emerging application.
(123I)-IMP SPECT findings in Machado-Joseph disease
International Nuclear Information System (INIS)
Suzuki, Masahiko
1997-01-01
Single photon emission computed tomography (SPECT) with N-isopropyl-p-( 123 I)iodoamphetamine (IMP) was used to study the dynamics of cerebellar and brainstem metabolic function in patients with Mochado-Joseph disease (MJD), the diagnosis of which was confirmed with genetic analysis. The SPECT data obtained was analyzed semiquantitatively. In patients with MJD, ( 123 I)-IMP accumulation in the cerebellum and brainstem was decreased, and the degree of decrease reflected the clinical severity of MJD. When MJD was mild, the decrease in ( 123 I)-IMP accumulation was much greater in the brainstem than in the cerebellum. However, the decrease in ( 123 I)-IMP accumulation in the cerebellum and brainstem was not correlated with the severity of atrophy or with the number of CAG repeats. ( 123 I)-IMP SPECT was useful for evaluating the decrease in cerebellum and brainstem function in patients with MJD. Results of this study suggest that the functional decrease in MJD may begin in the brainstem. (author)
[11 C]Rhodamine-123: Synthesis and biodistribution in rodents
International Nuclear Information System (INIS)
Bao Xiaofeng; Lu Shuiyu; Liow, Jeih-San; Morse, Cheryl L.; Anderson, Kacey B.; Zoghbi, Sami S.; Innis, Robert B.; Pike, Victor W.
2012-01-01
Introduction: Rhodamine-123 is a known substrate for the efflux transporter, P-glycoprotein (P-gp). We wished to assess whether rhodamine-123 might serve as a useful substrate for developing probes for imaging efflux transporters in vivo with positron emission tomography (PET). For this purpose, we aimed to label rhodamine-123 with carbon-11 (t 1/2 = 20.4 min) and to study its biodistribution in rodents. Methods: [ 11 C]Rhodamine-123 was prepared by treating rhodamine-110 (desmethyl-rhodamine-123) with [ 11 C]methyl iodide. The biodistribution of this radiotracer was studied with PET in wild-type mice and rats, in efflux transporter knockout mice, in wild-type rats pretreated with DCPQ (an inhibitor of P-gp) or with cimetidine (an inhibitor of organic cation transporters; OCT), and in P-gp knockout mice pretreated with cimetidine. Unchanged radiotracer in forebrain, plasma and peripheral tissues was also measured ex vivo at 30 min after radiotracer administration to wild-type and efflux transporter knockout rodents. Results: [ 11 C]Rhodamine-123 was obtained in 4.4% decay-corrected radiochemical yield from cyclotron-produced [ 11 C]carbon dioxide. After intravenous administration of [ 11 C]rhodamine-123 to wild-type rodents, PET and ex vivo measurements showed radioactivity uptake was very low in brain, but relatively high in some other organs such as heart, and especially liver and kidney. Inhibition of P-gp increased uptake in brain, heart, kidney and liver, but only by up to twofold. Secretion of radioactivity from kidney was markedly reduced by OCT knockout or pretreatment with cimetidine. Conclusions: [ 11 C]Rhodamine-123 was unpromising as a PET probe for P-gp function and appears to be a strong substrate of OCT in kidney. Cimetidine appears effective for blocking OCT in kidney in vivo.
40 CFR 91.123 - Denial, revocation of certificate of conformity.
2010-07-01
... conformity. 91.123 Section 91.123 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) AIR... Certification Provisions § 91.123 Denial, revocation of certificate of conformity. (a) If, after review of the... conformity if the Administrator finds any one of the following infractions to be substantial: (1) The engine...
Mirror nesting of the Fermi contour and enhanced diamagnetism of the pseudogap state in cuprates
Energy Technology Data Exchange (ETDEWEB)
Kapaev, V.V.; Belyavsky, V.I. [P.N. Lebedev Physical Institute of Russian Academy of Sciences, Moscow 119991 (Russian Federation); Kopaev, Yu.V. [P.N. Lebedev Physical Institute of Russian Academy of Sciences, Moscow 119991 (Russian Federation)], E-mail: kopaev@sci.lebedev.ru; Smirnov, M.Yu. [State Pedagogical University, Voronezh 394043 (Russian Federation)
2007-09-01
Since the insulating gap in parent spin antiferromagnet survives under a hole underdoping, it might result in a rise of a metal state with a pocket-like Fermi contour with both conventional and mirror nesting corresponding to the same momentum K = ({pi}, {pi}). The nesting leads to a possibility of singlet orbital antiferromagnetic order whereas the mirror nesting promotes the superconducting pairing with the momentum K. We assume screened Coulomb repulsion to be the dominating pairing interaction in the cuprates resulting in the two-component superconducting order parameter. The relative phase of the parameter can be related to orbital current circulations as it follows from the Ginzburg-Landau phenomenology. The orbital antiferromagnetic state with the insulating gap on the Fermi contour is related to the pseudogap state with enhanced diamagnetic response.
Mirror nesting of the Fermi contour and enhanced diamagnetism of the pseudogap state in cuprates
International Nuclear Information System (INIS)
Kapaev, V.V.; Belyavsky, V.I.; Kopaev, Yu.V.; Smirnov, M.Yu.
2007-01-01
Since the insulating gap in parent spin antiferromagnet survives under a hole underdoping, it might result in a rise of a metal state with a pocket-like Fermi contour with both conventional and mirror nesting corresponding to the same momentum K = (π, π). The nesting leads to a possibility of singlet orbital antiferromagnetic order whereas the mirror nesting promotes the superconducting pairing with the momentum K. We assume screened Coulomb repulsion to be the dominating pairing interaction in the cuprates resulting in the two-component superconducting order parameter. The relative phase of the parameter can be related to orbital current circulations as it follows from the Ginzburg-Landau phenomenology. The orbital antiferromagnetic state with the insulating gap on the Fermi contour is related to the pseudogap state with enhanced diamagnetic response
A novel ferrimagnetic irido-cuprate: IrSr2GdCu2O8
International Nuclear Information System (INIS)
Dos Santos-Garcia, A.J.; Aguirre, Myriam H.; Moran, E.; Saez Puche, R.; Alario-Franco, M.A.
2006-01-01
We have performed an investigation of the structural, microstructural and magnetic properties of the new compound IrSr 2 GdCu 2 O 8 . The sample was prepared under high temperature (∼1393K) and high-pressure conditions (∼60Kbars) in a Belt type apparatus. X-ray diffraction (XRD) analysis shows that this irido-cuprate is isostructural with the corresponding Ru-1212 phase. Structurally, this material shows an interesting hierarchy of ordering phenomena, whose observation actually depends on the technique used to analyze the material: from a 'simple' cell a p xa p x3a p which is supported by XRD, through a 'diagonal' one, ∼2a p x2a p x3a p as seen by SAED, to a microdomain texture of this last one cell supported by HREM. A ferrimagnetic Ir IV -Gd III spin ordering is observed below 15K. The iridium oxidation state seems to be +4
Myocardial kinetics of 123I-labeled-16-hexadecanoic acid
International Nuclear Information System (INIS)
Okada, R.D.; Elmaleh, D.; Werre, G.S.; Strauss, H.W.; Massachusetts General Hospital, Boston
1983-01-01
To determine if the myocardial clearance of omega 123 I-16-hexadecanoic acid ( 123 I-HDA) is affected by decreased coronary blodood flow, six anesthetized dogs had partial occlusion of the left anterior descending coronary artery. One hour later, 113 Sn-microspheres were injected into the left atrium, followed immediately by the IV administration of 123 I-HDA. Following injection, regional myocardial 123 I activities were monitored continuously with miniature cadmium telluride radiation detectors placed against the endocardium in both ischemic and nonischemic zones. After 3 h continuous monitoring, 46 Sc-microspheres were injected into the left atrium and the dogs were killed. Ischemic and nonischemic areas of myocardium were sectioned and counted in a well counter. (orig./WL)
Investigations of the trend followed in heat capacity of Re_6UO_1_2 (s) along lanthanide series
International Nuclear Information System (INIS)
Sahu, Manjulata; Saxena, M.K.; Rawat, Deepak; Dash, Smruti
2017-01-01
The compound RE_6UO_1_2 (s) (RE = Ho, Er, Tm, Yb and Lu) was synthesized by complex polymerisation method and characterised using X-ray diffraction (XRD). Heat capacity measurements of RE_6UO_1_2 (s) were performed with heat flux-type differential scanning calorimeter in the temperature range of 300-870 K. The trend in heat capacity along the rare earth series was proposed for RE_6UO_1_2 (s) and thermodynamic functions were generated. (author)
Directory of Open Access Journals (Sweden)
Fabian Eustermann
2018-04-01
Full Text Available The REPt2Al3 compounds of the late rare-earth metals (RE = Y, Dy–Tm were found to crystallize isostructural. Single-crystal X-ray investigations of YPt2Al3 revealed an orthorhombic unit cell (a = 1080.73(6, b = 1871.96(9, c = 413.04(2 pm, wR2 = 0.0780, 942 F2 values, 46 variables with space group Cmmm (oC48; q2pji2hedb. A comparison with the Pearson database indicated that YPt2Al3 forms a new structure type, in which the Pt and Al atoms form a [Pt2Al3]δ− polyanion and the Y atoms reside in the cavities within the framework. Via a group-subgroup scheme, the relationship between the PrNi2Al3-type structure and the new YPt2Al3-type structure was illustrated. The compounds with RE = Dy–Tm were characterized by powder X-ray diffraction experiments. While YPt2Al3 is a Pauli-paramagnet, the other REPt2Al3 (RE = Dy–Tm compounds exhibit paramagnetic behavior, which is in line with the rare-earth atoms being in the trivalent oxidation state. DyPt2Al3 and TmPt2Al3 exhibit ferromagnetic ordering at TC = 10.8(1 and 4.7(1 K and HoPt2Al3 antiferromagnetic ordering at TN = 5.5(1 K, respectively. Attempts to synthesize the isostructural lutetium compound resulted in the formation of Lu2Pt3Al4 (Ce2Ir3Sb4-type, Pnma, a = 1343.4(2, b = 416.41(8, c = 1141.1(2 pm, which could also be realized with thulium. The structure was refined from single-crystal data (wR2 = 0.0940, 1605 F2 values, 56 variables. Again, a polyanion with bonding Pt–Al interactions was found, and the two distinct Lu atoms were residing in the cavities of the [Pt3Al4]δ– framework. X-ray photoelectron spectroscopy (XPS measurements were conducted to examine the electron transfer from the rare-earth atoms onto the polyanionic framework.
Physical properties of layered homologous RE-B-C(N) compounds
International Nuclear Information System (INIS)
Mori, Takao; Zhang Fuxiang; Leithe-Jasper, Andreas
2004-01-01
Physical properties of a series of homologous RE-B-C(N) B 12 cluster compounds REB 17 CN, REB 22 C 2 N, and REB 28.5 C 4 (RE=Er,Ho) were investigated. The structures of the compounds are layer-like along the c-axis, with rare earth and B 6 octahedral layers separated by B 12 icosahedral and C-B-C chain layers whose number increases successively from two B 12 layers for the REB 17 CN compound to four for the REB 28.5 C 4 compound. The rare earth atoms are configured in two triangular flat layers which are stacked on top of one another in AB stacking where the nearest-neighbor rare earth directions are the three atoms forming a triangle in the adjacent layer. The series of homologous compounds exhibit a spin glass transition with T f shifting in correspondence with variations of the basal plane lattice constants, consistent with the magnetic interaction being effective in the basal planes. The isothermal remanent magnetization shows a stretched exponential decay I m (t)∝ exp[-Ct -(1-n) ]. Exponents determined for the different homologous compounds were scaled as a function of T r =T/T f and found to follow the empirical dependency determined for typical spin glasses. It is indicated that a mixture of disorder originating from the partial occupancy of the rare earth sites and frustration of interactions due to the unique configuration is responsible for the manifestation of spin glass transitions in these homologous systems
Iodine-123 and bromine-75 production and development program at Juelich
International Nuclear Information System (INIS)
Stoecklin, G.
1985-01-01
The iodine-123 and bromine-75 production and development program at the Nuclear Research Center in Juelich as of 1982 is described, and examples of recent 123 I- and 75 Br-analogue tracers that have been developed to the level of clinical trial are given. Iodine-123 is produced via the 127 I(d,6n) 123 Xe → 123 I process and by the 124 Te(p,2n) 123 I and 122 Te(d,n) 123 I reactions. These production methods are critically reviewed. Bromine-75-labeled benzodiazenes have been prepared for in vivo mapping of benzodiazepine receptor sites. The 7-( 75 Br)-5-(2-fluorophenyl)-1-methyl-1,3-dihydro-2H-1,4-benzodiazepine-2-one (BFB) was prepared with a specific activity of > 10 4 Ci/mmole. Finally, preparation and applications of the halogenated amino acid L-3-( 123 I)-iodo-α-methyltyrosine (IMT) and the analogous 75 Br compound (BMT) are reported. Both IMT and BMT have been successfully applied for pancreas imaging and tomography, and IMT has been used for imaging both melanotic and amelanotic malignant melanoma of the eye
123I research and production at Brookhaven
International Nuclear Information System (INIS)
Mausner, L.F.; Srivastava, S.C.; Mirzadeh, S.; Meinken, G.E.; Prach, T.
1985-01-01
The procedures for preparing high purity 123 I at the BLIP using the 127 I(p,5n) 123 Xe reaction on an NaI target are described. The activity is supplied in a glass ampoule with anhydrous 123 I deposited on the interior walls, allowing maximum flexibility in subsequent iodinations. Preliminary experience with a continuous flow target is also described. The results of a series of measurements of specific activity by neutron activation, x-ray fluorescence, uv absorption, and wet chemistry generally showed no detectable carrier. HPLC methods to analyse the chemical form of radioiodine and to characterize various iodinated radiopharmaceuticals have been developed. These methods provide higher sensitivity, speed and resolution than commonly used techniques. 19 refs., 6 figs., 2 tabs
Local magnetism in rare-earth metals encapsulated in fullerenes
De Nadai, C; Mirone, A; Dhesi, SS; Bencok, P; Brookes, NB; Marenne, [No Value; Rudolf, P; Tagmatarchis, N; Shinohara, H; Dennis, TJS; Marenne, I.; Nadaï, C. De
Local magnetic properties of rare-earth (RE) atoms encapsulated in fullerenes have been characterized using x-ray magnetic circular dichroism and x-ray absorption spectroscopy (XAS). The orbital and spin contributions of the magnetic moment have been determined through sum rules and theoretical
International Nuclear Information System (INIS)
Albert, Nathalie L.; Unterrainer, Marcus; Xiong, Guoming; Bartenstein, Peter; Koch, Walter; Diemling, Markus; Varrone, Andrea; Dickson, John C.; Tossici-Bolt, Livia; Sera, Terez; Asenbaum, Susanne; Booij, Jan; Kapucu, L. Oezlem A.; Kluge, Andreas; Ziebell, Morten; Darcourt, Jacques; Nobili, Flavio; Pagani, Marco; Sabri, Osama; Hesse, Swen; Borght, Thierry vander; Laere, Koen van; Tatsch, Klaus; La Fougere, Christian
2016-01-01
Even though [ 123 I]FP-CIT SPECT provides high accuracy in detecting nigrostriatal cell loss in neurodegenerative parkinsonian syndromes (PS), some patients with an inconclusive diagnosis remain. We investigated whether the diagnostic accuracy in patients with clinically uncertain PS with previously inconclusive findings can be improved by the use of iterative reconstruction algorithms and an improved semiquantitative evaluation which additionally implemented a correction algorithm for patient age and gamma camera dependency (EARL-BRASS; Hermes Medical Solutions, Sweden). We identified 101 patients with inconclusive findings who underwent an [ 123 I]FP-CIT SPECT between 2003 and 2010 as part of the diagnostic process of suspected PS at the University of Munich, and re-evaluated these scans using iterative reconstruction algorithms and the new corrected EARL-BRASS. Clinical follow-up was obtained in 62 out of the 101 patients and constituted the gold standard for the re-evaluation to assess the possible improvement in diagnostic accuracy. Clinical follow-up confirmed the diagnosis of PS in 11 of the 62 patients. In patients in whom both visual and semiquantitative analysis showed concordant findings (48 patients), a high negative predictive value (93 %), positive predictive value (100 %) and accuracy (94 %) were found, and thus a correct diagnosis was obtained in 45 of the 48 patients. Among the 14 patients with discordant findings, the additional semiquantitative analysis correctly identified all five of nine patients patients without PS by nonpathological semiquantitative findings in visually pathological or inconclusive scans. In contrast, four of the remaining five patients with decreased semiquantitative values but visually normal scans did not show a PS during follow-up. The age-corrected and camera-corrected mode of evaluation using EARL-BRASS provided a notable improvement in the diagnostic accuracy of [ 123 I]FP-CIT SPECT in PS patients with previously
Energy Technology Data Exchange (ETDEWEB)
Kemmler-Sack, S [Tuebingen Univ. (Germany, F.R.). Lehrstuhl fuer Anorganische Chemie 2
1982-06-01
In the series Ba/sub 2-y/Sr/sub y/La/sub 2-x/RE/sub x/MgW/sub 2/vacantO/sub 12/ the Ba/sup 2 +/ can be completely substituted by Sr/sup 2 +/. All compounds crystallize in the rhombohedral 12 L-type (space group R-3m; sequence (hhcc)/sub 3/). By doping the stacking polytypes with some of the trivalent rare earths efficient visible photoluminescence is obtained. The simultaneous incorporation of two different rare earth ions leads to two-color-phosphors, which, according to the excitation energy used, emit either mainly the typical spectrum from one or the other activator; the corresponding luminescence mechanism are discussed.
Innovative re-creation of realities in a holographic digital form
Wang, Shuo; Hebblewhite, Richard; Osanlou, Ardieshir; Excell, Peter; Di Gennaro, Sonia; Shi, Lishen
2014-02-01
Only nature can create, whereas humans can only re-create. This article is an exploration of synergies between art and science in digital holography in relation to art practice and the making of holograms as art works. This is achieved through involvement in the re-creation of a real object (a telescope) as a case study. A digital three-dimensional model suitable for holographic hard copy re-creation is produced. To explore special and immersive environment, real geographical landscape background from Google Earth is added to the model. After a brief introduction to visual art within the context of two and three-dimensional imaging in the form photography and holography, the whole process of producing the three-dimensional model and the environment in which it should be presented, ready for holographic printing is explained.
Melt processing of Yb-123 tapes
International Nuclear Information System (INIS)
Athur, S. P.; Balachandran, U.; Salama, K.
2000-01-01
The innovation of a simple, scalable process for manufacturing long-length conductors of HTS is essential to potential commercial applications such as power cables, magnets, and transformers. In this paper the authors demonstrate that melt processing of Yb-123 tapes made by the PIT route is an alternative to the coated conductor and Bi-2223 PIT tape fabrication techniques. Ag-clad Yb-123 tapes were fabricated by groove rolling and subsequently, melt processed in different oxygen partial pressures in a zone-melting furnace with a gradient of 140 C/cm. The transition temperatures measured were found to be around 81 K undermost processing conditions. EPMA of the tapes processed under different conditions show the 123 phase to be Ba deficient and Cu and Yb rich. Critical current was measured at various temperatures from 77 K to 4.2 K. The J c increased with decrease in pO 2 . The highest I c obtained was 52 A at 4.2 K
Stabilization of high Tc phase in bismuth cuprate superconductor by lead doping
Gupta, Ram. P.; Pachauri, J. P.; Khokle, W. S.; Nagpal, K. C.; Date, S. K.
1991-01-01
It has been widely ascertained that doping of lead in Bi-Sr-Ca-Cu-O systems promotes the growth of high T sub c (110 K) phase, improves critical current density, and lowers processing temperature. A systematic study was undertaken to determine optimum lead content and processing conditions to achieve these properties. A large number of samples with cationic compositions of Bi(2-x)Pb(x)Sr2Ca2Cu3 (x = 0.2 to 2.0) were prepared by conventional solid state reaction technique. Samples of all compositions were annealed together at a temperature and characterized through resistance temperature (R-T) measurements and x ray diffraction to determine the zero resistance temperature, T sub c(0) and to identify presence of phases, respectively. The annealing temperature was varied between 790 and 880 C to optimize processing parameters. Results are given. In brief, an optimum process is reported along with composition of leaded bismuth cuprate superconductor which yields nearly a high T sub c single phase with highly stable superconducting properties.
Ultra-fast pump-probe determination of electron-phonon coupling in cuprate superconductors
Mihailovic, Dragan
2010-03-01
Fresh femtosecond spectroscopy experiments show the electron-phonon interaction strength λ to be 0.7 and 1.4 for YBCO and LSCO respectively and not around 0.2 as previously reported [1]. The revised estimates arise primarily from improved time-resolution, and also partly from improved modeling. Comparison with classical superconductors and pnictides shows non-monotonic correlation of λ with Tc. Systematic new measurements of the condensate vaporization energy (Uv) in cuprates [2] and pnictides reveals a power-law dependence on Tc with exponent 2. However, Uc is 16-18 times greater than the BCS condensation energy Uc, implying that a significant heat capacity of the ``bosonic glue.'' In contrast, charge-density wave systems with electronically driven ordering transitions have Uv˜Uc. The data suggest BCS and Eliashberg-based models to be inappropriate for describing the physics of high-temperature superconductors, and point towards polaron models which consider strong or intermediate λ.[4pt] [1] C.Gadermeier et al., arXiv:0902.1636[0pt] [2] P.Kusar et al., Phys. Rev. Lett. 101, 227001 (2008)
X-ray fluorescence analysis of high purity rare earth oxides for common trace rare earth impurities
International Nuclear Information System (INIS)
Chandola, L.C.; Dixit, R.M.; Khanna, P.P.; Deshpande, S.S.; Machado, I.J.; Kapoor, S.K.
1990-01-01
Methods for the determination of individual trace common rare earth (RE) elements have been developed for fifteen RE oxide matrices viz. La 2 O 3 to Lu 2 O 3 and Y 2 O 3 . In general, for each matrix, two or three neighbouring elements on both sides of the matrix element are determined. The minimum determination limit (MDL) achieved is 0.002% for most of the elements. Special efforts were made to use a small amount of sample (as low as 400 mg) for the analysis by the use of double layer pellet technique and critical thickness studies. Practical experiences with 15 RE matrices, most of which are investigated for the first time, are discussed. Details of selection of instrumental parameters and analysis lines, precision and accuracy and preparation of samples and synthetic standards are given. Theoretical minimum detection limit (TMDL) for each analyte element is calculated in all the 15 matrices. (author). 50 tabs., 2 figs
49 CFR 37.123 - ADA paratransit eligibility: Standards.
2010-10-01
... 49 Transportation 1 2010-10-01 2010-10-01 false ADA paratransit eligibility: Standards. 37.123... INDIVIDUALS WITH DISABILITIES (ADA) Paratransit as a Complement to Fixed Route Service § 37.123 ADA... complementary paratransit service shall provide the service to the ADA paratransit eligible individuals...
Energy Technology Data Exchange (ETDEWEB)
Mohd Fadzil, Syazwani, E-mail: mfsyazwani86@postech.ac.kr [Division of Advanced Nuclear Engineering, Pohang University of Science and Technology, 790784 Pohang, Gyeongbuk (Korea, Republic of); School of Applied Physics, Faculty of Science and Technology, The National University of Malaysia, 43650 Bandar Baru Bangi, Selangor (Malaysia); Hrma, Pavel [Division of Advanced Nuclear Engineering, Pohang University of Science and Technology, 790784 Pohang, Gyeongbuk (Korea, Republic of); Pacific Northwest National Laboratory, P.O. Box 999, Richland, WA (United States); Schweiger, Michael J.; Riley, Brian J. [Pacific Northwest National Laboratory, P.O. Box 999, Richland, WA (United States)
2015-10-15
Pyroprocessing is are processing method for managing and reusing used nuclear fuel (UNF) by dissolving it in an electrorefiner with a molten alkali or alkaline earth chloride salt mixture while avoiding wet reprocessing. Pyroprocessing UNF with a LiCl–KCl eutectic salt releases the fission products from the fuel and generates a variety of metallic and salt-based species, including rare earth (RE) chlorides. If the RE-chlorides are converted to oxides, borosilicate glass is a prime candidate for their immobilization because of its durability and ability to dissolve almost any RE waste component into the glass matrix at high loadings. Crystallization that occurs in waste glasses as the waste loading increases may complicate glass processing and affect the product quality. This work compares three types of borosilicate glasses in terms of liquidus temperature (T{sub L}): the International Simple Glass designed by the International Working Group, sodium borosilicate glass developed by Korea Hydro and Nuclear Power, and the lanthanide aluminoborosilicate (LABS) glass established in the United States. The LABS glass allows the highest waste loadings (over 50 mass% RE{sub 2}O{sub 3}) while possessing an acceptable chemical durability. - Highlights: • We investigated crystallization in borosilicate glasses containing rare earth oxides. • New crystallinity and durability data are shown for glasses proposed in the literature. • Both liquidus temperature and chemical durability increased as the waste loading increased.
Radiological issues in monazite processing for rare earth extraction: regulatory approach
International Nuclear Information System (INIS)
Mohandas, P.V.; Sinha, Soumen; Bhattacharya, R.
2014-01-01
Rare earth minerals quite often contain Naturally Occurring Radioactive Materials (NORM) in varying concentrations resulting in occupational and environmental radiation exposures during their mining, milling and chemical processing for the extraction of rare earth elements and their compounds. NORMs such as Uranium, Thorium and their decay products in the mineral result in enhanced natural background radiation fields in their areas of occurrence. The mining of the mineral ores and further processing results in concentration/redistribution of the NORM in the process streams, product intermediaries, products and effluents. Monazite which is available in plenty in India is one of the most important resources for Rare Earths (RE). Monazite is chemically processed by subjecting it to alkali digestion and selective extraction with hydrochloric acid. During the above process radium ( 228 Ra) and lead present in the monazite appear in the RE composite chloride (RECl3) fraction. These are removed from the product by a process known as 'deactivation' and 'lead elimination' to obtain deactivated and lead free composite RE chloride. The solid waste obtained from the deactivation and lead elimination, referred to as 'mixed cake' is suitably contained and disposed off as radioactive waste. Radioactive wastes/effluents generated during the processing of monazite is another source of concern with respect to occupational and public exposure. This requires adequate attention from the waste management considerations
I-123 IMP SPECT in Parkinson's disease
International Nuclear Information System (INIS)
Kawabata, Keita; Tachibana, Kyudai; Sugita, Minoru
1990-01-01
To examine semiquantitatively regional cerebral blood flow, SPECT with N-isopropyl-p-[I-123]iodoamphetamine (I-123 IMP) was undertaken in 17 patients with Parkinson's disease. Seven patients with Alzheimer's disease and 9 senile control subjects were also imaged for comparison. Both the Parkinson's disease group and the Alzheimer's disease group had a decreased uptake of I-123 IMP in the frontal lobe, in comparison with the control group. A remarkably decreased uptake was seen in the lateral and parietal lobes in the group of Parkinson's disease associated with dementia, as well as in the Alzheimer's disease group. A significantly decreased uptake was observed in the frontal lobe, lateral lobe, thalamus, and basal ganglia in the Parkinson's disease group, irrespective of the presence or absence of dementia. For Parkinson's disease associated with dementia, there was much more significant decrease in I-123 IMP uptake. The pattern of regional cerebral blood flow in the Alzheimer's disease group was analogous to that in the Parkinson's disease group associated with dementia. This supports the hypothesis that Alzheimer's disease may be somewhat involved in the occurrence of dementia for Parkinson's disease. (N.K.)
Selection of patients for re-irradiation with local implants in carcinomas of oropharynx and tongue
International Nuclear Information System (INIS)
Langlois, D.; Hoffstetter, S.; Pernot, M.
1988-01-01
Between 1972 and 1984, 123 patients with recurrent or new primary carcinomas in previously irradiated areas of soft palate, tonsil, base of tongue or mobile tongue were re-irradiated with iridium-192 afterloading techniques. The average re-irradiation dose was 62 Gy (31-84 Gy) and the total dose 131 Gy (92-162 Gy); only 28 cases of mucosal necrosis were observed (23%). Two and 5 years actuarial local control rates were 67% and 59% and survival rates 48% and 24% respectively. Death was related to local tumor in 48 cases, metastases in 8 cases and intercurrent disease in 39 cases. We analysed the effect on survival and local control of age, initial tumor site and volume, previous surgery, time between first irradiation and re-irradiation, doses, dose rate, and techniques of brachytherapy. With this analysis as background, we recommend the use of salvage brachytherapy for patients with a) small tumors of soft palate, tonsil or mobile tongue without synchronic lymph node metastases, b) long time interval between first irradiation and re-irradiation, c) new primary tumors (rather than recurrence of first tumor), and d) no previous local surgery. A high re-irradiation dose given with low dose rate is recommended. (orig.)
23 CFR 771.123 - Draft environmental impact statements.
2010-04-01
... 23 Highways 1 2010-04-01 2010-04-01 false Draft environmental impact statements. 771.123 Section... ENVIRONMENT ENVIRONMENTAL IMPACT AND RELATED PROCEDURES § 771.123 Draft environmental impact statements. (a) A... significant impacts on the environment. When the applicant, after consultation with any project sponsor that...
11B study of spin dynamics in Y/sub 1-x/RE/sub x/Rh4B4
International Nuclear Information System (INIS)
Kumagai, K.; Fradin, F.Y.
1982-06-01
There has been intense interest in re-entrance and coexistence in ternary rare earth magnetic superconductors of the form RE Rh 4 B 4 . Of particular interest in this investigation is the effect of the superconducting state on the RKKY (Yosida, 1957) coupling between RE ions. Since one expects the conduction electron spin susceptibility chi/sup e/(q) to be cut off for q - 1 for the RE moments in the superconducting state. This paper reports on the spin dynamics of the RE ions using the 11 B nuclear magnetic relaxation rate T 1- 1 in dilute Y/sub 1-x/RE/sub x/Rh 4 B 4 (RE = Gd and Er)
International Nuclear Information System (INIS)
Cabovich, Alexander M.; Voitenko, Alexander I.
2016-01-01
The state of the art concerning tunnel measurements of energy gaps in cuprate oxides has been analyzed. A detailed review of the relevant literature is made, and original results calculated for the quasiparticle tunnel current J(V) between a metallic tip and a disordered d-wave superconductor partially gapped by charge density waves (CDWs) are reported, because it is this model of high-temperature superconductors that becomes popular owing to recent experiments in which CDWs were observed directly. The current was calculated suggesting the scatter of both the superconducting and CDW order parameters due to the samples intrinsic inhomogeneity. It was shown that peculiarities in the current-voltage characteristics inherent to the case of homogeneous super-conducting material are severely smeared, and the CDW-related features transform into experimentally observed peak-dip-hump structures. Theoretical results were used to fit data measured for YBa_2Cu_3O_7_-_d_e_l_t_a and Bi_2Sr_2CaCu_2O_8_+_d_e_l_t_a. The fitting demonstrated a good qualitative agreement between the experiment and model calculations. The analysis of the energy gaps in high-Tc superconductors is important both per se and as a tool to uncover the nature of superconductivity in cuprates not elucidated so far despite of much theoretical effort and experimental progress.
Coherence factors in a high-tc cuprate probed by quasi-particle scattering off vortices.
Hanaguri, T; Kohsaka, Y; Ono, M; Maltseva, M; Coleman, P; Yamada, I; Azuma, M; Takano, M; Ohishi, K; Takagi, H
2009-02-13
When electrons pair in a superconductor, quasi-particles develop an acute sensitivity to different types of scattering potential that is described by the appearance of coherence factors in the scattering amplitudes. Although the effects of coherence factors are well established in isotropic superconductors, they are much harder to detect in their anisotropic counterparts, such as high-superconducting-transition-temperature cuprates. We demonstrate an approach that highlights the momentum-dependent coherence factors in Ca2-xNaxCuO2Cl2. We used Fourier-transform scanning tunneling spectroscopy to reveal a magnetic-field dependence in quasi-particle scattering interference patterns that is sensitive to the sign of the anisotropic gap. This result is associated with the d-wave coherence factors and quasi-particle scattering off vortices. Our technique thus provides insights into the nature of electron pairing as well as quasi-particle scattering processes in unconventional superconductors.
Monitoring of Earth Rotation by VLBI
Ma., Chopo; Macmillan, D. S.
2000-01-01
Monitoring Earth rotation with Very Long Baseline Interferometry (VLBI) has unique potential because of direct access to the Celestial Reference System (CRF and Terrestrial Reference System (TRF) and the feasibility of re-analyzing the entire data set. While formal precision of better than 0.045 mas for pole and 0.002 ms for UT 1 has been seen in the best 24-hr data, the accuracy of the Earth Orientation Parameter (EOP) time series as a whole is subject to logistical, operational, analytical and conceptual constraints. The current issues related to the VLBI data set and the CORE program for greater time resolution such as analysis consistency, network jitter and reference frame stability will be discussed.
Structure and properties of rare earth-rich glassed for nuclear waste immobilisation
International Nuclear Information System (INIS)
Bardez, I.
2004-11-01
A new nuclear glass composition, able to immobilize highly radioactive liquid wastes from high burn-up UO 2 fuel, was established and its structure studied. The composition of the selected rare earth-rich glass is (molar %): 61.79 SiO 2 - 8.94 B 2 O 3 - 3.05 Al 2 O 3 - 14.41 Na 2 O - 6.32 CaO - 1.89 ZrO 2 - 3.60 RE 2 O 3 (with RE = La, Ce, Pr and Nd). The aim of this study was to determine the local environment of the rare earth in this glass and also to glean information about the effect of glass composition on the rare earth neighbouring (influence of Si, B, Al, Na and Ca contents). To this end, several series of glasses, prepared from the baseline glass, were studied by different characterisation methods such as EXAFS spectroscopy at the neodymium LIII-edge, optical absorption spectroscopy, Raman spectroscopy and 29 Si, 27 Al and 11 B MAS-NMR. By coupling all the results obtained, several hypotheses about the nature of the rare earth neighbouring in the glass were proposed. (author)
Structure, stoichiometry and spectroscopy of oxide superconductors
Rao, C. N. R.
In the new oxide superconductors, structure and oxygen stoichiometry play the most crucial role. Thus, all the high-temperature oxide superconductors are orthorhombic perovskites with low-dimensional features. Oxygen stoichiometry in YBa2Cu3O7-δ has an important bearing on the structure as well as superconductivity. This is equally true in the La3-xBa3+xCu 6O14+δ system of which only the 123 oxide (x = 1) with the orthorhombic structure shows high Tc. Orthorhombicity though not essential, is generally found ; it is necessary for the formation of twins. The nature of oxygen and copper in the cuprates has been examined by electron spectroscopy. Copper in these cuprates is only in 1 + and 2 + states. It seems likely that oxygen holes are responsible for superconductivity of the cuprates as well as Ba(Bi, Pb)O3. High Tc superconductivity is also found in oxides of the Bi-(Ca, Sr)-Cu-O and related oxides possessing Cu-O sheets. Dans les nouveaux oxydes supraconducteurs, la structure et la stoechiométrie de l'oxygène jouent un rôle absolument crucial. Ainsi, tous les oxydes supraconducteurs à haute température critique sont des pérovskites orthorhombiques possédant des propriétés de basse dimensionnalité. La stoechiométrie de l'oxygène dans YBa2Cu3O7- δ a une influence importante tant sur la structure que sur la supraconductibilité. Ceci est également valable pour les composés du type La3 -xBa3 + xCu 6O14 + δ parmi lesquels seul l'oxyde 123 (x = 1) à structure orthorhombique présente un grand T. Bien que ce ne soit pas essentiel, cette orthorhombicité est fréquente ; elle est nécessaire à la formation de macles. La nature de l'oxygène et du cuivre a été observée par spectroscopie électronique... Dans ces cuprates, le cuivre est dans les seuls états de valence + 1 et + 2. Vraisemblablement, les trous logés sur l'oxygène sont responsables de la supraconductibilité des cuprates comme de Ba(Bi, Pb)O3. La supraconductibilité existe aussi
Reduced temperature phase diagrams of the silver-rare earths binary systems
International Nuclear Information System (INIS)
Ferro, R.; Delfino, S.; Capelli, R.; Borsese, A.
1975-01-01
Phase equilibria of the silver-rare earth binary systems have been reported in ''reduced temperature'' diagrams (the ''reduced temperature'' being defined as the ratio between a characteristic temperature of the Agsub(x)R.E. phase and the melting temperature of the corresponding R.E. metal, both in 0 K). The smooth trends of the various characteristic reduced temperatures, when plotted against the R.E. atomic number, have been demonstrated. On passing from the light- to the heavy-rare-earths, a correlation has been found between the crossing of these curves and other phenomena, such as the disappearing of the Ag 5 R.E. phases from incongruently, to congruently melting compounds. The trends of the reduced-temperature curves have been briefly discussed in terms of the treatment suggested by Gschneidner together with the volumetric data known for the different Agsub(x)R.E. phases. In addition, the characteristic data of the 1:1 AgR.E. compounds have been compared with those of the analogous AuR.E. phases. (Auth.)
[sup 123]I-iodobenzoylglucosamines: glucose analogues for heart imaging
Energy Technology Data Exchange (ETDEWEB)
Lutz, T [British Columbia Univ., Vancouver, BC (Canada). Dept. of Pharmaceutical Sciences; Dougan, H [TRIUMF, Vancouver, BC (Canada); Rihela, T; Vo, C V [Vancouver General Hospital (Canada). Div. of Nuclear Medicine; Lyster, D M [British Columbia Univ., Vancouver, BC (Canada). Dept. of Pharmaceutical Sciences Vancouver General Hospital (Canada). Div. of Nuclear Medicine
1993-01-01
The ortho-, meta- and para-[[sup 123]I]-2-deoxy-2-N-(iodobenzoyl)-D-glucosamine (BGA) derivatives were investigated to determine the effect of iodine position and lipophilicity on tissue distribution. There was no correlation between tissue uptake and lipophilicity. Maximum uptake was observed for o-BGA displaying a heart:blood ratio of 36.0 at 18 hours post injection. Yeast hexokinase phosphorylation studies in vitro and an in vivo insulin experiment were carried out on o-BGA. No phosphorylation was detected, but the insulin study indicated that o-BGA uses the glucose transporter. o-BGA showed maximum tissue uptake in mice at an optimal specific activity of 0.004mg/[mu]Ci. Mouse biodistribution studies of o-[[sup 123]I]-iodobenzamide(o-[sup 123]IBA) indicated that the glucose moiety of o-BGA may be involved in the heart accumulation process in mice. Heart tissue extraction studies showed unmetabolized o-[[sup 123]I]BGA was the predominant species. A rabbit image of o-[[sup 123]I]BGA, recorded at 14 hours post injection, showed significant heart uptake. (author).
Effects of Rare Earth on Behavior of Precipitation and Properties in Microalloyed Steels
Institute of Scientific and Technical Information of China (English)
林勤; 陈邦文; 唐历; 李联生; 朱兴元; 王怀斌
2003-01-01
The influence of rare earths on the behavior of precipitation of 14MnNb,X60 and 10MnV steels was studied by STEM, XRD, ICP and thermal simulation method. The main carbonitride precipitates are Nb(C, N),(Nb, Ti)(C, N)and V(C, N). In austenite RE delays the beginning of precipitation, and decreases the rate of precipitation. In ferrite RE promotes precipitation and increases the amount of equilibrium carbonitride precipitation. RE can make precipitates fine, globular and dispersed in the microalloyed steels. With the increase of the amount of RE in steel, the amount of precipitation increases. The promotion effect is weakened with excessive RE. RE has only little influence on the strength of microalloyed steel, but it can improve impact toughness effectively.
International Nuclear Information System (INIS)
Braszczyńska-Malik, K.N.; Grzybowska, A.
2016-01-01
The microstructure and mechanical properties investigations of two AME503 and AME505 experimental alloys in as-cast conditions were presented. The investigated materials were fabricated on the basis of the AM50 commercial magnesium alloy with 3 and 5 wt.% cerium rich mischmetal. In the as-cast condition, both experimental alloys were mainly composed of α-Mg, Al_1_1RE_3 and Al_1_0RE_2Mn_7 intermetallic phases. Additionally, due to non-equilibrium solidification conditions, a small amount of α + γ divorced eutectic and Al_2RE intermetallic phase were revealed. The obtained results also show a significant influence of rare earth elements on Brinell hardness, tensile and compression properties at ambient temperature and especially on creep properties at 473 K. Improved alloy properties with a rise in rare earth elements mass fraction results from an increase in Al_1_1RE_3 phase volume fraction and suppression of α + γ eutectic volume fraction in the alloy microstructure. Additionally, the influence of rare earth elements on the dendrite arm space value was discussed. The presented results also proved the thermal stability of the intermetallic phases during creep testing. - Highlights: • Two different Mg-5Al-0.4Mn alloys containing 3 and 5 wt.% of rare earth elements were fabricated. • Addition of rare earth elements leads to a reduction of dendrite arm spaces. • Mechanical properties depend on the phase composition of the alloys. • The increase of the rare earth elements content causes rise of the creep resistance.
21 CFR 123.5 - Current good manufacturing practice.
2010-04-01
... 21 Food and Drugs 2 2010-04-01 2010-04-01 false Current good manufacturing practice. 123.5 Section...) FOOD FOR HUMAN CONSUMPTION FISH AND FISHERY PRODUCTS General Provisions § 123.5 Current good manufacturing practice. (a) Part 110 of this chapter applies in determining whether the facilities, methods...
19 CFR 123.41 - Truck shipments transiting Canada.
2010-04-01
... 19 Customs Duties 1 2010-04-01 2010-04-01 false Truck shipments transiting Canada. 123.41 Section... OF THE TREASURY CUSTOMS RELATIONS WITH CANADA AND MEXICO United States and Canada In-Transit Truck Procedures § 123.41 Truck shipments transiting Canada. (a) Manifest required. Trucks with merchandise...
7 CFR 457.123 - Almond crop insurance provisions.
2010-01-01
... 7 Agriculture 6 2010-01-01 2010-01-01 false Almond crop insurance provisions. 457.123 Section 457... CORPORATION, DEPARTMENT OF AGRICULTURE COMMON CROP INSURANCE REGULATIONS § 457.123 Almond crop insurance provisions. The Almond Crop Insurance Provisions for the 2008 and succeeding crop years are as follows: FCIC...
Luminescence studies of rare earth doped dosimeters
International Nuclear Information System (INIS)
Karali, T.
1999-10-01
The main objective of this thesis has been to address the applications and fundamentals of thermoluminescence (TL) and to contribute to existing knowledge about TL mechanisms in materials which are applied as radiation dosimeters. This issue has been explored for a long time but the mechanisms lack completeness and certainty. TL, Radioluminescence (RL) and Radio-thermoluminescence (RLTL) measurements have been conducted on a high sensitivity TL spectrometer both at low (30-290 K) and high (25-400 deg. C) temperatures, and different heat treatments (furnace and laser) were conducted in order to study the possible impurity clustering which changes the TL spectra and efficiency of the dosimeters. Studies have been based on three different host structure, namely sulphate, borates and zircon. The spectra of calcium sulphate samples doped with Tm 3+ and Dy 3+ at different concentration were examined using TL, RL and RLTL. Similar procedures were applied to the borate samples. Modifications of the material by thermal treatments convert the state of dispersion of the rare earth ions between isolated, pair or defect clusters, which alter the dosimeter efficiency. In some cases, modified geometries are detectable by movement of the line emissions such as for quenched samples which are attributable to new microcrystal line phases. The study of co-doped samples showed unequivocal evidence of a glow peak displacement of the two dopants within a single sample. This result supports the new view that RE 3+ ions could form part of a complex defect acting as both charge trap and recombination centres. Pulsed laser heating with a UV laser changed the glow curve shape and lead to strong signals. The detailed mechanisms for this process are discussed. The RL and TL spectra of synthetic zircon crystals doped with different RE 3+ ions (Pr, Sm, Eu, Gd, Ho, Dy, Er, and Yb) and phosphorus are reported. Even though there is some intrinsic emission from the host lattice the major signals are
I-123-insulin: A new marker for hepatoma
International Nuclear Information System (INIS)
Sodoyez, J.C.; Goffaux, F.S.; Fallais, C.; Bourgeois, P.
1984-01-01
Previous studies have demonstrated that carrier-free I-123-Tyr Al4 insulin was taken up by the liver (by a saturable mechanism) and by the kidneys (by a non saturable mechanism). Autoradiographs of rat liver after injection of I-125-insulin showed that binding specifically occurred at the plasma membrane of the hepatocytes. I-123-Insulin binding to the hepatocyte plasma membrane appeared mediated by specific receptors. Indeed it was blocked by antibodies to the insulin receptors and by an excess of native insulin. Futhermore insulin derivatives with low biological potency (proinsulin and desoctapeptide insulin) did not inhibit I-123-insulin binding to the hepatocytes. I-123-Insulin (1.3 mCi) was I.V. injected into a patient in whom the right liver lobe was normal (normal uptake of Tc-99m-colloid sulfur) but the left liver lobe was occupied by a voluminous hepatoma (no uptake of Tc-99m-colloid sulfur). Liver blood supply was also studied by Tc-99m-pyrophosphate-labeled red cells. Computer analysis of the data revealed that compared to the normal liver lobe, binding of I-123-insulin to the hepatoma was more precocious (vascularization through the hepatic artery and not the portal vein), more intense and more prolonged (half-lives were 6 min in the normal liver and 14 min in the hepatoma). These results are consistent with characteristics of hepatoma cells in culture in which high insulin binding capacity contrasts with a markedly decreased insulin degrading activity. It is concluded that I-123-insulin may be used as a specific marker of hepatoma in man
U(1) x SU(2) Chern-Simons gauge theory of underdoped cuprate superconductors
International Nuclear Information System (INIS)
Marchetti, P.A.; Su Zhao-Bin; Yu Lu
1998-05-01
The Chern-Simons bosonization with U(1)xSU(2) gauge field is applied to the 2-D t-J model in the limit t>>J, to study the normal state properties of underdoped cuprate superconductors. We prove the existence of an upper bound on the partition function for holons in a spinon background, and we find the optimal spinon configuration saturating the upper bound on average - a coexisting flux phase and s+id-like RVB state. After neglecting the feedback of holon fluctuations on the U(1) field B and spinon fluctuations on the SU(2) field V, the holon field is a fermion and the spinon field is a hard-core boson. Within this approximation we show that the B field produces a π flux phase for the holons, converting them into Dirac-like fermions, while the V field, taking into account the feedback of holons produces a gap for the spinons vanishing in the zero doping limit. The nonlinear σ-model with a mass term describes the crossover from the short-ranged antiferromagnetic (AF) state in doped samples to long range AF order in reference compounds. Moreover, we derive a low-energy effective action in terms of spinons holons and a self-generated U(1) gauge field. Neglecting the gauge fluctuations, the holons are described by the Fermi liquid theory with a Fermi surface consisting of 4 ''half-pockets'' centered at (+-π/2,+-π/2) and one reproduces the results for the electron spectral function obtained in the mean field approximation, in agreement with the photoemission data on underdoped cuprates. The gauge fluctuations are not confining due to coupling to holons, but nevertheless yield an attractive interaction between spinons and holons leading to a bound state with electron quantum numbers. The renormalisation effects due to gauge fluctuations give rise to non-Fermi liquid behaviour for the composite electron, in certain temperature range showing the linear in T resistivity. This formalism provides a new interpretation of the spin gap in the underdoped superconductors
Emergency planning and preparedness for re-entry of a nuclear powered satellite
International Nuclear Information System (INIS)
1996-01-01
This safety practice report provides a general overview of the management of incidents or emergencies that may be created when nuclear power sources employed in space systems accidentally re-enter the earth's atmosphere and impact on its surface. 8 refs, 4 figs, 7 tabs
Energy Technology Data Exchange (ETDEWEB)
Albert, Nathalie L.; Unterrainer, Marcus; Xiong, Guoming; Bartenstein, Peter; Koch, Walter [University of Munich, Department of Nuclear Medicine, Munich (Germany); Diemling, Markus [Hermes Medical Solutions, Stockholm (Sweden); Varrone, Andrea [Karolinska University Hospital, Karolinska Institutet, Department of Clinical Neuroscience, Centre for Psychiatry Research, Stockholm (Sweden); Dickson, John C. [UCLH NHS Foundation Trust and University College, Institute of Nuclear Medicine, London (United Kingdom); Tossici-Bolt, Livia [University Hospitals Southampton NHS Trust, Department of Medical Physics, Southampton (United Kingdom); Sera, Terez [University of Szeged, Department of Nuclear Medicine and Euromedic Szeged, Szeged (Hungary); Asenbaum, Susanne [Medical University of Vienna, Department of Neurology, Vienna (Austria); Booij, Jan [University of Amsterdam, Department of Nuclear Medicine, Academic Medical Centre, Amsterdam (Netherlands); Kapucu, L. Oezlem A. [Gazi University, Department of Nuclear Medicine, Faculty of Medicine, Ankara (Turkey); Kluge, Andreas [ABX-CRO, Dresden (Germany); Ziebell, Morten [Rigshospitalet and University of Copenhagen, Neurobiology Research Unit, Copenhagen (Denmark); Darcourt, Jacques [University of Nice-Sophia Antipolis, Nuclear Medicine Department, Centre Antoine Lacassagne, Nice (France); Nobili, Flavio [University of Genoa, Clinical Neurology Unit, Department of Neuroscience (DINOGMI), Genoa (Italy); Pagani, Marco [Institute of Cognitive Sciences and Technologies, CNR, Rome (Italy); Karolinska Hospital, Department of Nuclear medicine, Stockholm (Sweden); Sabri, Osama [University of Leipzig, Department of Nuclear Medicine, Leipzig (Germany); Hesse, Swen [University of Leipzig, Department of Nuclear Medicine, Leipzig (Germany); Leipzig University Medical Centre, Molecular Neuroimaging IFB Adiposity Diseases, Leipzig (Germany); Borght, Thierry vander [Universite Catholique de Louvain, Nuclear Medicine Division, Mont-Godinne Medical Center, Yvoir (Belgium); Laere, Koen van [University Hospital and K.U. Leuven, Nuclear Medicine, Leuven (Belgium); Tatsch, Klaus [Staedtisches Klinikum Karlsruhe, Department of Nuclear Medicine, Karlsruhe (Germany); La Fougere, Christian [University of Tuebingen, Division of Nuclear Medicine, Department of Radiology, Tuebingen (Germany)
2016-07-15
Even though [{sup 123}I]FP-CIT SPECT provides high accuracy in detecting nigrostriatal cell loss in neurodegenerative parkinsonian syndromes (PS), some patients with an inconclusive diagnosis remain. We investigated whether the diagnostic accuracy in patients with clinically uncertain PS with previously inconclusive findings can be improved by the use of iterative reconstruction algorithms and an improved semiquantitative evaluation which additionally implemented a correction algorithm for patient age and gamma camera dependency (EARL-BRASS; Hermes Medical Solutions, Sweden). We identified 101 patients with inconclusive findings who underwent an [{sup 123}I]FP-CIT SPECT between 2003 and 2010 as part of the diagnostic process of suspected PS at the University of Munich, and re-evaluated these scans using iterative reconstruction algorithms and the new corrected EARL-BRASS. Clinical follow-up was obtained in 62 out of the 101 patients and constituted the gold standard for the re-evaluation to assess the possible improvement in diagnostic accuracy. Clinical follow-up confirmed the diagnosis of PS in 11 of the 62 patients. In patients in whom both visual and semiquantitative analysis showed concordant findings (48 patients), a high negative predictive value (93 %), positive predictive value (100 %) and accuracy (94 %) were found, and thus a correct diagnosis was obtained in 45 of the 48 patients. Among the 14 patients with discordant findings, the additional semiquantitative analysis correctly identified all five of nine patients patients without PS by nonpathological semiquantitative findings in visually pathological or inconclusive scans. In contrast, four of the remaining five patients with decreased semiquantitative values but visually normal scans did not show a PS during follow-up. The age-corrected and camera-corrected mode of evaluation using EARL-BRASS provided a notable improvement in the diagnostic accuracy of [{sup 123}I]FP-CIT SPECT in PS patients with
Filimonov, Valeriy O; Dianova, Lidia N; Galata, Kristina A; Beryozkina, Tetyana V; Novikov, Mikhail S; Berseneva, Vera S; Eltsov, Oleg S; Lebedev, Albert T; Slepukhin, Pavel A; Bakulev, Vasiliy A
2017-04-21
High yield solvent-base-controlled, transition metal-free synthesis of 4,5-functionalized 1,2,3-thiadiazoles and 1,2,3-triazoles from 2-cyanothioacetamides and sulfonyl azides is described. Under diazo transfer conditions in the presence of a base in an aprotic solvent 2-cyanothioacetamides operating as C-C-S building blocks produce 5-amino-4-cyano-1,2,3-thiadiazoles exclusively. The use of alkoxide/alcohol system completely switches the reaction course due to the change of one of the reaction centers in the 2-cyanothioacetamide (C-C-N building block) resulting in the formation of 5-sulfonamido-1,2,3-triazole-4-carbothioamide sodium salts as the only products. The latter serve as good precursors for 5-amino-1,2,3-thiadiazole-4-carboximidamides, the products of Cornforth-type rearrangement occurring in neutral protic medium or under acid conditions. According to DFT calculations (B3LYP/6-311+G(d,p)) the rearrangement proceeds via intermediate formation of a diazo compound, and can be catalyzed by acids via the protonation of oxygen atom of the sulfonamide group.
Spectroscopy and Device Performance of Rare Earth Doped III-Nitrides
National Research Council Canada - National Science Library
Hommerich, Uwe
2002-01-01
.... Prime candidates for redgreen- blue (RGB) emission are the rare earth ions Eu3+ (red), Er3+ (green), and Tm3+ (blue). A full-color TFEL phosphor system based on RE doped GaN has been demonstrated with high brightness...