49 CFR 32.665 - State.

Science.gov (United States)

2010-10-01

... 49 Transportation 1 2010-10-01 2010-10-01 false State. 32.665 Section 32.665 Transportation Office... ASSISTANCE) Definitions § 32.665 State. State means any of the States of the United States, the District of Columbia, the Commonwealth of Puerto Rico, or any territory or possession of the United States. ...

22 CFR 210.665 - State.

Science.gov (United States)

2010-04-01

... 22 Foreign Relations 1 2010-04-01 2010-04-01 false State. 210.665 Section 210.665 Foreign... (FINANCIAL ASSISTANCE) Definitions § 210.665 State. State means any of the States of the United States, the District of Columbia, the Commonwealth of Puerto Rico, or any territory or possession of the United States. ...

45 CFR 630.665 - State.

Science.gov (United States)

2010-10-01

... 45 Public Welfare 3 2010-10-01 2010-10-01 false State. 630.665 Section 630.665 Public Welfare... DRUG-FREE WORKPLACE (FINANCIAL ASSISTANCE) Definitions § 630.665 State. State means any of the States of the United States, the District of Columbia, the Commonwealth of Puerto Rico, or any territory or...

22 CFR 1008.665 - State.

Science.gov (United States)

2010-04-01

... 22 Foreign Relations 2 2010-04-01 2010-04-01 true State. 1008.665 Section 1008.665 Foreign... ASSISTANCE) Definitions § 1008.665 State. State means any of the States of the United States, the District of Columbia, the Commonwealth of Puerto Rico, or any territory or possession of the United States. ...

45 CFR 1173.665 - State.

Science.gov (United States)

2010-10-01

... 45 Public Welfare 3 2010-10-01 2010-10-01 false State. 1173.665 Section 1173.665 Public Welfare...) Definitions § 1173.665 State. State means any of the States of the United States, the District of Columbia, the Commonwealth of Puerto Rico, or any territory or possession of the United States. ...

2 CFR 182.665 - State.

Science.gov (United States)

2010-01-01

... 2 Grants and Agreements 1 2010-01-01 2010-01-01 false State. 182.665 Section 182.665 Grants and... GOVERNMENTWIDE REQUIREMENTS FOR DRUG-FREE WORKPLACE (FINANCIAL ASSISTANCE) Definitions § 182.665 State. State means any of the States of the United States, the District of Columbia, the Commonwealth of Puerto Rico...

14 CFR 1267.665 - State.

Science.gov (United States)

2010-01-01

... 14 Aeronautics and Space 5 2010-01-01 2010-01-01 false State. 1267.665 Section 1267.665... WORKPLACE (FINANCIAL ASSISTANCE) Definitions § 1267.665 State. State means any of the States of the United States, the District of Columbia, the Commonwealth of Puerto Rico, or any territory or possession of the...

40 CFR 36.665 - State.

Science.gov (United States)

2010-07-01

... 40 Protection of Environment 1 2010-07-01 2010-07-01 false State. 36.665 Section 36.665 Protection... REQUIREMENTS FOR DRUG-FREE WORKPLACE (FINANCIAL ASSISTANCE) Definitions § 36.665 State. State means any of the States of the United States, the District of Columbia, the Commonwealth of Puerto Rico, or any territory...

21 CFR 1405.665 - State.

Science.gov (United States)

2010-04-01

... 21 Food and Drugs 9 2010-04-01 2010-04-01 false State. 1405.665 Section 1405.665 Food and Drugs... ASSISTANCE) Definitions § 1405.665 State. State means any of the States of the United States, the District of Columbia, the Commonwealth of Puerto Rico, or any territory or possession of the United States. ...

15 CFR 29.665 - State.

Science.gov (United States)

2010-01-01

... 15 Commerce and Foreign Trade 1 2010-01-01 2010-01-01 false State. 29.665 Section 29.665 Commerce... WORKPLACE (FINANCIAL ASSISTANCE) Definitions § 29.665 State. State means any of the States of the United States, the District of Columbia, the Commonwealth of Puerto Rico, or any territory or possession of the...

43 CFR 43.665 - State.

Science.gov (United States)

2010-10-01

... 43 Public Lands: Interior 1 2010-10-01 2010-10-01 false State. 43.665 Section 43.665 Public Lands... (FINANCIAL ASSISTANCE) Definitions § 43.665 State. State means any of the States of the United States, the District of Columbia, the Commonwealth of Puerto Rico, or any territory or possession of the United States. ...

Evidence for transfer of radicals between oil-in-water emulsion droplets as detected by the probe (E,E)-3,5-Bis(4-phenyl-1,3-butadienyl)-4,4-difluoro-4-bora-3a,4a-diaza-s-indacene, BODIPY665/676

DEFF Research Database (Denmark)

Raudsepp, Piret; Brüggemann, Dagmar Adeline; Andersen, Mogens Larsen

2014-01-01

(E,E)-3,5-Bis(4-phenyl-1,3-butadienyl)-4,4-difluoro-4-bora-3a,4a-diaza-s-indacene, BODIPY(665/676), is a lipophilic radical-sensitive fluorescent probe that can be used to study radical-driven lipid autoxidation. The sensitivity of BODIPY(665/676) was studied in the presence of radical initiators...... di-tert-butyl peroxide and 2,2'-azobis(2,4-dimethyl)valeronitrile (AMVN). In both cases the fluorescence of BODIPY(665/676) changed more in saturated medium-chain triglyceride oil than in linseed or sunflower oils, where the high degree of unsaturation is expected to give more pronounced radical......-derived lipid oxidation. It was suggested that BODIPY(665/676), as the only available oxidizable substance in the saturated oil, was directly attacked by radicals, resulting in high rates of probe oxidation, while in the unsaturated oils, radicals attacked either unsaturated fatty acids or BODIPY(665...

46 CFR 154.665 - Welding procedures.

Science.gov (United States)

2010-10-01

... 46 Shipping 5 2010-10-01 2010-10-01 false Welding procedures. 154.665 Section 154.665 Shipping COAST GUARD, DEPARTMENT OF HOMELAND SECURITY (CONTINUED) CERTAIN BULK DANGEROUS CARGOES SAFETY STANDARDS... Construction § 154.665 Welding procedures. Welding procedure tests for cargo tanks for a design temperature...

41 CFR 105-74.665 - State.

Science.gov (United States)

2010-07-01

... 41 Public Contracts and Property Management 3 2010-07-01 2010-07-01 false State. 105-74.665 Section 105-74.665 Public Contracts and Property Management Federal Property Management Regulations System...-GOVERNMENTWIDE REQUIREMENTS FOR DRUG-FREE WORKPLACE (FINANCIAL ASSISTANCE) Definitions § 105-74.665 State. State...

49 CFR 665.25 - Transportation of vehicle.

Science.gov (United States)

2010-10-01

... 49 Transportation 7 2010-10-01 2010-10-01 false Transportation of vehicle. 665.25 Section 665.25 Transportation Other Regulations Relating to Transportation (Continued) FEDERAL TRANSIT ADMINISTRATION, DEPARTMENT OF TRANSPORTATION BUS TESTING Operations § 665.25 Transportation of vehicle. A manufacturer shall...

7 CFR 3021.665 - State.

Science.gov (United States)

2010-01-01

... 7 Agriculture 15 2010-01-01 2010-01-01 false State. 3021.665 Section 3021.665 Agriculture... State. State means any of the States of the United States, the District of Columbia, the Commonwealth of Puerto Rico, or any territory or possession of the United States. ...

Dicty_cDB: SHA665 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available SH (Link to library) SHA665 (Link to dictyBase) - - - Contig-U15540-1 - (Link to Or...iginal site) - - SHA665Z 676 - - - - Show SHA665 Library SH (Link to library) Clone ID SHA665 (Link to dicty...Base) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U15540-1 Original site URL http://dictycdb.b...TQIDDKTGIFDSQRFLAFNNPQAMSKYESYRIYIHPSLGY SGNAKRFKQQPDVNEKALILDGNVYDGHLNPIYNCKICTE...ACWNLLEPMHR NYYQPIQFKLPSFPDTSLPITQIDDKTGIFDSQRFLAFNNPQAMSKYESYRIYIHPSLGY SGNAKRFKQQPDVNEKALILDGNVYDGHLNPIYNCKICT

36 CFR 1212.665 - State.

Science.gov (United States)

2010-07-01

... 36 Parks, Forests, and Public Property 3 2010-07-01 2010-07-01 false State. 1212.665 Section 1212... GOVERNMENTWIDE REQUIREMENTS FOR DRUG-FREE WORKPLACE (FINANCIAL ASSISTANCE) Definitions § 1212.665 State. State means any of the States of the United States, the District of Columbia, the Commonwealth of Puerto Rico...

38 CFR 48.665 - State.

Science.gov (United States)

2010-07-01

... 38 Pensions, Bonuses, and Veterans' Relief 2 2010-07-01 2010-07-01 false State. 48.665 Section 48... REQUIREMENTS FOR DRUG-FREE WORKPLACE (FINANCIAL ASSISTANCE) Definitions § 48.665 State. State means any of the States of the United States, the District of Columbia, the Commonwealth of Puerto Rico, or any territory...

46 CFR 108.665 - Appliances for watertight integrity.

Science.gov (United States)

2010-10-01

... 46 Shipping 4 2010-10-01 2010-10-01 false Appliances for watertight integrity. 108.665 Section 108.665 Shipping COAST GUARD, DEPARTMENT OF HOMELAND SECURITY (CONTINUED) A-MOBILE OFFSHORE DRILLING UNITS DESIGN AND EQUIPMENT Equipment Markings and Instructions § 108.665 Appliances for watertight integrity...

50 CFR 665.98 - Management area.

Science.gov (United States)

2010-10-01

... 50 Wildlife and Fisheries 9 2010-10-01 2010-10-01 false Management area. 665.98 Section 665.98 Wildlife and Fisheries FISHERY CONSERVATION AND MANAGEMENT, NATIONAL OCEANIC AND ATMOSPHERIC ADMINISTRATION... Management area. The American Samoa fishery management area is the EEZ seaward of the Territory of American...

World energy outlook 2006

Energy Technology Data Exchange (ETDEWEB)

NONE

2006-11-07

The World Energy Outlook 2006 sets out the IEA's latest projections of world energy supply and demand to 2030 for oil, gas, coal, renewables, nuclear and electricity, plus projections on energy-related CO{sub 2} emissions. The publication is in three parts. Part A: The reference scenario has chapters entitled: Key assumptions; Global Energy Trends; Oil market outlook; Gas market outlook; Coal market outlook; and Power sector outlook. Part B: The alternative policy scenario contains chapters on: Mapping a new energy future; Assessing the cost-effectiveness of alternative policies; Deepening the analysis results by sector; and Getting to and going beyond the alternative policy scenario. Part C: Focus on key topics contains: The impact of higher energy prices; Current trends in oil and gas investment; Prospects for nuclear power; The outlook for biofuels; Energy for coking in developing countries; and Focus on Brazil. 224 figs., 84 tabs., 5 annexes.

World energy outlook 2006

Energy Technology Data Exchange (ETDEWEB)

NONE

2006-11-07

The World Energy Outlook 2006 sets out the IEA's latest projections of world energy supply and demand to 2030 for oil, gas, coal, renewables, nuclear and electricity, plus projections on energy-related CO{sub 2} emissions. The publication is in three parts. Part A: The reference scenario has chapters entitled: Key assumptions; Global Energy Trends; Oil market outlook; Gas market outlook; Coal market outlook; and Power sector outlook. Part B: The alternative policy scenario contains chapters on: Mapping a new energy future; Assessing the cost-effectiveness of alternative policies; Deepening the analysis results by sector; and Getting to and going beyond the alternative policy scenario. Part C: Focus on key topics contains: The impact of higher energy prices; Current trends in oil and gas investment; Prospects for nuclear power; The outlook for biofuels; Energy for coking in developing countries; and Focus on Brazil. 224 figs., 84 tabs., 5 annexes.

50 CFR 665.220 - Hawaii coral reef ecosystem fisheries. [Reserved

Science.gov (United States)

2010-10-01

... 50 Wildlife and Fisheries 9 2010-10-01 2010-10-01 false Hawaii coral reef ecosystem fisheries. [Reserved] 665.220 Section 665.220 Wildlife and Fisheries FISHERY CONSERVATION AND MANAGEMENT, NATIONAL... PACIFIC Hawaii Fisheries § 665.220 Hawaii coral reef ecosystem fisheries. [Reserved] ...

50 CFR 665.420 - Mariana coral reef ecosystem fisheries. [Reserved

Science.gov (United States)

2010-10-01

... 50 Wildlife and Fisheries 9 2010-10-01 2010-10-01 false Mariana coral reef ecosystem fisheries. [Reserved] 665.420 Section 665.420 Wildlife and Fisheries FISHERY CONSERVATION AND MANAGEMENT, NATIONAL... PACIFIC Mariana Archipelago Fisheries § 665.420 Mariana coral reef ecosystem fisheries. [Reserved] ...

50 CFR 665.620 - PRIA coral reef ecosystem fisheries. [Reserved

Science.gov (United States)

2010-10-01

... 50 Wildlife and Fisheries 9 2010-10-01 2010-10-01 false PRIA coral reef ecosystem fisheries. [Reserved] 665.620 Section 665.620 Wildlife and Fisheries FISHERY CONSERVATION AND MANAGEMENT, NATIONAL... PACIFIC Pacific Remote Island Area Fisheries § 665.620 PRIA coral reef ecosystem fisheries. [Reserved] ...

International energy outlook, 2010

Science.gov (United States)

2010-07-01

This report presents international energy projections through 2035, : prepared by the U.S. Energy Information Administration, including outlooks : for major energy fuels and associated carbon dioxide emissions. The International Energy Outlook 2010 (...

10 CFR 603.665 - Periodic audits of nonprofit participants.

Science.gov (United States)

2010-01-01

... 10 Energy 4 2010-01-01 2010-01-01 false Periodic audits of nonprofit participants. 603.665 Section 603.665 Energy DEPARTMENT OF ENERGY (CONTINUED) ASSISTANCE REGULATIONS TECHNOLOGY INVESTMENT AGREEMENTS Award Terms Affecting Participants' Financial, Property, and Purchasing Systems Financial Matters...

Short-term energy outlook, annual supplement 1994

International Nuclear Information System (INIS)

1994-08-01

The Short-Term Energy Outlook Annual Supplement (Supplement) is published once a year as a complement to the Short-Term Energy Outlook (Outlook), Quarterly Projections. The purpose of the Supplement is to review the accuracy of the forecasts published in the Outlook, make comparisons with other independent energy forecasts, and examine current energy topics that affect the forecasts

Short-term energy outlook annual supplement, 1993

Energy Technology Data Exchange (ETDEWEB)

NONE

1993-08-06

The Short-Term Energy Outlook Annual Supplement (supplement) is published once a year as a complement to the Short-Term Energy Outlook (Outlook), Quarterly Projections. The purpose of the Supplement is to review the accuracy of the forecasts published in the Outlook, make comparisons with other independent energy forecasts, and examine current energy topics that affect the forecasts.

Education Policy Outlook: Austria

Science.gov (United States)

Figueroa, Diana Toledo; Golden, Gillian; Giovinazzo, Manon; Peterka, Judith; Ullmann, Marie

2017-01-01

This policy profile on education in Austria is part of the "Education Policy Outlook" series, which presents comparative analysis of education policies and reforms across OECD countries. Building on the OECD's substantial comparative and sectoral knowledge base, the series offers a comparative outlook on education policy by providing…

50 CFR 665.227 - Allowable gear and gear restrictions.

Science.gov (United States)

2010-10-01

... 50 Wildlife and Fisheries 9 2010-10-01 2010-10-01 false Allowable gear and gear restrictions. 665... Fisheries § 665.227 Allowable gear and gear restrictions. (a) Hawaii coral reef ecosystem MUS may be taken only with the following allowable gear and methods: (1) Hand harvest; (2) Spear; (3) Slurp gun; (4...

50 CFR 665.427 - Allowable gear and gear restrictions.

Science.gov (United States)

2010-10-01

... 50 Wildlife and Fisheries 9 2010-10-01 2010-10-01 false Allowable gear and gear restrictions. 665... Archipelago Fisheries § 665.427 Allowable gear and gear restrictions. (a) Mariana coral reef ecosystem MUS may be taken only with the following allowable gear and methods: (1) Hand harvest; (2) Spear; (3) Slurp...

50 CFR 665.127 - Allowable gear and gear restrictions.

Science.gov (United States)

2010-10-01

... 50 Wildlife and Fisheries 9 2010-10-01 2010-10-01 false Allowable gear and gear restrictions. 665... Fisheries § 665.127 Allowable gear and gear restrictions. (a) American Samoa coral reef ecosystem MUS may be taken only with the following allowable gear and methods: (1) Hand harvest; (2) Spear; (3) Slurp gun; (4...

50 CFR 665.627 - Allowable gear and gear restrictions.

Science.gov (United States)

2010-10-01

... 50 Wildlife and Fisheries 9 2010-10-01 2010-10-01 false Allowable gear and gear restrictions. 665... Island Area Fisheries § 665.627 Allowable gear and gear restrictions. (a) Coral reef ecosystem MUS may be taken only with the following allowable gear and methods: (1) Hand harvest; (2) Spear; (3) Slurp gun; (4...

27 CFR 6.65 - General.

Science.gov (United States)

2010-04-01

... TREASURY LIQUORS âTIED-HOUSEâ Unlawful Inducements Extension of Credit § 6.65 General. Extension of credit by an industry member to a retailer for a period of time in excess of 30 days from the date of...

Read your mail and more with Outlook 2007 - (IT3T/2007/4)

CERN Multimedia

CERN. Geneva

2007-01-01

IT3T/2007/4 - Lisez vos emails, et plus encore, avec Outlook 2007 Cette presentation vous expliquera, non seulement, comment utiliser Outlook 2007 pour envoyer et recevoir vos messages, mais aussi comment gérer un agenda, partager une boite aux lettres entre plusieurs personnes, conserver vos courriers dans votre ordinateur portable, utiliser la messagerie instantanée et configurer diverses options avancées comme le filtre anti-spam. IT3T/2007/4 - Read your mail and more with Outlook 2007 The presentation will explain how to use Outlook 2007 not only for sending and receiving messages but also for managing a personal calendar, sharing a mailbox between several people, keeping mails in a portable computer, using instant messaging and configuring various options including the anti-spam filter.

47 CFR 73.665 - Use of TV aural baseband subcarriers.

Science.gov (United States)

2010-10-01

... 47 Telecommunication 4 2010-10-01 2010-10-01 false Use of TV aural baseband subcarriers. 73.665... RADIO BROADCAST SERVICES Television Broadcast Stations § 73.665 Use of TV aural baseband subcarriers. Licensees of TV broadcast stations may transmit, without further authorization from the FCC, subcarriers and...

Conoco details energy outlook

International Nuclear Information System (INIS)

Anon.

1992-01-01

This paper reports that the U.S., government should adopt policies that encourage U.S. petroleum companies to diversify crude oil sources around the world, says Conoco Inc. That's the key them underlying Conoco's latest world energy outlook through 2000. In its 1989 outlook, Conoco called on the U.S. government to open the Arctic National Wildlife Refuge Coastal Plain to exploration and development and provide a tax credit of $5/bbl of oil equivalent (BOE) for production from U.S. frontier areas as keys to reducing U.S. oil import dependence. Although Conoco included opening the ANWR Coastal Plain and more of the U.S. offshore among U.S. policy recommendations in its current outlook, the company placed the greatest emphasis on incentives for worldwide exploration

Climate Prediction Center - monthly Outlook

Science.gov (United States)

Weather Service NWS logo - Click to go to the NWS home page Climate Prediction Center Site Map News Outlooks monthly Climate Outlooks Banner OFFICIAL Forecasts June 2018 [UPDATED MONTHLY FORECASTS SERVICE ) Canonical Correlation Analysis ECCA - Ensemble Canonical Correlation Analysis Optimal Climate Normals

Emotional outlook on life predicts increases in physical activity among initially inactive men.

Science.gov (United States)

Baruth, Meghan; Lee, Duck-Chul; Sui, Xuemei; Church, Timothy S; Marcus, Bess H; Wilcox, Sara; Blair, Steven N

2011-04-01

This study examined the relationship between emotional outlook on life and change in physical activity among inactive adults in the Aerobics Center Longitudinal Study. A total of 2,132 sedentary adults completed a baseline medical examination and returned for a follow-up examination at least 6 months later. Participants self-reported physical activity level and emotional outlook on life. Emotional outlook on life was significantly and positively related to physical activity participation at the follow-up visit in men but not women. Men who were usually very happy and optimistic at baseline had significantly greater increases in physical activity compared to men who were not happy. Men with a more positive outlook on life (e.g., happier) may be more likely to increase physical activity levels. Physical activity interventions targeting men may be more successful if they first increase happiness.

CERN Technical Training 2004: New Short Courses (SC) on Microsoft Outlook

CERN Multimedia

Monique Duval

2004-01-01

The CERN Technical Training programme is now proposing a new format for courses on Microsoft Outlook. Three two-hours Short Courses (SC) will cover basic and advanced functionalities of the recommended mail client for email at CERN. Each module can be followed independently. The next scheduled sessions will take place as follows: Outlook (SC I): E-mail. Next session: 22.10.2004 (9h00-11h00) Outlook (SC II): Calendar, Tasks and Notes. Next session: 22.10.2004 (14h00-16h00) Outlook (SC III): Meetings and Delegation. Next session: 9.11.2004 (14h00-16h00) In particular, SC I will cover how to open, create and send email, work with attachments, use stationery, organise mail, and work with the address book, SC II will show how to work with the calendar, tasks and notes, and SC III will cover how to organise and manage meetings, work with meeting requests, share tasks, and use email and calendar delegation. The number of participants to each session is limited to 8. The instructor is English-French bilingual, and...

50 CFR Figure 1 to Part 665 - Carapace Length of Lobsters

Science.gov (United States)

2010-10-01

... 50 Wildlife and Fisheries 9 2010-10-01 2010-10-01 false Carapace Length of Lobsters 1 Figure 1 to Part 665 Wildlife and Fisheries FISHERY CONSERVATION AND MANAGEMENT, NATIONAL OCEANIC AND ATMOSPHERIC... Part 665—Carapace Length of Lobsters ER14JA10.126 ...

26 CFR 1.665(f)-1A - Undistributed capital gain.

Science.gov (United States)

2010-04-01

... 26 Internal Revenue 8 2010-04-01 2010-04-01 false Undistributed capital gain. 1.665(f)-1A Section... Beginning on Or After January 1, 1969 § 1.665(f)-1A Undistributed capital gain. (a) Domestic trusts. (1) The term undistributed capital gain means (in the case of a trust other than a foreign trust created by a U...

CERN Technical Training 2004: New Short Courses (SC) on Microsoft Outlook

CERN Multimedia

Monique Duval

2004-01-01

The CERN Technical Training programme is now proposing a new format for courses on Microsoft Outlook. Three two-hours Short Courses (SC) will cover basic and advanced functionalities of the recommended mail client for email at CERN. Each module can be followed independently. The next scheduled sessions will take place as follows: Outlook (SC I): E-mail. Next session: 31.8.2004 (9h00-11h00) Outlook (SC II): Calendar, Tasks and Notes. Next session: 31.8.2004 (14h00-16h00) Outlook (SC III): Meetings and Delegation. Next session: 7.9.2004 (14h00-16h00) In particular, SC I will cover how to open, create and send email, work with attachments, use stationery, organise mail, and work with the address book, SC II will show how to work with the calendar, tasks and notes, and SC III will cover how to organise and manage meetings, work with meeting requests, share tasks, and use email and calendar delegation. The number of participants to each session is limited to 8. The instructor is English-French bilingual, and she...

The effect of proximity to hurricanes Katrina and Rita on subsequent hurricane outlook and optimistic bias.

Science.gov (United States)

Trumbo, Craig; Lueck, Michelle; Marlatt, Holly; Peek, Lori

2011-12-01

This study evaluated how individuals living on the Gulf Coast perceived hurricane risk after Hurricanes Katrina and Rita. It was hypothesized that hurricane outlook and optimistic bias for hurricane risk would be associated positively with distance from the Katrina-Rita landfall (more optimism at greater distance), controlling for historically based hurricane risk and county population density, demographics, individual hurricane experience, and dispositional optimism. Data were collected in January 2006 through a mail survey sent to 1,375 households in 41 counties on the coast (n = 824, 60% response). The analysis used hierarchal regression to test hypotheses. Hurricane history and population density had no effect on outlook; individuals who were male, older, and with higher household incomes were associated with lower risk perception; individual hurricane experience and personal impacts from Katrina and Rita predicted greater risk perception; greater dispositional optimism predicted more optimistic outlook; distance had a small effect but predicted less optimistic outlook at greater distance (model R(2) = 0.21). The model for optimistic bias had fewer effects: age and community tenure were significant; dispositional optimism had a positive effect on optimistic bias; distance variables were not significant (model R(2) = 0.05). The study shows that an existing measure of hurricane outlook has utility, hurricane outlook appears to be a unique concept from hurricane optimistic bias, and proximity has at most small effects. Future extension of this research will include improved conceptualization and measurement of hurricane risk perception and will bring to focus several concepts involving risk communication. © 2011 Society for Risk Analysis.

Climate Prediction Center - Atlantic Hurricane Outlook

Science.gov (United States)

Weather Service NWS logo - Click to go to the NWS home page Climate Prediction Center Home Site Map News ; Seasonal Climate Summary Archive The 2018 Atlantic hurricane season outlook is an official product of the National Oceanic and Atmospheric Administration (NOAA) Climate Prediction Center (CPC). The outlook is

Short-term energy outlook annual supplement, 1993

International Nuclear Information System (INIS)

1993-01-01

The Energy Information Administration (EIA) prepares quarterly, short-term energy supply, demand, and price projections for publication in February, May, August, and November in the Short-Term Energy Outlook (Outlook). An annual supplement analyzes the performance of previous forecasts, compares recent cases with those of other forecasting services, and discusses current topics related to the short-term energy markets. (See Short-Term Energy Outlook Annual Supplement, DOE/EIA-0202.) The forecast period for this issue of the Outlook extends from the third quarter of 1993 through the fourth quarter of 1994. Values for the second quarter of 1993, however, are preliminary EIA estimates (for example, some monthly values for petroleum supply and disposition are derived in part from weekly data reported in the Weekly Petroleum Status Report) or are calculated from model simulations using the latest exogenous information available (for example, electricity sales and generation are simulated using actual weather data). The historical energy data are EIA data published in the Monthly Energy Review, Petroleum Supply Monthly, and other EIA publications. Minor discrepancies between the data in these publications and the historical data in this Outlook are due to independent rounding

Global outlook for nuclear power

International Nuclear Information System (INIS)

Southworth, F.H.

2010-01-01

'Full text:' The global nuclear power forecast, the North American outlook and the effect of nuclear power growth on greenhouse gas emissions in North America will be discussed. The construction of Generation III reactors will replace aging power plants and, further, add capacity that is environmentally sustainable. The outlook for Generation IV reactors also may significantly improve the environmental balance after 2030, both in electrical markets, waste reduction, and in non-traditional markets such as process heat. (author)

Technical Training: CERN Technical Training 2004 - New Short Courses (SC) on Microsoft Outlook

CERN Multimedia

Monique Duval

2004-01-01

The CERN Technical Training programme is now proposing a new format for courses on Microsoft Outlook. Three two-hours Short Courses (SC) will cover basic and advanced functionalities of the recommended mail client for email at CERN. Each module can be followed independently. The next scheduled sessions will take place as follows: Outlook (SC I): E-mail. Next session: 31.8.2004 (9h00-11h00) Outlook (SC II): Calendar, Tasks and Notes. Next session: 31.8.2004 (14h00-16h00) Outlook (SC III): Meetings and Delegation. Next session: 7.9.2004 (14h00-16h00) In particular, SC I will cover how to open, create and send email, work with attachments, use stationery, organise mail, and work with the address book, SC II will show how to work with the calendar, tasks and notes, and SC III will cover how to organise and manage meetings, work with meeting requests, share tasks, and use email and calendar delegation. The number of participants to each session is limited to 8. The instructor is English-French bilingual, and s...

Fast-food Culture and Americans’Outlooks on Life

Institute of Scientific and Technical Information of China (English)

易婧

2014-01-01

Fast-food is always the one of the main culture in America just like it has been known. It is not only very important in Americans’lives, but can reflect some of their outlooks on life. This thesis gives an analysis of reflection of Americans ’out-looks on life in fast-food culture. Five types of Americans’outlooks on life have been surveyed:working hard and playing hard, optimism and open-mindedness, treating the time as the life, self-independence and believing the equality. Beginning with the introduction of the emergence and development of fast-food culture in America, the thesis brings why the fast-food can be pop-ularized among Americans to light. Consequently, we can find that some of the Americans ’outlooks on life can be consistent with their fast-food culture.This thesis will be divided into four parts. The first part is the introduction and the last conclusion. The focus of this thesis is laid on the two middle parts which first display the five types of Americans ’outlooks on life, then give the analysis of the reflection in fast-food culture. This thesis attempts to explore the Americans ’outlooks on life. Although by the thesis we can not learn about a nation completely, we still know some aspects of their outlooks on life from fast-food culture.

Short-term energy outlook: Quarterly projections, Third quarter 1992

International Nuclear Information System (INIS)

1992-08-01

The Energy Information Administration (EIA) prepares quarterly, short-term energy supply, demand, and price projections for publication in February, May, August, and November in the Short-Term Energy Outlook (Outlook). An annual supplement analyzes the performance of previous forecasts, compares recent cases with those of other forecasting services, and discusses current topics related to the short-term energy markets. (See Short-Term Energy Outlook Annual Supplement, DOE/EIA-0202.) The principal users of the Outlook are managers and energy analysts in private industry and government. The forecast period for this issue of the Outlook extends from the third quarter of 1992 through the fourth quarter of 1993. Values for the second quarter of 1992, however, are preliminary EIA estimates (for example, some monthly values for petroleum supply and disposition are derived in part from weekly data reported in the Weekly Petroleum Status Report) or are calculated from model simulations using the latest exogenous information available (for example, electricity sales and generation are simulated using actual weather data). The historical energy data are EIA data published in the Monthly Energy Review, Petroleum Supply Monthly, and other EIA publications. Minor discrepancies between the data in these publications and the historical data in this Outlook are due to independent rounding

MITI revises outlooks for energy and power demand

International Nuclear Information System (INIS)

Anon.

1987-01-01

The Ministry of International Trade and Industry has revised downward its long-term outlook on energy supply and demand, lowering the estimated primary energy demand for fiscal 2000 from 600 million tons in oil equivalent to 540 MTOE, and reducing total power demand for fiscal 2000 from 899.1 billion kWh to 838 billion. In this content, the outlook for installed nuclear capacity has been revised downward from 62,000 MW to 53,500 MW. This revision of the power supply-demand outlook was reported on Oct. 1 to the supply and demand committee (Chairman - Yoshihiko Morozumi, Adviser to Nippon Schlum-berger) of the Electric Utility Industry Council; the energy supply-demand outlook was decided on Oct. 14 by the MITI Supply and Demand Subcommittee of the Advisory Committee for Energy and reported on Oct. 16 to the conference of ministers concerned with energy. (author)

IEA World Energy Outlook 2011—A comment

International Nuclear Information System (INIS)

Khatib, Hisham

2012-01-01

There are increasing numbers of annual and periodical energy studies that look into future energy demand and sustainability issues. Among these the World Energy Outlook stands out as the most important futuristic energy study and analysis. The 2011 Outlook is in four parts and gives a full update of energy demand and supply projections to 2035. It analyses the possible evolution of energy markets under three scenarios. The core scenarios rest on common assumptions about macroeconomic conditions and population growth, while their assumptions about government policy differ. This year's Outlook offers an in-depth analysis of prospects for energy supply and use in Russia. It also provides an expanded assessment of the prospects for coal. It reviewed the future of nuclear energy after Fukushima, as well as the strategic challenges of energy poverty. Last it dealt with the important aspect of energy subsidies. In spite of its extensiveness and in depth analysis some of the Outlook assumptions and conclusions need careful analysis and review.

Annual energy outlook 1993 with projections to 2010

International Nuclear Information System (INIS)

1992-01-01

The Energy Information Administration's (EIA's) Annual Energy Outlook 1993 (AEO93) presents forecasts for energy prices, supply, demand, and imports over the period 1990 to 2010. These projections take into account existing legislation, including the Energy Policy Act of 1992. Even though the world oil market remains relatively tight, the long-term outlook for oil prices has been revised downward since the Annual Energy Outlook 1992 as expectations for both the Organization of Petroleum Exporting Countries (OPEC) and non-OPEC production potential have been revised upward. Domestic natural gas prices are also expected to be lower than projected last year, in part because of a more optimistic outlook for drilling technology. Finally, lower growth in the demand for electricity is expected because of the Energy Policy Act of 1992, which mandates efficiency standards for new energy-using equipment. These are the most striking differences between last year's EIA evaluation of long-term energy market trends and this year's evaluation

Positive Emotions and Your Health: Developing a Brighter Outlook

Science.gov (United States)

... Issues Subscribe August 2015 Print this issue Positive Emotions and Your Health Developing a Brighter Outlook En ... outlook doesn’t mean you never feel negative emotions, such as sadness or anger, says Dr. Barbara ...

International energy outlook, 1992

International Nuclear Information System (INIS)

1992-01-01

This report presents the current Energy Information Administration (EIA) assessment of the long-term outlook for international energy markets. The historic political and economic changes occurring in Easter Europe and the former Soviet Union will, no doubt, transform regional markets and world trade. This report pays particular attention to energy markets and resources in those countries that were once a part of the Centrally Planned Economies (CPE's) and how prospective changes in these countries might influence the energy outlook for the rest of the world. Several major EIA estimates determine, in large part, the resulting energy projections presented here. These include estimates of the energy intensity of economic activity; oil and natural gas production capacities; nuclear and hydroelectric generation capacities; international coal trade; and the rate of incremental energy requirements met by alternatives to oil

rno-miR-665 targets BCL2L1 (Bcl-xl) and increases vulnerability to propofol in developing astrocytes.

Science.gov (United States)

Sun, Wen-Chong; Pei, Ling

2016-07-01

Propofol exerts a cytotoxic influence over immature neurocytes. Our previous study revealed that clinically relevant doses of propofol accelerated apoptosis of primary cultured astrocytes of developing rodent brains via rno-miR-665 regulation. However, the role of rno-miR-665 during the growth spurt of neonatal rodent brains in vivo is still uncertain. Post-natal day 7 (P7) rats received a single injection of propofol 30 mg/kg intraperitoneally (i.p.), and neuroapoptosis of hippocampal astrocytes was analyzed by immunofluorescence and scanning electron microscopy. The differential expression of rno-miR-665, BCL2L1 (Bcl-xl), and cleaved caspase 3 (CC3) was surveyed by qRT-PCR and western blotting. In addition, the utility of A-1155463, a highly potent and BCL2L1-selective antagonist, was aimed to assess the contribution of BCL2L1 for neuroglial survival. Following the intraventricular injection of lentivirus rno-miR-665, neuroprotection was detected by 5-point scale measurement. The single dose of propofol 30 mg/kg triggered dose-dependent apoptosis of developing hippocampal astrocytes. Meanwhile, propofol triggered both rno-miR-665 and CC3, and depressed BCL2L1, which was predicted as one target gene of rno-miR-665. Combination treatment with A-1155463 and propofol induced lower mRNA and protein levels of BCL2L1 and more CC3 activation than propofol treatment alone in vivo. The lentivirus-mediated knockdown of rno-miR-665 elevated BCL2L1 and attenuated CC3 levels, whereas up-regulation of rno-miR-665 suppressed BCL2L1 and induced CC3 expression in vivo. More importantly, rno-miR-665 antagomir infusion improved neurological outcomes of pups receiving propofol during the brain growth spurt. Rno-miR-665, providing a potential target for alternative therapeutics for pediatric anesthesia, is susceptible to propofol by negatively targeting antiapoptotic BCL2L1. Relatively little is known about the association between exposure of astrocytes to brief propofol

LCG Persistency Framework (CORAL, COOL, POOL): Status and Outlook

International Nuclear Information System (INIS)

Valassi, A; Kalkhof, A; Loth, A; Trentadue, R; Clemencic, M; Frank, M; Pokorski, W; Dykstra, D; Front, D; Govi, G; Nowak, M; Salnikov, A; Schmidt, S A; Wache, M; Xie, Z

2011-01-01

The Persistency Framework consists of three software packages (CORAL, COOL and POOL) addressing the data access requirements of the LHC experiments in different areas. It is the result of the collaboration between the CERN IT Department and the three experiments (ATLAS, CMS and LHCb) that use this software to access their data. POOL is a hybrid technology store for C++ objects, metadata catalogs and collections. CORAL is a relational database abstraction layer with an SQL-free API. COOL provides specific software tools and components for the handling of conditions data. This paper reports on the status and outlook of the project and reviews in detail the usage of each package in the three experiments.

Outlook. Number 362

Science.gov (United States)

Council for American Private Education, 2011

2011-01-01

Council for American Private Education (CAPE) is a coalition of national associations serving private schools K-12. "Outlook" is published monthly by CAPE. This issue contains the following articles: (1) Boehner and Lieberman Introduce D.C. Choice Bill; (2) Research Demonstrates Benefits of School Choice; (3) NAEP [National Assessment …

20 CFR 416.665 - How does your representative payee account for the use of benefits?

Science.gov (United States)

2010-04-01

... for the use of benefits? 416.665 Section 416.665 Employees' Benefits SOCIAL SECURITY ADMINISTRATION... in order to make accounting reports and must make those records available upon our request. If your representative payee fails to provide an annual accounting of benefits or other required reports, we may require...

Short-term energy outlook, January 1999

Energy Technology Data Exchange (ETDEWEB)

NONE

1999-01-01

The Energy Information Administration (EIA) prepares the Short-Term Energy Outlook (energy supply, demand, and price projections) monthly. The forecast period for this issue of the Outlook extends from January 1999 through December 2000. Data values for the fourth quarter 1998, however, are preliminary EIA estimates (for example, some monthly values for petroleum supply and disposition are derived in part from weekly data reported in EIA`s Weekly Petroleum Status Report) or are calculated from model simulations that use the latest exogenous information available (for example, electricity sales and generation are simulated by using actual weather data). The historical energy data, compiled in the January 1999 version of the Short-Term Integrated Forecasting System (STIFS) database, are mostly EIA data regularly published in the Monthly Energy Review, Petroleum Supply Monthly, and other EIA publications. Minor discrepancies between the data in these publications and the historical data in this Outlook are due to independent rounding. The STIFS model is driven principally by three sets of assumptions or inputs: estimates of key macroeconomic variables, world oil price assumptions, and assumptions about the severity of weather. Macroeconomic estimates are produced by DRI/McGraw-Hill but are adjusted by EIA to reflect EIA assumptions about the world price of crude oil, energy product prices, and other assumptions which may affect the macroeconomic outlook. By varying the assumptions, alternative cases are produced by using the STIFS model. 28 figs., 19 tabs.

Financial outlook for the Canadian gas industry

International Nuclear Information System (INIS)

Friedenberg, B.

1995-01-01

The financial outlook for the Canadian gas industry depends on the outlook for gas prices at Canadian producing basins, the cost of producing in Canada and the volume of production of Canadian natural gas. Price, cost and volume determine the health of the Canadian industry. Industry's costs are the basis of the supply (volume) offered on the market and price is determined by the interaction of supply and demand. (author)

Probing the eV-mass range for solar axions with the CAST experiment

International Nuclear Information System (INIS)

Vogel, J.

2009-01-01

The CERN Axion Solar Telescope (CAST) is searching for solar axions, which could be produced in the core of the Sun via the so-called Primakoff effect. For this purpose, CAST uses a decommissioned LHC prototype magnet. In its magnetic field of 9 Tesla axions could be reconverted into X-ray photons. The magnet is mounted on a structure built to follow the Sun during sunrise and sunset for a total of about 3 hours per day. The analysis of the data acquired during the first phase of the experiment with vacuum in the magnetic field region yielded the most restrictive experimental upper limit on the axion-to-photon coupling constant for axion masses up to about 0.02 eV. In order to extend the sensitivity of the experiment to a wider mass range, the CAST experiment continued its search for axions with helium in the magnet bores. In this way it is possible to restore coherence for larger masses. Changing the pressure of the helium gas enables the experiment to scan different axion masses. In the first part of this second phase of CAST, helium-4 has been used and the axion mass region was extended up to 0.4 eV. Therefore the experiment enters the regions favored by axion models. In CAST's ongoing helium-3 phase the studied mass range is now further extended. We will present the final results of CAST's helium-4 phase. Furthermore the latest upgrades of the experiments will be shown and an outlook on CAST's status and prospects will be given. (author)

Outlook for the U.S. alkylation industry

International Nuclear Information System (INIS)

Felten, J.R.; Bradshaw, T.; McCarthy, K.

1994-01-01

Alkylation has long been recognized in the refining industry as one of the best options to convert refinery olefins into valuable, clean, high octane blending components. In fact, refinery alkylation is a preferred source of blending stocks for reformulated gasoline. However, the hydrofluoric acid (HF) alkylation process and, to a lesser extent, the sulfuric acid (SA) process have come under increasing pressure in the US due to safety and environmental concerns. This paper examines the current outlook for the US alkylation industry including: key trends and driving forces in the industry, the impact of environmental issues on both HF and SA alkylation, US alkylation supply/demand forecast including the outlook for oxygenates, how US refines will respond to the increased demand and restricted supply for alkylates, and the outlook for new solid acid alkylation (SAC) technology

Kaons Review and Outlook

CERN Document Server

Ceccucci, A

2006-01-01

This article presents a review of recent results and an outlook of kaon physics. After enjoying a renaissance, the discipline is now becoming and endangered species. Action will be needed to keep kaon physics at the heart of future FPCP meetings.

7 CFR 205.665 - Noncompliance procedure for certifying agents.

Science.gov (United States)

2010-01-01

... applicable State organic program's governing State official all records concerning its certification...) ORGANIC FOODS PRODUCTION ACT PROVISIONS NATIONAL ORGANIC PROGRAM Administrative Compliance § 205.665... agent. (f) Cessation of certification activities. A certifying agent whose accreditation is suspended or...

20 CFR 665.300 - What are rapid response activities and who is responsible for providing them?

Science.gov (United States)

2010-04-01

... responsible for providing them? 665.300 Section 665.300 Employees' Benefits EMPLOYMENT AND TRAINING... natural or other disaster resulting in a mass job dislocation. (b) The State is responsible for providing.... The State must establish methods by which to provide additional assistance to local areas that...

Outlook 2001

International Nuclear Information System (INIS)

Anon

2000-01-01

ABARE's Executive Director, Brian Fisher in his address at the annual assembly of economists and commodity producers (Outlook 2001) indicated that the world economic growth, which is of critical importance to the direction of world commodity prices, is assumed to ease in 2001 but to strengthen in 2002. Yet despite the slower world economic growth he forecast that Australia's commodity exports would rise to be worth $86 billion in 2000-2001 and $89 billion in 2001 - 2002 reflecting a relatively low Australian dollar. The value of commodity exports is then forecast to trend downwards in real terms for the remainder of the outlook period to 2005-2006. In preparing commodity projections ABARE assumed world economic growth to moderate to around 3.4% in 2001, and then strengthen to 3.9%, in 2002 supported by lower interest rates in key economies. Activity in the Australian economy is assumed to remain reasonably firm in the short term. While growth in domestic demand is likely to moderate, export performance is expected to remain strong. There has been a remarkable improvement in Australia's trade performance during the last year. This improvement is expected to continue in the short term. For energy commodities, export earnings are forecast to increase from $18.4 billion in 1999-2000 to $25.1 billion in 2000-2001 before declining to $24.4 billion in 2001-2002

Waste management outlook for mountain regions: Sources and solutions.

Science.gov (United States)

Semernya, Larisa; Ramola, Aditi; Alfthan, Björn; Giacovelli, Claudia

2017-09-01

Following the release of the global waste management outlook in 2015, the United Nations Environment Programme (UN Environment), through its International Environmental Technology Centre, is elaborating a series of region-specific and thematic waste management outlooks that provide policy recommendations and solutions based on current practices in developing and developed countries. The Waste Management Outlook for Mountain Regions is the first report in this series. Mountain regions present unique challenges to waste management; while remoteness is often associated with costly and difficult transport of waste, the potential impact of waste pollutants is higher owing to the steep terrain and rivers transporting waste downstream. The Outlook shows that waste management in mountain regions is a cross-sectoral issue of global concern that deserves immediate attention. Noting that there is no 'one solution fits all', there is a need for a more landscape-type specific and regional research on waste management, the enhancement of policy and regulatory frameworks, and increased stakeholder engagement and awareness to achieve sustainable waste management in mountain areas. This short communication provides an overview of the key findings of the Outlook and highlights aspects that need further research. These are grouped per source of waste: Mountain communities, tourism, and mining. Issues such as waste crime, plastic pollution, and the linkages between exposure to natural disasters and waste are also presented.

Short-term energy outlook, July 1998

Energy Technology Data Exchange (ETDEWEB)

NONE

1998-07-01

The Energy Information Administration (EIA) prepares The Short-Term Energy Outlook (energy supply, demand, and price projections) monthly for distribution on the internet at: www.eia.doe.gov/emeu/steo/pub/contents.html. In addition, printed versions of the report are available to subscribers in January, April, July and October. The forecast period for this issue of the Outlook extends from July 1998 through December 1999. Values for second quarter of 1998 data, however, are preliminary EIA estimates (for example, some monthly values for petroleum supply and disposition are derived in part from weekly data reported in EIA`s Weekly Petroleum Status Report) or are calculated from model simulations that use the latest exogenous information available (for example, electricity sales and generation are simulated by using actual weather data). The historical energy data, compiled in the July 1998 version of the Short-Term Integrated Forecasting System (STIFS) database, are mostly EIA data regularly published in the Monthly Energy Review, Petroleum Supply Monthly, and other EIA publications. Minor discrepancies between the data in these publications and the historical data in this Outlook are due to independent rounding. 28 figs., 19 tabs.

Global drought outlook by means of seasonal forecasts

Science.gov (United States)

Ziese, Markus; Fröhlich, Kristina; Rustemeier, Elke; Becker, Andreas

2017-04-01

Droughts are naturally occurring phenomena which are caused by a shortage of available water due to lower than normal precipitation and/or above normal evaporation. Depending on the length of the droughts, several sectors are affected starting with agriculture, then river and ground water levels and finally socio-economic losses at the long end of the spectrum of drought persistence. Droughts are extreme events that affect much larger areas and last much longer than floods, but are less geared towards media than floods being more short-scale in persistence and impacts. Finally the slow onset of droughts make the detection and early warning of their beginning difficult and time is lost for preparatory measures. Drought indices are developed to detect and classify droughts based on (meteorological) observations and possible additional information tailored to specific user needs, e.g. in agriculture, hydrology and other sectors. Not all drought indices can be utilized for global applications as not all input parameters are available at this scale. Therefore the Global Precipitation Climatology Centre (GPCC) developed a drought index as combination of the Standardized Drought Index (SPI) and the Standardized Precipitation Evapotranspiration Index (SPEI), the GPCC-DI. The GPCC-DI is applied to drought monitoring and retrospective analyses on a global scale. As the Deutscher Wetterdienst (DWD) operates a seasonal forecast system in cooperation with Max-Planck-Institute for Meteorology Hamburg and University of Hamburg, these data are also used for an outlook of drought conditions by means of the GPCC-DI. The reliability of seasonal precipitation forecasts is limited, so the drought outlook is available only for forecast months two to four. Based on the GPCC-DI, DWD provides a retrospective analysis, near-real-time monitoring and outlook of drought conditions on a global scale and regular basis.

Short-Term Energy Outlook: Quarterly projections. Fourth quarter 1993

Energy Technology Data Exchange (ETDEWEB)

1993-11-05

The Energy Information Administration (EIA) prepares quarterly, short-term energy supply, demand, and price projections for publication in February, May, August, and November in the Short-Term Energy Outlook (Outlook). An annual supplement analyzes the performance of previous forecasts, compares recent cases with those of other forecasting services, and discusses current topics related to the short-term energy markets. (See Short-Term Energy Outlook Annual Supplement, DOE/EIA-0202.) The forecast period for this issue of the Outlook extends from the fourth quarter of 1993 through the fourth quarter of 1994. Values for the third quarter of 1993, however, are preliminary EIA estimates (for example, some monthly values for petroleum supply and disposition are derived in part from weekly data reported in the Weekly Petroleum Status Report) or are calculated from model simulations using the latest exogenous information available (for example, electricity sales and generation are simulated using actual weather data). The historical energy data are EIA data published in the Monthly Energy Review, Petroleum Supply Monthly, and other EIA publications.

20 CFR 408.665 - How does your representative payee account for the use of your SVB payments?

Science.gov (United States)

2010-04-01

... for the use of your SVB payments? 408.665 Section 408.665 Employees' Benefits SOCIAL SECURITY... records of how benefits were used in order to provide accounting reports and must make those records available upon our request. If your representative payee fails to provide an annual accounting of benefits...

A demand/supply and price outlook for electricity in Ontario

International Nuclear Information System (INIS)

Dalton, J.

2004-01-01

This paper presents the demand/supply and price outlook for electricity in Ontario. The paper examines the near term outlook, critical demand and supply issues, the projected Ontario demand/supply balances and finally concludes by looking at the challenges for Ontario's new market structure

AEgIS Experiment: Status & Outlook

CERN Document Server

Lansonneur, P; Amsler, C; Bonomi, G; Brusa, R S; Caccia, M; Caravita, R; Castelli, F; Cerchiari, G; Comparat, D; Consolati, G; Demetrio, A; Di Noto, L; Doser, M; Evans, C; Ferragut, R; Fesel, J; Fontana, A; Gerber, S; Giammarchi, M; Gligorova, A; Guatieri, F; Haider, S; Hinterberger, A; Holmestad, H; Kellerbauer, A; Khalidova, O; Krasnicky, D; Lagomarsino, V; Lebrun, P; Malbrunot, C; Mariazzi, S; Marton, J; Matveev, V; Mazzotta, Z; Müller, S R; Nebbia, G; Nedelec, P; Oberthaler, M; Pacico, N; Pagano, D; Penasa, L; Petracek, V; Prelz, F; Prevedelli, M; Ravelli, L; Rienaecker, B; Robert, J; Rhøne, O M; Rotondi, A; Sacerdoti, M; Sandaker, H; Santoro, R; Simon, M; Smestad, L; Sorrentino, F; Testera, G; Tietje, I C; Widmann, E; Yzombard, P; Zimmer, C; Zmeska, J; Zurlo, N

2017-01-01

The AEGIS experiment 1 (Antimatter Experiment: Gravity, Interferometry, Spectroscopy) is planned to perform the first measurement of the gravitational acceleration on antimatter by observing the free fall of antihydrogen atoms. By combining techniques based on recent developments in the production of positronium and its laser excitation to Rydberg states, such a study seems indeed to be feasible for neutral antimatter. We present here some of the experimental techniques involved in the experiment as well as the status of the detector test envisioned for the gravity measurement.

Annual energy outlook 1994: With projections to 2010

Energy Technology Data Exchange (ETDEWEB)

1994-01-01

The Annual Energy Outlook 1994 (AEO94) presents the midterm energy forecasts of the Energy Information Administration (EIA). This year`s report presents projects and analyses of energy supply, demand, and prices through 2010, based for the first time on results from the National Energy Modeling System (NEMS). NEMS is the latest in a series of computer-based energy modeling systems used over the past 2 decades by EIA and its predecessor organization, the Federal Energy Administration, to analyze and forecast energy consumption and supply in the midterm period (about 20 years). Quarterly forecasts of energy supply and demand for 1994 and 1995 are published in the Short-Term Energy Outlook (February 1994). Forecast tables for 2000, 2005, and 2010 for each of the five scenarios examined in the AEO94 are provided in Appendices A through E. The five scenarios include a reference case and four additional cases that assume higher and lower economic growth and higher and lower world oil prices. Appendix F provides detailed comparisons of the AEO94 forecasts with those of other organizations. Appendix G briefly described the NEMS and the major AEO94 forecast assumptions. Appendix H summarizes the key results for the five scenarios.

International energy outlook 1999

Energy Technology Data Exchange (ETDEWEB)

NONE

1999-03-01

This report presents international energy projections through 2020, prepared by the Energy Information Administration. The outlooks for major energy fuels are discussed, along with electricity, transportation, and environmental issues. The report begins with a review of world trends in energy demand. The historical time frame begins with data from 1970 and extends to 1996, providing readers with a 26-year historical view of energy demand. The IEO99 projections covers a 24-year period. The next part of the report is organized by energy source. Regional consumption projections for oil, natural gas, coal, nuclear power, and renewable energy (hydroelectricity, geothermal, wind, solar, and other renewables) are presented in the five fuel chapters, along with a review of the current status of each fuel on a worldwide basis. The third part of the report looks at energy consumption in the end-use sectors, beginning with a chapter on energy use for electricity generation. New to this year`s outlook are chapters on energy use in the transportation sector and on environmental issues related to energy consumption. 104 figs., 87 tabs.

UNITI Bundesverband mittelstaendischer Mineraloelunternehmen e.V.. Annual report 2013/2014. Review, around look, outlook

International Nuclear Information System (INIS)

2014-01-01

The Bundesverband mittelstaendischer Mineraloelunternehmen gives a review, around look, and outlook over the trade for 2013/2014. The themes are among others the market transparency agency for fuels, the eu rule ''Clean Power for Transport'', the change of energy in the heat market, and the promotion of gaseous fuels. Additionally legislative amendments are summarized and further actual themes of the petroleum industry. Informations about the association work, some statistical data of the trade, as well as a glossary for the theme ''Card and Automation'' supplement the annual report.

CARICOF - The Caribbean Regional Climate Outlook Forum

Science.gov (United States)

Van Meerbeeck, Cedric

2013-04-01

Regional Climate Outlook Forums (RCOFs) are viewed as a critical building block in the Global Framework for Climate Services (GFCS) of the World Meteorological Organization (WMO). The GFCS seeks to extend RCOFs to all vulnerable regions of the world such as the Caribbean, of which the entire population is exposed to water- and heat-related natural hazards. An RCOF is initially intended to identify gaps in information and technical capability; facilitate research cooperation and data exchange within and between regions, and improve coordination within the climate forecasting community. A focus is given on variations in climate conditions on a seasonal timescale. In this view, the relevance of a Caribbean RCOF (CARICOF) is the following: while the seasonality of the climate in the Caribbean has been well documented, major gaps in knowledge exist in terms of the drivers in the shifts of amplitude and phase of seasons (as evidenced from the worst region-wide drought period in recent history during 2009-2010). To address those gaps, CARICOF has brought together National Weather Services (NWSs) from 18 territories under the coordination of the Caribbean Institute for Meteorology and Hydrology (CIMH), to produce region-wide, consensus, seasonal climate outlooks since March 2012. These outlooks include tercile rainfall forecasts, sea and air surface temperature forecasts as well as the likely evolution of the drivers of seasonal climate variability in the region, being amongst others the El Niño Southern Oscillation or tropical Atlantic and Caribbean Sea temperatures. Forecasts for both the national-scale forecasts made by the NWSs and CIMH's regional-scale forecast amalgamate output from several forecasting tools. These currently include: (1) statistical models such as Canonical Correlation Analysis run with the Climate Predictability Tool, providing tercile rainfall forecasts at weather station scale; (2) a global outlooks published by the WMO appointed Global Producing

Canada's energy outlook : the reference case 2006

International Nuclear Information System (INIS)

Labib, H.; Casaubon, R.; Peluso, T.

2006-10-01

This long-term projection of energy supply, demand, consumption, production and greenhouse gas emissions from now until 2020 identified pressure points and emerging issues in Canadian energy markets. It contributed to public discussions on energy and related economic and environmental issues in Canada and provided a reference scenario from which new energy and climate change policies can be evaluated. Energy projections were developed based on the relationships between energy production, consumption and prices, as well as economic, technological and policy factors. The report included government implemented initiatives that promote energy efficiency or increase the use of alternative energy. This Outlook to 2020 is sensitive to key assumptions about economic growth, oil sands development and the electricity generation mix. It is based on a specific set of assumptions regarding oil price and economic growth. This outlook assumes crude oil prices to be nearly twice that of the last outlook in 1999 and natural gas prices are assumed to be three times higher. The outlook also assumes that the Mackenzie Delta gas pipeline will be in service by 2011. Other principal assumptions used to develop this outlook were that population will grow by 0.7 percent annually and that all but two of Canada's nuclear power plants will stay in service for at least eight more years. The outlook revealed that total energy demand is projected to grow by 1.3 percent per year. The fuel mix will not change much over this period because the prices of different energy sources will remain the same. Energy intensity is expected to improve by about 0.25 per cent annually in the residential and commercial sectors due to stock turn over and appliance regulations. Total energy demand will increase by 1 per cent per year for the residential sector, and at 2.4 percent per year for the commercial sector. Transportation demand is expected to grow by 1.6 per cent per year, while industrial energy intensity

50 CFR 665.812 - Sea turtle take mitigation measures.

Science.gov (United States)

2010-10-01

....812 Section 665.812 Wildlife and Fisheries FISHERY CONSERVATION AND MANAGEMENT, NATIONAL OCEANIC AND... of hook sizes and styles used by the vessel. (B) Extended reach handle. The hook removal device must... hook sizes and styles used by the vessel. (B) Handle. The handle must have a length equal to or greater...

Short-term energy outlook. Quarterly projections, first quarter 1995

International Nuclear Information System (INIS)

1995-02-01

The Energy Information Administration (EIA) prepares quarterly, short-term energy supply, demand, and price projections for publication in February, May, August, and November in the Short-Term Energy Outlook (Outlook). The forecast period for this issue of the Outlook extends from the first quarter of 1995 through the fourth quarter of 1996. Values for the fourth quarter of 1994, however, are preliminary EIA estimates or are calculated from model simulations using the latest exogenous information available (for example, electricity sales and generation are simulated using actual weather data). The historical energy data, compiled into the first quarter 1995 version of the Short-Term Integrated Forecasting System (STIFS) database, are mostly EIA data regularly published in the Monthly Energy Review, Petroleum Supply Monthly, and other EIA publications. Minor discrepancies between the data in these publications and the historical data in this Outlook are due to independent rounding. The STIFS database is archived quarterly and is available from the National Technical Information Service. The cases are produced using the Short-Term Integrated Forecasting System (STIFS). The STIFS model is driven principally by three sets of assumptions or inputs: estimates of key macroeconomic variables, world oil price assumptions, and assumptions about the severity of weather. Macroeconomic estimates are produced by DRI/McGraw-Hill but are adjusted by EIA to reflect EIA assumptions about the world price of crude oil, energy product prices, and other assumptions which may affect the macroeconomic outlook. The EIA model is available on computer tape from the National Technical Information Service

National Energy Outlook Modelling System

Energy Technology Data Exchange (ETDEWEB)

Volkers, C.M. [ECN Policy Studies, Petten (Netherlands)

2013-12-15

For over 20 years, the Energy research Centre of the Netherlands (ECN) has been developing the National Energy Outlook Modelling System (NEOMS) for Energy projections and policy evaluations. NEOMS enables 12 energy models of ECN to exchange data and produce consistent and detailed results.

IEA World Energy Outlook 2010-A comment

International Nuclear Information System (INIS)

Khatib, Hisham

2011-01-01

The World Energy Outlook 2010 is a comprehensive energy report issued by the IEA. It is rewritten annually to reflect the world's changing energy and economy realities; it also introduces new issues relevant to the energy sector. This year it dealt with Caspian Energy, Energy Poverty and Energy Subsidies. WEO is controversial in few aspects; it still promotes a 450 Scenario which has become out of reach. This year however it introduced a more realistic New Policies Scenario which will need a lot of good will and investments to accomplish. Governmental policies are going to chart future energy sector performance; increasingly this is becoming decided by non-OECD countries. A more pragmatic future energy outlook is needed to reflect developing countries priorities for growth and utilization of local resources and how to accommodate this with abatement priorities through energy efficiency measures and technologies. - Research highlights: → We critically review the findings of the IEA - World Energy Outlook 2010. → The main '450 Scenario' is no longer realistic. → Some of the other indicators like the Energy Development Index are also critically reviewed and improvements proposed.

Short-term energy outlook, April 1999

Energy Technology Data Exchange (ETDEWEB)

NONE

1999-04-01

The forecast period for this issue of the Outlook extends from April 1999 through December 2000. Data values for the first quarter 1999, however, are preliminary EIA estimates (for example, some monthly values for petroleum supply and disposition are derived in part from weekly data reported in EIA`s Weekly Petroleum Status Report) or are calculated from model simulations that use the latest exogenous information available (for example, electricity sales and generation are simulated by using actual weather data). The historical energy data, compiled in the April 1999 version of the Short-Term Integrated forecasting system (STIFS) database, are mostly EIA data regularly published in the Monthly Energy Review, Petroleum Supply Monthly, and other EIA publications. Minor discrepancies between the data in these publications and the historical data in this Outlook are due to independent rounding. The STIFS model is driven principally by three sets of assumptions or inputs: estimates of key macroeconomic variables, world oil price assumptions, and assumptions about the severity of weather. Macroeconomic estimates are produced by DRI/McGraw-Hill but are adjusted by EIA to reflect EIA assumptions about the world price of crude oil, energy product prices, and other assumptions which may affect the macroeconomic outlook. By varying the assumptions, alternative cases are produced by using the STIFS model. 25 figs., 19 tabs.

International energy outlook 1995, May 1995

Energy Technology Data Exchange (ETDEWEB)

NONE

1995-06-01

The International Energy Outlook 1995 (IEO95) presents an assessment by the Energy Information Administration (EIA) of the international energy market outlook through 2010. The report is an extension of the EIA`s Annual Energy Outlook 1995 (AEO95), which was prepared using the National Energy Modeling System (NEMS). US projections appearing in the IEO95 are consistent with those published in the AEO95. IEO95 is provided as a statistical service to energy managers and analysts, both in government and in the private sector. The projects are used by international agencies, Federal and State governments, trade associations, and other planners and decisionmakers. They are published pursuant to the Department of energy Organization Act of 1977 (Public Law 95-91), Section 295(c). The IEO95 projections are based on US and foreign government policies in effect on October 1, 1994. IEO95 displays projections according to six basic country groupings. The regionalization has changed since last year`s report. Mexico has been added to the Organization for Economic Cooperation and Development (OECD), and a more detailed regionalization has been incorporated for the remainder of the world, including the following subgroups: non-OECD Asia, Africa, Middle East, and Central and South America. China is included in non-OECD Asia. Eastern Europe and the former Soviet Union are combined in the EE/FSU subgroup.

Remarks - Global energy outlook and externalities

International Nuclear Information System (INIS)

Gray, J.E.

1994-01-01

The author presents a global energy outlook, for the period 1990-2010. Then, he presents some views on the subject of externalities, some regulations and proscriptions about internalization of costs are detailed. (TEC)

Airline Disruption Management - Perspectives, Experiences and Outlook

DEFF Research Database (Denmark)

Kohl, Niklas; Larsen, Allan; Larsen, Jesper

2004-01-01

Over the past decade, airlines have become more concerned with developing an optimal flight schedule, with very little slack left to accommodate for any form of variation from the optimal solution. During operation the planned schedules often have to be revised due to disruptions caused...... report on experiences from a large research and development project on airline disruption management. Within the project the first prototype of a multiple resource decision support system at the operations control center in a major airline, has been implemented....... by for example severe weather, technical problems and crew sickness. Thus, the field of Airline Disruption Management has emerged within the past few years. The increased focus on cutting cost at the major airlines has intensified the interest in the development of new and cost e cient methods to handle airline...

Climate Prediction Center - Seasonal Outlook

Science.gov (United States)

Weather Service NWS logo - Click to go to the NWS home page Climate Prediction Center Site Map News Forecast Discussion PROGNOSTIC DISCUSSION FOR MONTHLY OUTLOOK NWS CLIMATE PREDICTION CENTER COLLEGE PARK MD INFLUENCE ON THE MONTHLY-AVERAGED CLIMATE. OUR MID-MONTH ASSESSMENT OF LOW-FREQUENCY CLIMATE VARIABILITY IS

RSM Outlook Autumn 2005 : Branding

NARCIS (Netherlands)

G. Kemp (Gail); R. Morris (Rebecca)

2005-01-01

markdownabstract#### Contents The inaugural issue of RSM Outlook from autumn 2005 includes the opening of the new T-building, and how RSM celebrated its 35th birthday with a wine-tasting session. There are also articles on Professor Cees van Riel and reputation management, the re-branding of the

Nanotechnology for sustainable development: retrospective and outlook

Science.gov (United States)

Diallo, Mamadou S.; Fromer, Neil A.; Jhon, Myung S.

2013-11-01

The world is facing great challenges in meeting rising demands for basic commodities (e.g., food, water and energy), finished goods (e.g., cell phones, cars and airplanes) and services (e.g., shelter, healthcare and employment) while reducing and minimizing the impact of human activities on Earth's global environment and climate. Nanotechnology has emerged as a versatile platform that could provide efficient, cost-effective and environmentally acceptable solutions to the global sustainability challenges facing society. This special issue of the Journal of Nanoparticle Research is devoted to the utilization of nanotechnology to improve or achieve sustainable development. We highlight recent advances and discuss opportunities of utilizing nanotechnology to address global challenges in (1) water purification, (2) clean energy technologies, (3) greenhouse gases management, (4) materials supply and utilization, and (5) green manufacturing and chemistry. In addition to the technical challenges listed above, we also discuss societal perspectives and provide an outlook of the role of nanotechnology in the convergence of knowledge, technology and society for achieving sustainable development.

Nanotechnology for sustainable development: retrospective and outlook

International Nuclear Information System (INIS)

Diallo, Mamadou S.; Fromer, Neil A.; Jhon, Myung S.

2013-01-01

The world is facing great challenges in meeting rising demands for basic commodities (e.g., food, water and energy), finished goods (e.g., cell phones, cars and airplanes) and services (e.g., shelter, healthcare and employment) while reducing and minimizing the impact of human activities on Earth’s global environment and climate. Nanotechnology has emerged as a versatile platform that could provide efficient, cost-effective and environmentally acceptable solutions to the global sustainability challenges facing society. This special issue of the Journal of Nanoparticle Research is devoted to the utilization of nanotechnology to improve or achieve sustainable development. We highlight recent advances and discuss opportunities of utilizing nanotechnology to address global challenges in (1) water purification, (2) clean energy technologies, (3) greenhouse gases management, (4) materials supply and utilization, and (5) green manufacturing and chemistry. In addition to the technical challenges listed above, we also discuss societal perspectives and provide an outlook of the role of nanotechnology in the convergence of knowledge, technology and society for achieving sustainable development

Nanotechnology for sustainable development: retrospective and outlook

Energy Technology Data Exchange (ETDEWEB)

Diallo, Mamadou S., E-mail: mdiallo@kaist.ac.kr [Korea Advanced Institute of Science and Technology (KAIST), Graduate School of Energy, Environment, Water and Sustainability (EEWS) (Korea, Republic of); Fromer, Neil A. [California Institute of Technology, Resnick Sustainability Institute (United States); Jhon, Myung S. [Carnegie Mellon University, Department of Chemical Engineering (United States)

2013-11-15

The world is facing great challenges in meeting rising demands for basic commodities (e.g., food, water and energy), finished goods (e.g., cell phones, cars and airplanes) and services (e.g., shelter, healthcare and employment) while reducing and minimizing the impact of human activities on Earth’s global environment and climate. Nanotechnology has emerged as a versatile platform that could provide efficient, cost-effective and environmentally acceptable solutions to the global sustainability challenges facing society. This special issue of the Journal of Nanoparticle Research is devoted to the utilization of nanotechnology to improve or achieve sustainable development. We highlight recent advances and discuss opportunities of utilizing nanotechnology to address global challenges in (1) water purification, (2) clean energy technologies, (3) greenhouse gases management, (4) materials supply and utilization, and (5) green manufacturing and chemistry. In addition to the technical challenges listed above, we also discuss societal perspectives and provide an outlook of the role of nanotechnology in the convergence of knowledge, technology and society for achieving sustainable development.

International energy outlook, 1993

International Nuclear Information System (INIS)

1993-01-01

This report presents the current Energy Information Administration (EIA) assessment of the long-term outlook for international energy markets. This and other EIA reports are provided as a statistical service for use by managers and international energy analysts, not as a Government energy plan. Current US Government policies and foreign government policies are assumed to hold over the projection interval, which extends to the year 2010

Technology Trends in Small Unmanned Aircraft Systems (sUAS) and Counter-UAS: A Five Year Outlook

Science.gov (United States)

2017-11-01

I N S T I T U T E F O R D E F E N S E ANALYSES Technology Trends in Small Unmanned Aircraft Systems (sUAS) and Counter-UAS: A Five-Year Outlook...the copyright license under the clause at DFARS 252.227-7013 (a)(16) [June 2013]. INSTITUTE FOR DEFENSE ANALYSES IDA Paper P-8823 Technology Trends...threats to infrastructure posed across all domains—air, land, sea, and cyber. Although threats and technologies are rapidly evolving across all

Frozen heat: Global outlook on methane gas hydrates

Energy Technology Data Exchange (ETDEWEB)

Beaudoin, Yannick; Solgaard, Anne

2010-09-15

The United Nations Environment Programme via its collaborating center in Norway, UNEP/GRID-Arendal, is undertaking an assessment of the state of the knowledge of methane gas hydrates. The Global Outlook on Methane Gas Hydrates seeks to bridge the gap between the science, research and development activities related to this potential large scale unconventional source of natural gas and the needs of decision makers and the general public to understand the underlying societal and environmental drivers and impacts. The Outlook aims to provide credible and unbiased information sourced from stakeholders representing the environment, government, industry and society.

New mine projects, positive outlook

Energy Technology Data Exchange (ETDEWEB)

M. Cremer

2006-12-15

Speaking on the first day at the Mining 2006 Resources Convention the Deputy Director General, Mining and Petroleum gave an optimistic outlook for mining in 2007 based on the number of new projects under consideration or construction. The convention was held in early November in Brisbane, Queensland, Australia. 3 figs., 1 photo.

32 CFR 37.665 - Must I require nonprofit participants to have periodic audits?

Science.gov (United States)

2010-07-01

... DEFENSE DoD GRANT AND AGREEMENT REGULATIONS TECHNOLOGY INVESTMENT AGREEMENTS Award Terms Affecting Participants' Financial, Property, and Purchasing Systems Financial Matters § 37.665 Must I require nonprofit...

Interim report on the long-term outlook of energy demands and supplies

International Nuclear Information System (INIS)

1982-01-01

The supply/demand committee on Overall Energy Council has long deliberated on the outlook of energy demands and supplies, and finalized its report, assuming a yearly economic growth of about 5% in 1980s and utmost efforts by both the people and the government: the background and basic ideas to decide the outlook, the outlook of energy demands and supplies, and conclusions. The energy demand for fiscal 1990 is put at 590 million kl (crude oil equivalent) and for fiscal 2000 at 770 million kl with energy saving ratios 15.5% and 25%, respectively. The energy supply by nuclear power for fiscal 1990 is then put at 46,000 MW with 11.3% of the total. In the energy supply outlook for fiscal 1990, the aspects of the economy and stability as well as the quantity of respective energy sources are considered, overall to reduce the reliance on petroleum. (Mori, K.)

The Device-Independent Outlook On Quantum Physics

International Nuclear Information System (INIS)

Scarani, V.

2012-01-01

This text is an introduction to an operational outlook on Bell inequalities, which has been very fruitful in the past few years. It has lead to the recognition that Bell tests have their own place in applied quantum technologies, because they quantify non-classicality in a device-independent way, that is, without any need to describe the degrees of freedom under study and the measurements that are performed. At the more fundamental level, the same device-independent outlook has allowed the falsification of several other alternative models that could hope to reproduce the observed statistics while keeping some classical features that quantum theory denies; and it has shed new light on the long-standing quest for deriving quantum theory from physical principles. (author)

Supplement to the Annual Energy Outlook 1993

International Nuclear Information System (INIS)

1993-01-01

The Supplement to the Annual Energy Outlook 1993 is a companion document to the Energy Information Administration's (EIA) Annual Energy Outlook 1993 (AEO). Supplement tables provide the regional projections underlying the national data and projections in the AEO. The domestic coal, electric power, commercial nuclear power, end-use consumption, and end-use price tables present AEO forecasts at the 10 Federal Region level. World coal tables provide data and projections on international flows of steam coal and metallurgical coal, and the oil and gas tables provide the AEO oil and gas supply forecasts by Oil and Gas Supply Regions and by source of supply. All tables refer to cases presented in the AEO, which provides a range of projections for energy markets through 2010

International energy outlook 1998

International Nuclear Information System (INIS)

1998-04-01

The International Energy Outlook 1998 (IEO98) presents an assessment by the Energy Information Administration (EIA) of the outlook for international energy markets through 2020. Projections in IEO98 are displaced according to six basic country groupings. The industrialized region includes projections for four individual countries -- the United States, Canada, Mexico, and Japan -- along with the subgroups Western Europe and Australasia (defined as Australia, New Zealand, and the US Territories). The developing countries are represented by four separate regional subgroups: developing Asia, Africa, Middle East, and Central and South America. China and India are represented in developing Asia. New to this year's report, country-level projections are provided for Brazil -- which is represented in Central and South America. Eastern Europe and the former Soviet Union (EE/FSU) are considered as a separate country grouping. The report begins with a review of world trends in energy demand. Regional consumption projections for oil, natural gas, coal, nuclear power, and renewable energy (hydroelectricity, geothermal, wind, solar, and other renewables) are presented in five fuel chapters, with a review of the current status of each fuel on a worldwide basis. Summary tables of the IEO98 projections for world energy consumption, carbon emissions, oil production, and nuclear power generating capacity are provided in Appendix A. 88 figs., 77 tabs

Death Attitudes and Changes in Existential Outlook in Parents of Vulnerable Newborns.

Science.gov (United States)

Barr, Peter

2015-01-01

This study is an Actor-Partner Interdependence Model analysis of the relation of death attitudes with changes in outlook in 59 parent couples of neonatal intensive care newborns. Death attitudes effects with changes in outlook were mostly intrapersonal and they mainly occurred in fathers, though between gender differences were not usually significant. Death avoidance and neutral death acquiescence were positive predictors of positive changes in outlook, and fear of death and neutral death acquiescence were respective positive and inverse predictors of negative changes. Multidimensional measures of death attitudes and personal change should be used when studying these domains of psychological functioning.

Precision experiments with antihydrogen: an outlook

International Nuclear Information System (INIS)

Doser, Michael

2011-01-01

After a first generation of experiments has demonstrated the feasibility of forming - in a controlled manner - low-energy antihydrogen atoms via several different techniques, a second generation of experiments is now attempting to trap sufficiently cold atoms, or to form an atomic beam of antihydrogen atoms. The goal of these experiments is to carry out comparative precision spectroscopy between hydrogen and antihydrogen, in view of testing the CPT theorem, either through 1S-2S spectroscopy or via a measurement of the hyperfine splitting of the ground state of antihydrogen. A related class of experiments combines techniques from these experiments with recent developments in the formation of positronium to test the gravitational interaction between matter and antimatter. A significant number of challenges and limitations will still need to be overcome before precision measurements with antihydrogen become feasible, with the next significant milestones being either trapping of antihydrogen or the formation of a beam of antihydrogen.

Energy outlooks of young members of parliament

International Nuclear Information System (INIS)

Tolonen, P.

1999-01-01

Pekka Tolonen Energy outlooks of young members of parliament The main theme is 'youth and nuclear energy'. This article presents opinions of young opinion leaders over energy policy and nuclear energy

World Energy Outlook Special Report 2012: Iraq Energy Outlook

Energy Technology Data Exchange (ETDEWEB)

NONE

2012-07-01

Iraq is already the world’s third largest oil exporter. It has the resources and intention to increase its oil production vastly. Contracts are already in place. Will Iraq’s ambitions be realised? And what would the implications be for Iraq’s economy and for world oil markets? The obstacles are formidable: political, logistical, legal, regulatory, financial, lack of security and sufficient skilled labour. One example: in 2011 grid electricity could meet only 55% of demand. The International Energy Agency has studied these issues with the support and close cooperation of the government of Iraq and many other leading officials, commentators, industry representatives and international experts. This special report, in the World Energy Outlook series, presents the findings.

An evaluation of soil water outlooks for winter wheat in south-eastern Australia

Science.gov (United States)

Western, A. W.; Dassanayake, K. B.; Perera, K. C.; Alves, O.; Young, G.; Argent, R.

2015-12-01

Abstract: Soil moisture is a key limiting resource for rain-fed cropping in Australian broad-acre cropping zones. Seasonal rainfall and temperature outlooks are standard operational services offered by the Australian Bureau of Meteorology and are routinely used to support agricultural decisions. This presentation examines the performance of proposed soil water seasonal outlooks in the context of wheat cropping in south-eastern Australia (autumn planting, late spring harvest). We used weather ensembles simulated by the Predictive Ocean-Atmosphere Model for Australia (POAMA), as input to the Agricultural Production Simulator (APSIM) to construct ensemble soil water "outlooks" at twenty sites. Hindcasts were made over a 33 year period using the 33 POAMA ensemble members. The overall modelling flow involved: 1. Downscaling of the daily weather series (rainfall, minimum and maximum temperature, humidity, radiation) from the ~250km POAMA grid scale to a local weather station using quantile-quantile correction. This was based on a 33 year observation record extracted from the SILO data drill product. 2. Using APSIM to produce soil water ensembles from the downscaled weather ensembles. A warm up period of 5 years of observed weather was followed by a 9 month hindcast period based on each ensemble member. 3. The soil water ensembles were summarized by estimating the proportion of outlook ensembles in each climatological tercile, where the climatology was constructed using APSIM and observed weather from the 33 years of hindcasts at the relevant site. 4. The soil water outlooks were evaluated for different lead times and months using a "truth" run of APSIM based on observed weather. Outlooks generally have useful some forecast skill for lead times of up to two-three months, except late spring; in line with current useful lead times for rainfall outlooks. Better performance was found in summer and autumn when vegetation cover and water use is low.

World LNG outlook

International Nuclear Information System (INIS)

Maisonnier, G.

1999-01-01

CEDIGAZ proposes this new survey about LNG in view of the main changes which have occurred on this market during the past few years. Several projects under construction or planned three years ago are now commissioned (Qatargas) or on the verge of starting to export this year (Trinidad LNG, RasGas, Nigeria LNG) or next years (Oman LNG). The Asian crisis, which had major impacts on both short-term demand in Asia and LNG prices, has brought about new uncertainties to the long-term prospects. At the same time, it now seems more and more certain that firstly India and then China will import LNG in the next decade. It remains to be seen at what level and when this will occur. LNG growth in Europe has now become a reality, and new potential markets, for example in South America (Brazil), are also being considered as real opportunities in the near future. Considering these 'new' trends, an updated study about LNG appeared necessary. This survey 'World LNG Outlook - 99 Edition' is organised as the previous one: a historical record since 1964 (Chapter 1) followed by a description of the infrastructures existing in 1998 (Chapter 2). The analysis continues with world trade prospects by the year 2010 (Chapters 3 to 5). Chapter 6 describes the future LNG chain and the last Chapter (7) focuses on economic matters (LNG price trends, cost reductions). The study 'World LNG Outlook - 99 Edition' offers hence a comprehensive panorama of this sector from a short and long-term point of view. (author)

Outlook: The Next Twenty Years

Energy Technology Data Exchange (ETDEWEB)

Murayama, Hitoshi

2003-12-07

I present an outlook for the next twenty years in particle physics. I start with the big questions in our field, broken down into four categories: horizontal, vertical, heaven, and hell. Then I discuss how we attack the bigquestions in each category during the next twenty years. I argue for a synergy between many different approaches taken in our field.

Short-term energy outlook. Quarterly projections, 2nd quarter 1994

Energy Technology Data Exchange (ETDEWEB)

1994-05-01

The Energy Information Administration (EIA) prepares quarterly, short-term energy supply, demand, and price projections for publication in February, May, August, and November in the Short-Term Energy Outlook (Outlook). An annual supplement analyzes the performance of previous forecasts, compares recent cases with those of other forecasting services, and discusses current topics related to the short-term energy markets. The forecast period for this issue of the Outlook extends from the second quarter of 1994 through the fourth quarter of 1995. Values for the first quarter of 1994, however, are preliminary EIA estimates (for example, some monthly values for petroleum supply and disposition are derived in part from weekly data reported in the Weekly Petroleum Status Report) or are calculated from model simulations using the latest exogenous information available. The historical energy data, compiled into the second quarter 1994 version of the Short-Term Integrated Forecasting System (STIFS) database, are mostly EIA data regularly published in the Monthly Energy Review, Petroleum Supply Monthly, and other EIA publications. Minor discrepancies between the data in these publications and the historical data in this Outlook are due to independent rounding. The STIFS database is archived quarterly and is available from the National Technical Information Service. The cases are produced using the STIFS. The STIFS model is driven principally by three sets of assumptions or inputs: estimates of key macroeconomic variables, world oil price assumptions, and assumptions about the severity of weather. Macroeconomic estimates are produced by DRI/McGraw-Hill but are adjusted by EIA to reflect EIA assumptions about the world price of crude oil, energy product prices, and other assumptions which may affect the macroeconomic outlook. The EIA model is available on computer tape from the National Technical Information Service.

Power Line Communication (PLC) in Space - Current Status and Outlook

Science.gov (United States)

Wolf, J.

2012-05-01

The Power Line Communication (PLC) technology as known from various terrestrial applications, e.g. in building automation, in the automotive sector and on aircraft, appears to be a promising technology for the use on spacecraft. Starting from a critical overview on existing terrestrial PLC applications with their pros and cons, the paper gives a motivation for the introduction of the PLC technology on spacecraft, discusses the potential areas where it can be applied and is highlighting the potential problem areas. A short overview of on-going ESA PLC activities is provided and an outlook is given.

International energy outlook 1998

Energy Technology Data Exchange (ETDEWEB)

NONE

1998-04-01

The International Energy Outlook 1998 (IEO98) presents an assessment by the Energy Information Administration (EIA) of the outlook for international energy markets through 2020. Projections in IEO98 are displaced according to six basic country groupings. The industrialized region includes projections for four individual countries -- the United States, Canada, Mexico, and Japan -- along with the subgroups Western Europe and Australasia (defined as Australia, New Zealand, and the US Territories). The developing countries are represented by four separate regional subgroups: developing Asia, Africa, Middle East, and Central and South America. China and India are represented in developing Asia. New to this year`s report, country-level projections are provided for Brazil -- which is represented in Central and South America. Eastern Europe and the former Soviet Union (EE/FSU) are considered as a separate country grouping. The report begins with a review of world trends in energy demand. Regional consumption projections for oil, natural gas, coal, nuclear power, and renewable energy (hydroelectricity, geothermal, wind, solar, and other renewables) are presented in five fuel chapters, with a review of the current status of each fuel on a worldwide basis. Summary tables of the IEO98 projections for world energy consumption, carbon emissions, oil production, and nuclear power generating capacity are provided in Appendix A. 88 figs., 77 tabs.

{sigma}{sup t}ot{sub e}eyy at e{sup +}e{sup -} colliders

Energy Technology Data Exchange (ETDEWEB)

Godbole, R.M. [Indian Institute of Science, Centre for Theoretical Studies, Bangalore (India); Pancheri, G. [Istituto Nazionale di Fisica Nucleare, Laboratori Nazionali di Frascati, Rome (Italy)

2001-02-01

In this talk are briefly summarized different models for {sigma}{sup t}ot{sub 2}y (e{sup +}e{sup -} {yields}yy{yields} hadrons) and contrast model predictions with the data. It will be then discussed the capability of the future e{sup +}e{sup -} and yy colliders to distinguish between various models and end with an outlook for future work.

σtoteeγγ at e+e- colliders

International Nuclear Information System (INIS)

Godbole, R. M.; Pancheri, G.

2001-02-01

In this talk are briefly summarized different models for σ t ot γγ (e + e - → γγ → hadrons) and contrast model predictions with the data. It will be then discussed the capability of the future e + e - and γγ colliders to distinguish between various models and end with an outlook for future work

An interim report on the outlook of long-term energy supply and demand

International Nuclear Information System (INIS)

1982-01-01

An interim report was presented by the supply/demand committee in Over-all Energy Council concerning the energy demand and supply outlook for fiscal 1990 as compared with fiscal 1980. The background for deciding the outlook of energy supply and demand and basic ideas for energy policy, and the outlook for energy supply and demand are outlined. The outlook was prepared, assuming yearly economic growth of about 5 % in 1980s and the utmost efforts by people in energy situation. The energy situation both domestic and abroad is largely changing, including energy saving efforts and petroleum price. The aggregate energy demand for fiscal 1990 was put at about 590 million kl in terms of crude oil. Then, concerning nuclear power generation, the power supply by nuclear energy in fiscal 1990 was estimated at 46 million kw accounting for 11.3 % of the total power supply. (Mori, K.)

LCG Persistency Framework (CORAL, COOL, POOL): Status and Outlook in 2012

International Nuclear Information System (INIS)

Trentadue, R; Kalkhof, A; Loth, A; Valassi, A; Clemencic, M; Frank, M; Dykstra, D; Front, D; Nowak, M; Salnikov, A; Wache, M

2012-01-01

The LCG Persistency Framework consists of three software packages (CORAL, COOL and POOL) that address the data access requirements of the LHC experiments in several different areas. The project is the result of the collaboration between the CERN IT Department and the three experiments (ATLAS, CMS and LHCb) that are using some or all of the Persistency Framework components to access their data. POOL is a hybrid technology store for C++ objects, using a mixture of streaming and relational technologies to implement both object persistency and object metadata catalogs and collections. CORAL is an abstraction layer with an SQL-free API for accessing data stored using relational database technologies. COOL provides specific software components and tools for the handling of the time variation and versioning of the experiment conditions data. This presentation reports on the status and outlook in each of the three sub-projects at the time of the CHEP2012 conference, reviewing the usage of each package in the three LHC experiments.

LCG Persistency Framework (CORAL, COOL, POOL): Status and Outlook in 2012

Energy Technology Data Exchange (ETDEWEB)

Trentadue, R. [CERN; Clemencic, M. [CERN; Dykstra, D. [Fermilab; Frank, M. [CERN; Front, D. [Weizmann Inst.; Kalkhof, A. [CERN; Loth, A. [CERN; Nowak, M. [Brookhaven; Salnikov, A. [SLAC; Valassi, A. [CERN; Wache, M. [Mainz U., Inst. Phys.

2012-06-27

The LCG Persistency Framework consists of three software packages (CORAL, COOL and POOL) that address the data access requirements of the LHC experiments in several different areas. The project is the result of the collaboration between the CERN IT Department and the three experiments (ATLAS, CMS and LHCb) that are using some or all of the Persistency Framework components to access their data. POOL is a hybrid technology store for C++ objects, using a mixture of streaming and relational technologies to implement both object persistency and object metadata catalogs and collections. CORAL is an abstraction layer with an SQL-free API for accessing data stored using relational database technologies. COOL provides specific software components and tools for the handling of the time variation and versioning of the experiment conditions data. This presentation reports on the status and outlook in each of the three sub-projects at the time of the CHEP2012 conference, reviewing the usage of each package in the three LHC experiments.

26 CFR 1.665(b)-2 - Exclusions from accumulation distributions in the case of trusts (other than a foreign trust...

Science.gov (United States)

2010-04-01

... 26 Internal Revenue 8 2010-04-01 2010-04-01 false Exclusions from accumulation distributions in the case of trusts (other than a foreign trust created by a U.S. person). 1.665(b)-2 Section 1.665(b)-2 Internal Revenue INTERNAL REVENUE SERVICE, DEPARTMENT OF THE TREASURY (CONTINUED) INCOME TAX (CONTINUED) INCOME TAXES Treatment of Excess...

OECD environmental outlook to 2030

National Research Council Canada - National Science Library

Organisation for Economic Co-operation and Development

2008-01-01

... achievable and that they are affordable. But we need to act now, while it is still relatively inexpensive, particularly in the rapidly emerging economies. One scenario in this Outlook found that if we are willing to accept a 98% increase in global GDP from now to 2030 - rather than the 99% in our Baseline - we could achieve significant improvements in air and water quali...

R2E - Experience and outlook for 2012

International Nuclear Information System (INIS)

Brugger, M.; Calviani, M.; Mekki, J.; Spiezia, G.

2012-01-01

In 2011 the very successful LHC operation provided valuable input for the detailed analysis of radiation levels and radiation-induced equipment failures. About 70 beam dumps were provoked by radiation effects on electronic equipment causing a downtime for the machine of about 400 hours Radiation levels around LHC critical areas and the LHC tunnel were studied in detail and compared to available simulation results, as well as put in perspective to LHC operation parameters. Observed radiation-induced failures were not only analyzed in detail, but already addressed through early relocation measures and patch-solutions on the equipment level. Both improvements continued during this Winter Break together with the installation of heavy shielding around the RBs and UJs in Point 1. Based on measured radiation levels, calculations for the shielding improvements, and expected operational parameters, this report provides an update on the expected radiation levels around LHC critical areas. It briefly summarizes the mitigation measures and equipment patches already performed and provides an estimate on the expected equipment failure rates during 2012 operation. Required beam and measurement studies are highlighted in order to further improve the predictions of both radiation levels and expected equipment failures, the latter driving the chosen mitigation actions for Long Shutdown 1 - LS1. (authors)

World Energy Outlook 2011 Special Report: Energy for All

Energy Technology Data Exchange (ETDEWEB)

NONE

2011-07-01

What impact will the return of high energy prices have on the fragile economic recovery? Will geopolitical unrest, price volatility and policy inaction defer investment in the oil sector and amplify risks to our energy security? What will renewed uncertainty surrounding the role of nuclear power mean for future energy and environmental trends? Is the gap between our climate actions and our climate goals becoming insurmountable? World Energy Outlook 2011 tackles these and other pressing questions. The latest data, policy developments, and the experience of another turbulent year are brought together to provide robust analysis and insight into global energy markets. WEO-2011 once again gives detailed energy demand and supply projections out to 2035, broken down by region, fuel, sector and scenario.

Nordic Energy Outlook 2012. Proceedings; Energiutblick 2012

Energy Technology Data Exchange (ETDEWEB)

NONE

2012-11-01

Conference arenas: Effective energy use, Energy and market, Future energy, Technology for growth, as well as Open arena. The Open arena gives other actors in the energy sector the opportunity to host their own activities as a side event to Nordic Energy Outlook.

Supplement to the annual energy outlook 1995

Energy Technology Data Exchange (ETDEWEB)

1995-02-01

This section of the Supplement to the Annual Energy Outlook 1995 present the major assumptions of the modeling system used to generate the projections in the Annual Energy Outlook 1995 (AEO95). In this context, assumptions include general features of the model structure, assumptions concerning energy markets, and the key input data and parameters that are most significant in formulating the model results. Detailed documentation of the modeling system is available in a series of documentation reports listed in Appendix B. A synopsis of the National Energy Modeling System (NEMS), the model components, and the interrelationships of the modules is presented. The NEMS is developed and maintained by the office of Integrated Analysis and Forecasting of the Energy Information Administration (EIA) to provide projection of domestic energy-economy markets in the midterm time period and perform policy analyses requested by various government agencies and the private sector.

Climate Prediction Center (CPC) U.S. Hazards Outlook

Data.gov (United States)

National Oceanic and Atmospheric Administration, Department of Commerce — The Climate Prediction Center releases a US Hazards Outlook daily, Monday through Friday. The product highlights regions of anticipated hazardous weather during the...

North American natural gas outlook : does gas remain a fuel option for oil sands?

International Nuclear Information System (INIS)

George, R.R.

2003-01-01

This paper presents a North America natural gas outlook from Purvin and Gertz, an international energy consulting firm that has 30 years experience in providing strategic, commercial and technical advice to the petroleum industry. In particular, this presentation focuses on natural gas market fundamentals and how they may impact on oil sands development. It includes charts and graphs depicting NYMEX natural gas outlooks to July, 2009 and examines how supply will react to major changes in Canada's supply portfolio. It was noted that oil sands development is a driver for natural gas demand in Alberta. The existing regional gas pipeline infrastructure was presented and the market impact on upgrader options was discussed. The author suggests that if gas prices are too high, there are other fuel options for steam and power generation. These include bitumen, asphalt, coke, coal and nuclear. However, these options have additional costs, uncertainties and environmental issues. A key factor for success would be to have a clear understanding of the benefits and risks between these fuel options. 1 tab., 9 figs

Canadian natural gas : review of 2003 and outlook to 2020

International Nuclear Information System (INIS)

2004-12-01

This presentation provides a summary of natural gas industry trends in Canada and the United States and also reviews Canadian natural gas exports in order to initiate dialogue with the industry and obtain feedback on Natural Resources Canada's interpretations of natural gas issues. The objective of this report is to provide an understanding of the overall North American natural gas picture, largely excluding Mexico, in a graphical format. This document examines market fundamentals in 2003, in 2004 and early 2005, and the long-term to 2020. The presentation first takes a review of 2003 by examining natural gas demand, supply, resources and reserves, storage, prices, and Canadian exports, imports and domestic sales. It then presents its short-term outlook. It concludes with the outlook to 2020 including demand, supply, prices, and Canadian exports and domestic sales. The document also contains appendices on coalbed methane in Canada, liquefied natural gas in Canada, as well as a five year review and outlook of North American natural gas pipelines. 28 refs., 15 tabs., 59 figs., 3 appendices

Long-range outlook of energy demands and supplies

International Nuclear Information System (INIS)

1984-01-01

An interim report on the long-range outlook of energy demands and supplies in Japan as prepared by an ad hoc committee, Advisory Committee for Energy was given for the period up to the year 2000. As the energy demands in terms of crude oil, the following figures are set: 460 million kl for 1990, 530 million kl for 1995, and 600 million kl for 2000. In Japan, without domestic energy resources, over 80% of the primary energy has been imported; the reliance on Middle East where political situation is unstable, for petroleum is very large. The following things are described. Background and policy; energy demands in industries, transports, and people's livelihood; energy supplies by coal, nuclear energy, petroleum, etc.; energy demand/supply outlook for 2000. (Mori, K.)

The International Energy Agency's world energy outlook

International Nuclear Information System (INIS)

O'Dell, S.

1996-01-01

The 1996 edition of the World Energy Outlook to 2010 was reviewed. An overview of the energy projections was provided based on assumptions about economic growth and energy prices, geological potential, technological developments, the availability of traditional fuels outside the OECD and the future preferences of energy users. Demand vs. price movements were modelled, based on 'capacity constraints' and 'energy saving ' scenarios. Three major conclusions derived from the projections were: (1) world primary energy demand will grow steadily as it has over the past two decades, (2) fossil fuels will account for 90 per cent of total primary energy demand in 2010, and (3) a structural shift in the shares of different regions in world energy demand is likely to occur, i.e., the OECD share will fall in favor of the share of the ROW (rest of the world). 4 tabs., 9 figs

Propofol-induced rno-miR-665 targets BCL2L1 and influences apoptosis in rodent developing hippocampal astrocytes.

Science.gov (United States)

Sun, Wen-Chong; Liang, Zuo-Di; Pei, Ling

2015-12-01

Propofol exerts neurotoxic effects on the developing mammalian brains, but the underlying molecular mechanism remains unclear. MicroRNAs (miRNAs) are a class of small noncoding RNAs that modulate gene expression at the post-transcriptional level. However, in specific types of neurocytes, the detailed functions of miRNAs were not entirely understood. We investigated the potential role of miRNAs in astrocyte pathogenesis caused by propofol. We performed genome-wide microRNA expression profiling in immature cultured hippocampal astrocytes by microarray analysis and predicted their targets and functions using bioinformatics tools. The functional effects of one differentially expressed miRNA were examined experimentally in relation to astrocyte viability. The results showed that 13 miRNAs were significantly differentially expressed after both short-term exposure to high-concentration propofol (10 μg/ml for 1h) and long-term exposure to low-concentration propofol (0.9 μg/ml for 48 h), including rno-miR-665, differing significantly between the 2. Bioinformatics predicted putative binding sites for rno-miR-665 existing in the 3'-untranslated region of Bcl-2-like protein 1 BCL2L1 (Bcl-xl) mRNA. Moreover, such relationship was assessed by luciferase reporter assay, qRT-PCR and western blot. Rno-miR-665 which was significantly up-regulated by propofol can suppress BCL2L1 and elevate cleaved caspase-3 expression in immature astrocytes in vitro. Apoptosis of developing hippocampal astrocytes was thus significantly influenced by propofol or rno-miR-665, or both. Taken together, rno-miR-665 is involved in the neurotoxicity induced by propofol via a caspase-3 mediated mechanism by negatively regulating BCL2L1. It might act as an alternative therapeutic target for treatment of neurological disorders in peadiatric prolonged anesthesia or sedation with propofol clinically. Copyright © 2015. Published by Elsevier B.V.

Coal in India: current status and outlook - Panorama 2008

International Nuclear Information System (INIS)

2008-01-01

The world cannot do without coal. This energy source covers more than one-quarter (28.4% in 2006) of all primary energy consumption and is used to generate nearly 40% of all electricity consumed worldwide. All scenarios and forecasts agree that coal consumption will be growing substantially, driven mostly by China and India. According to the IEA reference scenario (World Energy Outlook 2007), these two countries are expected to account for 82% of the increase in global coal demand by 2030. The outlook for India gives cause for concern: despite a strong domestic coal industry, it could eventually become a major importer. If so, what will the economic, industrial and environmental consequences be?

Short-term energy outlook, quarterly projections, first quarter 1998

Energy Technology Data Exchange (ETDEWEB)

NONE

1998-01-01

The forecast period for this issue of the Outlook extends from the first quarter of 1998 through the fourth quarter of 1999. Values for the fourth quarter of 1997, however, are preliminary EIA estimates (for example, some monthly values for petroleum supply and disposition are derived in part from weekly data reported in EIA`s Weekly Petroleum Status Report) or are calculated from model simulations that use the latest exogenous information available (for example, electricity sales and generation are simulated by using actual weather data). The historical energy data, compiled in the first quarter 1998 version of the Short-Term Integrated Forecasting System (STIFS) database, are mostly EIA data regularly published in the Monthly Energy Review, Petroleum Supply Monthly, and other EIA publications. Minor discrepancies between the data in these publications and the historical data in this Outlook are due to independent rounding. The STIFS model is driven principally by three sets of assumptions or inputs: estimates of key macroeconomic variables, world oil price assumptions, and assumptions about the severity of weather. Macroeconomic estimates are adjusted by EIA to reflect EIA assumptions which may affect the macroeconomic outlook. By varying the assumptions, alternative cases are produced by using the STIFS model. 24 figs., 19 tabs.

Climate Prediction Center (CPC) Monthly Drought Outlook (MDO)

Data.gov (United States)

National Oceanic and Atmospheric Administration, Department of Commerce — A CPC forecaster (from a rotating schedule of 5 as of August 2013) creates the Monthly Drought Outlook map and narratives. The map, produced using GIS, shows where...

The JESSICA experiment. Pt I. Improvements of the JESSICA-experiment

Energy Technology Data Exchange (ETDEWEB)

Nuenighoff, K.; Conrad, H.; Filges, D.; Goldenbaum, F.; Neef, R.D.; Pohl, Ch.; Schaal, H.; Stelzer, H.; Tietze-Jaensch, H.; Paul, N.; Wohlmuther, W. [Forschungszentrum Juelich GmbH, Juelich (Germany); Ninaus, W. [Technische Univ. Graz, Inst. fuer Technische Physik, Graz (Austria); Smirnov, A. [Joint Inst. of Nuclear Research, Dubna (Russian Federation)

2004-03-01

In this article we like to report on the progress of the JESSICA experiment. The experimental setup is described and the experimental method is presented. Proton beam monitoring and results from water and polyethylene will also be mentioned. In the end we give an outlook to the upcoming experiments with further cold moderator materials. (orig.)

The JESSICA experiment. Part I. Improvements of the JESSICA-experiment

International Nuclear Information System (INIS)

Nuenighoff, K.; Conrad, H.; Filges, D.; Goldenbaum, F.; Neef, R.D.; Pohl, Ch.; Schaal, H.; Stelzer, H.; Tietze-Jaensch, H.; Paul, N.; Wohlmuther, W.; Ninaus, W.; Smirnov, A.

2004-01-01

In this article we like to report on the progress of the JESSICA experiment. The experimental setup is described and the experimental method is presented. Proton beam monitoring and results from water and polyethylene will also be mentioned. In the end we give an outlook to the upcoming experiments with further cold moderator materials. (orig.)

Predicting Heat Stress to Inform Reef Management: NOAA Coral Reef Watch's 4-Month Coral Bleaching Outlook

Directory of Open Access Journals (Sweden)

Gang Liu

2018-03-01

Full Text Available The U.S. National Oceanic and Atmospheric Administration's (NOAA Coral Reef Watch (CRW operates a global 4-Month Coral Bleaching Outlook system for shallow-water coral reefs in collaboration with NOAA's National Centers for Environmental Prediction (NCEP. The Outlooks are generated by applying the algorithm used in CRW's operational satellite coral bleaching heat stress monitoring, with slight modifications, to the sea surface temperature (SST predictions from NCEP's operational Climate Forecast System Version 2 (CFSv2. Once a week, the probability of heat stress capable of causing mass coral bleaching is predicted for 4-months in advance. Each day, CFSv2 generates an ensemble of 16 forecasts, with nine runs out to 45-days, three runs out to 3-months, and four runs out to 9-months. This results in 28–112 ensemble members produced each week. A composite for each predicted week is derived from daily predictions within each ensemble member. The probability of each of four heat stress ranges (Watch and higher, Warning and higher, Alert Level 1 and higher, and Alert Level 2 is determined from all the available ensemble members for the week to form the weekly probabilistic Outlook. The probabilistic 4-Month Outlook is the highest weekly probability predicted among all the weekly Outlooks during a 4-month period for each of the stress ranges. An initial qualitative skill analysis of the Outlooks for 2011–2015, compared with CRW's satellite-based coral bleaching heat stress products, indicated the Outlook has performed well with high hit rates and low miss rates for most coral reef areas. Regions identified with high false alarm rates will guide future improvements. This Outlook system, as the first and only freely available global coral bleaching prediction system, has been providing critical early warning to marine resource managers, scientists, and decision makers around the world to guide management, protection, and monitoring of coral reefs

International workshop on energy outlook in France and in Europe; Seminaire international sur la prospective energetique en France et en Europe

Energy Technology Data Exchange (ETDEWEB)

NONE

2004-07-01

The objective of the Energy Outlook Workshop is to allow decision makers and energy experts to exchange views on a wide range of issues including current projections, economic, political, social and environmental stakes, use of forecasts, precautions required, and identification of priorities. Major challenges confronting energy policy makers include: design of new energy systems following opening of energy markets; investment required to ensure long-term security of supply (e.g depleted reserves of fossil energy); achieving international commitments for environmental protection (e.g Kyoto Protocol and other quantitative targets); respect of European standards and regulations; economic and social issues, such as impact of high energy prices. The workshop will take into account two new characteristics of Energy Outlook: the time horizon, previously limited to 10-20 years, may be now extended to 30-50 years due to enormous progress in economic modelling techniques and the European and international context. (author)

Precise tests of QCD in e+e- annihilation

International Nuclear Information System (INIS)

Burrows, P.N.

1997-03-01

A pedagogical review is given of precise tests of QCD in electron-positron annihilation. Emphasis is placed on measurements that have served to establish QCD as the correct theory of strong interactions, as well as measurements of the coupling parameter α s . An outlook is given for future important tests at a high-energy e + e - collider

Climate Prediction Center (CPC) One Month Probabilistic Precipitation Outlook for the Contiguous United States and Alaska

Data.gov (United States)

National Oceanic and Atmospheric Administration, Department of Commerce — The Climate Prediction Center (CPC) issues a probabilistic one-month precipitation outlook for the United States twice a month. CPC issues an initial monthly outlook...

Climate Prediction Center (CPC) One Month Probabilistic Temperature Outlook for the Contiguous United States and Alaska

Data.gov (United States)

National Oceanic and Atmospheric Administration, Department of Commerce — The Climate Prediction Center (CPC) issues a probabilistic one-month temperature outlook for the United States twice a month. CPC issues an initial monthly outlook...

Development of seasonal flow outlook model for Ganges-Brahmaputra Basins in Bangladesh

Science.gov (United States)

Hossain, Sazzad; Haque Khan, Raihanul; Gautum, Dilip Kumar; Karmaker, Ripon; Hossain, Amirul

2016-10-01

Bangladesh is crisscrossed by the branches and tributaries of three main river systems, the Ganges, Bramaputra and Meghna (GBM). The temporal variation of water availability of those rivers has an impact on the different water usages such as irrigation, urban water supply, hydropower generation, navigation etc. Thus, seasonal flow outlook can play important role in various aspects of water management. The Flood Forecasting and Warning Center (FFWC) in Bangladesh provides short term and medium term flood forecast, and there is a wide demand from end-users about seasonal flow outlook for agricultural purposes. The objective of this study is to develop a seasonal flow outlook model in Bangladesh based on rainfall forecast. It uses European Centre for Medium-Range Weather Forecasts (ECMWF) seasonal precipitation, temperature forecast to simulate HYDROMAD hydrological model. Present study is limited for Ganges and Brahmaputra River Basins. ARIMA correction is applied to correct the model error. The performance of the model is evaluated using coefficient of determination (R2) and Nash-Sutcliffe Efficiency (NSE). The model result shows good performance with R2 value of 0.78 and NSE of 0.61 for the Brahmaputra River Basin, and R2 value of 0.72 and NSE of 0.59 for the Ganges River Basin for the period of May to July 2015. The result of the study indicates strong potential to make seasonal outlook to be operationalized.

World economic outlook for the 1990S

International Nuclear Information System (INIS)

Temple, O.J. du; Webster, L.

1989-01-01

This work is related to the world economic outlook for the 1990S. It is discussed here: the new global economy, financial relations, output and income trades in industrial countries structure of imports and exports of developing countries, international policy issues, exchange rates, debt crisis, international trade and international economic environment. (A.C.A.S.)

World Copper Market Outlook: 2003-2014

OpenAIRE

Florela Stoian

2015-01-01

This paper presents synthetically the copper market outlook (demand, supply, and prices) during 2003-2014, highlighting the impact of economic crisis of 2008-2009 on the world copper market. During the crisis, the decline in demand caused increases in excess supply of metal, as the supply has followed an upward trend, contributing to the imbalances of the copper market and putting pressure on stock prices at LME London Metal Exchange.

The 2008-18 Job Outlook in Brief

Science.gov (United States)

Occupational Outlook Quarterly, 2010

2010-01-01

Some occupations will fare better than others over the 2008-18 decade. Although it's impossible to predict the future, one can gain insight into job outlook by analyzing trends in population growth, technological advances, and business practices. This insight is helpful in planning a career. Every 2 years, the U.S. Bureau of Labor Statistics (BLS)…

2017 NMC Technology Outlook for Nordic Schools A Horizon Project Regional Report

DEFF Research Database (Denmark)

2017-01-01

research effort between the New Media Consortium (NMC) and the Norwegian Centre for ICT in Education to inform Nordic school leaders and decision-makers about significant developments in technologies supporting teaching, learning, and creative inquiry in primary and secondary education across Denmark......Adams Becker, S., Cummins, M., Freeman, A., and Rose, K. (2017). 2017 NMC Technology Outlook for Nordic Schools: A Horizon Project Regional Report. Austin, Texas: The New Media Consortium. The 2017 NMC Technology Outlook for Nordic Schools: A Horizon Project Regional Report reflects a collaborative...

Soviet Union oil sector outlook grows bleaker still

International Nuclear Information System (INIS)

Anon.

1991-01-01

This paper reports on the outlook for the U.S.S.R's oil sector which grows increasingly bleak and with it prospects for the Soviet economy. Plunging Soviet oil production and exports have analysts revising near term oil price outlooks, referring to the Soviet oil sector's self-destructing and Soviet oil production in a freefall. County NatWest, Washington, citing likely drops in Soviet oil production and exports (OGJ, Aug. 5, p. 16), has jumped its projected second half spot price for West Texas intermediate crude by about $2 to $22-23/bbl. Smith Barney, New York, forecasts WTI postings at $24-25/bbl this winter, largely because of seasonally strong world oil demand and the continued collapse in Soviet oil production. It estimates the call on oil from the Organization of Petroleum Exporting Countries at more than 25 million b/d in first quarter 1992. That would be the highest level of demand for OPEC oil since 1980, Smith Barney noted

Nuclear power: status and outlook

International Nuclear Information System (INIS)

Rogner, H.H.; Langlois, L.M.; McDonald, A.

2002-01-01

Current state of the world nuclear energetics is reviewed; data on operating and nuclear power blocks under construction in different countries, data on electric power output, practice of operation are presented. New plans of energetic reactors, capitalized costs for their construction, operating cost and period of construction are treated. Problems of nuclear safety, spent fuel and radioactive waste management, non-proliferation policy are discussed. Outlook for the development of the nuclear energetics is directed and importance of the Bonn agreement in connection with economic reasons for NPP operation is noted [ru

Short-term energy outlook: Quarterly projections, fourth quarter 1997

Energy Technology Data Exchange (ETDEWEB)

NONE

1997-10-14

The Energy Information Administration (EIA) prepares quarterly short-term energy supply, demand, and price projections for printed publication in January, April, July, and October in the Short-Term Energy Outlook. The details of these projections, as well as monthly updates on or about the 6th of each interim month, are available on the internet at: www.eia.doe.gov/emeu/steo/pub/contents.html. The forecast period for this issue of the Outlook extends from the fourth quarter of 1997 through the fourth quarter of 1998. Values for the fourth quarter of 1997, however, are preliminary EIA estimates (for example, some monthly values for petroleum supply and disposition are derived in part from weekly data reported in EIA`s Weekly Petroleum Status Report) or are calculated from model simulations that use the latest exogenous information available (for example, electricity sales and generation are simulated by using actual weather data). The historical energy data, compiled in the fourth quarter 1997 version of the Short-Term Integrated Forecasting System (STIFS) database, are mostly EIA data regularly published in the Monthly Energy Review, Petroleum Supply Monthly, and other EIA publications. Minor discrepancies between the data in these publications and the historical data in this Outlook are due to independent rounding. The STIFS model is driven principally by three sets of assumptions or inputs: estimates of key macroeconomic variables, world oil price assumptions, and assumptions about the severity of weather. 19 tabs.

The Future of the Global Environment: A Model-based Analysis Supporting UNEP's First Global Environment Outlook

NARCIS (Netherlands)

Bakkes JA; Woerden JW van; Alcamo J; Berk MM; Bol P; Born GJ van den; Brink BJE ten; Hettelingh JP; Langeweg F; Niessen LW; Swart RJ; United Nations Environment; MNV

1997-01-01

This report documents the scenario analysis in UNEP's first Global Environment Outlook, published at the same time as the scenario analysis. This Outlook provides a pilot assessment of developments in the environment, both global and regional, between now and 2015, with a further projection to

The messages of the world energy outlook

International Nuclear Information System (INIS)

Cozzi, L.

2001-01-01

This article provides an overview of the International Energy Agency's 2000 edition of the World Energy Outlook, Global and regional energy demand, supply and CO 2 emissions to the year 2020 are discussed under the Reference Scenario assumption. Main challenges that actors of global energy scene will be asked to cope with in the next two decade are derived [it

50 CFR 665.249 - Lobster size and condition restrictions in Permit Area 2.

Science.gov (United States)

2010-10-01

... 50 Wildlife and Fisheries 9 2010-10-01 2010-10-01 false Lobster size and condition restrictions in... WESTERN PACIFIC Hawaii Fisheries § 665.249 Lobster size and condition restrictions in Permit Area 2. (a) Only spiny lobsters with a carapace length of 8.26 cm or greater may be retained (see Figure 1 to this...

Short-term energy outlook, October 1998. Quarterly projections, 1998 4. quarter

Energy Technology Data Exchange (ETDEWEB)

NONE

1998-10-01

The Energy Information Administration (EIA) prepares The Short-Term Energy Outlook (energy supply, demand, and price projections) monthly for distribution on the Internet at: www.eia.doe.gov/emeu/steo/pub/contents.html. In addition, printed versions of the report are available to subscribers in January, April, July and October. The forecast period for this issue of the Outlook extends from October 1998 through December 1999. Values for third quarter of 1998 data, however, are preliminary EIA estimates (for example, some monthly values for petroleum supply and disposition are derived in part from weekly data reported in EIA`s Weekly Petroleum Status Report) or are calculated from model simulations that use the latest exogenous information available (for example, electricity sales and generation are simulated by using actual weather data). The historical energy data, compiled in the October 1998 version of the Short-term Integrated Forecasting System (STIFS) database, are mostly EIA data regularly published in the Monthly Energy Review, Petroleum Supply Monthly, and other EIA publications. Minor discrepancies between the data in these publications and the historical data in this Outlook are due to independent rounding.

Enhancing Seasonal Water Outlooks: Needs and Opportunities in the Critical Runoff Season

Science.gov (United States)

Ray, A. J.; Barsugli, J. J.; Yocum, H.; Stokes, M.; Miskus, D.

2017-12-01

The runoff season is a critical period for the management of water supply in the western U.S., where in many places over 70% of the annual runoff occurs in the snowmelt period. Managing not only the volume, but the intra-seasonal timing of the runoff is important for optimizing storage, as well as achieving other goals such as mitigating flood risk, and providing peak flows for riparian habitat management, for example, for endangered species. Western river forecast centers produce volume forecasts for western reservoirs that are key input into many water supply decisions, and also short term river forecasts out to 10 days. The early volume forecasts each year typically begin in December, and are updated throughout the winter and into the runoff season (April-July for many areas, but varies). This presentation will discuss opportunities for enhancing this existing suite of RFC water outlooks, including the needs for and potential use for "intraseasonal" products beyond those provided by the Ensemble Streamflow Prediction system and the volume forecasts. While precipitation outlooks have little skill for many areas and seasons, and may not contribute significantly to the outlook, late winter and spring temperature forecasts have meaningful skill in certain areas and sub-seasonal to seasonal time scales. This current skill in CPC temperature outlooks is an opportunity to translate these products into information about the snowpack and potential runoff timing, even where the skill in precipitation is low. Temperature is important for whether precipitation falls as snow or rain, which is critical for streamflow forecasts, especially in the melt season in snowpack-dependent watersheds. There is a need for better outlooks of the evolution of snowpack, conditions influencing the April-July runoff, and the timing of spring peak or shape of the spring hydrograph. The presentation will also discuss a our work with stakeholders of the River Forecast Centers and the NIDIS

A Future with Hope :China Agriculture Outlook 2007

Institute of Scientific and Technical Information of China (English)

无

2007-01-01

@@ China's macro economy has remained in a good and stable condition overall, experiencing an annual GDP growth of over 10% for several consecutive years. Under this basic condition,the main focus of the Outlook was China's current grain and oil supply, and the demand market with its probable future prices.

The photovoltaic: channels, markets and outlooks

International Nuclear Information System (INIS)

Jourde, P.

2005-01-01

The photovoltaic market is in expansion with a good energy, political and environmental context. It needs meanwhile to realize developments in the storage domain and in the cost of connexion to the network. To illustrate these conclusions this paper discusses the following chapters: the solar energy, the principle and the channels of the photovoltaic, the applications (autonomous electrification and houses connected to the network) and the markets, a state of the art and the outlooks. (A.L.B.)

Annual Energy Outlook 2009 with Projections to 2030

Energy Technology Data Exchange (ETDEWEB)

None

2009-03-01

The Annual Energy Outlook 2009 (AEO2009), prepared by the Energy Information Administration (EIA), presents long-term projections of energy supply, demand, and prices through 2030, based on results from EIA’s National Energy Modeling System (NEMS). EIA published an “early release” version of the AEO2009 reference case in December 2008.

Climate Prediction Center (CPC) 6 to 10 Day Probabilistic Precipitation Outlook for the Contiguous United States and Alaska

Data.gov (United States)

National Oceanic and Atmospheric Administration, Department of Commerce — The Climate Prediction Center (CPC) issues 6 to 10 day probabilistic precipitation outlooks for the United States. The 6-10 day Outlook gives the confidence that a...

Climate Prediction Center (CPC) 8 to 14 Day Probabilistic Precipitation Outlook for the Contiguous United States and Alaska

Data.gov (United States)

National Oceanic and Atmospheric Administration, Department of Commerce — The Climate Prediction Center (CPC) issues 8 to 14 day probabilistic precipitation outlooks for the United States. The 8-14 day Outlook gives the confidence that a...

Climate Prediction Center (CPC) 6 to 10 Day Probabilistic Temperature Outlook for the Contiguous United States and Alaska

Data.gov (United States)

National Oceanic and Atmospheric Administration, Department of Commerce — The Climate Prediction Center (CPC) issues 6 to 10 day probabilistic temperature outlooks for the United States. The 6-10 day Outlook gives the confidence that a...

Climate Prediction Center (CPC) 8 to 14 Day Probabilistic Temperature Outlook for the Contiguous United States and Alaska

Data.gov (United States)

National Oceanic and Atmospheric Administration, Department of Commerce — The Climate Prediction Center (CPC) issues 8 to 14 day probabilistic temperature outlooks for the United States. The 8-14 day Outlook gives the confidence that a...

World energy outlook 2014

CERN Document Server

International Energy Agency. Paris

2014-01-01

The global energy landscape is evolving at a rapid pace, reshaping long-held expectations for our energy future. The 2014 edition of the World Energy Outlook (WEO) will incorporate all the latest data and developments to produce a comprehensive and authoritative analysis of medium- and longer-term energy trends. It will complement a full set of energy projections – which extend from today through, for the first time, the year 2040 – with strategic insights into their meaning for energy security, the economy and the environment. Oil, natural gas, coal, renewables and energy efficiency will be covered, along with updates on trends in energy-related CO2 emissions, fossil-fuel and renewable energy subsidies, and universal access to modern energy services.

World energy outlook 2004

International Nuclear Information System (INIS)

2004-01-01

The World Energy Outlook is the most complete and authoritative energy publication and has received several prestigious awards from government and industry in recognition of its analytical excellence. The new edition offers: - Analysis: Over 550 pages of detailed analysis with 150 graphs and tables. - Projections: Supply and demand projections to 2030 for oil, gas, coal, renewables, nuclear and electricity, plus projections of energy related CO 2 emissions. -World Alternative Policy Scenario:A detailed assessment of the impact of possible climate change policies and energy efficient technologies. -Russia: An in-depth study of the 'most important energy country'. - Energy and Development: An analysis of energy's role in overcoming world poverty. - Reserves: A detailed analysis of world oil and gas reserves and of the problems involved in measuring them

Innovative algorithms and tools summary and outlook

International Nuclear Information System (INIS)

Fine, V.E.; Naumann, N.A.

2003-01-01

This contribution provides a summary of the 'Session IV: Innovative Algorithms and Tools'. The 'tools' portion of the session IV comprised three oral sessions, 12 talks by seven speakers, and three posters. The algorithmic part was covered by 15 talks and three poster presentations. We will try to give a summary of the main development directions, and state our personal views and interpretation on it as well as an outlook

RSM Outlook Winter 2013: Growing Tomorrow's Entrepreneurs

OpenAIRE

Whittern, Justine; Schreiner, Dorine

2013-01-01

markdownabstract#### Innovation and the path to value (Russell Gilbert) At the RSM Leadership Summit in October, Frans van Houten, CEO of Royal Philips (pictured), gave a uniquely insightful presentation about the benefits of organisational transformation, innovation, and the importance of keeping abreast of technological and societal changes. In an exclusive interview, Mr Van Houten discusses these issues with Russell Gilbert, Managing Editor of RSM Outlook. #### Ready for lift off!! (Bennet...

Annual Energy Outlook 2011 with Projections to 2035

Energy Technology Data Exchange (ETDEWEB)

None

2011-04-01

The projections in the Energy Information Administration's (EIA) Annual Energy Outlook 2011 (AEO2011) focus on the factors that shape the U.S. energy system over the long term. Under the assumption that current laws and regulations remain unchanged throughout the projections, the AEO2011 Reference case provides the basis for examination and discussion of energy production, consumption, technology, and market trends and the direction they may take in the future. It also serves as a starting point for analysis of potential changes in energy policies. But AEO2011 is not limited to the Reference case. It also includes 57 sensitivity cases (see Appendix E, Table E1), which explore important areas of uncertainty for markets, technologies, and policies in the U.S. energy economy. Key results highlighted in AEO2011 include strong growth in shale gas production, growing use of natural gas and renewables in electric power generation, declining reliance on imported liquid fuels, and projected slow growth in energy-related carbon dioxide (CO2) emissions even in the absence of new policies designed to mitigate greenhouse gas (GHG) emissions. AEO2011 also includes in-depth discussions on topics of special interest that may affect the energy outlook. They include: impacts of the continuing renewal and updating of Federal and State laws and regulations; discussion of world oil supply and price trends shaped by changes in demand from countries outside the Organization for Economic Cooperation and Development or in supply available from the Organization of the Petroleum Exporting Countries; an examination of the potential impacts of proposed revisions to Corporate Average Fuel Economy standards for light-duty vehicles and proposed new standards for heavy-duty vehicles; the impact of a series of updates to appliance standard alone or in combination with revised building codes; the potential impact on natural gas and crude oil production of an expanded offshore resource base

Climate Prediction Center (CPC)U.S. Seasonal Drought Outlook (SDO)

Data.gov (United States)

National Oceanic and Atmospheric Administration, Department of Commerce — Abstract: A CPC forecaster (from a rotating schedule of 5 as of August 2013) creates the Seasonal Drought Outlook map and narratives. The map, produced using GIS,...

Climate Prediction Center - Forecasts & Outlook Maps, Graphs and Tables

Science.gov (United States)

Weather Service NWS logo - Click to go to the NWS home page Climate Prediction Center Home Site Map News list below The Climate Prediction Center (CPC) is responsible for issuing seasonal climate outlook maps , and National Centers for Environmental Prediction). These weather and climate products comprise the

Marketing library and information services II a global outlook

CERN Document Server

Gupta, Dinesh K; Massisimo, Angels

2013-01-01

With contributions from library and information professionals (practitioners, researchers, faculty members, consultants, and others), Marketing Library and Information Services: A Global Outlook highlights a variety of exemplary LIS marketing practices and efforts from around the globe. The following broad topics are explored: changing marketing concepts; marketing library

The outlooks of Helmholtz, Plank and Einstein on the unified physical theory

International Nuclear Information System (INIS)

Treder, G.Yu.

1982-01-01

The outlooks of Helmholtz, Planck and Einstein on the unified physical theory are exposed. Planck formulated the Einstein relativistic mechanics in the canonical form stemming from the suggested by Helmholtz approach that the principle of action is the unified formal principle of physics. Einstein and his companious proceeded from machroscopic fields in the attempts to prove the unified geometric field theory. The sense of Planck length as ''the smallest length in physics'' is determined, on the one hand, by the Heizenberg uncerntainty principle for the measurement process, and on the other hand by the universal proportionality between inertia and gravity. It results from geometrical nature and gravitational potential, i. e. from Einstein interpretation of the equivalence principle

Precise tests of QCD in e{sup +}e{sup {minus}} annihilation

Energy Technology Data Exchange (ETDEWEB)

Burrows, P.N.

1997-03-01

A pedagogical review is given of precise tests of QCD in electron-positron annihilation. Emphasis is placed on measurements that have served to establish QCD as the correct theory of strong interactions, as well as measurements of the coupling parameter {alpha}{sub s}. An outlook is given for future important tests at a high-energy e{sup +}e{sup {minus}} collider.

The world coke market. Problems and outlook

International Nuclear Information System (INIS)

Anon.

1998-01-01

Outlooks to the world coke market are considered with regard to supply and demand as well as the current state of capacities for its production in some countries of Asia, Western and Eastern Europe, USA. In experts opinion increase of coke import from China, increase in service life of currently operating coke furnaces, as well as more extensive use of PCI coal mixture are among the most feasible opportunities for its Western consumers [ru

Academic training lectures | The outlook for energy supply and demand | 14 - 16 September

CERN Multimedia

2015-01-01

Please note that the next series of Academic Training Lectures will take place on the 14, 15 and 16 September. The lectures will be given by by Chris Llewellyn Smith (Director of Energy Research, University of Oxford, President of SESAME Council). The Outlook for Energy Supply and Demand (1/3) on Monday, 14 September from 11.00 a.m. to 12.00 p.m. https://indico.cern.ch/event/388334/ Can Future Energy Needs be Met Sustainably? (2/3) on Tuesday, 15 September from 4.30 p.m. to 5.30 p.m.  (CERN Colloquium) https://indico.cern.ch/event/388335/ The Outlook for Energy Supply and Demand (3/3) on Wednesday, 16 September from 11.00 a.m to 12.00 p.m. https://indico.cern.ch/event/388336/ at CERN, Main Auditorium, in Building 500-1-001. Description: These lectures will review the challenges facing energy policy, the outlook for different sources of primary energy (fossil and renewable), how energy is used, and prospects for improved energy efficiency. A colloquium ‘Can Future Energy Needs be Met ...

Statistics in action a Canadian outlook

CERN Document Server

Lawless, Jerald F

2014-01-01

Commissioned by the Statistical Society of Canada (SSC), Statistics in Action: A Canadian Outlook helps both general readers and users of statistics better appreciate the scope and importance of statistics. It presents the ways in which statistics is used while highlighting key contributions that Canadian statisticians are making to science, technology, business, government, and other areas. The book emphasizes the role and impact of computing in statistical modeling and analysis, including the issues involved with the huge amounts of data being generated by automated processes.The first two c

Residency programs and the outlook for occupational and environmental medicine in Korea.

Science.gov (United States)

Lee, Youngil; Kim, Jungwon; Chae, Yoomi

2015-01-01

This study investigated the implementation of training courses and the overall outlook for occupational and environmental medicine (OEM) in Korea. We described the problems facing OEM residency programs in Korea, and reviewed studies dealing with the specialty of occupational health in developed countries in order to suggest directions of improvement for the OEM training courses. We surveyed 125 OEM residents using a questionnaire in August 2012. A total of 23 questions about the training environment, residency programs, preferred institutions for post-licensure employment, and the outlook for OEM specialists were included in the questionnaire and analyzed according to the type of training institution and residency year. Responses from 88 residents (70.4 %) were analyzed. The major responsibilities of OEM residents were found to vary depending on whether they were trained in research institutes or in hospitals. OEM residents had a lower level of satisfaction with the following training programs: toxicology practice (measurements of biological markers, metabolites, and working environments), and OEM practice (environmental diseases and clinical training involving surgery). When asked about their eventual place of employment, OEM residents preferred institutions providing special health examinations or health management services. OEM residents reported a positive outlook for OEM over the next 5 years, but a negative outlook for the next 10 years. Although a standardized training curriculum for OEM residents exists, this study found differences in the actual training courses depending on the training institution. We plan to standardize OEM training by holding a regional conference and introducing open training methods, such as an open hospital system. Use of Korean-language OEM textbook may also reduce differences in the educational programs of each training institution. Toxicology practice, environmental diseases, and clinical training in surgery are areas that

Advancing sustainable safety : National Road Safety Outlook for 2005-2020.

NARCIS (Netherlands)

Wegman, F.C.M. & Aarts, L.T. (eds.)

2006-01-01

Advancing Sustainable Safety: National Road Safety Outlook for 2005-2020 is the follow-up to Naar een duurzaam veilig wegverkeer [Towards sustainably safe road traffic] (Koornstra et al., 1992). Advancing Sustainable Safety is a critique of Sustainable Safety. In this advanced version, adaptations

Global wind energy outlook 2006

International Nuclear Information System (INIS)

2006-09-01

The global market for wind power has been expanding faster than any other source of renewable energy. From just 4,800 MW in 1995 the world total has multiplied more than twelve-fold to reach over 59,000 MW at the end of 2005. The international market is expected to have an annual turnover in 2006 of more than euro 13 billion, with an estimated 150,000 people employed around the world. The success of the industry has attracted investors from the mainstream finance and traditional energy sectors. In a number of countries the proportion of electricity generated by wind power is now challenging conventional fuels. The Global Wind Energy Outlook 2006 reports that over a third of the world's electricity - crucially including that required by industry - can realistically be supplied by wind energy by the middle of the century. The report provides an industry blueprint that explains how wind power could supply 34% of the world's electricity by 2050. Most importantly, it concludes that if wind turbine capacity implemented on this scale it would save 113 billion tonnes of CO2 from entering the atmosphere by 2050. This places wind power as one of the world's most important energy sources for the 21st century. The 'Global Wind Energy Outlook 2006' runs three different scenarios for wind power - a Reference scenario based on figures from the International Energy Agency (IEA); a Moderate version which assumes that current targets for renewable energy are successful; and an advanced version assuming that all policy options in favour of renewables have been adopted. These are then set against two scenarios for global energy demand. Under the Reference scenario, growth in demand is again based on IEA projections; under the High Energy Efficiency version, a range of energy efficiency measures result in a substantial reduction in demand

Global environment outlook GEO5. Environment for the future we want

Energy Technology Data Exchange (ETDEWEB)

NONE

2012-05-15

The main goal of UNEP's Global Environment Outlook (GEO) is to keep governments and stakeholders informed of the state and trends of the global environment. Over the past 15 years, the GEO reports have examined a wealth of data, information and knowledge about the global environment; identified potential policy responses; and provided an outlook for the future. The assessments, and their consultative and collaborative processes, have worked to bridge the gap between science and policy by turning the best available scientific knowledge into information relevant for decision makers. The GEO-5 report is made up of 17 chapters organized into three distinct but linked parts. Part 1 - State and trends of the global environment; Part 2 - Policy options from the regions; Part 3 - Opportunities for a global response.

Global environment outlook GEO5. Environment for the future we want

Energy Technology Data Exchange (ETDEWEB)

NONE

2012-05-15

The main goal of UNEP's Global Environment Outlook (GEO) is to keep governments and stakeholders informed of the state and trends of the global environment. Over the past 15 years, the GEO reports have examined a wealth of data, information and knowledge about the global environment; identified potential policy responses; and provided an outlook for the future. The assessments, and their consultative and collaborative processes, have worked to bridge the gap between science and policy by turning the best available scientific knowledge into information relevant for decision makers. The GEO-5 report is made up of 17 chapters organized into three distinct but linked parts. Part 1 - State and trends of the global environment; Part 2 - Policy options from the regions; Part 3 - Opportunities for a global response.

International Energy Outlook 2016 With Projections to 2040

Energy Technology Data Exchange (ETDEWEB)

Conti, John [USDOE Energy Information Administration (EIA), Washington, DC (United States). Office of Petroleum, Natural Gas, and Biofuels Analysis; Holtberg, Paul [USDOE Energy Information Administration (EIA), Washington, DC (United States). Analysis Integration Team; Diefenderfer, Jim [USDOE Energy Information Administration (EIA), Washington, DC (United States). Office of Electricity, Coal, Nuclear, and Renewables Analysis; LaRose, Angelina [USDOE Energy Information Administration (EIA), Washington, DC (United States). Office of Integrated and International Energy Analysis; Turnure, James T. [USDOE Energy Information Administration (EIA), Washington, DC (United States). Office of Energy Consumption and Efficiency Analysis; Westfall, Lynn [USDOE Energy Information Administration (EIA), Washington, DC (United States). Office of Energy Markets and Financial Analysis

2016-05-01

The International Energy Outlook 2016 (IEO2016) presents an assessment by the U.S. Energy Information Administration (EIA) of the outlook for international energy markets through 2040. U.S. projections appearing in IEO2016 are consistent with those published in EIA’s Annual Energy Outlook 2015 (AEO2015). IEO2016 is provided as a service to energy managers and analysts, both in government and in the private sector. The projections are used by international agencies, federal and state governments, trade associations, and other planners and decisionmakers. They are published pursuant to the Department of Energy Organization Act of 1977 (Public Law 95-91), Section 205(c). The IEO2016 energy consumption projections are divided according to Organization for Economic Cooperation and Development members (OECD) and nonmembers (non-OECD). OECD members are divided into three basic country groupings: OECD Americas (United States, Canada, and Mexico/Chile), OECD Europe, and OECD Asia (Japan, South Korea, and Australia/New Zealand). Non-OECD countries are divided into five separate regional subgroups: non-OECD Europe and Eurasia (which includes Russia); non-OECD Asia (which includes China and India); Middle East; Africa; and non-OECD Americas (which includes Brazil). In some instances, the IEO2016 energy production models have different regional aggregations to reflect important production sources (for example, Middle East OPEC is a key region in the projections for liquids production). Complete regional definitions are listed in Appendix M. IEO2016 focuses exclusively on marketed energy. Nonmarketed energy sources, which continue to play an important role in some developing countries, are not included in the estimates. The IEO2016 projections are based on existing U.S. and foreign government laws and regulations. In general, IEO2016 reflects the effects of current policies—often stated through regulations—within the projections. EIA analysts attempt to interpret the

e-Learning Continuance Intention: Moderating Effects of User e-Learning Experience

Science.gov (United States)

Lin, Kan-Min

2011-01-01

This study explores the determinants of the e-learning continuance intention of users with different levels of e-learning experience and examines the moderating effects of e-learning experience on the relationships among the determinants. The research hypotheses are empirically validated using the responses received from a survey of 256 users. The…

Job Outlook Information: Careers for the Future. InfoSeries.

Science.gov (United States)

Indiana Career and Postsecondary Advancement Center, Bloomington.

Job outlook information forecasts the growth and decline of jobs in the near future--usually for a 10-year period. The purpose of this information is to help individuals understand where future employment opportunities may occur, but the individual must also consider his/her skills and interests and the level of education needed to accomplish…

Key issues in the outlook for minerals and energy

International Nuclear Information System (INIS)

Waring, T.; Love, G.; Hogan, J.; Gooday, P.

1996-01-01

The outlook for Australia's minerals and energy sector continues to be positive because of the flow-on effects of economic growth in the newly industrialized Asia. The East Asian share of mineral and energy commodities continues to expand reflecting the growing demand for consumer goods and new economic and social infrastructure. Uncertainties in the minerals and energy outlook include the future economic performance of the developed countries and the former Soviet Union, trade and environmental issues and the effects of changing technology on minerals and energy production and consumption. Encouraged by good prospects for exploration success and firmer markets, real exploration expenditure is forecast to continue to rise and the volume of Australian mine production is expected to rise by 14 percent between 1995-6 and 2000-1. Export earnings from mineral and energy commodities are expected to rise by $5.6 billion Australian (16 percent) from 1995-6 levels to reach $41.9 billion in real terms by 2000-1. (author). 2 tabs., 14 figs., 14 refs

Implications of short-term financial outlook for Canadian producers

International Nuclear Information System (INIS)

Shiry, J.

1997-01-01

The short-term outlook for the Western Canadian natural gas industry was reviewed. Based on the dramatic growth in the demand for gas, and the explosive growth of the industry in response to export opportunities, the outlook for the remainder of this decade remains good, notwithstanding low internal returns, below-average returns on equity, and increased competition for U.S. markets. The competition will come from offshore wells in the US Gulf, from offshore wells of Sable Island, and from offshore wells in the Gulf of Mexico. Despite the increasing sources of supply gas prices are actually expected to improve slightly in 1997 and beyond, giving rise to cautious optimism. Nevertheless, more favorable tax treatment is urgently required to head off the likelihood of investment dollars moving to Africa, the Middle East, South America, and most especially China and Russia. Once those countries open up for business in the not-too-distant future, the likelihood of them offering substantially better tax treatment than what is available in Canada could do serious damage to domestic gas industry development. 12 figs

Surging electricity demand growth bolsters outlook for natural gas

International Nuclear Information System (INIS)

Koen, A.D.

1994-01-01

Economic expansion and regulatory reform are combining to boost global opportunities for burning gas to generate electric power. Companies producing, marketing, or transporting gas are capitalizing on the improved outlook by seizing on synergistic roles in the power generation chain. Much of the improved outlook for gas stems from projected hearty increases in global demand for electricity. Bechtel Power Corp., estimates global power generation capacity during 1994--2003 will increase to as much as 1.2 billion kw, about 25% of which could be added by independent power production (IPPs). Since about 200 bcf of gas reserves producing about 20 MMcfd of gas is needed to fuel of a 100,000 kw electric generating station for 25 years, that adds up to a major growth opportunity for gas producers. The paper discusses the assessment of gas reserves, US power growth, the intent of the Energy Policy Act of 1992 (Epact), effects of Epact, gas industry response, power marketing units, synergistic possibilities, effects on US utilities, international power imperatives, non-US projects, funding good projects, and forecasting future developments

The world energy outlook

International Nuclear Information System (INIS)

Anon.

2005-01-01

The oil and gas resources of the Middle East and North Africa (MENA) will be critical to meeting the world's growing appetite for energy. The greater part of the world's remaining reserves lie in that region. They are relatively under-exploited and are sufficient to meet rising global demand for the next quarter century and beyond. The export revenues they would generate would help sustain the region's economic development. But there is considerable uncertainty about the pace at which investment in the region's upstream industry will occur, how quickly production capacity will expand and, given rising domestic energy needs, how much of the expected increase in supply will be available for export. The implications for both MENA producers and consuming countries are profound. The World Energy Outlook, published by the International Energy Agency (IEA), seeks to shed light on these very complex issues

The interplay of theory and experiment

International Nuclear Information System (INIS)

Jacob, M.

1987-01-01

The author reviews the interplay between theory and experiment in the development of the physics of elementary particles and gives an outlook on the possibilities of the new accelerators to study the yet unexplained phenomena of particle physics. (HSI).

Global EV Outlook: Understanding the Electric Vehicle Landscape to 2020

Energy Technology Data Exchange (ETDEWEB)

NONE

2013-06-01

The Global EV Outlook represents the collective efforts of two years of primary data gathering and analysis from the Electric Vehicles Initiative (EVI) and IEA. Key takeaways and insights include landscape analysis of electric vehicle (EV) stock/sales and charging station deployment. Existing policy initiatives are delineated and future opportunities highlighted in an ''Opportunity Matrix: Pathways to 2020''. Together EVI countries accounted for more than 90% of world EV stock at the end of 2012. Strong government support in EVI countries on both the supply and demand sides are contributing to rising market penetration. 12 out of 15 EVI countries offer financial support for vehicle purchases, and most employ a mix of financial and non-financial incentives (such as access to restricted highway lanes) to help drive adoption. The Global EV Outlook is a unique and data-rich overview of the state of electric vehicles today, and offers an understanding of the electric vehicle landscape to 2020.

Global EV Outlook: Understanding the Electric Vehicle Landscape to 2020

Energy Technology Data Exchange (ETDEWEB)

NONE

2013-06-01

The Global EV Outlook represents the collective efforts of two years of primary data gathering and analysis from the Electric Vehicles Initiative (EVI) and IEA. Key takeaways and insights include landscape analysis of electric vehicle (EV) stock/sales and charging station deployment. Existing policy initiatives are delineated and future opportunities highlighted in an ''Opportunity Matrix: Pathways to 2020''. Together EVI countries accounted for more than 90% of world EV stock at the end of 2012. Strong government support in EVI countries on both the supply and demand sides are contributing to rising market penetration. 12 out of 15 EVI countries offer financial support for vehicle purchases, and most employ a mix of financial and non-financial incentives (such as access to restricted highway lanes) to help drive adoption. The Global EV Outlook is a unique and data-rich overview of the state of electric vehicles today, and offers an understanding of the electric vehicle landscape to 2020.

Evaluating Uncertainty in GHG Emission Scenarios: Mapping IAM Outlooks With an Energy System Phase Space

Science.gov (United States)

Ritchie, W. J.; Dowlatabadi, H.

2017-12-01

Climate change modeling relies on projections of future greenhouse gas emissions and other phenomena leading to changes in planetary radiative forcing (RF). Pathways for long-run fossil energy use that map to total forcing outcomes are commonly depicted with integrated assessment models (IAMs). IAMs structure outlooks for 21st-century emissions with various theories for developments in demographics, economics, land-use, energy markets and energy service demands. These concepts are applied to understand global changes in two key factors relevant for scenarios of carbon emissions: total energy use (E) this century and the carbon intensity of that energy (F/E). A simple analytical and graphical approach can also illustrate the full range of outcomes for these variables to determine if IAMs provide sufficient coverage of the uncertainty space for future energy use. In this talk, we present a method for understanding uncertainties relevant to RF scenario components in a phase space. The phase space of a dynamic system represents significant factors as axes to capture the full range of physically possible states. A two-dimensional phase space of E and F/E presents the possible system states that can lead to various levels of total 21st-century carbon emissions. Once defined in this way, a phase space of these energy system coordinates allows for rapid characterization of large IAM scenario sets with machine learning techniques. This phase space method is applied to the levels of RF described by the Representative Concentration Pathways (RCPs). The resulting RCP phase space identifies characteristics of the baseline energy system outlooks provided by IAMs for IPCC Working Group III. We conduct a k-means cluster analysis to distinguish the major features of IAM scenarios for each RCP range. Cluster analysis finds the IAM scenarios in AR5 illustrate RCPs with consistent combinations of energy resources. This suggests IAM scenarios understate uncertainty ranges for future

E-Learning Experiences of Hong Kong Students

OpenAIRE

J. Lam; R. Chan

2013-01-01

The adoption of e-learning in Hong Kong has been increasing rapidly in the past decade. To understand the e-learning experiences of the students, the School of Professional and Continuing Education of The University of Hong Kong conducted a survey. The survey aimed to collect students- experiences in using learning management system, their perceived e-learning advantages, barriers in e-learning and preferences in new e-learning development. A questionnaire with 84 questio...

Nuclear energy outlook 2008

International Nuclear Information System (INIS)

2008-01-01

With the launch today of its first Nuclear Energy Outlook, the OECD Nuclear Energy Agency (NEA) makes an important contribution to ongoing discussions of nuclear energy's potential role in the energy mixes of its member countries. As world energy demand continues to grow unabated, many countries face serious concerns about the security of energy supplies, rising energy prices and climate change stemming from fossil fuel consumption. In his presentation, the NEA Director-General Luis Echavarri is emphasizing the role that nuclear power could play in delivering cost-competitive and stable supplies of energy, while also helping to reduce greenhouse gas emissions. In one Outlook scenario, existing nuclear power technologies could provide almost four times the current supply of nuclear-generated electricity by 2050. Under this scenario, 1400 reactors of the size commonly in use today would be in operation by 2050. But in order to accomplish such an expansion, securing political and societal support for the choice of nuclear energy is vital. An ongoing relationship between policy makers, the nuclear industry and society to develop knowledge building and public involvement will become increasingly important, the publication notes. Moreover, governments have a clear responsibility to maintain continued effective safety regulation, advance efforts to develop radioactive waste disposal solutions and uphold and reinforce the international non-proliferation regime. The authors find that the security of energy from nuclear power is more reliable than that for oil or gas. Additionally, uranium's high energy density means that transport is less vulnerable to disruption, and storing a large energy reserve is easier than for fossil fuels. One tonne of uranium produces the same energy as 10 000 to 16 000 tonnes of oil using current technology. Ongoing technological developments are likely to improve that performance even more. Until the middle of the century the dominant reactor

World Energy Outlook 2009

Energy Technology Data Exchange (ETDEWEB)

NONE

2009-11-10

What will the credit crunch and economic recession mean for energy markets? Will investment cutbacks lead us towards a supply crunch a few years down the line? How could the transition to a clean global energy system be financed? These are just three of the questions that World Energy Outlook 2009 addresses. Incorporating recent developments in energy and environmental policy, this year's Outlook draws on the latest data reflecting the impact of the global financial and economic crisis and takes into account ongoing gyrations in energy prices. The resulting analysis presents a full update of energy projections through to 2030, fuel by fuel, and with more country-level detail than ever before. WEO-2009 puts the spotlight on three special topics: (1) Financing energy investment under a post-2012 climate framework: What policy action is needed to increase deployment of new energy technologies? Where are the most cost-effective opportunities for carbon mitigation? This ground-breaking analysis, which zooms in on the crucial period through to 2020, provides a robust quantitative basis for United Nations Framework Convention on Climate Change negotiations in the lead-up to the crucial climate meeting in Copenhagen in December 2009. (2) Prospects for global natural gas markets: How hard will the credit crisis and economic recession hit gas demand and investment in gas supply? How will geology and geopolitics affect future gas supplies? Through field-by-field analysis of production trends of the world's key gas fields and a bottom-up analysis of upstream costs and investment, WEO-2009 takes a hard look at future global gas supply. (3) Energy trends in Southeast Asia: In recognition of the growing influence Southeast Asia is having on global energy markets, WEO-2009 includes an in-depth analysis of this fast-growing region. The annual WEO report -- the flagship publication of the IEA -- is widely recognised as the most authoritative source of global energy

Canadian natural gas liquids : market outlook 2000 - 2010

International Nuclear Information System (INIS)

Gill, L.; Mortensen, P.

2001-01-01

This study provides a comprehensive analysis of the availability of Canadian natural gas liquids. The analysis was developed from production profiles and gas compositions for individual gas pools and takes into account the effects of market factors. On the demand side, the effects of new infrastructure and changes in corporate structures have been evaluated. The study was initiated at a time when energy prices were stable and the major concern was to see how the addition of the Alliance pipeline, the Aux Sable gas processing plant, the Empress V straddle plant and the Nova/UCC E3 ethylene plant would affect the Canadian liquids business. The study was complicated by the advent of unexpected factors affecting the supply and demand of natural gas liquids (NGLs). These included extremely high prices for natural gas, an apparent inability of the supply basin to respond to the high gas prices with increased supply, and the very high electricity costs in Alberta. The weak supply of NGLs coincides with the increase in ethane demand from the start-up of Alberta's fourth ethylene facility and the addition of the high vapour pressure Alliance pipeline. This weak supply suggests there will be an ethane shortage for at least the next few years. The longer term outlook, however, is less certain and will require an analysis of the outlook for gas production, gas composition and NGL extraction capacity. This study developed two forecasts for natural gas prices. Both presume rising gas demand across North America driven by increased gas use for power generation. The Low Case assumes modest growth in domestic Canadian gas demand and the High case predicts strong growth in domestic demand as higher levels of exports to the United States, resulting in a doubling in growth for Canadian gas production from 2000-2015 compared to the Low Case. Both High and Low Case scenarios suggest that prices will decline from current levels so that Alberta plant gate prices fall by 2005 and will then

Canadian natural gas liquids : market outlook 2000 - 2010

Energy Technology Data Exchange (ETDEWEB)

Gill, L.; Mortensen, P.

2001-04-01

This study provides a comprehensive analysis of the availability of Canadian natural gas liquids. The analysis was developed from production profiles and gas compositions for individual gas pools and takes into account the effects of market factors. On the demand side, the effects of new infrastructure and changes in corporate structures have been evaluated. The study was initiated at a time when energy prices were stable and the major concern was to see how the addition of the Alliance pipeline, the Aux Sable gas processing plant, the Empress V straddle plant and the Nova/UCC E3 ethylene plant would affect the Canadian liquids business. The study was complicated by the advent of unexpected factors affecting the supply and demand of natural gas liquids (NGLs). These included extremely high prices for natural gas, an apparent inability of the supply basin to respond to the high gas prices with increased supply, and the very high electricity costs in Alberta. The weak supply of NGLs coincides with the increase in ethane demand from the start-up of Alberta's fourth ethylene facility and the addition of the high vapour pressure Alliance pipeline. This weak supply suggests there will be an ethane shortage for at least the next few years. The longer term outlook, however, is less certain and will require an analysis of the outlook for gas production, gas composition and NGL extraction capacity. This study developed two forecasts for natural gas prices. Both presume rising gas demand across North America driven by increased gas use for power generation. The Low Case assumes modest growth in domestic Canadian gas demand and the High case predicts strong growth in domestic demand as higher levels of exports to the United States, resulting in a doubling in growth for Canadian gas production from 2000-2015 compared to the Low Case. Both High and Low Case scenarios suggest that prices will decline from current levels so that Alberta plant gate prices fall by 2005 and will

The World energy outlook in 2020: a presentation of the World energy outlook 2000

International Nuclear Information System (INIS)

Cattier, F.

2000-01-01

In November 2000, the International Energy Agency published the new edition of the 'World Energy Outlook'. This work presents forecasts from the energy sector for the next 20 years. It describes changes in the supply and demand of energy as well as their consequences in terms of CO 2 emissions. The forecasts emerging are: continued growth in energy consumption and the associated carbon emissions; the ever preponderant role of fossil fuels, the importance of the developing countries in the global energy situation, the key role of the electrical sector and transport in changes in energy consumption and carbon emissions; the increased dependency of OECD and Asian countries; as well as the necessity of implementing additional policies and measures to reach the objectives detailed in the Kyoto Protocol. (author)

State Outlook: Fiscal and Public Policy Issues Affecting Postsecondary Education

Science.gov (United States)

American Association of State Colleges and Universities, 2010

2010-01-01

This publication provides a compilation of the issues affecting postsecondary education in America. The contents of this issue include: (1) Overview of Economic and Fiscal Policy Dynamics; (2) July 2010 Economic Snapshot; (3) State Economic Conditions and Budget Outlook; (4) State Budget Pressures; (5) State Budget Realignment Strategies; (6)…

Polarization response functions and the (/rvec e/,e'/rvec p/) reaction

International Nuclear Information System (INIS)

Picklesimer, A.; Van Orden, J.W.

1988-01-01

The first comprehensive study of the full set of eighteen response functions relevant to the (/rvec e/,e'/rvec p/) reaction is presented. Benchmark analytical features and limiting cases of the response functions are described. Numerical predictions contrasting nonrelativistic and relativistic (Dirac) dynamics and on- and off- shell final state interaction effects are presented. Basic physical characteristics and dependences of the response functions are identified. The outlook for future experimental studies of the (/rvec e/,e'/rvec p/) polarization response functions is discussed. 56 refs., 5 figs., 1 tab

The Future of the Global Environment: A Model-based Analysis Supporting UNEP's First Global Environment Outlook

OpenAIRE

Bakkes JA; Woerden JW van; Alcamo J; Berk MM; Bol P; Born GJ van den; Brink BJE ten; Hettelingh JP; Langeweg F; Niessen LW; Swart RJ; United Nations Environment Programme (UNEP), Nairobi, Kenia; MNV

1997-01-01

This report documents the scenario analysis in UNEP's first Global Environment Outlook, published at the same time as the scenario analysis. This Outlook provides a pilot assessment of developments in the environment, both global and regional, between now and 2015, with a further projection to 2050. The study was carried out in support of the Agenda 21 interim evaluation, five years after 'Rio' and ten years after 'Brundtland'. The scenario analysis is based on only one scenario, Conventional...

The wind power state of the art and development outlooks

International Nuclear Information System (INIS)

Bal, J.L.

2005-01-01

This document presented during the Physics Summer school, deals with the wind power situation in Europe. The wind energy conversion in electric power is explained as the management and implementing of a wind site. The author discusses also the economy of the wind power and the market and development outlooks. (A.L.B.)

Annual energy outlook 1997 with projections to 2015

International Nuclear Information System (INIS)

1996-12-01

The Annual Energy Outlook 1997 (AEO97) presents midterm forecasts of energy supply, demand, and prices through 2015 prepared by the Energy Information Administration (EIA). These projections are based on results of EIA's National Energy Modeling System (NEMS). This report begins with a summary of the reference case, followed by a discussion of the legislative assumptions and evolving legislative and regulatory issues. ''Issues in Focus'' discusses emerging energy issues and other topics of particular interest. It is followed by the analysis of energy market trends. The analysis in AEO97 focuses primarily on a reference case and four other cases that assume higher and lower economic growth and higher and lower world oil prices than in the reference case. Forecast tables for these cases are provided in Appendixes A through C. Appendixes D and E present summaries of the reference case forecasts in units of oil equivalence and household energy expenditures. Twenty-three other cases explore the impacts of varying key assumptions in NEMS--generally, technology penetration, with the major results shown in Appendix F. Appendix G briefly describes NEMS and the major AEO97 assumptions, with a summary table. 114 figs., 22 tabs

Annual energy outlook 1997 with projections to 2015

Energy Technology Data Exchange (ETDEWEB)

NONE

1996-12-01

The Annual Energy Outlook 1997 (AEO97) presents midterm forecasts of energy supply, demand, and prices through 2015 prepared by the Energy Information Administration (EIA). These projections are based on results of EIA`s National Energy Modeling System (NEMS). This report begins with a summary of the reference case, followed by a discussion of the legislative assumptions and evolving legislative and regulatory issues. ``Issues in Focus`` discusses emerging energy issues and other topics of particular interest. It is followed by the analysis of energy market trends. The analysis in AEO97 focuses primarily on a reference case and four other cases that assume higher and lower economic growth and higher and lower world oil prices than in the reference case. Forecast tables for these cases are provided in Appendixes A through C. Appendixes D and E present summaries of the reference case forecasts in units of oil equivalence and household energy expenditures. Twenty-three other cases explore the impacts of varying key assumptions in NEMS--generally, technology penetration, with the major results shown in Appendix F. Appendix G briefly describes NEMS and the major AEO97 assumptions, with a summary table. 114 figs., 22 tabs.

Australian natural gas market outlook

International Nuclear Information System (INIS)

Anon.

2004-01-01

A new study of the Australian natural gas industry by leading Australian economics and policy consultancy ACIL Tasman highlights the significant supply and demand side uncertainties currently facing the industry. The ACIL Tasman 'Australian Gas Market Review and Outlook 2004' study presents modelling results for three supply/demand scenarios in Eastern Australia and two in Western Australia. The results show that, even under moderate assumptions about future levels of gas demand growth, major supply-side investment is likely to be needed over the next ten to fifteen years. The base supply/demand scenario for Eastern Australia and Northern Territory, illustrated in Figure 1, shows that even allowing for substantial new discoveries in existing production basins and major expansion of coal seam methane production, in the absence of a northern gas connection to the eastern states (Timor Sea or PNG Highlands) a significant supply gap will begin to emerge from around 2013. The study identifies several supply-side options for Eastern Australia - new discoveries in the established production provinces in Bass Strait and Central Australia; greenfield developments such as the Otway Basin offshore from Victoria and South Australia; continuing expansion of coal seam methane production in Queensland and New South Wales; and gas from Papua New Guinea, Timor Sea or from the North West Shelf region delivered via a trans-continental pipeline. The study concludes that it is unlikely that any single option will suffice to meet future demand. Almost inevitably, a combination of these sources will be needed if anticipated growth opportunities are to be met. With regard to prices, the study shows that in the short to medium term the outlook is for some real reductions in wholesale prices in most regional markets. This reflects increasing levels of upstream competition and declining real costs of pipeline transportation. However in the longer term, supply-side constraints will tend to

The OrbitOutlook Data Archive

Science.gov (United States)

Czajkowski, M.; Shilliday, A.; LoFaso, N.; Dipon, A.; Van Brackle, D.

2016-09-01

In this paper, we describe and depict the Defense Advanced Research Projects Agency (DARPA)'s OrbitOutlook Data Archive (OODA) architecture. OODA is the infrastructure that DARPA's OrbitOutlook program has developed to integrate diverse data from various academic, commercial, government, and amateur space situational awareness (SSA) telescopes. At the heart of the OODA system is its world model - a distributed data store built to quickly query big data quantities of information spread out across multiple processing nodes and data centers. The world model applies a multi-index approach where each index is a distinct view on the data. This allows for analysts and analytics (algorithms) to access information through queries with a variety of terms that may be of interest to them. Our indices include: a structured global-graph view of knowledge, a keyword search of data content, an object-characteristic range search, and a geospatial-temporal orientation of spatially located data. In addition, the world model applies a federated approach by connecting to existing databases and integrating them into one single interface as a "one-stop shopping place" to access SSA information. In addition to the world model, OODA provides a processing platform for various analysts to explore and analytics to execute upon this data. Analytic algorithms can use OODA to take raw data and build information from it. They can store these products back into the world model, allowing analysts to gain situational awareness with this information. Analysts in turn would help decision makers use this knowledge to address a wide range of SSA problems. OODA is designed to make it easy for software developers who build graphical user interfaces (GUIs) and algorithms to quickly get started with working with this data. This is done through a multi-language software development kit that includes multiple application program interfaces (APIs) and a data model with SSA concepts and terms such as: space

Background report to the OECD Environmental Outlook to 2030. Overviews, details, and methodology of model-based analysis

International Nuclear Information System (INIS)

Bakkes, J.A.; Bagnoli, P.; Chateau, J.; Corfee-Morlot, J.; Kim, Y.G.

2008-01-01

This background report provides overviews and details of the model-based analyses for the Outlook. The global analyses have been conducted for 24 regions. They cover: climate change; urban air pollution and related health impacts; nutrient loading to the aquatic environment by agriculture and by trends in sanitation and sewerage; terrestrial biodiversity. A baseline scenario has been developed, as well as three policy packages. Most of the model-based analyses for the Environmental Outlook include a retrospect to 1970 and a look forward up to 2050. This enables an assessment of the cost of policy inaction and of the delaying of such action. This background report compares the impacts of the baseline for the various regions of the world. It also assesses the impact of uncertainties in the modelling for the key messages of the Environmental Outlook

Experience based on practice to improve the radon-situation in Saxony. A personal retrospect and outlook for young radiation protection engineers; Erfahrungen aus praktischer Taetigkeit zur Verbesserung der Radon-Situation in Sachsen. Ein persoenlicher Rueckblick und Perspektiven fuer junge Strahlenschuetzer

Energy Technology Data Exchange (ETDEWEB)

Loebner, Walfried

2015-07-01

Based on the state of knowledge and international developments concerning the radon situation in dwellings the experiences regarding the improvement of the radon situation in Saxony were described as a personal retrospect of more than 20 years practice. The taken path to control the radon situation in German dwellings has been reflected as a personally point of view. Open questions and controversial issues were named. The practical experiences in handling of radon in dwellings in connection with the remediation activities at uranium mining legacies were described. As conclusions drawn on own activities and insights the future challenges to improve the radon situation in Saxony were outlined. An outlook was directed to the young radiation protection engineers and civil engineers.

Outlook '98 - Stock markets

International Nuclear Information System (INIS)

Vankka, D.

1998-01-01

In view of the recent drop of some 20 per cent in energy stock prices, and the decline in the value of the Canadian dollar, forecasting oilpatch financing in 1998 is a risky undertaking. Based on a variety of relevant factors, it is expected that there will be a slowdown in oil and gas financing deals in the short term. On the other hand, longer term outlook is bullish, based on the huge capital requirements over the next few years for conventional projects, heavy oil, oilsands and pipelines projects. Corporate mergers and acquisitions will continue at about the same rate as in 1997, as companies attempt to achieve ''economies of scale'' and growth in the most economically sensible manner. Adding production and reserves through corporate transactions at the current lower stock prices will be a powerful incentive. Creative deal structuring will become more prevalent. Corporate reorganizations into separate companies in search of value maximization will increase

Nuclear energy - status and outlook

Energy Technology Data Exchange (ETDEWEB)

Rogner, Hans-Holger; MacDonald, Alan

2007-07-01

Rising expectations best characterize the current prospects of nuclear power in a world that is confronted with a burgeoning demand for energy, higher energy prices, energy supply security concerns and growing environmental pressures. It appears that the inherent economic and environmental benefits of the technology and its excellent performance record over the last twenty years are beginning to tilt the balance of political opinion and public acceptance in favour of nuclear power. Nuclear power is a cost-effective supply-side technology for mitigating climate change and can make a substantial contribution to climate protection. This paper reviews the current status of nuclear power and its fuel cycle and provides an outlook on where nuclear power may be headed in the short-to-medium run (20 to 40 years from now). (auth)

Thermodynamic properties of crystalline Sr0.5Zr2(PO4)3 phosphate from T → 0 to 665 K

International Nuclear Information System (INIS)

Pet'kov, V.I.; Markin, A.V.; Bykova, T.A.; Sukhanov, M.V.; Smirnova, N.N.; Loshkarev, V.N.

2007-01-01

The temperature dependence of the heat capacity of crystalline Sr 0.5 Zr 2 (PO 4 ) 3 phosphate was studied by precision adiabatic vacuum and dynamic scanning calorimetry over the temperature range 7-665 K. The low-temperature dependence of the heat capacity was analyzed using the Debye theory of the heat capacity of solids and its multifractal generalization, which allowed conclusions to be drawn about the heterodynamic characteristics of the structure. The experimental data obtained were used to calculate the standard thermodynamic functions of Sr 0.5 Zr 2 (PO 4 ) 3 from T → 0 to 665 K. The standard absolute entropy of Sr 0.5 Zr 2 (PO 4 ) 3 was in turn used to calculate the standard entropy of its formation from simple substances at 298.15 K [ru

The energy outlook for Russia and the dialogue between the European Union and Russian concerning energy

International Nuclear Information System (INIS)

Laponche, B.

2003-01-01

The discussions concerning energy taking place between the European Union and Russia are aimed at setting up a permanent partnership in the energy sector in order to ensure that the exploitation of Russian energy resources makes it possible to guarantee the economic development of Russia while at the same time supplying sufficient energy exports to the European Union. The outlook for Russia's energy strategy in the years up to 2020 are based on a rate of growth in GDP of 5 % per year, combined with structural changes in economic activities and a vigorous energy efficiency policy, leading to a significant reduction in energy intensity. The low level of growth in demand resulting from this, combined with an increase in production and a reduction in the percentage of natural gas in electricity production guarantees a high level of potential for oil and gas exports in 2020, Compatible with the energy importation requirements of the future European Union and security of supply. The energy outlook for Russia presented by the International Energy Agency (IEA) are based on much lower economic growth figures and on a limited reduction in energy intensity. The percentage accounted for by natural gas in the production of electricity remains high. The IEA assessment is also based on a major increase in the production capacities for hydrocarbons in Russia while at the same time stressing the importance of the financial effort required to achieve this. Like the Russian outlook, it also identifies a major potential for the exportation of oil and natural gas by 2020. The convergence of these two outlooks concerning the future energy exporting capacity of Russia are seriously overshadowed by the fact that they differ greatly concerning their hypotheses and results with regard to domestic consumption and the production of energy. A 'warning scenario' combining the most similar hypotheses from both outlooks demonstrates the uncertain accompanying them. This analysis highlights the

The INCA project: present status and outlook

International Nuclear Information System (INIS)

Aleksandrov, K.V.; Ammosov, V.V.; Chechin, V.A.; Chubenko, A.P.; Erlykin, A.D.; Ladygin, E.A.; Merzon, G.I.; Mukhamedshin, R.A.; Murashov, V.N.; Pavlyuchenko, V.P.; Ryabov, V.A.; Ryazhskaya, O.G.; Saito, T.; Sobolevskii, N.M.; Shchepetov, A.L.; Starkov, N.I.; Trostin, I.S.; Tsarev, V.A.; Wolfendale, A.; Zatsepin, G.T.; Zhdanov, G.B.; Zhukov, A.P.

2002-01-01

Scientific objectives, foundations, status, and outlook of the INCA Project are presented. Fundamentally new technique based on the ionization-neutron calorimeter (INCA) and designed to study local nearby sources of high-energy cosmic rays by direct measuring the spectrum and composition of the nuclear component in the 'knee' region and the spectrum of primary electrons in the energy range 0.1-10 TeV with the proton-background suppression factor up to 10 7 is discussed. Experimental data on exposition of the INCA prototypes to electron, pion, and proton beams at various energies and corresponding simulation results are presented. Prospects are considered

Summary of the OECD Environmental Outlook to 2050; Samenvatting OESO milieuverkenning tot 2050

Energy Technology Data Exchange (ETDEWEB)

Manders, A.J.G.

2012-03-15

The OECD Environmental Outlook to 2050 asks 'What will the next four decades bring?' Based on joint modelling by the OECD and the Netherlands Environmental Assessment Agency (PBL), it looks forward to the year 2050 to find out what demographic and economic trends might mean for the environment if the world does not adopt more ambitious green policies. It also looks at what policies could change that picture for the better. This Outlook focuses on four areas: climate change, biodiversity, freshwater and health impacts of pollution. These four key environmental challenges were identified by the previous Environmental Outlook to 2030 (OECD, 2008) as 'Red Light' issues requiring urgent attention [Dutch] De Organisatie voor Economische Samenwerking en Ontwikkeling (OESO) maakt milieuverkenningen om beleidsmakers beter inzicht te geven in de schaal en samenhang van toekomstige uitdagingen rond milieu. De OESO maakt daarbij gebruik van modellen om projecties te maken. Voor deze verkenning is intensief samengewerkt met het Planbureau voor de Leefomgeving (PBL). De milieuverkenning tot 2050 verkent de gevolgen voor het milieu als meer ambitieuze maatregelen voor het beheer van onze natuurlijke hulpbronnen uitblijven. De verkenning stelt beleidsmaatregelen voor die deze situatie zouden kunnen verbeteren en richt zich op de vier meest urgente thema's: klimaatverandering, biodiversiteit, water en de gezondheidsimplicaties van vervuiling.

The outlook for nuclear power in Europe by 2030

International Nuclear Information System (INIS)

Leclercq, J.

2008-01-01

A 57% increase in the world consumption of electricity is expected between 2004 and 2030. According to the alternative policy scenario of the world energy outlook 2006, the contribution of nuclear power would be +300 GW for a total increase of +4600 GW in power production. The economic outlook for nuclear power appears to be favorable over a long period. Between 2006 and 2030, about 30 countries will order the construction of nuclear power plants but only 5 countries (Usa, China, Japan, Russia and India) will concentrate the 2/3 of this demand. This demand will be met mostly with 10 commercial offers representing reactors of third generation (6 PWR-types + 3 BWR-types + 1 Candu-type). The existing resources of natural uranium (about 15*10 6 tonnes) are sufficient to ensure in 2040 a global nuclear power as high as 3 to 4 times the today's nuclear power. As for Europe, 2 scenarios are considered: an evolution of -60 GW in case of no decision concerning the construction of new nuclear plants and a likely +120 GW scenario including the replacement of 64 GW. The second scenario will lead to an installed capacity of 229 GW in 2030 compared to today's 172 GW. (A.C.)

Gas MGP: review and outlook

International Nuclear Information System (INIS)

Lafon, M.

2007-01-01

The multi-year guidance plan (MGP), publicly disclosed on March 7, 2007, by the French Ministry of Economy and Finances, is the first report by the parliament on the development of the gas sector, in line with the January 3, 2003 law. It was issued for fiscal year 2006 and covers the period spanning 2006-2015. Drafted by a steering committee, chaired by J.P. Falque-Pierrotin and composed of representatives from the relevant ministries, the document involved hearing many experts from the gas sector (industry, commerce, professional unions, government agencies). An exercise in guidance planning, this document is of a forward-looking nature and aims at setting out a shared understanding of demand and outlook for supply. It is also designed to offer analysis of natural gas supply and demand in order to estimate infrastructure capacity

X-ray Polarimetry: From the Early Days to an Outlook for the Future

Science.gov (United States)

Weisskopf, Martin C.

2014-01-01

We present a historical (and personal) overview beginning with the pioneering contributions of Professor R. Novick and the team at the Columbia Astrophysics Laboratory. We will end with our (biased) outlook for the future.

The IMAGE model suite used for the OECD Environmental Outlook to 2050

Energy Technology Data Exchange (ETDEWEB)

Kram, T.; Stehfest, E.

2012-03-15

In the Environmental Outlook to 2050 from the Organisation for Economic Co-operation and Development (OECD) a number of scenarios and projection are used which are calculated with the IMAGE model suite. This document describes the models and modules used and their interconnections.

Canadian gas exports in the U.S. market: 1995 evaluation and outlook

International Nuclear Information System (INIS)

1996-03-01

The outlook for Canadian gas exports was presented. It was predicted that the Canadian natural gas industry will respond well to the changing conditions and regulatory dynamics in the North American market and that gas exports will continue to flow on existing export pipelines at high load factors. Canadian gas will likely be priced lower relative to Gulf Coast prices until 1998, as the reflection of regional supply and demand. A summary of the data and information pertaining to the North American natural gas industry including supply, demand, prices, transportation capacities and key regulatory events which determine current and future export of Canadian natural gas, was presented. Key sections of the report were: (1) 1995 in review, (2) outlook to the year 2000, and (3) a regulatory update. A review of the current state of U.S. electricity restructuring was also included. 15 refs., 7 tabs., 27 figs

Secure e-mail and Web browsing

CERN Multimedia

CERN. Geneva

2009-01-01

This is an entry-level 1.5-hour training course aimed to show how to detect and avoid typical security pitfalls encountered when e-mailing and browsing the Web. It is designed for non-technical users of Internet Explorer and Outlook. Register at CTA

Food irradiation: outlook for commercialization in the United States

International Nuclear Information System (INIS)

Giddings, G.G.

1985-01-01

An account is presented of the long-term and near-term outlooks for food irradiation in the United States, with particular reference to US regulatory status and to the problems of securing public acceptance of the process. Actions taken by international organizations to consider and determine whether irradiated food is wholesome are summarized. A table is included showing dose levels for various food applications. Political and sociological aspects are discussed. (U.K.)

World Energy Outlook 2012 Special Report: Golden Rules for a Golden Age of Gas

Energy Technology Data Exchange (ETDEWEB)

NONE

2012-07-01

Natural gas is poised to enter a golden age, but this future hinges critically on the successful development of the world’s vast unconventional gas resources. North American experience shows unconventional gas - notably shale gas - can be exploited economically. Many countries are lining up to emulate this success. But some governments are hesitant, or even actively opposed. They are responding to public concerns that production might involve unacceptable environmental and social damage. This report, in the World Energy Outlook series, treats these aspirations and anxieties with equal seriousness. It features two new cases: a Golden Rules Case, in which the highest practicable standards are adopted, gaining industry a {sup s}ocial licence to operate{sup ;} and its counterpart, in which the tide turns against unconventional gas as constraints prove too difficult to overcome.

CERN Technical Training 2004: New Short Course III (SC III) on Microsoft Outlook - Meetings and Delegation

CERN Multimedia

Monique Duval

2004-01-01

The CERN Technical Training programme is now proposing a new format for courses on Microsoft Outlook. Three two-hours Short Courses (SC) cover basic and advanced functionalities of the recommended mail client for email at CERN. Each module can be followed independently. The next scheduled session of the 3rd module will take place as follows: Outlook (SC III): Meetings and Delegation. Next session: 9.11.2004 (14:00-16:00) SC III will cover how to organise and manage meetings, work with meeting requests, share tasks, and use email and calendar delegation. The number of participants to each session is limited to 8. The instructor is English-French bilingual, and she will be available some time after each session to answer specific questions, or provide further explanations following demand. The cost of attending any SC module on Outlook is 70.- CHF. The above session will be confirmed if there are enough participants, and the attendance costs will be lower in case of a full class. If you are interested in...

On-line experience with the 168/E

International Nuclear Information System (INIS)

Carroll, J.T.; Brau, J.E.; Maruyama, T.; Parker, D.B.; Chima, J.S.; Price, D.R.; Rankin, P.; Hatley, R.W.

1981-04-01

Current 20 GeV/c photoproduction experiments at the SLAC Hybrid Facility require a decision to take a picture within 150 to 300 μs after the beam pulse. A charged track trigger is provided by a 168/E processor which finds tracks in a downstream PWC system. To meet trigger time requirements the 168/E SNOOP module CAMAC interface is augmented by a CAMAD Auxiliary Controller and dedicated I/0 cards in the 168/E chassis. Between beam pulses a floating point Fortran program executing on a 168/E monitors data acquisition. Experiences with software development and application are reviewed

Uranium exploration programmes, and the outlook for the 1990s

International Nuclear Information System (INIS)

Underhill, D.

1991-01-01

To understand the exploration patterns of the industry and forecast the outlook for the 1990s, it is necessary to understand the broad and diverse makeup of the participants, which consists of: producers, consumers, and government agencies. The most visible group, the producers, are primarily motivated by profit expectation. Their actions show a high correlation to the spot market price. The second group, consumers, are more concerned with the existence of supplier competition, diversification of supply sources, and fuel cycle economics. The last group, governments, further breaks down into importing and exporting groups. They are motivated by either assurances of supply (importing) or hard currency trade (exporting). The future uranium supply/demand balance for the major countries is shown. The sustained decline of uranium prices has resulted in drastic cuts in uranium exploration. In this paper, I will review and analyze the trends of the recent past and the outlook for the 1990s, for civilian power programmes only, not defence stockpiles; also only Western World countries and China are considered, not the USSR and Europe and limited nuclear growth is assumed with no nuclear resurgence. (author)

INPRO: status, ongoing, activities and outlook

International Nuclear Information System (INIS)

Khoroshev, M.

2004-01-01

In this presentation author deals with activities of the International Project on Innovative Nuclear Reactors and Fuel Cycles (INPRO). Presentation const of the following chapters: Introduction; Goals of INPRO and results of Phase IA; Basic principles, user requirements and methodology for assessment of INS; Highlights of INPRO in the areas of economics, environment, safety, waste management, proliferation resistance and infrastructure; Outlook Phase II of INPRO. It is concluded that INPRO has political, financial and technical support from Member States; Phase IA on the establishment of basic principles user requirements and criteria the development of an assessment methodology has been finalised; Phase IB addresses the validation of the INPRO methodology and the assessment of concepts and approaches; INPRO is open to all interested Member States an international organisations

Feed-in tariff outlook in Malaysia

International Nuclear Information System (INIS)

Chua, Shing Chyi; Oh, Tick Hui; Goh, Wei Wei

2011-01-01

This paper aims to present the feed-in tariff (FiT) outlook in Malaysia, which is in the process of being enacted through a Renewable Energy (RE) Policy by the Government of Malaysia (GoM). A brief in policies leading towards the RE policy and the potential of each RE sources under FiT mechanism have been discussed. The successful utilisation of RE source in electricity generation and the FiT implementation globally are positive indicators to implement FiT in Malaysia. Potentials of FiT on biomass, biogas and solid waste energy are currently very promising in Malaysia, but it is solar energy which is predicted to be the main RE of the future, surpassing all other REs. (author)

Asia Pacific outlook

Energy Technology Data Exchange (ETDEWEB)

Swanson, A.B.

1998-09-01

Chem Systems and the WEFA Group has developed a GDP outlook for the Asian economies. The difficulties involved in forecasting Asian demand for petrochemical products was stressed. As proof of that, prior to the current financial crisis, Asian demand for petrochemicals was booming. Double digit growth rates was predicted for demand in the ASEAN countries (Thailand, Indonesia, Singapore, Malaysia, Philippines) for the basic thermoplastic polymers, polyethylene, polypropylene, polystyrene, and polyvinyl chloride. In actual fact, Asian demand for petrochemicals has fallen considerably, with many significant projects in the planning stages delayed or cancelled outright. Within the countries of ASEAN, the lost demand was predicted to be the worst during the 1997 to 1999 period. Access to China`s markets was said to be critical to the continuing recovery of the ASEAN countries. The current five-year plan for China emphasizes investment in petrochemicals. South Korea is a major petrochemical supplier to northern China`s downstream industries. The issues confronting Asian companies to deal with the current crisis in order to be well placed for market recovery were discussed. It was predicted that in the short to medium-term mergers and acquisitions will become more widespread in an effort to hasten the recovery of Asian industry. 4 tabs., 9 figs.

Asia Pacific outlook

International Nuclear Information System (INIS)

Swanson, A.B.

1998-01-01

Chem Systems and the WEFA Group has developed a GDP outlook for the Asian economies. The difficulties involved in forecasting Asian demand for petrochemical products was stressed. As proof of that, prior to the current financial crisis, Asian demand for petrochemicals was booming. Double digit growth rates was predicted for demand in the ASEAN countries (Thailand, Indonesia, Singapore, Malaysia, Philippines) for the basic thermoplastic polymers, polyethylene, polypropylene, polystyrene, and polyvinyl chloride. In actual fact, Asian demand for petrochemicals has fallen considerably, with many significant projects in the planning stages delayed or cancelled outright. Within the countries of ASEAN, the lost demand was predicted to be the worst during the 1997 to 1999 period. Access to China's markets was said to be critical to the continuing recovery of the ASEAN countries. The current five-year plan for China emphasizes investment in petrochemicals. South Korea is a major petrochemical supplier to northern China's downstream industries. The issues confronting Asian companies to deal with the current crisis in order to be well placed for market recovery were discussed. It was predicted that in the short to medium-term mergers and acquisitions will become more widespread in an effort to hasten the recovery of Asian industry. 4 tabs., 9 figs

Oil sands supply outlook

International Nuclear Information System (INIS)

Dunbar, R.

2004-01-01

In March 2004, The Canadian Energy Research Institute released a report on the expected future supply from Alberta's oil sands. The report indicates that the future for the already well-established oil sands industry is promising, particularly given the outlook for oil prices. The challenges facing the industry include higher industry supply costs and the need for innovative commercial and technological solutions to address the risks of irregularities and changes in crude oil prices. In 2003, the industry produced 874 thousand barrels per day of synthetic crude oil and unprocessed crude bitumen. This represents 35 per cent of Canada's total oil production. Current production capacity has increased to 1.0 million barrels per day (mbpd) due to new projects. This number may increase to 3.5 mbpd by 2017. Some new projects may be deferred due to the higher raw bitumen and synthetic crude oil supply costs. This presentation provided supply costs for a range of oil sands recovery technologies and production projections under various business scenarios. tabs., figs

APEC's greener energy outlook

International Nuclear Information System (INIS)

Isa, A M; Samuelson, R D

2013-01-01

The APEC member economies combined accounts for more than 50% of the world's GDP and consume almost 60% of the world's energy. Under the 2011 Honolulu Declaration, APEC Leaders have set an aspirational goal to reduce APEC's aggregate energy intensity by 45 percent by 2035, compared to 2005 levels. This article summarises the results from an APEC-wide study on APEC energy demand and supply outlook from 2010 to 2035. Our business-as-usual projections show that by 2035, APEC energy demand will have increased by 40% of 2010 levels. We also found that historical trends for declining energy intensity will continue and that APEC will likely achieve its aspirational intensity reduction goal. However, our results also suggest that CO 2 emissions will continue to rise and energy security will become less assured. Recognizing these vulnerabilities, APEC has already initiated a broad range of activities to achieve its 'green growth' objectives. While these have been fairly successful in guiding APEC economies towards a path of more sustainable development, these efforts will need to be intensified further to avoid serious environmental degradation.

APEC's greener energy outlook

Science.gov (United States)

Isa, A. M.; Samuelson, R. D.

2013-06-01

The APEC member economies combined accounts for more than 50% of the world's GDP and consume almost 60% of the world's energy. Under the 2011 Honolulu Declaration, APEC Leaders have set an aspirational goal to reduce APEC's aggregate energy intensity by 45 percent by 2035, compared to 2005 levels. This article summarises the results from an APEC-wide study on APEC energy demand and supply outlook from 2010 to 2035. Our business-as-usual projections show that by 2035, APEC energy demand will have increased by 40% of 2010 levels. We also found that historical trends for declining energy intensity will continue and that APEC will likely achieve its aspirational intensity reduction goal. However, our results also suggest that CO2 emissions will continue to rise and energy security will become less assured. Recognizing these vulnerabilities, APEC has already initiated a broad range of activities to achieve its 'green growth' objectives. While these have been fairly successful in guiding APEC economies towards a path of more sustainable development, these efforts will need to be intensified further to avoid serious environmental degradation.

Lead -- supply/demand outlook

International Nuclear Information System (INIS)

Schnull, T.

1999-01-01

As Japan goes--so goes the world. That was the title of a recent lead article in The Economist that soberly discussed the potential of much more severe global economic problems occurring, if rapid and coordinated efforts were not made to stabilize the economic situation in Asia in general, and in Japan in particular. During the first 6 months of last year, commodity markets reacted violently to the spreading economic problems in Asia. More recent currency and financial problems in Russia have exacerbated an already unpleasant situation. One commodity after another--including oil, many of the agricultural commodities, and each of the base metals--have dropped sharply in price. Many are now trading at multiyear lows. Until there is an overall improvement in the outlook for these regions, sentiment will likely continue to be negative, and metals prices will remain under pressure. That being said, lead has maintained its value better than many other commodities during these difficult times, finding support in relatively strong fundamentals. The author takes a closer look at those supply and demand fundamentals, beginning with consumption

Battelle Research Outlook, Volume 2 Number 3. Cleaning Up the Atmosphere.

Science.gov (United States)

Westerman, Arthur B., Ed.

"Outlook" publications focus on areas of science and technology in which research can be valuable to industry, government, and society as a whole. This issue deals with the problems of air pullution and air quality control. The first of six essays,". . . This Most Excellent Canopy, the Air," prognosticates the surge in atmospheric pollution and…

Tradition and Modernization: Siting Philosophy for Children within the African Outlook

Science.gov (United States)

Ndofirepi, Amasa Philip; Cross, Michael

2016-01-01

In this philosophical paper, we investigate the project of doing philosophy with children in Africa. While the philosophy for children program has its roots in the Anglo-Saxon world, we contend that it can sit well in Africa if given an African outlook. We challenge Eurocentric specialists, who are attempting a wholesale introduction of the…

Assumptions for the Annual Energy Outlook 1992

International Nuclear Information System (INIS)

1992-01-01

This report serves a auxiliary document to the Energy Information Administration (EIA) publication Annual Energy Outlook 1992 (AEO) (DOE/EIA-0383(92)), released in January 1992. The AEO forecasts were developed for five alternative cases and consist of energy supply, consumption, and price projections by major fuel and end-use sector, which are published at a national level of aggregation. The purpose of this report is to present important quantitative assumptions, including world oil prices and macroeconomic growth, underlying the AEO forecasts. The report has been prepared in response to external requests, as well as analyst requirements for background information on the AEO and studies based on the AEO forecasts

Energy peaks: A high energy physics outlook

Science.gov (United States)

Franceschini, Roberto

2017-12-01

Energy distributions of decay products carry information on the kinematics of the decay in ways that are at the same time straightforward and quite hidden. I will review these properties and discuss their early historical applications, as well as more recent ones in the context of (i) methods for the measurement of masses of new physics particle with semi-invisible decays, (ii) the characterization of Dark Matter particles produced at colliders, (iii) precision mass measurements of Standard Model particles, in particular of the top quark. Finally, I will give an outlook of further developments and applications of energy peak method for high energy physics at colliders and beyond.

A cosmic ALP background and the cluster soft X-ray excess in A665, A2199 and A2255

Energy Technology Data Exchange (ETDEWEB)

Powell, Andrew J., E-mail: Andrew.Powell2@physics.ox.ac.uk [Rudolf Peierls Centre for Theoretical Physics, University of Oxford, 1 Keble Road, Oxford, OX1 3NP (United Kingdom)

2015-09-01

It has been proposed that an excess in soft X-ray emission observed from many galaxy clusters can be explained by conversion into photons of axion-like particles (ALPs) in the cluster's magnetic field. Previously it has been shown that conversion of this primordially-generated background of relativistic ALPs—a cosmic ALP background (CAB)—can explain the observed soft X-ray excess in both the centre and the outskirts of the Coma cluster. Here we extend this work to the three clusters A665, A2199 and A2255. We use a stochastic, power law model of the cluster magnetic field to numerically calculate ALP-photon conversion probabilities to predict the CAB-generated soft X-ray flux in these clusters. The simulated magnetic fields include models with non-standard (i.e. not turbulent Kolmogorov) power spectra, the index of the spectrum changes from cluster to cluster and even within the cluster A2255. We compare this flux to ROSAT PSPC observations of the three clusters, and use these observations to constrain the CAB parameter space. Assuming these non-standard magnetic field power spectra are valid, we find the CAB can reproduce the magnitude of the observed excess in A2199 and A2255 for the same CAB parameters that match the observed soft excess in the Coma cluster. We also find good fit to the morphology of the excesses in these clusters. Simulation of CAB conversion in the cluster A665 is in mild tension with the other clusters due to producing a small but observable excess at large radii where none is observed. This tension is alleviated considering the uncertainty on predicting the count rate in the ROSAT detector, and on the systematics affecting the magnetic field determination. Overall we find good agreement between the CAB parameters for the four clusters studied so far.

A cosmic ALP background and the cluster soft X-ray excess in A665, A2199 and A2255

International Nuclear Information System (INIS)

Powell, Andrew J.

2015-01-01

It has been proposed that an excess in soft X-ray emission observed from many galaxy clusters can be explained by conversion into photons of axion-like particles (ALPs) in the cluster's magnetic field. Previously it has been shown that conversion of this primordially-generated background of relativistic ALPs—a cosmic ALP background (CAB)—can explain the observed soft X-ray excess in both the centre and the outskirts of the Coma cluster. Here we extend this work to the three clusters A665, A2199 and A2255. We use a stochastic, power law model of the cluster magnetic field to numerically calculate ALP-photon conversion probabilities to predict the CAB-generated soft X-ray flux in these clusters. The simulated magnetic fields include models with non-standard (i.e. not turbulent Kolmogorov) power spectra, the index of the spectrum changes from cluster to cluster and even within the cluster A2255. We compare this flux to ROSAT PSPC observations of the three clusters, and use these observations to constrain the CAB parameter space. Assuming these non-standard magnetic field power spectra are valid, we find the CAB can reproduce the magnitude of the observed excess in A2199 and A2255 for the same CAB parameters that match the observed soft excess in the Coma cluster. We also find good fit to the morphology of the excesses in these clusters. Simulation of CAB conversion in the cluster A665 is in mild tension with the other clusters due to producing a small but observable excess at large radii where none is observed. This tension is alleviated considering the uncertainty on predicting the count rate in the ROSAT detector, and on the systematics affecting the magnetic field determination. Overall we find good agreement between the CAB parameters for the four clusters studied so far

Tecnologia, experiência e memória

Directory of Open Access Journals (Sweden)

Aécio Amaral Jr

2006-10-01

Full Text Available O artigo investiga a estruturação de uma nova cultura de memória, a qual inverte a lógica metafísica com que se pensou a relação entre tecnologia e experiência nas ciências sociais. Com as recentes tecnologias da vida e da informação, a concepção do corpo humano como algo que se constitui à margem de um aparato tecnológico declina em credibilidade. Com isso, um dos principais projetos da metafísica ocidental, a saber, a estruturação de um campo de experiência e conhecimento livre de suportes técnicos, malogra em seu humanismo tecnofóbico. A partir de uma apreciação do conto Memento Mori, de Jonathan Nolan, e do filme Amnésia, de Christopher Nolan, analiso a relação entre memória e escritura, corpo e arquivo na contemporaneidade. O objetivo é perceber as tensões e oscilações implícitas na tentativa de instauração de uma mnemotécnica pretensamente pós-humana ou pós-orgânica. Palavras-chave: tecnologia; experiência; memória; humanismo; pós-humanismo.

E-mail security: mail clients must use encrypted protocols

CERN Multimedia

2006-01-01

In the coming weeks, users of mail clients other than Outlook (e.g. Pine, Mozilla, Mac Mail, etc.) may receive an e-mail from Mail-service@cern.ch with instructions to update the security settings of their mail client. The aim of this campaign is to enforce the use of encrypted and authenticated mail protocols in order to prevent the propagation of viruses and protect passwords from theft. As a first step, from 6 June 2006 onwards, access to mail servers from outside CERN will require a securely configured mail client as described in the help page http://cern.ch/mmmservices/Help/?kbid=191040. On this page most users will also find tools that will update their mail client settings automatically. Note that Outlook clients and WebMail access are not affected. The Mail Team

World Energy Outlook 2004. The new report of the International Energy Agency; World Energy Outlook 2004. Le nouveau rapport de l'Agence Internationale de l'Energie

Energy Technology Data Exchange (ETDEWEB)

Anon.

2004-12-01

Here is given the complete text of the summary of the World Energy Outlook report of the International Energy Agency. This report includes an alternative scenario which gives the image of an energy future more efficient and more respectful of the environment than those of the reference scenario. (O.M.)

Mu2e, a coherent μ → e conversion experiment at Fermilab

International Nuclear Information System (INIS)

Brown, D. N.

2012-01-01

We describe a proposed experiment to search for Charged Lepton Flavor Violation (CLFV) using stopped muons at Fermilab. A primary Proton beam will strike a gold target, producing pions which decay to muons. Low-momentum negative muons will be collected, selected, and transported by a custom arrangement of solenoidal magnets and collimators. Muons will stop in thin foil targets, creating muonic atoms with significant nuclear overlap. Mu2e will search for the coherent conversion of nuclear bound muons to electrons, with an experimental signature of a single mono-energetic electron. Conversion electrons will be detected and measured in a low-mass straw tracker and a crystal calorimeter. Mu2e will have a sensitivity four orders of magnitude better than the most sensitive published result for μ → e conversion, and will have complementary physics reach to LHC experiments and μ → eγ decay experiments such as MEG.

Making a Case for E - learning: Experiences in E-learning at ...

African Journals Online (AJOL)

Making a Case for E - learning: Experiences in E-learning at Langston University ... performances can surpass those of students in traditional learning settings. ... The research method was qualitative based mainly on participatory and ...

Antropologia e filosofia: estética e experiência em Clifford Geertz e Walter Benjamin

Directory of Open Access Journals (Sweden)

Relivaldo Pinho de Oliveira

2012-06-01

Full Text Available Este artigo estuda as concepções de estética e experiência de Clifford Geertz e Walter Benjamin como possibilidades argumentativas e metodológicas para pensar a realidade e suas formas estéticas. Utiliza-se para isso as discussões metodológicas de Geertz, especialmente a respeito do lugar da estética e de sua relação com os demais âmbitos do humano, que encetaram uma nova forma de concebê-los para a etnografia e antropologia de modo geral, e os estudos de Benjamin a respeito da estética como expressão fisionômica de uma época, de determinada realidade, especialmente os que se referem sobre a modernidade. Constata-se essa possibilidade a partir da observação de que a estética e a experiência, nos autores, são tomadas como dimensões da realidade que se relacionam, não de modo mecânico, e sim como âmbitos que atravessam a realidade, os artefatos estéticos, os discursos, e esses assim devem ser observados.This article study the conceptions of aesthetics and experience of Clifford Geertz and Walter Benjamin as argumentative and methodological possibilities for thinking reality and its aesthetic forms. Uses for this Geertz's methodological discussions, especially regarding the place of aesthetics and its relation to other spheres of the human, which has embarked on a new way of conceiving them to ethnography and anthropology in general, and studies Benjamin about the aesthetics and physiognomical expression of an era, a certain reality, especially those concerning about modernity. There is that possibility from the observation that the aesthetics and experience, in the authors, are taken as the dimensions of reality are related, not mechanically, but as areas that cross the reality, the aesthetic artifacts, the speeches, and so these must be observed.

Experience Effect in E-Learning Research

Science.gov (United States)

Wu, Bing; Xu, WenXia; Ge, Jun

This study is a productivity review on the literature gleaned from SSCI, SCIE databases concerning experience in E-Learning research. The result indicates that the number of literature productions on experience effect in ELearning research is still growing from 2005. The main research development country is Croatia, and from the analysis of the publication year, the number of papers is increasing to the peaking in 2010. And the main source title is British Journal of Educational Technology. In addition the subject area concentrated on Education & Educational Research. Moreover the research focuses on are mainly survey research and empirical research, in order to explore experience effect in E-Learning research. Also the limitations and future research of these research were discussed, so that the direction for further research work can be exploited

What is the referential gas outlook for North Africa

International Nuclear Information System (INIS)

Chegrouche, L.

2000-01-01

The estimation of energy requirements for North Africa.is often a result of urgent necessities and supply models. The outlook proposed here puts the accent more on a market logic. It attempts to.combine the objectives of supply and demand, in order to anticipate a reasonable level of market growth. The survey method providing the basis of this approach involves the simulation of preferences and the comparison of forecasts. For the favourable scenario, the projected level reflects energy-related and strategic choices by the countries consulted. In the reference scenario, it refers to the anticipation of demand which becomes combined with the objectives of supply in terms of production capacity and maturing supply projects. The most relevant forecasts for gas demand are introduced for a region and on a per country basis for the period 2000 - 2030. The demand for natural gas is analysed from a global and sector-based point of view. The question of supply capacity acts as a constraint in saturating the market and anticipating its equilibrium. Global gas demand is in line with the pace of change in gross domestic product. This suggests that it is just as sensitive to economic changes as energy demand. An additional demand generated by economic growth can only intensify energy competition. The indicators used in this outlook and the results obtained support this observation. (authors)

A review of 'long-term energy supply and demand outlook'

International Nuclear Information System (INIS)

Hoshino, Yuko; Hamagata, Sumio; Nagata, Yutaka

2016-01-01

In this paper, we reviewed the 'Long-term Energy Supply and Demand Outlook' based on our original Japan's Economy and Energy Outlook toward 2030. 'The Long-term Energy Supply and Demand Outlook' was based on the following three basic policies: (1) Energy self-sufficiency rate in 2030 should be around 25 percent. (2) Electricity Costs in 2030 should be lower than the current level in 2013. (3) Emissions target of GHGs in 2030 should not be lower than that of EU and the US. Moreover, there were many assumptions or constraints, such as assumed economic growth rate consistent to the government's macro-economic policy and the share of renewable energy more than 20 percent. In order to satisfy the above mentioned conditions, an extraordinary energy saving should be implemented in the scenario. The assumed intensity of energy saving is as much as that after the two oil crises. We estimated the cost of that magnitude of energy saving based on our model simulation, which revealed that in order to achieve the energy saving target, the electricity price should be 80% higher than the business as usual case. In addition, we reviewed the long-term energy supply and demand scenarios of major developed countries such as the UK, the US, Italy, Germany and Australia. We found that most of the scenarios depend on a large scale of energy saving in order to achieve the GHG emissions reductions targets. The reality of those energy saving targets should be carefully re-examined under the low oil price environment. (author)

Energy in ASEAN: An outlook into the 21st century

Science.gov (United States)

Arismunandar, A.; Dupuis, P.

The Association of Southeast Asian Nations (ASEAN) was formed in Bangkok in 1967 by five countries: Indonesia, Malaysia, the Philippines, Singapore, and Thailand. A sixth nation, recently independent Brunei Darussalam, joined the association in 1984. The story on enery in the ASEAN is presented. The topics covered include the following: energy resources; energy demand versus elasticity; how to cope with energy demand; and an outlook into the 21st century.

Airline Disruption Management - Perspectives, Experiences and Outlook

DEFF Research Database (Denmark)

Kohl, Niklas; Larsen, Allan; Larsen, Jesper

2007-01-01

Over the past decade, airlines have become more concerned with developing an optimal flight schedule, with very little slack left to accommodate for any form of variation from the optimal solution. During operation the planned schedules often have to be revised due to disruptions caused...... part we report on experiences from a large research and development project on airline disruption management. Within the project the first prototype of a multiple resource decision support system at the operations control center in a major airline, has been implemented....... by for example severe weather, technical problems and crew sickness. Thus, the field of Airline Disruption Management has emerged within the past few years. The increased focus on cutting cost at the major airlines has intensified the interest in the development of new and cost efficient methods to handle...

Electricity energy outlook in Malaysia

International Nuclear Information System (INIS)

Tan, C S; Leong, Y P; Maragatham, K

2013-01-01

Population and income growth are the key drivers behind the growing demand for energy. Demand for electricity in Malaysia is always growing in tandem with its Gross Domestic Product (GDP) growth. The growth for electricity in Malaysia forecasted by Economic Planning Unit (EPU) has shown an increase of 3.52% in 2012 compared to 3.48% in 2011. This growth has been driven by strong demand growth from commercial and domestic sectors. The share of electricity consumption to total energy consumption has increased from 17.4% in 2007 to 21.7% in 2012. The total electricity production was reported at 122.12TWh in 2012, where gas is still the major fuel source contributing to 52.7% of the total generation fuel mix of electricity followed by Coal, 38.9%, hydro, 7.3%, oil, 1% and others, 0.2%. This paper aims to discuss the energy outlook particularly the electricity production and ways toward greener environment in electricity production in Malaysia

Electricity energy outlook in Malaysia

Science.gov (United States)

Tan, C. S.; Maragatham, K.; Leong, Y. P.

2013-06-01

Population and income growth are the key drivers behind the growing demand for energy. Demand for electricity in Malaysia is always growing in tandem with its Gross Domestic Product (GDP) growth. The growth for electricity in Malaysia forecasted by Economic Planning Unit (EPU) has shown an increase of 3.52% in 2012 compared to 3.48% in 2011. This growth has been driven by strong demand growth from commercial and domestic sectors. The share of electricity consumption to total energy consumption has increased from 17.4% in 2007 to 21.7% in 2012. The total electricity production was reported at 122.12TWh in 2012, where gas is still the major fuel source contributing to 52.7% of the total generation fuel mix of electricity followed by Coal, 38.9%, hydro, 7.3%, oil, 1% and others, 0.2%. This paper aims to discuss the energy outlook particularly the electricity production and ways toward greener environment in electricity production in Malaysia

Outlook for international oil markets

Energy Technology Data Exchange (ETDEWEB)

Zanoyan, V; French, M

1984-01-01

Despite increased hostilities in the Persian Gulf, there has been a slack in both petroleum product and crude markets and concern over the possibility of a wave of refinery bankruptcies. The short-term outlook recognizes that OPEC problems are not permanent. Demand is not expected to return to pre-1979 levels, and demand growth will not have an equal distribution among OPEC members. Mid-term projections are for real oil prices to be about 12% below 1982 levels, with the decline continuing through 1986. The only significant demand expansion will occur in the industrial sectors of the developing countries due to conservation efforts and fuel substitution that will continue to reduce petroleum's share of total energy consumed by developed countries. Consumption in the transport sector will probably remain at current levels. Oil production in Western countries should peak and then decline during the 1980s, with non-OPEC developing countries filling some of the demand gap and OPEC prices going up instead of production. 6 tables.

Outlook and overview of the North American marketplace: 1997-2015

International Nuclear Information System (INIS)

Sitzer, S.

1997-01-01

A series of projections for natural gas prices and production patterns in North America to the year 2015 were presented, based on the 'Annual Energy Outlook 1997' (AEO97) and on the 'International Energy Outlook 1996' (IEO96), two publications of the US Energy Information Administration. AEO's primary focus is the U.S. domestic situation, whereas the IEO provides international forecasts and analysis. In general, it is expected that while the growth in U.S. demand will put severe strain on North American natural gas reserves, production and delivery systems, deregulation will provide the incentives to maintain the improvements in efficiency and deliverability that have characterized gas supply over the past 10 years. To buttress these predictions, a series of analysis on U.S. economic growth, energy demand, world oil prices, U.S. electricity generation and cogeneration by fuel type, U.S. natural gas supply and prices were modelled under different price scenarios. Estimates included Canadian and Mexican reserves, storage and productive capacities in the overall North American energy picture. It was concluded that because of the relatively abundant supply and low environmental emissions, natural gas will continue to play a key role in North American energy markets. 4 refs., 13 figs

Power generation in India: analysing trends and outlook

International Nuclear Information System (INIS)

2011-01-01

The objective of this report is to provide up-to-date data, critical analysis and information encompassing all aspects of power generation in India. The report provides historic and future outlook for power generation in India. It also provides an evaluation of private participation in power generation segment of India and investment opportunities in Indian power sector. In addition, the report examines policies, regulatory framework and financing of power generation in India. It also highlights key issues and challenges that are restricting the accelerated development of this sector. The report has thirteen chapters in total. (author)

Outlook for alternative energy sources. [aviation fuels

Science.gov (United States)

Card, M. E.

1980-01-01

Predictions are made concerning the development of alternative energy sources in the light of the present national energy situation. Particular emphasis is given to the impact of alternative fuels development on aviation fuels. The future outlook for aircraft fuels is that for the near term, there possibly will be no major fuel changes, but minor specification changes may be possible if supplies decrease. In the midterm, a broad cut fuel may be used if current development efforts are successful. As synfuel production levels increase beyond the 1990's there may be some mixtures of petroleum-based and synfuel products with the possibility of some shale distillate and indirect coal liquefaction products near the year 2000.

Particle searches in e+e- experiments at PEP and PETRA

International Nuclear Information System (INIS)

Lau, K.H.

1982-10-01

This talk reviews recent results in new particle searches performed by experiments at the high energy e + e - storage rings PEP and PETRA. It concentrates on recent searches for: hadrons with a new quark flavor, spin-1/2 charged heavy leptons, spin-0 charged leptons, spin-0 point-like scalars or pseudoscalars, and neutral heavy leptons

A CBO Study. The Budget and Economic Outlook: An Update

Science.gov (United States)

2006-08-01

the growth of quarterly corporate income tax payments due in September. 6 THE BUDGET AND ECONOMIC OUTLOOK: AN UPDATETable 1-3. CBO’s Baseline Budget...receipts relative to GDP is expected to be offset by reductions in corporate income tax receipts and (to a lesser extent) in receipts from estate...taxes—have also contrib- uted to the latest technical revisions: B This year’s corporate income tax receipts are higher than can be explained by

The Outlook for Energy Supply and Demand (1/3)

CERN Multimedia

CERN. Geneva

2015-01-01

These lectures will review the challenges facing energy policy, the outlook for different sources of primary energy (fossil and renewable), how energy is used, and prospects for improved energy efficiency. A colloquium ‘Can Future Energy Needs be Met Sustainably?’, that I will be giving on Tuesday 15 September at 16:30, is part of this course – see separate Abstract for a summary. The lectures will provide more details and address topics that will only be mentioned in passing in the colloquium.

International energy outlook 1996

International Nuclear Information System (INIS)

1996-05-01

This International Energy Outlook presents historical data from 1970 to 1993 and EIA's projections of energy consumption and carbon emissions through 2015 for 6 country groups. Prospects for individual fuels are discussed. Summary tables of the IEO96 world energy consumption, oil production, and carbon emissions projections are provided in Appendix A. The reference case projections of total foreign energy consumption and of natural gas, coal, and renewable energy were prepared using EIA's World Energy Projection System (WEPS) model. Reference case projections of foreign oil production and consumption were prepared using the International Energy Module of the National Energy Modeling System (NEMS). Nuclear consumption projections were derived from the International Nuclear Model, PC Version (PC-INM). Alternatively, nuclear capacity projections were developed using two methods: the lower reference case projections were based on analysts' knowledge of the nuclear programs in different countries; the upper reference case was generated by the World Integrated Nuclear Evaluation System (WINES)--a demand-driven model. In addition, the NEMS Coal Export Submodule (CES) was used to derive flows in international coal trade. As noted above, foreign projections of electricity demand are now projected as part of the WEPS. 64 figs., 62 tabs

International energy outlook 1996

Energy Technology Data Exchange (ETDEWEB)

NONE

1996-05-01

This International Energy Outlook presents historical data from 1970 to 1993 and EIA`s projections of energy consumption and carbon emissions through 2015 for 6 country groups. Prospects for individual fuels are discussed. Summary tables of the IEO96 world energy consumption, oil production, and carbon emissions projections are provided in Appendix A. The reference case projections of total foreign energy consumption and of natural gas, coal, and renewable energy were prepared using EIA`s World Energy Projection System (WEPS) model. Reference case projections of foreign oil production and consumption were prepared using the International Energy Module of the National Energy Modeling System (NEMS). Nuclear consumption projections were derived from the International Nuclear Model, PC Version (PC-INM). Alternatively, nuclear capacity projections were developed using two methods: the lower reference case projections were based on analysts` knowledge of the nuclear programs in different countries; the upper reference case was generated by the World Integrated Nuclear Evaluation System (WINES)--a demand-driven model. In addition, the NEMS Coal Export Submodule (CES) was used to derive flows in international coal trade. As noted above, foreign projections of electricity demand are now projected as part of the WEPS. 64 figs., 62 tabs.

World Energy Outlook 2012

Energy Technology Data Exchange (ETDEWEB)

NONE

2012-07-01

Industry and government decision-makers and others with a stake in the energy sector all benefit from the contents of World Energy Outlook (WEO) 2012. It presents authoritative projections of energy trends through to 2035 and insights into what they mean for energy security, environmental sustainability and economic development. Oil, coal, natural gas, renewables and nuclear power are all covered, together with an update on climate change issues. Global energy demand, production, trade, investment and carbon dioxide emissions are broken down by region or country, by fuel and by sector. Special strategic analyses cover: What unlocking the purely economic potential for energy efficiency could do, country by country and sector by sector, for energy markets, the economy and the environment; The Iraqi energy sector, examining both its importance in satisfying the country’s own needs and its crucial role in meeting global oil and gas demand; The water-energy nexus, as water resources become increasingly stressed and access more contentious; Measures of progress towards providing universal access to modern energy services. There are many uncertainties, but many decisions cannot wait. The insights of this publication are invaluable to those who must shape our energy future.

Conectividade e Informação: Usabilidade e Mobilidade orientada para User Experience

Directory of Open Access Journals (Sweden)

Antonio Mendes Silva Filho

2012-08-01

Full Text Available Tempo é o bem mais precioso que todo ser humano pode possuir, inclusive para aqueles que pensam nada ter. Adicionalmente, o livre arbítrio de cada ser lhe permite escolher como utilizar esse bem precioso. O ser humano quando envolvido em atividades profissionais ou de lazer buscam otimizar o uso de tempo, que é propiciada pela facilidade através da qual ele(a consegue realizar a atividade. E, se para realizar a atividade, ele requer uso de tecnologias como computador, notebook, iGadgets (como, por exemplo, iPad, iPhone e iPod, TV, DVD player, dentre outros, essa facilidade é oferecida pela usabilidade do produto. Isso é determinante no momento que usuário vai escolher um produto. Preocupar-se com o usuário e prover ele com um produto que tem simplicidade, eficiência e elegância é prover suporte à experiência do usuário. Nesse sentido, este artigo explora e discute como a experiência do usuário (user experience e usabilidade impactam uso e adoção de novas tecnologias.

Stat-of-the art of nuclear fusion and its future outlook in

International Nuclear Information System (INIS)

Abdelaziz, M.E.; Elnadi, A.M.; Masoud, M.; Elshaer, M.A.; Khalil, S.M.

1993-01-01

The study in this project is carried out with the objective of being able to present a clear view for the state-of-the art of nuclear fusion as one of the most promising coming energy source and its future outlook in Egypt. The study introduce a summary of the world energy problem and the advantages of thermonuclear fusion energy compared to other energy sources. A description of the two main techniques of confining plasma in the fusion experiments, namely the magnetic and the inertial confinement. These techniques are discussed and investigated through linear pinches and tokamaks. Tokamaks showed to be a promising machines for achieving the controlled thermonuclear fusion power reactor. Recent development of the research on laser fusion together with fast progress in pellet and laser technology suggest that it may be possible to achieve laser fusion power reactor. The story of the strange phenomena of cold fusion, muon-catalyzed fusion, and cold fusion in condensed matter are also studied and showed to be non promising. The project study in details the future fusion reactor, its nuclear engineering and its safety and environmental aspects. The study is based on the magnetic fusion using the tokamak configuration. The positive safety and environmental aspects of fusion reactors, if exist, is also investigated. Status of plasma physics and nuclear fusion activities and strategies in the developing countries (including egypt and the arab countries) are reviewed, besides, some national programmes are proposed. In addition, the status of international activities in plasma technology and its application are represented. Future outlook for egyptian programmes on different plasma technologies are studied. Finally, conclusions and recommendations are presented which summarized the principle achiements and future research opportunities in nuclear fusion activities. In fact, it must be emphasized that fusion is an exciting and challenging field of research -the most

Issues of formation of anti-corruption outlook in the society

Directory of Open Access Journals (Sweden)

Ruslan A. Abramov

2014-01-01

Full Text Available Objective to show that the formation of anticorruption outlook is an important and vital aspect of modern society and to prove that it is more useful to prevent corruption manifestations than to combat them. Methods the methodological basis of the research is the universal analysis and synthesis of anticorruption issues allowing to actually or virtually divide the objects into constituent parts and to find out which parts they consists of what its properties and characteristics are and to synthesize their consolidation into a single organic whole not into a mechanical unit. Also a method of survey and statistical polls was used including conversation interviews massive data collection through questionnaires and their systematization into a single report. Results the paper studies the corruption institution as a social act allowing to destabilize the socioeconomic situation in the country as a whole. At the same time it proves the necessity to combat this phenomenon including level impacts related to the institutional nature of the formation of a comprehensive system of the countryrsquos sustainable development. The corruption perception by young people is explored. Basing on the conducted research it is demonstrated that the introduction of profile and specialized courses on the existing anticorruption state policy in the system of higher and additional education forms a new correct outlook on the perception of corruption which eventually should lead to the reduction of corruption level in the country. This also proves the point that prevention is more effective than struggle with corruption. Also it is proved that for the effectiveness of combating corruption and clarifying the corruption dynamics it is advisable to periodically conduct monitoring seminars round tables conferences and other practical applied measures with the participation of practitioners. Scientific novelty the paper contains provisions on the formalization of corruption

Outlooks for Wind Power in the United States: Drivers and Trends under a 2016 Policy Environment

Energy Technology Data Exchange (ETDEWEB)

Mai, Trieu [National Renewable Energy Lab. (NREL), Golden, CO (United States); Lantz, Eric [National Renewable Energy Lab. (NREL), Golden, CO (United States); Ho, Jonathan [National Renewable Energy Lab. (NREL), Golden, CO (United States); Stehly, Tyler [National Renewable Energy Lab. (NREL), Golden, CO (United States); Heimiller, Donna [National Renewable Energy Lab. (NREL), Golden, CO (United States)

2016-12-01

Over the past decade, wind power has become one of the fastest growing electricity generation sources in the United States. Despite this growth, the U.S. wind industry continues to experience year-to-year fluctuations across the manufacturing and supply chain as a result of dynamic market conditions and changing policy landscapes. Moreover, with advancing wind technologies, ever-changing fossil fuel prices, and evolving energy policies, the long-term future for wind power is highly uncertain. In this report, we present multiple outlooks for wind power in the United States, to explore the possibilities of future wind deployment. The future wind power outlooks presented rely on high-resolution wind resource data and advanced electric sector modeling capabilities to evaluate an array of potential scenarios of the U.S. electricity system. Scenario analysis is used to explore drivers, trends, and implications for wind power deployment over multiple periods through 2050. Specifically, we model 16 scenarios of wind deployment in the contiguous United States. These scenarios span a wide range of wind technology costs, natural gas prices, and future transmission expansion. We identify conditions with more consistent wind deployment after the production tax credit expires as well as drivers for more robust wind growth in the long run. Conversely, we highlight challenges to future wind deployment. We find that the degree to which wind technology costs decline can play an important role in future wind deployment, electric sector CO₂ emissions, and lowering allowance prices for the Clean Power Plan.

Machine Repairers and Operators. Reprinted from the Occupational Outlook Handbook, 1978-79 Edition.

Science.gov (United States)

Bureau of Labor Statistics (DOL), Washington, DC.

Focusing on machine repairers and operators, this document is one in a series of forty-one reprints from the Occupational Outlook Handbook providing current information and employment projections for individual occupations and industries through 1985. The specific occupations covered in this document include appliance repairers,…

NOAA's Strategy to Improve Operational Weather Prediction Outlooks at Subseasonal Time Range

Science.gov (United States)

Schneider, T.; Toepfer, F.; Stajner, I.; DeWitt, D.

2017-12-01

NOAA is planning to extend operational global numerical weather prediction to sub-seasonal time range under the auspices of its Next Generation Global Prediction System (NGGPS) and Extended Range Outlook Programs. A unification of numerical prediction capabilities for weather and subseasonal to seasonal (S2S) timescales is underway at NOAA using the Finite Volume Cubed Sphere (FV3) dynamical core as the basis for the emerging unified system. This presentation will overview NOAA's strategic planning and current activities to improve prediction at S2S time-scales that are ongoing in response to the Weather Research and Forecasting Innovation Act of 2017, Section 201. Over the short-term, NOAA seeks to improve the operational capability through improvements to its ensemble forecast system to extend its range to 30 days using the new FV3 Global Forecast System model, and by using this system to provide reforecast and re-analyses. In parallel, work is ongoing to improve NOAA's operational product suite for 30 day outlooks for temperature, precipitation and extreme weather phenomena.

Complete (γ,2e) experiments at 0.1 eV above threshold

International Nuclear Information System (INIS)

Rond, F.; Mazeau, J.; Huetz, A.

1999-01-01

Here we report on a new experiment which has been designed to perform (γ,2e) experiments extremely close to threshold, in an energy range which is inaccessible to conventional electron analysers. The angular and energy resolutions of this new technique are illustrated by measuring electrons issued from resonant single ionization of argon. First results on double ionization of argon for the 3p 4 3 P e J=2 final state of Ar ++ are also presented. The contribution of an indirect process producing 20 meV Auger electrons, which was suspected from previous experiments, is clearly observed in addition to the direct process. (orig.)

Energy outlook for the APEC region

International Nuclear Information System (INIS)

Priddle, R.

1996-01-01

The outlook for energy demand in the Asia-Pacific Economic Cooperation (APEC) region to 2010 is summarized under two scenarios: capacity constraints, in which energy price increases dampen demand, and energy savings, in which energy demand growth is dampened by improvements to the underlying energy intensity trends. In the capacity constraints case, total APEC primary energy demand is projected to increase by more than 50 percent, at an average annual rate of 2.3 percent. Natural gas and solids (mostly coal) are expected to be the fastest growing fossil fuels. In the energy savings case, total primary energy demand could increase by 42 percent, an annual average rate of 2 percent. Projected demands for energy are presented, categorized by fuel: oil demand/supply, natural gas, coal and other solid fuel, electricity and heat, hydroelectric power, and nuclear power. (author). 4 tabs., 3 figs

Natural gas supply and demand outlook

International Nuclear Information System (INIS)

McGill, C.B.

1998-01-01

The outlook for U.S. natural gas supply and demand in the residential, commercial, industrial/cogeneration, electricity and transportation sectors for 1995, 2000, 2005, 2010, and 2015 was presented. A summary of gas well completions from 1990 to 1997 was also provided. The Canadian natural gas resource was estimated at 184 trillion cubic feet. In 1996, Canada produced 5.6 trillion cubic feet of natural gas, half of which was exported to the U.S. New pipeline projects have been proposed to transport natural gas from eastern offshore areas and the Western Canadian Sedimentary Basin. A table representing U.S. and Canada gas trade from 1990 to 1997 and a map of proposed Canadian and U.S. natural gas pipeline routes were also included. Looking into the future, this speaker predicted continued volatility in natural gas prices. 9 tabs., 9 figs

The Global Pipeline of GM crops: an outlook for 2020

OpenAIRE

PARISI CLAUDIA; TILLIE PASCAL; RODRIGUEZ CEREZO Emilio

2015-01-01

This study presents the worldwide pipeline of genetically modified (GM) crops that are likely to be commercialized and cultivated by farmers in the short to medium term. The database presented has been built by collecting information about the status of GM crops both in the regulatory pipeline of national biotechnology agencies and in the advanced phase of development by technology providers. Particular attention will be given to the 2020 outlook of new crops and traits, with a special fo...

OECD Skills Outlook 2013: First Results from the Survey of Adult Skills

Science.gov (United States)

OECD Publishing, 2013

2013-01-01

This first "OECD Skills Outlook" presents the initial results of the Survey of Adult Skills (PIAAC), which evaluates the skills of adults in 22 OECD member countries and two partner countries. The PIAAC survey was designed to provide insights into the availability of some key skills and how they are used at work and at home through the…

Annual Energy Outlook 2016 With Projections to 2040

Energy Technology Data Exchange (ETDEWEB)

None, None

2016-08-01

The Annual Energy Outlook 2016 (AEO2016), prepared by the U.S. Energy Information Administration (EIA), presents long-term projections of energy supply, demand, and prices through 2040. The projections, focused on U.S. energy markets, are based on results from EIA’s National Energy Modeling System (NEMS). NEMS enables EIA to make projections under alternative, internallyconsistent sets of assumptions. The analysis in AEO2016 focuses on the Reference case and 17 alternative cases. EIA published an Early Release version of the AEO2016 Reference case (including U.S. Environmental Protection Agency’s (EPA) Clean Power Plan (CPP)) and a No CPP case (excluding the CPP) in May 2016.

MAGIX. Progressing towards a new experiment

Energy Technology Data Exchange (ETDEWEB)

Caiazza, Sabato Stefano [Institut fuer Kernphysik, JGU Mainz (Germany); Collaboration: Magix/MESA-Collaboration

2016-07-01

In the next years, the Institut fuer Kernphysik at the Johannes Gutenberg-Universitaet Mainz, will build a new high-intensity accelerator for low-energy polarized electron beams. The MAGIX experiment will be one of the two exploiting this new machine. This experiment is designed to perform high precision measurement on the intense beam provided by the accelerator with polarized an unpolarized gas targets. This report will present an overview of the experiment and of its objectives, focussing on the development of the first prototypes of the experimental components and the first simulations of the experimental performances with an outlook on the future perspectives.

Natural gas liquids: market outlook

International Nuclear Information System (INIS)

Heath, M.

1996-01-01

Future market outlook for natural gas liquids was discussed. It was shown that Canadian natural gas and natural gas liquid (NGL) production levels have experienced extraordinary growth over the past few years due to an increased U.S. demand for Canadian natural gas. Recent supply and demand studies have indicated that there will be growing surpluses of NGLs in Canada. By 1996, the majority of NGL surplus that is forecast to be available is ethane (64%), followed by propane (22%), butane (12%) and pentane plus (2%). Throughout the forecast period, the ratio of incremental ethane to the total NGL surplus, over and above forecast demand, was expected to continue to rise. The viability of producing and processing that ethane and transporting it to market, will be crucial. Development of a large ex-Alberta C2+ pipeline from Empress to Mont Belvieu under the reference case supply projection is a possibility, but only if total tariff and fractionation charge on the line is less than or equal to 10 US cents/USG (currently 16-22 US cents/USG). 11 figs

Alberta wind integration. Status and outlook

Energy Technology Data Exchange (ETDEWEB)

Kehler, John; Aksomitis, Kris; Duchesne, Jacques [Alberta Electric System Operator (AESO), Calgary, AB (Canada)

2010-07-01

Alberta has excellent wind resources with over 600 MW of wind generation currently operating on the Alberta Interconnected Electric System (AIES) and there continues to be strong interest in wind development. Integration of large-scale wind power, however, is still relatively new and presents new operational opportunities and challenges. The AESO currently has over 7,700 MW in potential wind power development in Alberta in our interconnection queue. The Alberta system peak load is 10, 236 MW with 12,763 MW installed generation capacity and limited interconnection capability to neighboring jurisdictions. The AESO recognizes that it is important, both to system reliability and to the successful development of renewable resources in Alberta, that the impact on power system operations and the obligations of market participants are understood as Alberta reaches higher levels of wind penetration. The paper discusses the current status and future outlook on wind integration in Alberta. (orig.)

Observation of the rare {eta}{yields}e{sup +}e{sup -}e{sup +}e{sup -} decay with the KLOE experiment

Energy Technology Data Exchange (ETDEWEB)

Ambrosino, F. [Dipartimento di Scienze Fisiche dell' Universita ' Federico II' , Napoli (Italy); INFN Sezione di Napoli, Napoli (Italy); Antonelli, A.; Antonelli, M. [Laboratori Nazionali di Frascati dell' INFN, Frascati (Italy); Archilli, F. [Dipartimento di Fisica dell' Universita ' Tor Vergata, Roma (Italy); INFN Sezione di Roma Tor Vergata, Roma (Italy); Balwierz, I. [Institute of Physics, Jagiellonian University, Krakow (Poland); Bencivenni, G. [Laboratori Nazionali di Frascati dell' INFN, Frascati (Italy); Bini, C. [Dipartimento di Fisica dell' Universita ' Sapienza' , Roma (Italy); INFN Sezione di Roma, Roma (Italy); Bloise, C. [Laboratori Nazionali di Frascati dell' INFN, Frascati (Italy); Bocchetta, S. [Dipartimento di Fisica dell' Universita ' Roma Tre' , Roma (Italy); INFN Sezione di Roma Tre, Roma (Italy); Bossi, F. [Laboratori Nazionali di Frascati dell' INFN, Frascati (Italy); Branchini, P. [INFN Sezione di Roma Tre, Roma (Italy); Capon, G.; Capussela, T. [Laboratori Nazionali di Frascati dell' INFN, Frascati (Italy); Ceradini, F. [Dipartimento di Fisica dell' Universita ' Roma Tre' , Roma (Italy); INFN Sezione di Roma Tre, Roma (Italy); Ciambrone, P.; Czerwinski, E.; De Lucia, E. [Laboratori Nazionali di Frascati dell' INFN, Frascati (Italy); De Santis, A. [Dipartimento di Fisica dell' Universita ' Sapienza' , Roma (Italy); INFN Sezione di Roma, Roma (Italy); De Simone, P. [Laboratori Nazionali di Frascati dell' INFN, Frascati (Italy); De Zorzi, G. [Dipartimento di Fisica dell' Universita ' Sapienza' , Roma (Italy); INFN Sezione di Roma, Roma (Italy)

2011-08-26

We report the first observation of the rare {eta}{yields}e{sup +}e{sup -}e{sup +}e{sup -}({gamma}) decay based on 1.7 fb{sup -1} collected by the KLOE experiment at the DA{Phi}NE {phi}-factory. The selection of the e{sup +}e{sup -}e{sup +}e{sup -} final state is fully inclusive of radiation. We have identified 362{+-}29 events resulting in a branching ratio of (2.4{+-}0.2{sub stat}+bckg{+-}0.1{sub syst})x10{sup -5}.

A experiência da maternidade e a dialogia mãe-filho com distúrbio de linguagem Maternal experience and language impairment mother-child dialogics

Directory of Open Access Journals (Sweden)

Anelise Henrich Crestani

2012-04-01

Full Text Available TEMA: a experiência da maternidade e dialogia mãe-filho com distúrbio de linguagem. PROCEDIMENTOS: o objetivo de investigar as possíveis relações entre a constituição da experiência da maternidade e a dialogia mãe-filho com distúrbio de linguagem. A amostra desta pesquisa foi constituída por 4 crianças, entre 2 e 4 anos, com distúrbio de linguagem, e suas mães. As mães foram submetidas a uma entrevista semi-estruturada acerca da experiência materna e a possibilidade de a mesma ter passado por alterações emocionais tais como a depressão e/ou ansiedade. Coletou-se uma interação mãe-filho, e em um caso avó-neta, através da filmagem da díade em atividade lúdica para analisar o modo como a dialogia e a interação aconteciam na díade. RESULTADOS: demonstraram que as quatro crianças estiveram sujeitas a interações com mães e avó com índices de ansiedade (dois casos e depressão (dois casos. Apenas uma mãe não possuía tais índices e esta possuía dialogia adequada com a filha. CONCLUSÃO: os dados demonstraram relações entre a dialogia mãe-filho e a experiência materna. Houve distinções na dialogia e no brincar relacionados aos estados emocionais das mães e, em um caso, da avó.BACKGROUND: the maternal experience and language impairment mother-child dialogics. PROCEDURES: the aim was to research the possible relations between maternal experience and mother-child dialogics, in language impairment children cases. The sample was made up with four children, between two and four year old with language impairment and their mothers.The mothers answered a semi-structured interview about the maternal experience and possible mothers' emotional signs like anxiety and depression. The pairs engaged in interaction were videotaped in order to interpret the mother's speech, in one case grand-mother, and the interaction process. RESULTS: the results showed that the children were in interactions with mothers and a grandmother

World Energy Outlook 2013

Energy Technology Data Exchange (ETDEWEB)

NONE

2013-07-01

In a world where big differences in regional energy prices impact competitiveness, who are the potential winners and losers? Huge volumes of oil are needed to meet growing demand and offset declines in existing fields. Where will it all come from? What could trigger a rapid convergence in natural gas prices between Asia, Europe and North America, and how would it affect energy markets? Is the growth in renewable energy self-sustaining and is it sufficient to put us on track to meet global climate goals? How much progress is being made in phasing out fossil-fuel subsidies and expanding access to modern energy services to the world’s poor? The answers to these and many other questions are found in WEO-2013, which covers the prospects for all energy sources, regions and sectors to 2035. Oil is analysed in-depth: resources, production, demand, refining and international trade. Energy efficiency – a major factor in the global energy balance – is treated in much the same way as conventional fuels: Its prospects and contribution are presented in a dedicated chapter. And the report examines the outlook for Brazil's energy sector in detail and the implications for the global energy landscape.

Climate Prediction Center (CPC) Three Month Probabilistic Precipitation Outlook for the Contiguous United States and Alaska

Data.gov (United States)

National Oceanic and Atmospheric Administration, Department of Commerce — The Climate Prediction Center (CPC) issues a series of thirteen probabilistic three-month precipitation outlooks for the United States. CPC issues the thirteen...

Climate Prediction Center (CPC) Three Month Probabilistic Temperature Outlook for the Contiguous United States and Alaska

Data.gov (United States)

National Oceanic and Atmospheric Administration, Department of Commerce — The Climate Prediction Center (CPC) issues a series of thirteen probabilistic three-month temperature outlooks for the United States. CPC issues the thirteen...

Macrorrealismo fenomenológico e campos-experiência

Directory of Open Access Journals (Sweden)

Renato Schaeffer

1995-01-01

Full Text Available Este artigo critica a concepção predominante, representacionista-neurofisicalista sobre a percepção sensorial. Introduz a noção de "campo-experiência" na tentativa de tratamento ontológico dos dados fenomenológicos da experiência. A idéia geral é que a experiência visual, por exemplo, seria ontologicamente algo assim como um campo-experiência de intencionalidade visual, que se estende por sobre e entre o sistema nervoso central do sujeito da experiência e o objeto distai da visão. Chamo esta posição de macrorrealismo fenomenológico, em contraste com o microrrealismo científico. Qualidades da fenomenalidade não estão subjetivamente dentro do cérebro, mas objetivamente dentro de campos-experiência perceptuais extra-encefálicos, ou, como dizemos, lá fora no mundo. Algumas conseqüências específicas do macrorrealismo fenomenológico são apresentadas.

Supplement to the annual energy outlook 1994

Energy Technology Data Exchange (ETDEWEB)

NONE

1994-03-01

This report is a companion document to the Annual Energy Outlook 1994 (AEO94), (DOE/EIA-0383(94)), released in Jan. 1994. Part I of the Supplement presents the key quantitative assumptions underlying the AEO94 projections, responding to requests by energy analysts for additional information on the forecasts. In Part II, the Supplement provides regional projections and other underlying details of the reference case projections in the AEO94. The AEO94 presents national forecasts of energy production, demand and prices through 2010 for five scenarios, including a reference case and four additional cases that assume higher and lower economic growth and higher and lower world oil prices. These forecasts are used by Federal, State, and local governments, trade associations, and other planners and decisionmakers in the public and private sectors.

Thoroughly Applying Scientific Outlook on Development Implementing Sustainable Development Strategy in Higher Vocational Colleges

Science.gov (United States)

Li, Zhi; Wang, Youhua

2008-01-01

To make breakthroughs, obtain further development, and win in the fierce competition, higher vocational colleges must apply scientific outlook on development, set up students-and-teachers oriented educational concept, enhance connotation construction, create competition advantages so as to fully improve education and teaching quality and realize…

Model Forecast Skill and Sensitivity to Initial Conditions in the Seasonal Sea Ice Outlook

Science.gov (United States)

Blanchard-Wrigglesworth, E.; Cullather, R. I.; Wang, W.; Zhang, J.; Bitz, C. M.

2015-01-01

We explore the skill of predictions of September Arctic sea ice extent from dynamical models participating in the Sea Ice Outlook (SIO). Forecasts submitted in August, at roughly 2 month lead times, are skillful. However, skill is lower in forecasts submitted to SIO, which began in 2008, than in hindcasts (retrospective forecasts) of the last few decades. The multimodel mean SIO predictions offer slightly higher skill than the single-model SIO predictions, but neither beats a damped persistence forecast at longer than 2 month lead times. The models are largely unsuccessful at predicting each other, indicating a large difference in model physics and/or initial conditions. Motivated by this, we perform an initial condition sensitivity experiment with four SIO models, applying a fixed -1 m perturbation to the initial sea ice thickness. The significant range of the response among the models suggests that different model physics make a significant contribution to forecast uncertainty.

Physical activity: does environment make a difference for tension, stress, emotional outlook, and perceptions of health status?

Science.gov (United States)

Puett, Robin; Teas, Jane; España-Romero, Vanesa; Artero, Enrique Garcia; Lee, Duck-chul; Baruth, Meghan; Sui, Xuemei; Montresor-López, Jessica; Blair, Steven N

2014-11-01

The importance of physical activity for health is well-established. Questions remain whether outdoor exercise additionally benefits overall mental and physical well-being. Using cross-sectional data from the Aerobics Center Longitudinal Study, we examined relationships of physical activity environment (PAE) with reported tension, stress, emotional outlook, and health. 11,649 participants were included. 18% exercised indoors, 54% outdoors, and 28% in both. Participants who exercised partially or entirely outdoors exercised more. In fully adjusted models, for women combined PAE was protective for worse emotional outlook (OR: 0.72; 95% CI: 0.52-0.98). Combined PAE was also protective for reported poor health (OR for women: 0.63; 95% CI: 0.44-0.91; OR for men: 0.75; 95% CI: 0.61-0.92). Amount of physical activity modified PAE relationships with outcomes. Combined and outdoor PAE were more consistently protective for worse outcomes among high activity participants. Regardless of PAE, better outcomes were observed in active versus inactive participants. The current study suggests addition of outdoor PAE may be linked with better stress management, outlook and health perceptions for more active populations, whereas indoor PAE may be more important for low active populations. Further research should examine the order of causation and whether type of outdoor PAE (eg, urban, natural) is important.

Children’s E-books are Born: How E-books for Children are Leading E-book Development and Redefining the Reading Experience

Directory of Open Access Journals (Sweden)

Kathleen Schreurs

2013-12-01

Full Text Available Children’s e-books waited to emerge until technology could support their advanced requirements. Recent technologies such as colour e-readers and tablets like Apple’s iPad provide support for heavy visual content and opportunities for interactivity. E-books for children have grown in availability and popularity and now include puzzles, games, music, video, and audio features that boost narratives and create a unique reading experience that is further from print than ever before. This article positions e-books for children as leaders in e-book development. It reviews concepts, practices, and scholarship in the area of e-books for children and highlights issues with definitions and research caused by the rapid growth of enhanced and interactive e-books. There is little argument among scholars and practitioners that the reading experience is changing, and the new generation of readers may have different opinions, assumptions, and preferences for the meanings of ‘book’ and ‘reading’. Managing these shifts in the reading experience, which is still strongly tied to notions from print culture, is an important role for LIS scholars, librarians, educators, and parents. Recent research on e-books for children focuses largely on literacy and education. Little attention has been paid to if and why children enjoy the e-reading experience. Additionally, the majority of current research examines children’s e-reading from an adult perspective with most surveys and interviews consulting parent participants and not children. An examination of relevant research as well as literature on the history and conceptualization of e-books and reading as an evolving experience reveals that, from new technologies to new experiences and new definitions, e-books for children are pushing toward the future of reading.

Solar rooftop in India: Policies, challenges and outlook

Directory of Open Access Journals (Sweden)

Malti Goel

2016-07-01

Full Text Available Solar photovoltaic rooftop has emerged as a potential green technology to address climate change issues by reducing reliance on conventional fossil fuel based energy. With a strong commitment to increase the renewable sources based energy capacity to 175 GW by 2022, India has a target to install 100 GW of solar energy capacity. Of this 40 GW would be the share of grid connected solar PV rooftop. This paper examines global growth in solar energy, world's major rooftop installed capacity countries' policies and solar rooftop policy instruments in India. The current Indian goals, issues & challenges in achieving them and trends in further development are discussed. Keywords: Solar energy, India, Rooftop PV, Policies, Outlook

Office Machine and Computer Occupations. Reprinted from the Occupational Outlook Handbook, 1978-79 Edition.

Science.gov (United States)

Bureau of Labor Statistics (DOL), Washington, DC.

Focusing on office machine and computer occupations, this document is one in a series of forty-one reprints from the Occupational Outlook Handbook providing current information and employment projections for individual occupations and industries through 1985. The specific occupations covered in this document include business machine repairers,…

Air and Water Transportation Occupations. Reprinted from the Occupational Outlook Handbook, 1978-79 Edition.

Science.gov (United States)

Bureau of Labor Statistics (DOL), Washington, DC.

Focusing on air and water transportation occupations, this document is one in a series of forty-one reprints from the Occupational Outlook Handbook providing current information and employment projections for individual occupations and industries through 1985. The specific occupations covered in this document include civil aviation workers, air…

Original Sin and T. E. Hulme's Aesthetics

Science.gov (United States)

Kishler, Thomas C.

1976-01-01

T. E. Hulme, a vigorous opponent of romanticism in art, poetry, and philosophy, insisted that the underlying flaw of the romantic view was its rejection of the dogma of Original Sin and the fall of man. His views are explored for the significant bearing they have on the development of aesthetic insight and indirectly on value and outlook.…

Why a NESSiE-like experiment at SBL is needed?

OpenAIRE

Pasqualini, Laura

2015-01-01

The NESSiE experiment is designed to perform an accurate measurement of muon-neutrino disappearance at small L/E, in order to severely constrain models with more than three-standard neutrinos, or even determine for the first time the presence of a new kind of neutrino oscillation. NESSiE is a Short-Baseline experiment with magnetic spectrometers at two different sites on the FNAL-Booster neutrino beam. The experiment would allow to definitively solve the existing tension of the muon-neutrino ...

An Update to the Budget and Economic Outlook: 2014 to 2024

Science.gov (United States)

2014-08-01

line) reflect the data available and projec- tions made before July 30. U.S. dollar and the currencies of major U.S. trading part- ners using shares of...U.S. trade as weights) in 2015 and later years will reduce the foreign- currency price of U.S. exports and increase the domestic price of U.S. imports...UPDATE TO THE BUDGET AND ECONOMIC OUTLOOK: 2014 TO 2024 AUGUST 2014 CBOEconomic Projections The economic projections were prepared by the Macroeconomic

Results from the first cycle of the PWR crud deposition test (IFA-665.1)

International Nuclear Information System (INIS)

Bennett, Peter

2004-03-01

The main objective of IFA-665.1 is to deposit crud on fuel rods operating under PWR thermal-hydraulic and water chemistry conditions, and to measure the resulting power reduction due to incorporation of boron into the crud. The test has operated for 160 days at power. Water chemistry conditions were 3.15 ppm LiOH and 1400 ppm boron (pH 300 =7.0). The coolant inlet temperature was 290/294 C, with sub-cooled nucleate boiling along the upper half of the fuel bundle. This report presents the results from the first cycle of operation. Three methods have been used to attempt to accelerate crud formation: (i) injection of simulated crud particles (NiFe 2 O 4 ); (ii) pH transients (reduction of pH 300 from 7.0 to 6.0 for periods of 48 hours); and (iii) oxygen addition transients. While the pH transients resulted in movement of large amounts of corrosion products around the loop, no significant deposition onto the fuel surfaces was measured. Comparison of the heat fluxes in IFA-665 with those in previous tests in which crud deposition has occurred does not clearly identify reasons for the lack of crud formation, although it is noted that higher heat fluxes may be required. In addition, the relatively benign boiling conditions in the current test (small void fraction with no detached voidage) may partly explain the absence of crud formation. For the second cycle of the test, changes will be made to the water chemistry to attempt to increase the concentrations of dissolved and colloidal Fe and Ni in the test rig, such that a continuous (Fe + Ni) level of 100 ppb will be targeted, with short-term concentrations of colloids of up to 500 ppb. (Author)

Outlook for Noth American natural gas supplies

International Nuclear Information System (INIS)

Kuuskraa, V.A.

1995-01-01

The underlying resource base for North America natural gas is large, sufficient for nearly 100 years of current consumption. As such, the issues are not the size of the resource, but how to convert this resource into economically competitive supply. The key questions are: Will the cost (price) of natural gas remain competitive? What is the status of near-term deliverability? Will there be enough supply to meet growing demand? These economic and market issues frame the outlook for gas supplies in North America. Most importantly, they will determine how natural gas emerges from its competition for markets with other fuels and electricity. The paper addresses these questions by examining: (1) the underlying nature of the natural gas resource base; (2) the current status and trends in deliverability; and, (3) the potential of new technologies for producing gas more cost-effectively. (author)

Short-term energy outlook, quarterly projections, second quarter 1998

Energy Technology Data Exchange (ETDEWEB)

NONE

1998-04-01

The Energy Information Administration (EIA) prepares quarterly short-term energy supply, demand, and price projections. The details of these projections, as well as monthly updates, are available on the Internet at: www.eia.doe.gov/emeu/steo/pub/contents.html. The paper discusses outlook assumptions; US energy prices; world oil supply and the oil production cutback agreement of March 1998; international oil demand and supply; world oil stocks, capacity, and net trade; US oil demand and supply; US natural gas demand and supply; US coal demand and supply; US electricity demand and supply; US renewable energy demand; and US energy demand and supply sensitivities. 29 figs., 19 tabs.

A retrospective study of the impact of a telephone alert service (Healthy Outlook) on hospital admissions for patients with chronic obstructive pulmonary disease.

Science.gov (United States)

Sarran, Christophe; Halpin, David; Levy, Mark L; Prigmore, Samantha; Sachon, Patrick

2014-10-23

Healthy Outlook is a service delivered by the UK Met Office directly to patients with chronic obstructive pulmonary disease (COPD) that has been in place since 2006. Its objective is to reduce the severity and length of COPD exacerbations, hence improving the quality of life and life expectancy. To assess the effect of the Healthy Outlook service on hospital admission rates of all general practitioners that have used the service. Control practices were selected for each of the 661 participating practices. The number of hospital admissions for each practice was extracted from the Hospital Episode Statistics database. The differences in admission rates per practice between the first year of use of the Healthy Outlook service and the previous year were compared by paired t-test analyses. For admissions with a primary diagnosis of COPD, the difference between participating and control practices was -0.8% (95% confidence interval (CI)=-1.8 to 0.2%; P=0.13). For admissions with a primary or co-morbid diagnosis of COPD, the difference was -2.3% (95% CI=-4.2 to -0.4%; P=0.02). Participation in the Healthy Outlook service reduces hospital admission rates for patients coded on discharge with COPD (including co-morbid).

U.S. gas outlook: A better year ahead

International Nuclear Information System (INIS)

Parent, L.

1996-01-01

Considering the mixed bag of factors affecting the US gas industry--restructuring, better prices, hopefully better margins, higher production, better drilling in some locations and some iffy stuff in the regulatory scene--the overall analysis is for a generally better year. After an extended period of low prices, the recent price surge is a welcome change. While the price roller coaster will probably continue, there should be, on the average, a $0.15--0.20 per Mcf improvement over 1995. Gas prices and the futures market are discussed further in the paper. Other conclusions developed in this article to support a basically optimistic outlook overview include: supply/demand; gas well drilling; entrance of electric power; integrated seamless pipeline networks; capacity turnback; and Canada/Mexico factors

Outlook with conservative treatment of peptic oesophageal stricture.

Science.gov (United States)

Ogilvie, A L; Ferguson, R; Atkinson, M

1980-01-01

In order to assess the outlook for patients with peptic oesophageal strictures treated by Eder Puestow dilatation at fibreoptic endoscopy, 50 patients were followed up for periods ranging from nine months to four years. Twenty patients (40%) required only a single dilatation, and the remaining 30 (60%) required multiple dilatations. The frequency of dilatation tended to decrease with time. There was one death attributable to the procedure. Two patients developed an adenocarcinoma at the site of the stricture. We conclude that conservative management of peptic oesophageal stricture combining the use of dilatation at fibreoptic endoscopy with medical measures to control gastro-oesophageal reflux offers a relatively safe means of providing symptomatic relief, maintaining nutrition, and allowing the patient an acceptable quality of life. PMID:7364314

Open-Rate Controlled Experiment in E-Mail Marketing Campaigns

Directory of Open Access Journals (Sweden)

Antun Biloš

2016-06-01

Full Text Available Purpose – The main purpose of this paper is to test the controlled experiment (A/B split methodology in B2C oriented e-mail marketing campaigns. Design/Methodology/Approach – E-mail marketing techniques have been a substantial part of e-marketing methodology since the early Internet days of the mid-1990s. From the very beginning of Internet utilization for business purposes, e-mail was one of the most widely used communication techniques in B2B and B2C markets alike. Due to high volumes of spamming and progression of online communication clutter, some practitioners began to question the usability of e-mail as a marketing communication channel, while others embarked on working on improving the message itself. Efforts were invested into improving message quality, as well as into better understanding user expectations. One of the most commonly used techniques to test specific e-mail message elements is the controlled experiment. Findings and implications – This paper explores several types of controlled experiments in a specific Croatian B2C market. Tests were run to determine subscriber behavior towards several newsletter components, including sending time, sending day, sender’s name, and subject line. Open and click rates for tested campaigns, and several other metrics were investigated using MailChimp software. An N − 1 two-proportion test using an adjusted Wald confidence interval around the difference in the proportions was used for comparing the open-rate measure in the controlled experiments between subjects. Limitation – Controlled experiments (A/B split tests showed a lot of potential as a way of measuring behavior and preferences of subscribers, although several apparent limitations (the data-set scope, comparability issues indicated a clear need for standardization on a managerial and scientific level. Originality – This paper provides an up-to-date e-mail marketing effectiveness literature review, describes and tests the

E-36: First Proto-Megascience Experiment at NAL

Energy Technology Data Exchange (ETDEWEB)

Pronskikh, Vitaly S. [Fermilab

2016-03-01

E-36, an experiment on small angle proton-proton scattering, began testing equipment in the National Accelerator Laboratory’s newly achieved 100-GeV beam on February 12, 1972, marking the beginning of NAL’s experimental program. This experiment, which drew collaborators from NAL, Joint Institute for Nuclear Research (JINR at Dubna, USSR), the University of Rochester (Rochester, New York) and Rockefeller University (New York City) was significant not only as a milestone in Fermilab’s history but also as a model of cooperation between the East and West at a time when Cold War tensions still ran high. An examination of the origin, operation, and resolution of E-36 and the chain of experiments it spawned reveals the complex interplay of science and politics that drove these experiments as well as seeds of the megascience paradigm that has come to dominate high-energy physics research since the 1970s.

Charged particle multiplicity distributions in e+e--annihilation processes in the LEP experiments

International Nuclear Information System (INIS)

Shlyapnikov, P.V.

1992-01-01

Results of studies of the charged particle multiplicity distributions in the process of e + e - -annihilation into hadrons obtained in experiments at LEP accelerator in CERN are reviewed. Universality in energy dependence of the average charged particle multiplicity in e + e - and p ± p collisions, evidence for KNO-scaling in e + e - data, structure in multiplicity distribution and its relation to the jet structure of events, average particle multiplicities or quark and gluon jets, 'clan' picture and other topics are discussed. 73 refs.; 20 figs.; 3 tabs

E143 experiment. Shower counter calibration

International Nuclear Information System (INIS)

Fonvieille, H.; Grenier, P.

1994-01-01

The calibration procedure for the shower counters used in the E143 experiment is described. It has been developed during january 1994 in view of being used for the quick analysis. The method is explained and the results obtained on a given run are presented. (author)

Annual energy outlook 1999, with projections to 2020

Energy Technology Data Exchange (ETDEWEB)

NONE

1998-12-01

The Annual Energy Outlook 1999 (AEO99) presents midterm forecasts of energy supply, demand, and prices through 2020 prepared by the Energy Information Administration (EIA). The projections are based on results from EIA`s National Energy Modeling System (NEMS). The report begins with an Overview summarizing the AEO99 reference case. The next section, Legislation and Regulations, describes the assumptions made with regard to laws that affect energy markets and discusses evolving legislative and regulatory issues. Issues in Focus discusses current energy issues--the economic decline in East Asia, growth in demand for natural gas, vehicle emissions standards, competitive electricity pricing, renewable portfolio standards, and carbon emissions. It is followed by the analysis of energy market trends. The analysis in AEO99 focuses primarily on a reference case and four other cases that assume higher and lower economic growth and higher and lower world oil prices than in the reference case. Forecast tables for these cases are provided in Appendixes A through C. Appendixes D and E present a summary of the reference case forecasts in units of oil equivalence and household energy expenditures. The AEO99 projections are based on Federal, State, and local laws and regulations in effect on July 1, 1998. Pending legislation and sections of existing legislation for which funds have not been appropriated are not reflected in the forecasts. Historical data used for the AEOI99 projections were the most current available as of July 31, 1998, when most 1997 data but only partial 1998 data were available.

The Influence of Experience, Ability and Interest on e-Learning Effectiveness

Science.gov (United States)

Haverila, Matti; Barkhi, Reza

2009-01-01

The purpose of this paper is to report the findings of a research conducted to evaluate the effect of learning preconceptions, prior e-learning experience, ability and interest of students on their perceptions regarding the process of e-learning. We study the effectiveness of e-learning as it relates to the level of e-learning experience. The…

HLW disposal in Germany - R and D achievements and outlook

International Nuclear Information System (INIS)

Steininger, W.

2006-01-01

The paper gives a brief overview of the status of R and D on HLW disposal. Shortly addressed is the current nuclear policy. After describing the responsibilities regarding R and D for disposing of heat-generating high-level (HLW) waste (vitrified waste and spent fuel), selected projects are mentioned to illustrate the state of knowledge in disposing of waste in rock salt. Participation in international projects and programs is described to illustrate the value for the German concepts and ideas for HLW disposal in different rock types. Finally, a condensed outlook on future activities is given. (author)

The outlook for crude oil supply and demand in Australia and its energy policy implications

International Nuclear Information System (INIS)

1991-08-01

Australia's oil reserves and production have contributed significantly to national economic prosperity and growth since the first large scale discoveries in Bass Strait in the 1960s. As a finite, non-renewable resource, the reserves ultimately must decline. In 1988 the forecast was that Australia's oil production would begin to decline in the mid 1990s and then rapidly tail off by the late 1990s. With this in mind, AMEC Ministers agreed in 1988 that a Working Group should review the energy policy implications of the forecast decline in the production of petroleum. The Working Group's findings are presented in this booklet. Chapter 2 examines the outlook for demand for petroleum products in Australia until 2005. This Chapter is based on current Australian Bureau of Agricultural and Resource Economics (ABARE) forecasts as well as savings in fuel demand that are potentially available from fuel efficiency and fuel switching measures. Chapter 3, which includes BMR's recently revised petroleum production forecasts, looks at the outlook for crude oil and condensate production, also to 2005. Chapter 4 discusses the range of government initiatives already in place to foster the efficient exploration and production of petroleum in Australia. This Chapter also examines the outlook for Australian alternative liquid fuels. Chapter 5, which is based on analysis by ABARE, broadly examines the possible macroeconomic implications of declining oil production for Australia while Chapter 6 examines the issue of energy security and in particular its relationship with oil self sufficiency. Finally, Chapter 7 identifies some energy policy considerations and recommendations arising out of the Working Group's analysis. 7 tabs, 3 figs

The outlook for North American supply

International Nuclear Information System (INIS)

Coppens, J.

1998-01-01

An overview of North American natural gas assets and operations is presented, along with an outlook for natural gas demand, supply, and prices. Future natural gas demand was considered in the light of 1997 natural gas consumption by the residential, commercial, industrial and utility sectors, and an attempt was made to provide answers to questions such as the reasonableness of projections 30 Tcf annual demand, and the availability of gas resources or gas infrastructure to sustain demand of this magnitude. According to projections by the Electric Industry Association, 65 per cent of gas demand growth is for electric power generation. Natural gas supply on a regional and continental basis was reviewed and the implications for production were assessed. The overall conclusion was that resource supply will not be the constraining factor since there is plenty of gas, and the demand is regionally dispersed. However, if the demand for power generation comes anywhere near the high consumption forecast of 100 to 150 GW, a huge amount of gas-fired power plants would have to be built. Expansion of this magnitude would not be inexpensive

HVO applications and practical experiences; HVO Anwendungen und Praxiserfahrungen

Energy Technology Data Exchange (ETDEWEB)

Doerr, Sebastian [Neste Oil Corporation, Espoo (Finland); Honkanen, Markku; Mikkonen, Seppo

2012-07-01

Since 2007 Neste Oil Finland is producing renewable Diesel based on vegetable oils. The key process step is hydro treatment, products are called HVO = Hydrotreated Vegetable Oils. Process and main product performance will be introduced. Main focus is on applications and experience from several field tests. The presentation will give an overview and short outlook to future applications and challenges. (orig.)

Radioactive waste storage: historical outlook and socio technical analysis

International Nuclear Information System (INIS)

Petit, J.C.

1993-07-01

The radioactive waste storage remains, in most of the industrialized concerned countries, one extremely debated question. This problem may, if an acceptable socially answer is not found, to create obstacles to the whole nuclear path. This study aim was to analyze the controversy in an historical outlook. The large technological plans have always economical, political, sociological, , psychological and so on aspects, that the experts may be inclined to neglect. ''Escape of radioactivity is unlikely, as long as surveillance of the waste is maintained, that is, as long as someone is present to check for leaks or corrosion or malfunctioning of and to take action, if any of these occur. 444 refs., 32 figs

Venezuela natural gas outlook

International Nuclear Information System (INIS)

Silva, P.

1991-01-01

This paper reports on the natural gas outlook for Venezuela. First of all, it is very important to remember that in the last few years we have had frequent and unforeseen changes in the energy, ecological, geopolitical and economical fields which explain why all the projections of demand and prices for hydrocarbons and their products have failed to predict what later would happen in the market. Natural gas, with its recognized advantages over other traditional competitors such as oil, coal and nuclear energy, is identified as the component that is acquiring more weight in the energy equation, with a strengthening projection, not only as a resource that covers demand but as a key element in the international energy business. In fact, natural gas satisfies 21% of overall worldwide energy consumption, with an annual increase of 2.7% over the last few years, which is higher than the global energy growth of other fossil fuels. This tendency, which dates from the beginning of the 1980's, will continue with a possibility of increasing over the coming years. Under a foreseeable scenario, it is estimated that worldwide use of natural gas will increase 40% over the next 10 years and 75% on a longer term. Specifically for liquid methane (LNG), use should increase 60% during this last decade. The LPG increase should be moderate due to the limited demand until 1995 and to the stable trends that will continue its use until the end of this century

Understanding Firms' Inflation Expectations Using the Bank of Canada's Business Outlook Survey

OpenAIRE

Richards, Simon; Verstraete, Matthieu

2016-01-01

Inflation expectations are a key determinant of actual and future inflation and thus matter for the conduct of monetary policy. We study how firms form their inflation expectations using quarterly firm-level data from the Bank of Canada's Business Outlook Survey, spanning the 2001 to 2015 period. The data are aggregated to construct an inflation expectations index. Results based on the index suggest that expectations are not consistent with the rationality assumption but are, still, more comp...

SciTil Detector for the PANDA experiment at FAIR

Science.gov (United States)

Suzuki, Ken; Gruber, Lukas; Brunner, Stefan; Marton, Johann; Orth, Herbert; Schwarz, Carsten; Scitil/Panda Collaboration

2014-09-01

The PANDA experiment at the Facility for Antiproton and Ion Research (FAIR) is a fixed-target experiment installed in a antiproton storage ring (HESR) in the energy range of 1 GeV to 15 GeV. FAIR is being build on the area of the GSI Helmholtzzentrum für Schwerionenforschung in Darmstadt, Germany. The universal PANDA detector together with the HESR enables to study fundamental questions of hadron and nuclear physics, e.g. gluonic excitations, the physics of strange and charm quarks and nucleon structure. The SciTil detector is a barrel time-of-flight detector and is a relatively new subcomponent to the system. The demand arose in order to provide a securer event tagging at the event rates of 20-100 MHz instantaneous event rate, to improve a particle identification capability of relatively low momentum particles, and to allow a faster track finding with pattern recognition. The beam test of the SciTil prototype detector in January 2014 showed a promising result. We report the status and outlook of the project.

Genotossicologia di Nanomateriali Ingegnerizzati (ENMs): l’esperienza e i risultati di un confronto di analisi genome-wide in lievito e in pianta.

OpenAIRE

Pasquali, Francesco

2017-01-01

I nanomateriali ingegnerizzati (ENMs) sono strutture nell’ordine degli 1-100 nm, e sono caratterizzati da proprietà, dovute alle loro ridotte dimensioni e alla reattività superficiale, che li rendono adatti ad un ampia gamma di applicazioni industriali. Le nanotecnologie sono un’industria in rapida crescita, con un valore di mercato che si prevede raggiungerà i 49 miliardi di dollari entro il 2017 (Nanotechnology Market Outlook 2017, RNCOS, Maggio 2013). A causa della loro ampia diffusion...

Indian Wind Energy Outlook 2011

International Nuclear Information System (INIS)

Shukla, Shruti; Kharul, Rajendra; Sawyer, Steve; Patel, Narendra; Pullen, Angelika; Gorate, Devanand; Raghu, V.

2011-12-01

This report is a valuable tool for members of the wind industry and policy makers alike to learn about the market opportunities and the legal and regulatory framework in India. In addition, it gives us insights into the challenges going forward and offers suggestions for overcoming remaining hurdles for wind power development. According to the outlook 65.2 GW of wind power could be installed in Indian by 2020, up from 13.1 GW at the end of 2010. This would attract around USD 10.4bn of annual investment to the sector, and create 170,000 'green collar' jobs in manufacturing, project development, installation, operation, maintenance, consulting etc. At the same time, it would save 174 tons of CO2 every year. By 2030, the installed capacity could reach as much as 160.7 GW. In order to fully exploit the indigenous energy source at its doorstep, the Indian government needs to address several challenges and barriers that are holding back development. This includes a national renewable energy law, incentives for repowering, and rapid up-scaling of grid infrastructure to transport increasing amounts of wind power to the demand centres. It highlights the key role wind power could play in fueling India's growing energy demand, by delivering substantial amounts of clean energy.

Sala de descanso em empresas de telemarketing e qualidade de vida

OpenAIRE

Victor Hugo de Almeida

2008-01-01

Para sistematizar a produção, majorar a produtividade, suprimir gastos e economizar tempo, empresas aderiram ao telemarketing, principal atividade terceirizada no Brasil e uma das maiores empregadoras do país (665 mil teleoperadores). Todavia, doenças desencadeadas pela atividade laboral são freqüentes em teleoperadores, fato que tem motivado empresas a buscarem recursos no próprio ambiente laboral, como a implementação de uma sala de descanso para seus funcionários, para atender ao recém apr...

Parents' experience of unintended childbearing: A qualitative study of factors that mitigate or exacerbate effects.

Science.gov (United States)

Kavanaugh, Megan L; Kost, Kathryn; Frohwirth, Lori; Maddow-Zimet, Isaac; Gor, Vivian

2017-02-01

Births resulting from an unintended pregnancy affect individuals differentially, and some may experience more negative consequences than others. In this study, we sought to describe the mechanisms through which the severity of effects may be mitigated or exacerbated. We conducted in-depth interviews with 35 women and 30 men, all with a youngest child born resulting from an unintended pregnancy, in two urban sites in the United States. Respondents described both negative and positive effects of the child's birth in the areas of school; work and finances; partner relationships; personal health and outlook on life trajectories. Mechanisms through which unintended pregnancies mitigated or exacerbated certain effects fell at the individual (e.g. lifestyle modification), interpersonal (e.g. partner support) and structural (e.g. workplace flexibility) levels. These qualitative findings deepen understanding of the impact of unintended childbearing on the lives of women, men and families. Copyright © 2016 Elsevier Ltd. All rights reserved.

The simulation for the ATLAS experiment Present status and outlook

CERN Document Server

Rimoldi, A; Gallas, M; Nairz, A; Boudreau, J; Tsulaia, V; Costanzo, D

2004-01-01

The simulation program for the ATLAS experiment is presently operational in a full OO environment. This important physics application has been successfully integrated into ATLAS's common analysis framework, ATHENA. In the last year, following a well stated strategy of transition from a GEANT3 to a GEANT4-based simulation, a careful validation programme confirmed the reliability, performance and robustness of this new tool, as well as its consistency with the results of previous simulation. Generation, simulation and digitization steps on different sets of full physics events we retested for performance. The same software used to simulate the full the ATLAS detector is also used with testbeam configurations. Comparisons to real data in the testbeam validate both the detector description and the physics processes within each subcomponent. In this paper we present the current status of ATLAS GEANT4 simulation, describe the functionality tests performed during its validation phase, and the experience with distrib...

The Mu2e experiment at Fermilab

International Nuclear Information System (INIS)

Donghia, R.

2017-01-01

The Mu2e experiment searches for the neutrinoless muon to electron conversion in the field of a nucleus, which is a charged lepton flavor violating process. The goal of the experiment is to reach a single event sensitivity of 2.8×10"−"1"7, setting an upper limit on the muon conversion rate of 6.7 × 10"−"1"7. This corresponds to a four order of magnitude improvement with respect to the existing limits.

Redes Sociais e as Gerações X e Y: Disseminação e Compartilhamento de Experiências de Turismo / Social Networks and Generations X and Y: Dissemination and Tourism Experience Sharing

Directory of Open Access Journals (Sweden)

Antônio Claret Guerra

2015-07-01

Full Text Available Este artigo tem como objetivo identificar a contribuição de redes sociais on-line (OSN para o processo de disseminação e compartilhamento de experiências de turismo das gerações X e Y. A pesquisa realizada tem natureza exploratória e abordagem qualitativa, sendo os dados obtidos por entrevistas semiestruturadas. A análise de conteúdo (Bardin, 2009 foi a técnica usada para a análise dos dados coletados. Procurou-se, dessa forma, investigar vários aspectos ligados ao tema proposto: se as OSN são uma inovação tecnológica que impactou o setor de viagens; sua importância para o desenvolvimento e manutenção de relacionamentos das gerações X e Y com mídias sociais on-line; a interface de cocriação de produtos turísticos; sua contribuição para a formação de preferências e intenções de compra. Entre as conclusões do estudo, verifica-se que os entrevistados concordam que as OSN impactam o setor e o consumidor busca benefícios ao utilizá-las, destacando a praticidade, comodidade, segurança, troca de informações e experiências. Foi citado, ainda, que as OSN divulgam roteiros turísticos competitivos e acessíveis, que antes da era digital eram relativamente pouco conhecidos do grande público. Palavras-chave: Turismo. Experiência Turística. Redes Sociais On-line. Gerações X e Y. Social Networks and Generations X and Y: Dissemination and Tourism Experience Sharing - This article aims to identify the on-line social network (OSN contribution to the X and Y generations´ tourism experiences of dissemination and sharing process. The content analysis (Bardin, 2008 was the technique used to analyses the data obtained through semi structured interviews. It was sought to investigate the OSN as technological innovation, its significance for the X and y generations relationships development, co-creation and formation of purchase intentions interface. Among the conclusions is the actual benefit of the OSN impact on the

Collaborative e-Science Experiments and Scientific Workflows

NARCIS (Netherlands)

Belloum, A.; Inda, M.A.; Vasunin, D.; Korkhov, V.; Zhao, Z.; Rauwerda, H.; Breit, T.M.; Bubak, M.; Hertzberger, L.O.

2011-01-01

Recent advances in Internet and grid technologies have greatly enhanced scientific experiments' life cycle. In addition to compute- and data-intensive tasks, large-scale collaborations involving geographically distributed scientists and e-infrastructure are now possible. Scientific workflows, which

Neutrino oscillation: status and outlooks

International Nuclear Information System (INIS)

Nedelec, P.

1994-01-01

Whether the neutrinos are massive or not is one of the most puzzling question of physics today. If they are massive, they can contribute significantly to the Dark Matter of the Universe. An other consequence of a non-zero mass of neutrinos is that they might oscillate from one flavor to another. This oscillation process is by now the only way to detect a neutrino with a mass in the few eV range. Several neutrino experiments are currently looking for such an oscillation, in different modes, using different techniques. An overview of the experimental situation for neutrino experiments at accelerators is given. (author). 9 refs., 5 figs., 5 tabs

Psychological and Pedagogical Support of the Formation of Professional World Outlook of the University Students

Science.gov (United States)

Kirillova, Olga V.; Kirillova, Tatyana V.; Abramova, Lyudmila A.; Gavrilova, Irina V.; Vaibert, Margarita I.

2017-01-01

The research urgency is caused by necessity of the accumulation of human capital as the main factor of economic growth. The purpose of this article is to identify methods of psychological and pedagogical support of formation of professional outlook of the university students. Methodological basis of the research was the principle of acmeology,…

The Global Outlook for Small Reactors: Opportunities, Challenges and Implementation

International Nuclear Information System (INIS)

Hughes, A.

2012-01-01

The fascinating topic of small nuclear is becoming more prevalent on the nuclear agenda. The discussions are generally focused within the country of technical origin. In this presentation 'The global outlook for small reactors' Rolls-Royce along with energy business analysts Douglas-Westwood present their shared views on the global opportunities for Small Reactor deployment in the context of the wider energy market. The presentation will: provide a compressive overview of trends and dynamics relating to Small Reactors in the context of the current world energy market, identify specific Small Reactor opportunities and areas of interest, address the challenges and potential solutions for Small Reactor deployment and operation.(author).

Meson spectroscopy experiment at KEK - E/iota puzzle

International Nuclear Information System (INIS)

Tsuru, Tsuneaki

1985-01-01

Physics interests at the KEK (National Laboratory for High Energy Physics) are (1) search for exotic mesons such as glueballs (gg), meiktons (q anti q g) and multiquark states (q sup(2 - )q 2 ), (2) search for missing ordinary mesons (q anti q) and confirmation of unestablished mesons, and (3) new informations of quark contents of mesons, mixing angles of SU(3) singlet-octet and tests of conservations law. Special interest is in search for exotics such as glueballs and meiktons. (2) is a so-called meson spectroscopy experiment. This is important not only in itself but also in identifying newly discovered states as exotics because exotics have often same quantum numbers as ordinary mesons. Contents are the following: glueballs and E/iota puzzles, spectrometer system, experiments, performance of the spectrometer, physics outputs, E/iota puzzles and πI experiment, future plans. (Mori, K.)

Experiência e Utopia em Theodor W. Adorno, André Gorz e François Dubet

Directory of Open Access Journals (Sweden)

Sílvio César Camargo

2007-01-01

sociedade contemporânea. Conceito bastante complexo quanto a sua possibilidade de apreensão pela sociologia, experiência se refere tanto a problemas relativos ao conhecimento e suas possibilidades, mas também para as possibilidades de transformação da sociedade. Entende-se que há três teóricos da sociedade contemporânea, que partindo de bases epistemológicas diferentes, problematizam a emancipação humana a partir de uma singular atenção ao conceito de experiência. Theodor W. Adorno, André Gorz e François Dubet representam três formas de pensamento sobre a sociedade bastante diferentes, mas que possuem em comum o interesse normativo, e seu confronto nos mostra a importância do conceito de experiência para a compreensão da sociedade contemporânea e para pensar-se a utopia.

Aluminum, Iron and Steel, and Foundry Industries. Reprinted from the Occupational Outlook Handbook, 1978-79 Edition.

Science.gov (United States)

Bureau of Labor Statistics (DOL), Washington, DC.

Focusing on occupations in the various metal industries, this document is one in a series of forty-one reprints from the Occupational Outlook Handbook providing current information and employment projections for individual occupations and industries through 1985. The specific occupations covered in this document include occupations in the aluminum…

Bilayer graphene: physics and application outlook in photonics

Directory of Open Access Journals (Sweden)

Yan Hugen

2015-05-01

Full Text Available Layered materials, such as graphene, transition metal dichacogenides and black phosphorus have attracted lots of attention recently. They are emerging novel materials in electronics and photonics, with tremendous potential in revolutionizing the traditional electronics and photonics industry. Marrying layered material to the nanophotonics is being proved fruitful. With the recent emphasis and development of metasurfaces in nanophotonics, atomically thin materials can find their unique position and strength in this field. In this article, I will focus on one specific two dimensional material: bilayer graphene. Basic physics will be reviewed, such as band-gap opening, electron-phonon interaction, phonon-plasmon interaction and Fano resonances in the optical response. Moreover, I will review the application of bilayer graphene as a sensitive and fast photodetector. An outlook will be given in the final part of the paper.

The Sea Ice for Walrus Outlook: A collaboration between scientific and Indigenous communities to support safety and food security in a changing Arctic

Science.gov (United States)

Sheffield Guy, L.; Wiggins, H. V.; Schreck, M. B.; Metcalf, V. K.

2017-12-01

The Sea Ice for Walrus Outlook (SIWO) provides Alaskan Native subsistence walrus hunters and Bering Strait coastal communities with weekly reports on spring sea ice and weather conditions to promote hunter safety, food security, and preservation of cultural heritage. These reports integrate scientific and Indigenous knowledge into a co-produced tool that is used by both local and scientific communities. SIWO is a team effort led by the Arctic Research Consortium of the U.S. (ARCUS, with funding from NSF Arctic Sciences Section), with the Eskimo Walrus Commission, National Weather Service - Alaska Sea Ice Program, University of Alaska Fairbanks - International Arctic Research Center, and local observers. For each weekly outlook, the National Weather Service provides location-specific weather and sea ice forecasts and regional satellite imagery. Local observations of sea ice, weather, and hunting conditions are provided by observers from five Alaskan communities in the Bering Strait region: Wales, Shishmaref, Nome, Gambell, and Savoonga. These observations typically include a written description of conditions accompanied by photographs of sea ice or subsistence activities. Outlooks are easily accessible and provide a platform for sharing of knowledge among hunters in neighboring communities. The opportunity to contribute is open, and Indigenous language and terms are encouraged. These observations from local hunters and community members also provide a valuable tool for validation of weather forecasts, satellite products, and other information for scientists. This presentation will discuss the process, products, and mutually beneficial outcomes of the Sea Ice for Walrus Outlook.

North American natural gas storage, market and price outlook

International Nuclear Information System (INIS)

George, R.

1999-01-01

A series of overhead viewgraphs accompanied this presentation which dealt with the fundamental factors and short-term considerations that will impact Canadian and U.S. natural gas pricing. The short-term pricing outlook and some transportation issues were also highlighted. The major transportation issues for 1999/2000 are: (1) Nova tolling, (2) incentive tolling and negotiations, (3) decontracting, (4) pipeline project schedules, and (5) land use and environmental considerations. The major supply issues are: (1) impact of oil prices on gas drilling and production, (2) impact of merger and acquisition activity, and (3) land use and environmental considerations. The major demand issues for the same time period are: (1) greenhouse gas emissions, (2) electricity restructuring, and (3) new end-use technologies. 3 tabs., 21 figs

Delírios I – Agonia e experiência (jogos de vida e morte

Directory of Open Access Journals (Sweden)

Vinícius Nicastro Honesko

2010-07-01

Full Text Available O presente ensaio pretende expor uma idéia de agonia como jogo de vida e morte no qual imerge o artista no ato de criação. A partir das leituras e conceituações do termo jogo em Johan Huizinga e em Roger Caillois, mostra como tais idéias são importantes para compreender a experiência humana diante do incompreensível que é a morte. Aponta como a agonia inspira no poeta, principalmente na modernidade, uma distância em relação às certezas do conhecimento, implicando uma leitura etimológica do termo experiência, isto é, como ex periri, (aqui, também, jogo de vida e morte. Por fim, procura ver como os traços desse jogo – uma eterna luta – sutilmente se mostram nos pânicos de Murilo Mendes e de Paul Gauguin, artistas nos quais a consciência dessa luta é atravessada pela imagem do lugar por excelência da agonia: o Calvário.

Coal in India: current status and outlook - Panorama 2008; Le charbon en Inde: etat des lieux et perspectives - Panorama 2008

Energy Technology Data Exchange (ETDEWEB)

NONE

2008-07-01

The world cannot do without coal. This energy source covers more than one-quarter (28.4% in 2006) of all primary energy consumption and is used to generate nearly 40% of all electricity consumed worldwide. All scenarios and forecasts agree that coal consumption will be growing substantially, driven mostly by China and India. According to the IEA reference scenario (World Energy Outlook 2007), these two countries are expected to account for 82% of the increase in global coal demand by 2030. The outlook for India gives cause for concern: despite a strong domestic coal industry, it could eventually become a major importer. If so, what will the economic, industrial and environmental consequences be?.

The Outlook for Technological Change and Employment. Technology and the American Economy, Appendix Volume I.

Science.gov (United States)

National Commission on Technology, Automation and Economic Progress, Washington, DC.

Findings of a study of the nation's manpower requirements to 1975 are presented. Part I, on the employment outlook, consists of a 10-year projection of manpower requirements by occupation and by industry prepared by the Bureau of Labor Statistics and an analysis of the growth prospects and the state of fiscal policy in the United States economy as…

Oil outlook to 2020

International Nuclear Information System (INIS)

Lounnas, R.; Brennand, G.

2002-01-01

The latest oil outlook to the year 2020 is presented, using the OPEC World Energy Model (OWEM). In the reference case, the OPEC Reference Basket of seven crudes is assumed to remain within the declared price range of US dollars 22-28 per barrel, in nominal terms, for the rest of this decade, growing with inflation thereafter. World oil demand grows from 76 million barrels a day in 2000 to 89 mb/d by 2010, and to over 106 mb/d by 2020. Two-thirds of the increase in demand over this 20-year period comes from China and the developing countries. Non-OPEC production is expected to continue to increase throughout the entire forecast period, with the decline in North Sea output more than compensated by increases in the developing countries, Russia and the Caspian region. OPEC market share in the first decade is accordingly relatively stable, as increases in output are approximately matched by higher non-OPEC supply. In the following ten years, however, it becomes increasingly inevitable that OPEC market share will increase, as the net rise in non-OPEC output slows. The net investment requirement will need to cover both additional capacity and the maintenance of the existing production potential. For OPEC alone, the estimate is around 10 billion dollars a year during this period. Substantially higher or lower oil prices than the assumed values for the reference case are shown not only to generate lower OPEC export revenue, but also to be unsustainable. (Author)

Rank distributions: A panoramic macroscopic outlook

Science.gov (United States)

Eliazar, Iddo I.; Cohen, Morrel H.

2014-01-01

This paper presents a panoramic macroscopic outlook of rank distributions. We establish a general framework for the analysis of rank distributions, which classifies them into five macroscopic "socioeconomic" states: monarchy, oligarchy-feudalism, criticality, socialism-capitalism, and communism. Oligarchy-feudalism is shown to be characterized by discrete macroscopic rank distributions, and socialism-capitalism is shown to be characterized by continuous macroscopic size distributions. Criticality is a transition state between oligarchy-feudalism and socialism-capitalism, which can manifest allometric scaling with multifractal spectra. Monarchy and communism are extreme forms of oligarchy-feudalism and socialism-capitalism, respectively, in which the intrinsic randomness vanishes. The general framework is applied to three different models of rank distributions—top-down, bottom-up, and global—and unveils each model's macroscopic universality and versatility. The global model yields a macroscopic classification of the generalized Zipf law, an omnipresent form of rank distributions observed across the sciences. An amalgamation of the three models establishes a universal rank-distribution explanation for the macroscopic emergence of a prevalent class of continuous size distributions, ones governed by unimodal densities with both Pareto and inverse-Pareto power-law tails.

Status and Outlook for Building Integrated Photovoltaics (BIPV) in Relation to Educational needs in the BIPV Sector

NARCIS (Netherlands)

Tabakovic, Momir; Fechner, Hubert; Van Sark, Wilfried; Louwen, Atse; Georghiou, George; Makrides, George; Loucaidou, Eliza; Ioannidou, Monica; Weiss, Ingrid; Arancon, Sofia; Betz, Stephanie

2017-01-01

This paper reviews the present status and outlook of the building integrated photovoltaics (BIPV) market on a global and European scale. In particular, it provides a comprehensive review of the market situation and the future trends for Austria, Cyprus, France, Germany, Italy and the Netherlands

Hanford and the tri-cities economy: Review and outlook, March 1989

International Nuclear Information System (INIS)

Scott, M.J.; Belzer, D.B.; March, S.J.; Beck, D.M.; Schultz, R.W.; Harkreader, S.A.

1989-03-01

The economy of the Tri-Cities, Washington area (primarily, Benton and Franklin Counties) is in transition due to major changes in two Department of Energy programs at Hanford---the abrupt ending of the Basalt Waste Isolation Project (BWIP) in December 1987 and the placing of the N Reactor in ''cold standby'' status in February 1988. This report reviews the economic situation in the Tri-Cities during 1988 and presents forecasts for key economic indicators for 1989. This report will be updated about every six months to review the changes in the area economy and forecast the near-term outlook. 6 figs., 33 tabs

Hanford and the tri-cities economy: Review and outlook, March 1989

Energy Technology Data Exchange (ETDEWEB)

Scott, M.J.; Belzer, D.B.; March, S.J.; Beck, D.M.; Schultz, R.W.; Harkreader, S.A.

1989-03-01

The economy of the Tri-Cities, Washington area (primarily, Benton and Franklin Counties) is in transition due to major changes in two Department of Energy programs at Hanford---the abrupt ending of the Basalt Waste Isolation Project (BWIP) in December 1987 and the placing of the N Reactor in ''cold standby'' status in February 1988. This report reviews the economic situation in the Tri-Cities during 1988 and presents forecasts for key economic indicators for 1989. This report will be updated about every six months to review the changes in the area economy and forecast the near-term outlook. 6 figs., 33 tabs.

Experiment E89-044 on the Quasielastic ³He(e,e'p) Reaction at Jefferson Laboratory

Energy Technology Data Exchange (ETDEWEB)

Penel-Nottaris, Emilie [Univ. Joseph Fourier Grenoble (France)

2004-07-07

The Jefferson Lab Hall A E89-044 experiment has measured the ³He(e,e'p) reaction cross-sections. The extraction of the longitudinal and transverse response functions for the two-body break-up ³He(e,e'p)d reaction in parallel kinematics allows the study of the bound proton electromagnetic properties inside the ³He nucleus and the involved nuclear mechanisms beyond plane wave approximations.

Indian Wind Energy Outlook 2011

Energy Technology Data Exchange (ETDEWEB)

Shukla, Shruti; Kharul, Rajendra; Sawyer, Steve; Patel, Narendra; Pullen, Angelika; Gorate, Devanand; Raghu, V. (eds.)

2011-12-15

This report is a valuable tool for members of the wind industry and policy makers alike to learn about the market opportunities and the legal and regulatory framework in India. In addition, it gives us insights into the challenges going forward and offers suggestions for overcoming remaining hurdles for wind power development. According to the outlook 65.2 GW of wind power could be installed in Indian by 2020, up from 13.1 GW at the end of 2010. This would attract around USD 10.4bn of annual investment to the sector, and create 170,000 'green collar' jobs in manufacturing, project development, installation, operation, maintenance, consulting etc. At the same time, it would save 174 tons of CO2 every year. By 2030, the installed capacity could reach as much as 160.7 GW. In order to fully exploit the indigenous energy source at its doorstep, the Indian government needs to address several challenges and barriers that are holding back development. This includes a national renewable energy law, incentives for repowering, and rapid up-scaling of grid infrastructure to transport increasing amounts of wind power to the demand centres. It highlights the key role wind power could play in fueling India's growing energy demand, by delivering substantial amounts of clean energy.

Evaluation Of User Experience And Its Economics In E-Commerce

Directory of Open Access Journals (Sweden)

Praneeth Kumar Baru

2017-10-01

Full Text Available User Experience pertains to designing studying and evaluating experiences that users have while using or interacting with the system with a specific context. UX is seen as a field of study a phenomenon and as a practice as well. To understand it with an analogy justice as a phenomenon law as a field of study and a lawyers work as a practice. Evaluating the users experience can help quantify or measure to the extent to which the system is being understood or perceived the way it is supposed to be. Evaluation methods can take various forms and are categorized in this paper. Essentials of the user experience are elaborated and furthermore some quantified data is presented that discusses the role user experience in e-commerce website and also the future prospects of the e-commerce domain are briefly described.

Asia energy outlook to 2030: Impacts of energy outlook in China and India on the world

Energy Technology Data Exchange (ETDEWEB)

Komiyama, R.

2007-07-01

This paper presents an international energy outlook, focusing on an analysis of energy impacts of Asia, particularly China and India, on the world energy markets to 2030. Based on vigorous economic growth, soaring electricity demand and progressive motorisation in China and India, Asia's primary energy demand is expected to double, eventually positioning Asia as the largest energy-consuming region with largest CO{sub 2} emissions in the world. This paper also discusses energy security challenges for Asia, in particular East Asian region, where steady oil demand growth will lead to increasing dependency on imported oil from Middle East and sea lane security in the Malacca Strait. Furthermore, this paper explores various future scenarios for Asia including 'Technological Advanced Scenario' to highlight the differences in possible energy futures in Asia and its implication to the global energy market. In Technological Advanced Scenario, which assumes the stepped-up implementation of energy and environmental policies in Asian countries, Asia's primary energy demand in 2030 is expected to be 15%, or 943 Mtoe, lower than the Reference Scenario. The paper concludes that successful implementation of such an energy strategy will decrease the energy demand and greatly mitigate the growth of CO{sub 2} emissions from the energy sector. (auth)

STS operations planning - Current status and outlook for the future

Science.gov (United States)

Lee, C. M.

1981-01-01

Consideration is given to the status of Space Shuttle operations planning and outlook for the period 1982-94, with some speculations on Shuttle-related space operations early in the next century. Attention is given to the evolution of Shuttle payload capabilities over the next five years. The following list of near-earth environment factors to be exploited by the Space Shuttle is given: (1) easy control of gravity; (2) absence of atmosphere; (3) a comprehensive view of the earth's surface and atmosphere; (4) isolation of hazardous processes from earth biosphere; (5) freely available light, heat and photovoltaic power; (6) an infinite natural reservoir for the disposal of radioactive waste products; and (7) a super-cold heat sink.

Salomon: '97 E and P looking strongest in 9 years

International Nuclear Information System (INIS)

Anon.

1997-01-01

Based on companies' disclosed spending plans, 1997 is shaping up to be the strongest year-ahead outlook in 9 years, according to Salomon Bros. Inc. Salomon Bros.' conclusion stems from its 15th annual survey of worldwide oil and gas exploration and production spending. The survey, released last month, included 125 US independents, 97 Canadian companies, 103 companies outside the US and Canada, and 15 majors. Significantly, when the 15% growth experienced in 1996 is combined with the 1997 outlook, it represents the strongest indicator of 2-year activity in the past 15 years, said Salomon Bros. Double-digit spending growth is projected in all regions for 1997, the analyst said. Salomon Bros. said a higher percentage of companies' E and P budgets are being allocated to offshore projects, driven in part by attractive prospects, 3D seismic technology, and increased operational efficiencies

O Plano Real à luz da experiência mexicana e argentina

Directory of Open Access Journals (Sweden)

Paulo Nogueira Batista Jr.

1996-12-01

Full Text Available O trabalho discute os primeiros dois anos do Plano Real e em especial os seus efeitos sobre as relações externas do Brasil, à luz da experiência de programas de estabilização adotados no México, em 1988-1994, e na Argentina, desde 1991. Embora cada experiência nacional apresente as suas peculiaridades, argumenta-se que a economia brasileira vem revivendo a experiência mexicana e argentina em alguns pontos importantes, combinando sucesso no combate à inflação com acentuada e persistente apreciação cambial, elevados déficits no balanço de pagamentos em conta corrente e dependência de fluxos voláteis de capital internacional.This paper discusses the first two years of Brazil's current stabilization programme - known as the Real Plan - and in particular its effects on the country's external economic relations, in the ligth of similar stabilization programmes adopted in Mexico from 1988 to 1994 and in Argentina since 1991. Although each national experience has its peculiarities, it is shown that the Brazilian economy has been reliving the Mexican and Argentinian experience in some important respects, combining success in terms of inflation reduction, with strong and persistent exchange rate appreciation, high deficits in the balance of payments on current account and dependence on volatile international capital flows.

International Reactor Physics Experiment Evaluation (IRPhE) Project. IRPhE Handbook - 2015 edition

International Nuclear Information System (INIS)

Bess, John D.; Gullifor, Jim

2015-03-01

The purpose of the International Reactor Physics Experiment Evaluation (IRPhE) Project is to provide an extensively peer-reviewed set of reactor physics-related integral data that can be used by reactor designers and safety analysts to validate the analytical tools used to design next-generation reactors and establish the safety basis for operation of these reactors. This work of the IRPhE Project is formally documented in the 'International Handbook of Evaluated Reactor Physics Benchmark Experiments', a single source of verified and extensively peer-reviewed reactor physics benchmark measurements data. The evaluation process entails the following steps: Identify a comprehensive set of reactor physics experimental measurements data, Evaluate the data and quantify overall uncertainties through various types of sensitivity analysis to the extent possible, verify the data by reviewing original and subsequently revised documentation, and by talking with the experimenters or individuals who are familiar with the experimental facility, Compile the data into a standardized format, Perform calculations of each experiment with standard reactor physics codes where it would add information, Formally document the work into a single source of verified and peer reviewed reactor physics benchmark measurements data. The International Handbook of Evaluated Reactor Physics Benchmark Experiments contains reactor physics benchmark specifications that have been derived from experiments that were performed at nuclear facilities around the world. The benchmark specifications are intended for use by reactor designers, safety analysts and nuclear data evaluators to validate calculation techniques and data. Example calculations are presented; these do not constitute a validation or endorsement of the codes or cross-section data. The 2015 edition of the International Handbook of Evaluated Reactor Physics Benchmark Experiments contains data from 143 experimental series that were

Assumptions for the Annual Energy Outlook 1993

International Nuclear Information System (INIS)

1993-01-01

This report is an auxiliary document to the Annual Energy Outlook 1993 (AEO) (DOE/EIA-0383(93)). It presents a detailed discussion of the assumptions underlying the forecasts in the AEO. The energy modeling system is an economic equilibrium system, with component demand modules representing end-use energy consumption by major end-use sector. Another set of modules represents petroleum, natural gas, coal, and electricity supply patterns and pricing. A separate module generates annual forecasts of important macroeconomic and industrial output variables. Interactions among these components of energy markets generate projections of prices and quantities for which energy supply equals energy demand. This equilibrium modeling system is referred to as the Intermediate Future Forecasting System (IFFS). The supply models in IFFS for oil, coal, natural gas, and electricity determine supply and price for each fuel depending upon consumption levels, while the demand models determine consumption depending upon end-use price. IFFS solves for market equilibrium for each fuel by balancing supply and demand to produce an energy balance in each forecast year

Experiment Software and Projects on the Web with VISPA

Science.gov (United States)

Erdmann, M.; Fischer, B.; Fischer, R.; Geiser, E.; Glaser, C.; Müller, G.; Rieger, M.; Urban, M.; von Cube, R. F.; Welling, C.

2017-10-01

The Visual Physics Analysis (VISPA) project defines a toolbox for accessing software via the web. It is based on latest web technologies and provides a powerful extension mechanism that enables to interface a wide range of applications. Beyond basic applications such as a code editor, a file browser, or a terminal, it meets the demands of sophisticated experiment-specific use cases that focus on physics data analyses and typically require a high degree of interactivity. As an example, we developed a data inspector that is capable of browsing interactively through event content of several data formats, e.g., MiniAOD which is utilized by the CMS collaboration. The VISPA extension mechanism can also be used to embed external web-based applications that benefit from dynamic allocation of user-defined computing resources via SSH. For example, by wrapping the JSROOT project, ROOT files located on any remote machine can be inspected directly through a VISPA server instance. We introduced domains that combine groups of users and role-based permissions. Thereby, tailored projects are enabled, e.g. for teaching where access to student’s homework is restricted to a team of tutors, or for experiment-specific data that may only be accessible for members of the collaboration. We present the extension mechanism including corresponding applications and give an outlook onto the new permission system.

Globalization Competencies in Information Systems and E-Learning

OpenAIRE

Pawlowski, Jan; Holtkamp, Philipp; Kalb, Hendrik

2010-01-01

Abstract. Internationalization and globalization competences play a major role for graduates and employees in IS related enterprises. In contrast to other disciplines such as Business or Economics, the IS discipline rarely addresses this competence area. In the paper, we identify generic competence areas: coordination, communication, and cooperation. We derive domain specific competences for the field of E-Learning in Higher Education. The paper concludes with an outlook of promising research...

How to measure parity violating effects in e/sup +/e/sup -/. -->. tau/sup +/tau/sup -/ annihilation experiments

Energy Technology Data Exchange (ETDEWEB)

Dahmen, H D; Schuelke, L; Zech, G [Physics Department, Siegen University, Germany, F.R.

1979-02-26

A measurement of parity violating effects in the process e/sup +/e/sup -/ ..-->.. tau/sup +/tau/sup -/ for unpolarized e/sup +/e/sup -/ beams is proposed. For realistic assumptions on the luminosity of PETRA and PEP an estimate shows that the experiment is feasible.

Religiosidade e turismo: o primado da experiência

Directory of Open Access Journals (Sweden)

António Sérgio Araújo de Almeida

Full Text Available Resumo Localizada em um plano complexo e multifacetado, a experiência turística em contexto religioso é fortemente afetada pelos aspectos simbólicos, culturais, sociais e econômicos, presentes no lugar de visitação. É neste sentido que este trabalho se propõe a discutir alguns destes elementos no contexto empírico da Semana Santa de Braga, em Portugal.

World Energy Outlook 2010

Energy Technology Data Exchange (ETDEWEB)

NONE

2010-11-09

The world appears to be emerging from the worst economic crisis in decades. Many countries have made pledges under the Copenhagen Accord to reduce greenhouse-gas emissions. Commitments have also been made by the G-20 and APEC to phase out inefficient fossil-fuel subsidies. Are we, at last, on the path to a secure, reliable and environmentally sustainable energy system? Updated projections of energy demand, production, trade and investment, fuel by fuel and region by region to 2035 are provided in the 2010 edition of the World Energy Outlook (WEO). It includes, for the first time, a new scenario that anticipates future actions by governments to meet the commitments they have made to tackle climate change and growing energy insecurity. WEO-2010 shows: what more must be done and spent to achieve the goal of the Copenhagen Accord to limit the global temperature increase to 2 deg. C and how these actions would impact on oil markets; how emerging economies -- led by China and India -- will increasingly shape the global energy landscape; what role renewables can play in a clean and secure energy future; what removing fossil-fuel subsidies would mean for energy markets, climate change and state budgets; the trends in Caspian energy markets and the implications for global energy supply; the prospects for unconventional oil; and how to give the entire global population access to modern energy services. With extensive data, projections and analysis, this publication provides invaluable insights into how the energy system could evolve over the next quarter of a century. The book is essential reading for anyone with a stake in the energy sector.

Four Scenarios for Europe. Based on UNEP's third Global Environment Outlook

International Nuclear Information System (INIS)

Bakkes, J.; Gaponenko, N.; Mnatsakanian, R.

2003-01-01

The third Global Environment Outlook (GEO-3) was published on the eve of the Johannesburg summit (autumn 2002). GEO-3 looked back thirty years and forward thirty years. A set of what-if scenarios was used to explore the ways our society can advance, including implications for environmental and social goals. Characteristically, GEO-3 examines in a relatively deep fashion how its global scenarios can be interpreted in the context of each of the world's regions. This brochure presents the pan-European elaboration of the four GEO-3 scenarios. It focusses on the scenarios proper and their impacts in environmental terms. The scenarios are: The Markets First scenario envisages a world in which market-driven developments converge on the currently prevailing values and expectations in industrialized countries; In a Policy First world, strong actions are undertaken by governments in an attempt to achieve specific social and environmental goals; The Security First scenario assumes a world full of large disparities, where inequality and conflict, brought about by socio-economic and environmental stresses, prevail: and Sustainability First pictures a world in which a new development paradigm emerges in response to the challenge of sustainability supported by new, more equitable values and institutions. The second section describes 'the pan-European tale of the four futures' in a predominantly qualitative manner. Section 3 presents a regionally differentiated examination of the environmental implications of the scenarios. Details on input material, assumptions and methodologies applied, and actual results, can be found in Chapter 4 of GEO-3 'Outlook 2002-32' and in the Technical Background Report on GEO-3 Scenario Work

Feminilidade: alteridade e experiência Femininity: alterity and experience

Directory of Open Access Journals (Sweden)

Márcia Arán

2002-06-01

Full Text Available Este ensaio tem como objetivo desenvolver a noção de alteridade na psicanálise a partir dos conceitos de feminilidade e de experiência. Parte de uma crítica à centralidade do modelo Édipo / castração na teoria psicanalítica ­ modelo este que fundamenta uma forma de subjetivação que se faz pelo recalque como defesa ou pela renúncia pulsional - para pensar novas formas de sociabilidade. Inicialmente, procura-se analisar o destino da experiência alteritária na modernidade: o outro como estranho-familiar. Em seguida, através da análise de algumas passagens da obra freudiana, procura-se desen­ volver a noção de alteridade no registro da imanência, ou seja, como uma abertura para a diferença.The objective of this essay is to elaborate on the notion of alterity in psychoanalysis based on the concepts of femininity and experience. The point of departure is a critique of the centrality of the Oedipean/castration model in psychoanalytical theory (a model underlying a form of subjectivation resulting from repression or denial of drive in order to conceive new forms of sociabilily. The article begins by analyzing lhe fate of the altetily experience in modernity: lhe other as slrange/familiar. Next, by analyzing key passages from Freud's work, lhe author seeks to develop the notion of alterily in lhe context of immanence, that is, as an openness to difference.

A "Uses and Gratification Expectancy Model" to Predict Students' "Perceived e-Learning Experience"

Science.gov (United States)

Mondi, Makingu; Woods, Peter; Rafi, Ahmad

2008-01-01

This study investigates "how and why" students' "Uses and Gratification Expectancy" (UGE) for e-learning resources influences their "Perceived e-Learning Experience." A "Uses and Gratification Expectancy Model" (UGEM) framework is proposed to predict students' "Perceived e-Learning Experience," and…

The E166 experiment: Development of an undulator-based ...

Indian Academy of Sciences (India)

A longitudinal polarized positron beam is foreseen for the international linear collider (ILC). A proof-of-principle experiment has been performed in the final focus test beam at SLAC to demonstrate the production of polarized positrons for implementation at the ILC. The E166 experiment uses a 1 m long helical undulator in a ...

World energy outlook 2007 -- China and India insights

Energy Technology Data Exchange (ETDEWEB)

NONE

2007-11-07

World leaders have pledged to act to change the energy future. Some new policies are in place. But the trends in energy demand, imports, coal use and greenhouse gas emissions to 2030 in this year's World Energy Outlook are even worse than projected in WEO 2006. China and India are the emerging giants of the world economy. Their unprecedented pace of economic development will require ever more energy, but it will transform living standards for billions. There can be no question of asking them selectively to curb growth so as to solve problems which are global. So how is the transition to be achieved to a more secure, lower-carbon energy system? WEO 2007 provides the answers. With extensive statistics, projections in three scenarios, analysis and advice, it shows China, India and the rest of the world why we need to co-operate to change the energy future and how to do it.

World energy outlook 2007 -- China and India insights

Energy Technology Data Exchange (ETDEWEB)

NONE

2007-11-07

World leaders have pledged to act to change the energy future. Some new policies are in place. But the trends in energy demand, imports, coal use and greenhouse gas emissions to 2030 in this year's World Energy Outlook are even worse than projected in WEO 2006. China and India are the emerging giants of the world economy. Their unprecedented pace of economic development will require ever more energy, but it will transform living standards for billions. There can be no question of asking them selectively to curb growth so as to solve problems which are global. So how is the transition to be achieved to a more secure, lower-carbon energy system? WEO 2007 provides the answers. With extensive statistics, projections in three scenarios, analysis and advice, it shows China, India and the rest of the world why we need to co-operate to change the energy future and how to do it.

O ensino e a experiência nas narrativas de professores de Inglês

Directory of Open Access Journals (Sweden)

Annallena de Souza Guedes

2016-09-01

Full Text Available Resumo: Este trabalho tem como objetivo analisar três narrativas de professores de Inglês em exercício, através das quais são reveladas experiências que dizem respeito ao processo de ensinar Inglês em contextos de instituições públicas no Brasil. Pautado no conceito de experiência (MICCOLI, 2010, buscamos compreender quais experiências emergem dessas narrativas e como elas influenciam na prática de ensino dos professores. Ademais, intentamos analisar como os professores de Inglês se veem e quais desafios ele enfrentam nos seus contextos de trabalho. Os resultados desse estudo mostraram que, apesar de todas as experiências de dificuldades e indisciplina reveladas nas narrativas, duas delas parecem ainda encontrar motivação e esperança quanto à sua profissão. Além disso, percebemos que o modo como os professores veem sua realidade, seus alunos e seu trabalho são importantes para caracterizar sua prática profissional. Assim, acreditamos que o contexto e as experiências retratados nas narrativas podem ser caminhos que direcionem as ações desses professores em sala de aula e, consequentemente, possibilitem reflexões e mudanças no seu papel como educador. 

Developing Drought Outlook Forums in Support of a Regional Drought Early Warning Information System

Science.gov (United States)

Mcnutt, C. A.; Pulwarty, R. S.; Darby, L. S.; Verdin, J. P.; Webb, R. S.

2011-12-01

The National Integrated Drought Information System (NIDIS) Act of 2006 (P.L. 109-430) charged NIDIS with developing the leadership and partnerships necessary to implement an integrated national drought monitoring and forecasting system that creates a drought "early warning system". The drought early warning information system should be capable of providing accurate, timely and integrated information on drought conditions at the relevant spatial scale to facilitate proactive decisions aimed at minimizing the economic, social and ecosystem losses associated with drought. As part of this effort, NIDIS has held Regional Drought Outlook Forums in several regions of the U.S. The purpose of the Forums is to inform practices that reduce vulnerability to drought through an interactive and collaborative process that includes the users of the information. The Forums have focused on providing detailed assessments of present conditions and impacts, comparisons with past drought events, and seasonal predictions including discussion of the state and expected evolution of the El Niño Southern Oscillation phenomena. Regional Climate Outlook Forums (RCOFs) that include close interaction between information providers and users are not a new concept, however. RCOFs started in Africa in the 1990s in response to the 1997-98 El Niño and have since expanded to South America, Asia, the Pacific islands, and the Caribbean. As a result of feedback from the RCOFs a large body of research has gone into improving seasonal forecasts and the capacity of the users to apply the information in a way that improves their decision-making. Over time, it has become clear that more is involved than just improving the interaction between the climate forecasters and decision-makers. NIDIS is using the RCOF approach as one component in a larger effort to develop Regional Drought Early Warning Information Systems (RDEWS) around the U.S. Using what has been learned over the past decade in the RCOF process

LNG Market: Developments in 2014 and 2015 Outlook. Enerdata Gas/LNG and Power Consulting - January 2015

International Nuclear Information System (INIS)

2015-01-01

Enerdata power and gas expert held a webinar on the important developments happened in the LNG market in 2014 and provided insight on the LNG market outlook for 2015. 2015 is the year of uncertainty for the LNG industry. We will continue to experience low LNG prices driven by temporary liquefaction over capacity. The 2015 low prices environment will continue to support domestic gas price reforms in countries such as India, China, Malaysia and Indonesia. National economies of high LNG consumers such as Japan, Korea and Taiwan will benefit from low energy cost. Import terminal operators will see their utilization rates drop at concerning levels where the balance between operating cost and revenue starts to move on the red zone. Project developers will continue to delay their FID until they can see the light out of the tunnel. Those negotiating long term contracts have the big dilemma of shall it be oil-linked or not oil-linked. Never as before the importance to have a good insight of the future will differentiate losers from winners

Quality management of eLearning for medical education: current situation and outlook.

Science.gov (United States)

Abrusch, Jasmin; Marienhagen, Jörg; Böckers, Anja; Gerhardt-Szép, Susanne

2015-01-01

In 2008, the German Council of Science had advised universities to establish a quality management system (QMS) that conforms to international standards. The system was to be implemented within 5 years, i.e., until 2014 at the latest. The aim of the present study was to determine whether a QMS suitable for electronic learning (eLearning) domain of medical education to be used across Germany has meanwhile been identified. We approached all medical universities in Germany (n=35), using an anonymous questionnaire (8 domains, 50 items). Our results (response rate 46.3%) indicated very reluctant application of QMS in eLearning and a major information deficit at the various institutions. Authors conclude that under the limitations of this study there seems to be a considerable need to improve the current knowledge on QMS for eLearning, and that clear guidelines and standards for their implementation should be further defined.

Worldwide outlook clouded by market slump of late 1993

International Nuclear Information System (INIS)

Beck, R.J.

1994-01-01

Excess production and production capacity reasserted their influence in worldwide petroleum markets last year, pushing crude oil prices to their lowest levels since before the Persian Gulf crisis. The development ended the relative price stability that has characterized the period since the crisis ended in January 1991. One of the major questions now being asked is whether there has been a downward shift in the seasonal range of crude prices. In the near future, OPEC's degree of success in balancing the market will be a key to prices. Another is politics in the Middle East. If it were not for a United Nations embargo, the market would have another 2--3 million b/d of oil supply--from Iraq. The paper discusses worldwide demand, economic trends, the supply in 1993, the supply outlook, prices, and international drilling activities

Open-Rate Controlled Experiment in E-Mail Marketing Campaigns

OpenAIRE

Biloš, Antun; Turkalj, Davorin; Kelić, Ivan

2016-01-01

Purpose – The main purpose of this paper is to test the controlled experiment (A/B split) methodology in B2C oriented e-mail marketing campaigns. Design/Methodology/Approach – E-mail marketing techniques have been a substantial part of e-marketing methodology since the early Internet days of the mid-1990s. From the very beginning of Internet utilization for business purposes, e-mail was one of the most widely used communication techniques in B2B and B2C markets alike. Due to high volumes o...

Rare K+ decays from experiment E787

International Nuclear Information System (INIS)

Jain, V.

2000-01-01

This paper presents the latest results from experiment E787, at Brookhaven National Laboratory, on K + -> π + νbar ν and radiative K + decays. The result for K + -> π + νbar ν uses data collected in runs taken during 1995, 1996 and 1997. In addition, they discuss plans for future measurements of K + -> π + νbar ν

International Reactor Physics Experiment Evaluation (IRPhE) Project

International Nuclear Information System (INIS)

2013-01-01

The International Reactor Physics Experiment Evaluation (IRPhE) Project aims to provide the nuclear community with qualified benchmark data sets by collecting reactor physics experimental data from nuclear facilities, worldwide. More specifically the objectives of the expert group are as follows: - maintaining an inventory of the experiments that have been carried out and documented; - archiving the primary documents and data released in computer-readable form; - promoting the use of the format and methods developed and seek to have them adopted as a standard. For those experiments where interest and priority is expressed by member countries or working parties and executive groups within the NEA provide guidance or co-ordination in: - compiling experiments into a standard international agreed format; - verifying the data, to the extent possible, by reviewing original and subsequently revised documentation, and by consulting with the experimenters or individuals who are familiar with the experimenters or the experimental facility; - analysing and interpreting the experiments with current state-of-the-art methods; - publishing electronically the benchmark evaluations. The expert group will: - identify gaps in data and provide guidance on priorities for future experiments; - involve the young generation (Masters and PhD students and young researchers) to find an effective way of transferring know-how in experimental techniques and analysis methods; - provide a tool for improved exploitation of completed experiments for Generation IV reactors; - coordinate closely its work with other NSC experimental work groups in particular the International Criticality Safety Benchmark Evaluation Project (ICSBEP), the Shielding Integral Benchmark Experiment Data Base (SINBAD) and others, e.g. knowledge preservation in fast reactors of the IAEA, the ANS Joint Benchmark Activities; - keep a close link with the working parties on scientific issues of reactor systems (WPRS), the expert

XbD Video 2, Taxonomy of Experience (ToE) [Online

DEFF Research Database (Denmark)

2013-01-01

This is the second video in the Experience-based Designing series: It describes the Taxonomy of Experience, a structural way of looking at human experiences of almost any kind.This hierarchical model is useful to researchers and decision makers as a general method or tool for guiding the collection......, processing and categorisation of field data about an everyday experience. Researchers using this model often referred to the process as 'doing a ToE'...

Nietzsche e a jubilosa experiência trágica dos gregos

Directory of Open Access Journals (Sweden)

Renato Nunes Bittencourt

2010-10-01

Full Text Available Neste texto analisamos a interpretação de Nietzsche sobre o sentido existencial da experiência trágica realizada pelos antigos gregos na celebração estética e religiosa da Tragédia Ática, e de que modo tal experiência favorece a compreensão imanente e amoral da vida, suprimindo-se ainda qualquer tipo de depreciação moralista em relação ao real.

The photovoltaic: channels, markets and outlooks; Le photovoltaique: les filieres, les marches, les perspectives

Energy Technology Data Exchange (ETDEWEB)

Jourde, P. [CEA Cadarache (GENEC), 13 - Saint-Paul-lez-Durance (France)

2005-07-01

The photovoltaic market is in expansion with a good energy, political and environmental context. It needs meanwhile to realize developments in the storage domain and in the cost of connexion to the network. To illustrate these conclusions this paper discusses the following chapters: the solar energy, the principle and the channels of the photovoltaic, the applications (autonomous electrification and houses connected to the network) and the markets, a state of the art and the outlooks. (A.L.B.)

E-Books and Audiobooks: Extending the Digital Reading Experience

Science.gov (United States)

Larson, Lotta C.

2015-01-01

This article examines how sixth-grade students navigated and perceived a combined e-book and audiobook reading experience using Kindle Fires. While audiobooks and e-books are not new, little is known about students' use and perceptions of the combination of these two media, as the ability to synchronize audio contents with digital texts is rather…

Future coal production outlooks in the IPCC Emission Scenarios: Are they plausible?

International Nuclear Information System (INIS)

Hoeoek, Mikael

2010-10-01

Anthropogenic climate change caused by CO 2 emissions is strongly and fundamentally linked to the future energy production. The Special Report on Emission Scenarios (SRES) from 2000 contains 40 scenarios for future fossil fuel production and is used by the IPCC to assess future climate change. Coal, with its 26% share of world energy, is a major source of greenhouse gas emissions and commonly seen as a key contributor to anthropogenic climate change. SRES contains a wide array of different coal production outlooks, ranging from a complete coal phase-out by 2100 to a roughly tenfold increase from present world production levels. Scenarios with high levels of global warming also have high expectations on future fossil fuel production. The assumptions on resource availability are in SRES based on Rogner's assessment of world hydrocarbon resources from 1997, where it is stated that 'the sheer size of the fossil resource base makes fossil sources an energy supply option for many centuries to come'. Regarding the future coal production it is simply assumed to be dependent on economics, accessibility, and environmental acceptance. It is also generally assumed that coal is abundant, and will thus take a dominating part in the future energy system. Depletion, geographical location and geological parameters are not given much influence in the scenario storylines. This study quantifies what the coal production projection in SRES would imply in reality. SRES is riddled with future production projections that would put unreasonable expectation on just a few countries or regions. Is it reasonable to expect that China, among the world's largest coal reserve and resource holder and producer, would increase their production by a factor of 8 over the next 90 years, as implied by certain scenarios? Can massive increases in global coal output really be justified from historical trends or will reality rule out some production outlooks as implausible? The fundamental assumptions

Future coal production outlooks in the IPCC Emission Scenarios: Are they plausible?

Energy Technology Data Exchange (ETDEWEB)

Hoeoek, Mikael

2010-10-15

Anthropogenic climate change caused by CO{sub 2} emissions is strongly and fundamentally linked to the future energy production. The Special Report on Emission Scenarios (SRES) from 2000 contains 40 scenarios for future fossil fuel production and is used by the IPCC to assess future climate change. Coal, with its 26% share of world energy, is a major source of greenhouse gas emissions and commonly seen as a key contributor to anthropogenic climate change. SRES contains a wide array of different coal production outlooks, ranging from a complete coal phase-out by 2100 to a roughly tenfold increase from present world production levels. Scenarios with high levels of global warming also have high expectations on future fossil fuel production. The assumptions on resource availability are in SRES based on Rogner's assessment of world hydrocarbon resources from 1997, where it is stated that 'the sheer size of the fossil resource base makes fossil sources an energy supply option for many centuries to come'. Regarding the future coal production it is simply assumed to be dependent on economics, accessibility, and environmental acceptance. It is also generally assumed that coal is abundant, and will thus take a dominating part in the future energy system. Depletion, geographical location and geological parameters are not given much influence in the scenario storylines. This study quantifies what the coal production projection in SRES would imply in reality. SRES is riddled with future production projections that would put unreasonable expectation on just a few countries or regions. Is it reasonable to expect that China, among the world's largest coal reserve and resource holder and producer, would increase their production by a factor of 8 over the next 90 years, as implied by certain scenarios? Can massive increases in global coal output really be justified from historical trends or will reality rule out some production outlooks as implausible? The

De Marias e Luizes: experiências devocionais e de gênero numa festa mariana

Directory of Open Access Journals (Sweden)

Martín, Eloísa

2003-01-01

Full Text Available O presente artigo parte de uma pesquisa levada a cabo entre 1998 e 2000 na festa da Virgem de Itatí em Corrientes (Argentina. A partir de dois casos, proponho analisar a maneira pela qual as experiências religiosas e de gênero relacionam-se e se constituem mutuamente a través de certas práticas devocionais. Tais práticas, transmitidas e reproduzidas por meio de laços familiares também marcadas por diferenciais de gênero, se processam em termos de um compromisso com a Virgem, mas também com as tradições locais e com os próprios laços de parentesco. Assim, através de certas práticas de devoção, veremos como se aprende a ser, ao mesmo tempo e desde o início, mulher e devota, homem e devoto

Power to the people: The world outlook for electricity investment

International Nuclear Information System (INIS)

Birol, Fatih

2004-01-01

Total investment required for the energy-supply infrastructure worldwide over the period 2001-2030 is expected to amount to $16 trillion, or $550 billion a year. This investment is needed to replace existing and future supply facilities that will be exhausted or become obsolete during the projection period, as well as to expand supply capacity to meet projected primary energy demand growth of 1.7% per year. Capital needs will grow steadily through the projection period. The average annual rate of investment is projected to rise from around $450 billion in the current decade to $630 billion in 2021-2030. This compares with estimated investment of $410 billion in 2000. Actual capital flows will fluctuate around these levels according to project and business cycles. The power sector will account for the bulk of energy-investment needs, and oil and gas in almost equal measure for most of the rest. These are some of the key findings of the World Energy Investment Outlook of the International Energy Agency (IEA), based in Paris, France. This article focuses on the power sector. The award-winning report, released in late 2003, assesses, fuel by fuel and region by region, the prospects for and possible barriers to investment in the global energy sector to 2030. The core analysis of investment needs is based on the reference scenario projections of supply and demand contained in the IEA's World Energy Outlook 2002. Although the total sum of investment needs is large in absolute terms, it is modest relative to the size of the world economy, amounting to only about 1% of global GDP on average over the next thirty years. The proportion is expected to fall slightly over the projection period, from 1.1% in the current decade to 0.9% in the decade 2021-2030. But the extent of the challenge differs among regions, ranging from only half a percent in countries of the Organisation for Economic Cooperation and Development (OECD) to 5% in Russia

The challenges of new nuclear projects. E.ON Experience

International Nuclear Information System (INIS)

Spechty, J.; Perez Rodriguez, J. L.

2012-01-01

E.ON is one of the largest privately-owned energy companies in the world. Its portfolio of nuclear assets in composed of 21 nuclear power plants on 13 sites located in Germany and Sweden, 9 of which are directly operated by E.ON. At present E.ON develops large-scale construction projects in two of the European countries willing to commit to new nuclear build-Finland and UK - for which its experience as the best nuclear power plant operator in Europe is key. (Author)

Feasibility of a 81Br(ν,e-) 81Kr solar neutrino experiment

International Nuclear Information System (INIS)

Hurst, G.S.; Chen, C.H.; Kramer, S.D.; Cleveland, B.T.; Davis, R. Jr.; Rowley, R.K.; Gabbard, F.; Schima, F.J.

1984-01-01

A solar neutrino experiment utilizing the interaction of 81 Br(ν,e - ) 81 Kr to study the 7 Be neutrino source in the interior of the sun is shown to be feasible. Resonance ionization spectroscopy was used to count less than 1000 atoms of 2 x 10 5 -yr 81 Kr, making the bromine experiment possible. Except for the method of counting product atoms, the bromine experiment would be very similar to the successful chlorine detector 37 Cl(ν,e - ) 37 Ar, and thus it is a natural sequel to the only solar neutrino experiment to date

Strategic Planning for scenarios in the natural environment. The case of the Nature Outlook 2050 GDP; La Planificacion Estrategica por Escenarios en el medio natural. El caso del Nature Outlook 2050 del PIB

Energy Technology Data Exchange (ETDEWEB)

Urbano Lopez de Meneses, J.

2015-07-01

Forward planning is part of strategic planning. It is a regular tool in management and direction of the companies. Some European countries include it in environmental policy cycle. Scenarios approach is a proved qualitative foresight technique. It is useful in high variability and complexity environments. This paper shows how to implement the tool, mixing theoretical explanation and the practical performance done in project called: Nature Outlook 2050. This project has been done by the Netherlands agency for environmental assessment and foresight (PBL). (Author)

International Reactor Physics Experiment Evaluation (IRPhE) Project. IRPhE Handbook - 2017 edition

International Nuclear Information System (INIS)

2017-01-01

The International Reactor Physics Evaluation (IRPhE) Project was initiated as a pilot in 1999 by the Nuclear Energy Agency (NEA) Nuclear Science Committee (NSC). The project was endorsed as an official activity of the NSC in June 2003. While the NEA co-ordinates and administers the IRPhE Project at the international level, each participating country is responsible for the administration, technical direction and priorities of the project within their respective countries. The information and data included in this handbook are available to NEA member countries, to all contributing countries and to others on a case-by-case basis. The IRPhE Project is patterned after the International Criticality Safety Benchmark Evaluation Project (ICSBEP). It closely co-ordinates with the ICSBEP to avoid duplication of efforts and publication of conflicting information. Some benchmark data are applicable to both nuclear criticality safety and reactor physics technology. Some have already been evaluated and published by the ICSBEP, but have been extended to include other types of measurements in addition to the critical configuration. Through this effort, the IRPhE Project will be able to 1) consolidate and preserve the existing worldwide information base; 2) retrieve lost data; 3) identify areas where more data are needed; 4) draw upon the resources of the international reactor physics community to help fill knowledge gaps; 5) identify discrepancies between calculations and experiments due to deficiencies in reported experimental data, cross-section data, cross-section processing codes and neutronics codes; 6) eliminate a large amount of redundant research and processing of reactor physics experiment data, and 7) improve future experimental planning, execution and reporting. This handbook contains reactor physics benchmark specifications that have been derived from experiments performed at nuclear facilities around the world. The benchmark specifications are intended for use by

Annual Energy Outlook 1992 with projections to 2010

International Nuclear Information System (INIS)

1992-01-01

Dramatic events over the past year show how international developments can affect domestic energy markets. Market reactions to events in the Persian Gulf and in what used to be called the Soviet Union reinforced the perception of global interdependence in regard to both energy supply and energy demand. The interdependence was reflected most visibly and promptly in world oil prices. With US reliance on foreign oil expected to continue trending upward, any price changes tend to ''feed back'' throughout this Nation's economy. Despite short-term fluctuations, the longer-range US energy outlook has remained relatively constant since last year. Assuming that current laws and policies remain in force, this document addresses uncertainties by discussing four alternative scenarios in addition to a ''reference'' case. Two cases vary the assumption about the rate at which the US national economy will grow, while the other two estimate effects if world oil prices should go lower or higher. This report gives projections to 2010 for energy end uses, oil, gas, electricity, coal, and comparative analyses

Annual energy outlook 1998 with projections to 2020

Energy Technology Data Exchange (ETDEWEB)

NONE

1997-12-01

The Annual Energy Outlook 1998 (AEO98) is the first AEO with projections to 2020. Key issues for the forecast extension are trends in energy efficiency improvements, the effects of increasing production and productivity improvements on energy prices, and the reduction in nuclear generating capacity. Projections in AEO98 also reflect a greater shift to electricity market restructuring. Restructuring is addressed through several changes that are assumed to occur in the industry, including a shorter capital recovery period for capacity expansion decisions and a revised financial structure that features a higher cost of capital as the result of higher competitive risk. Both assumptions tend to favor less capital-intensive generation technologies, such as natural gas, over coal or baseload renewable technologies. The forecasts include specific restructuring plans in those regions that have announced plans. California, New York, and New England are assumed to begin competitive pricing in 1998. The provisions of the California legislation for stranded cost recovery and price caps are incorporated. In New York and New England, stranded cost recovery is assumed to be phased out by 2008.

AREVA Technical Days (ATD) session 1: Energy outlook and presentation of the Areva Group

International Nuclear Information System (INIS)

2002-01-01

These technical days organized by the Areva Group aims to explain the group activities in a technological and economic point of view, to provide an outlook of worldwide energy trends and challenges and to present each of their businesses in a synthetic manner. This first session deals with energy challenges and nuclear, public acceptance of nuclear power, mining activities, chemistry activities, enrichment activities, fuel assembly, reactors and services activities, nuclear measurements activities, reprocessing and recycling activities, logistics activities and connectors activities. (A.L.B.)

Infância, experiência e performatividade: primeiras aproximações

Directory of Open Access Journals (Sweden)

Sandro Vinicius Sales dos Santos

2014-08-01

Full Text Available http://dx.doi.org/10.5007/1980-4512.2014n30p31 O presente trabalho apresenta e discute alguns resultados parciais de uma pesquisa de mestrado em andamento que objetiva analisar as experiências vivenciadas por crianças de quatro anos no interior de uma instituição pública de educação infantil. O estudo de caráter interpretativo busca suas bases teóricas na sociologia da infância e nas pedagogias da infância e da educação infantil. Do ponto de vista metodológico, a pesquisa se fundamenta em um estudo de caso (ANDRÉ, 1991; SARMENTO, 2003 assumindo uma lógica de investigação etnográfica (CASTANHEIRA, 2004; GREEN, DIXON, ZAHALIRICK, 2005, tendo como principais instrumentos de coleta de dados, a observação participante, fotografias e desenhos articulados com a oralidade; entrevista com crianças e adultos, dentre outros. Discute ainda a noção de experiência infantil como a possibilidade de análise das formas de sociabilidade das crianças. Palavras-chave: infância, crianças, educação infantil, experiência infantil, ponto de vista das crianças.

Renewables Deals. Mergers and acquisitions activity in renewable power and related clean technology. 2012 outlook and 2011 review

Energy Technology Data Exchange (ETDEWEB)

NONE

2012-01-15

Renewables Deals is our annual analysis of deal activity in the renewable power and related clean technology sectors. We publish our outlook on the prospects for dealmaking in the year ahead. We also take a look at what's been happening in the last 12 months and in the different main markets around the world. This year for the first time, we open our report with our discussion of the outlook for the year ahead and identify some of the main themes we expect to be at work. Looking ahead, the sector is undergoing a growing maturity and consolidation phase. This evolution inclines us to believe that deal flow will remain significant in 2012. In part, though, this will depend on how the Eurozone crisis unfolds. We assume a continuation of a 'rolling uncertainty' scenario affecting the Eurozone and wider world sentiment. But, if there are significant adverse events that turn Eurozone 'rolling uncertainty' into deeper crisis, deal flow is likely to be dampened.

Coincidence (e,e'p) Scattering on 40Ar and 48Ti to Aid Precision Neutrino Oscillation Experiments

Science.gov (United States)

Abrams, Dan; E12-14-012 Collaboration

2017-09-01

Neutrino oscillations are an active area of research, with experiments such as DUNE (Deep Underground Neutrino Experiment). DUNE will make use of large liquid argon detectors to perform a precision measurement of the CP violating phase. Hence, an understanding of the argon nuclear ground state and its response to (anti-)neutrino interactions is of paramount importance. Information about the nuclear ground state is encapsulated in the spectral function, S (k , E) , the joint probability of removing a nucleon of momentum k = |k | from the ground state leaving the residual (A-1) system with excitation energy E. E12-14-012 at Jefferson Lab ran in early 2017 and has measured the argon spectral function through coincidence (e ,e' p) scattering on 40Ar and 48Ti. The results of E12-14-012 are important to both the neutrino and nuclear physics communities. A direct measurement of the coincidence (e ,e' p) cross section from 40Ar and 48Ti will provide valuable information about the argon nucleus, as well as the experimental input necessary to constrain theoretical models used to calculate S (k , E) , paving the way for reliable estimates of the neutrino cross sections. Data from E12-14-012 is currently being analyzed at UVA and Va. Tech. Supported in part by the Department of Energy Grant No: DE-FG02-96ER40950.

Energy Survival Guide. Insight in energy and outlook for the future

International Nuclear Information System (INIS)

Hermans, J.

2008-12-01

This book is written for everyone who wishes to distinguish the sense and nonsense in the area of energy. Are all those energy saving tips useful? Is a train really more efficient than a passenger car? Are all those talks about climate change justified? What do those wind turbines deliver? Will solar panels ever become profitable? Is nuclear energy justifiable? Why are we not exploiting wave energy? Will we still be able to drive cars in the future? This book provides the answers. It offers insight in where we stand and gives an outlook on how the future generation should proceed. It lists the facts and gives a complete view with clear conclusions. And there are separate frames for those who wish to check things. [mk] [nl

Tempo e Trânsito na Experiência Subjetiva de Motoristas

OpenAIRE

Ana Inez Oka Elvas de Lima; Sylvia Cavalcante

2015-01-01

Esta pesquisa investiga como são percebidos e vivenciados o tempo e a pressa no trânsito por motoristas de Fortaleza, identificando e analisando seus estados subjetivos e comportamentos associados a essa experiência. Para a coleta de dados, organizaram-se quatro grupos focais, a partir dos quais emergiram diversos elementos relacionados ao tempo e à pressa e à incidência de comportamentos inadequados no trânsito, segundo o sexo e a idade dos participantes. Para analisar os dados obtidos nas d...

Green Energy Outlook in Europe. Strategic prospects to 2010

International Nuclear Information System (INIS)

2002-07-01

As the successor to last years' report The Green Energy Outlook 2001 by Reuters Business Insight, this new report focuses on the opportunities that are opening across Europe. In particular the report evaluates the implications of trading in a harmonised green energy market and how certification and labelling will affect trading strategies. Renewable energy is rapidly becoming an important commodity. The report forecasts a green certificate market of over 20 to 30 billion Euro in 2010, largely driven by environmental policy and the increasing viability of green technologies. The impact of new policies and key issues such as certification and labeling are significant factors of the current European renewable energy market. This report evaluates the current market and identifies the main areas for growth and development to 2010. The latest market research and analysis, detailed country profiles, key players' strategies and recommendations for success in the expanding and evolving market make this report a must for every company and government with interest in the renewable energy market

Healthcare students' experiences when integrating e-learning and flipped classroom instructional approaches.

Science.gov (United States)

Telford, Mark; Senior, Emma

2017-06-08

This article describes the experiences of undergraduate healthcare students taking a module adopting a 'flipped classroom' approach. Evidence suggests that flipped classroom as a pedagogical tool has the potential to enhance student learning and to improve healthcare practice. This innovative approach was implemented within a healthcare curriculum and in a module looking at public health delivered at the beginning of year two of a 3-year programme. The focus of the evaluation study was on the e-learning resources used in the module and the student experiences of these; with a specific aim to evaluate this element of the flipped classroom approach. A mixed-methods approach was adopted and data collected using questionnaires, which were distributed across a whole cohort, and a focus group involving ten participants. Statistical analysis of the data showed the positive student experience of engaging with e-learning. The thematic analysis identified two key themes; factors influencing a positive learning experience and the challenges when developing e-learning within a flipped classroom approach. The study provides guidance for further developments and improvements when developing e-learning as part of the flipped classroom approach.

A model based estimate of the geometrical acceptance of the e+e- experiment on the HYPERON spectrometer

International Nuclear Information System (INIS)

Cerny, V.

1983-01-01

A model based estimate is presented of the geometrical acceptance of the HYPERON spectrometer for the detection of the e + e - pairs in the proposed lepton experiment. The results of the Monte Carlo calculation show that the expected acceptance is fairly high. (author)

Low-dose antibiotics: current status and outlook for the future

DEFF Research Database (Denmark)

Antimicrobial therapy is a key factor in our success against pathogens poised to ravage at risk or infected individuals. However, we are currently at a watershed point as we face a growing crisis of antibiotic resistance among diverse pathogens. One area of intense interest is the impact of the a......Antimicrobial therapy is a key factor in our success against pathogens poised to ravage at risk or infected individuals. However, we are currently at a watershed point as we face a growing crisis of antibiotic resistance among diverse pathogens. One area of intense interest is the impact...... of the application of antibiotics for uses other than the treatment of patients and the association with such utilization with emerging drug resistance. This Research Topic “Low- dose antibiotics: current status and outlook for the future” in Frontiers in Microbiology: Antimicrobials, Resistance and Chemotherapy...

Proposed solar neutrino experiment using 81Br(nu,e-)81Kr

International Nuclear Information System (INIS)

Hurst, G.S.; Chen, C.H.; Kramer, S.D.; Allman, S.L.

1984-12-01

It has now been shown that it is feasible to measure the 7 Be neutrino source in the sun by using the reaction 81 Br(nu,e - ) 81 Kr in a radiochemical experiment. Such an experiment would be quite similar to the Davis, Cleveland, and Rowley method for measuring the 8 B neutrino using 37 Cl(nu,e - ) 37 Ar except that the resonance ionization spectroscopy (RIS) method (instead of decay counting) would be employed to count the 2 x 10 5 -yr 81 Kr atoms

Status and future of the experiment PS 170 (anti pp → e+e-)

International Nuclear Information System (INIS)

Duclos, J.

1985-03-01

The LEAR experiment PS170 is designed to detect the e +- pairs from anti p-annihilation. It aims to measure the proton form factors in the time like region and the spectrum of vector mesons in the mass range: 1-1,6 GeV. Data have been taken at 300, 600 and 1500 MeV/c incident momenta. The analysis of the 300 MeV/c data gave 200 2-body events: (anti pp → e + e - ), clearly separated from the hadronic background. Values of the form factors are extracted near threshold. The next step will be to accumulate sufficient data to measure separately the electric and magnetic components up to 600 MeV/c. The use of an internal target is considered for measurements at high momenta

Legal improvements brighten North Africa production outlook

International Nuclear Information System (INIS)

Anon.

1997-01-01

North Africa's three main oil producing countries soon will reap benefits of past moves by their governments to encourage investment by international companies. Production of crude oil and natural gas in Algeria, Egypt, and Libya is ready to increase from suppressed levels of the recent past, says International Energy Agency, Paris. The gains are possible despite political risks, total reserves accounting for only 4% of the world's crude reserves, and oil prices well below levels of the 1980s, when the countries' flow rates peaked. The reason: producing oil in North Africa is profitable. In a recent study entitled North Africa Oil and Gas, IEA attributes the bright production outlook to improvements that the countries' governments have made in the past decade to hydrocarbon laws and the fiscal terms they offer international investors. According to announced plans, the three countries' combined capacity to produce crude oil will rise 18% by the year 2000 to 3.65 million b/d, and a further gain of 700,000 b/d is possible. IEA expects production capacity for natural gas to increase 50% from its 1995 level by 2000 to a combined 139.4 billion cu m/year. This paper discusses production capacities, Algeria's record, improvements in Egypt, and Libya's changes

An electricity system : 18-month outlook from Oct 2004 to March 2006

International Nuclear Information System (INIS)

2004-01-01

This report presents a resource assessment by the Independent Electricity Market Operator (IMO) for the 18-month period from October 2004 to March 2006. It is based on the IMO's forecast of electricity demand. The information was provided by power generators in Ontario. The outlook for the electricity system has improved due to new resource additions in 2004 which have improved the general supply situation. The Brighton Beach (580 MW) and Kirkland Lake (32 MW) facilities have completed commissioning since the last quarterly outlook. Plans have also been announced to return the nuclear Pickering Unit 1 to service for a projected capacity increase of 515 MW by the fall of 2005. The impending shutdown of 1150 MW of coal-fired generation at Lakeview Thermal Generating Station in Mississauga in April 2005 emphasizes the importance of improving transmission and generation capacity in the Toronto area. Requests for Proposals for 300 MW of renewable energy supply have been issued by the Ontario government along with requests for 2,500 MW of new clean generation and demand-side projects. This report also includes updated values for existing resource scenarios and planned resource scenarios. The reliability of Ontario's transmission system was also assessed along with the adequacy of the existing resource to meet the forecast demand. The existing installed generation resources include 5 nuclear stations generating 10,850 MW of electricity, 5 coal stations generating 7,564 MW of electricity, 23 oil and gas fired stations generating 4,976 MW of electricity, 61 hydroelectric stations generating 7,676 MW of electricity, and 2 other stations generating 66 MW of electricity. Although the existing resource scenario is better than in previous reports, imports will be required under extreme weather conditions to help meet electricity demand in Ontario during peak periods. 19 tabs., 10 figs

Assessing the User Experience of E-Books in Academic Libraries

Science.gov (United States)

Zhang, Tao; Niu, Xi; Promann, Marlen

2017-01-01

We report findings from an assessment of e-book user experience (search and information seeking) from usage data and user tests. The usage data showed that most reading sessions were brief and focused on certain pages, suggesting that users mainly use e-books to find specific information. The user tests found that participants tended to use…

Petroleum product market outlook

International Nuclear Information System (INIS)

2005-09-01

The influence of petroleum market disturbances on price increases was discussed with particular reference to Hurricane Katrina and the loss of refinery production and damage to oil infrastructure in the United States. The supply of petroleum products in Canada will be very tight heading into the winter of 2006, despite the fact that Canadian refineries are operating at full capacity to ensure an adequate supply of gasoline and diesel fuel for consumers. In addition to refinery production, petroleum supplies are also determined by the adequacy of inventories and the efficiency of the infrastructure in place to deliver products to where they are needed. The lack of spare capacity has reduced the flexibility of the North American refining system to respond to further disruptions. Refiners were asked to provide information on 4 areas of their operations in order for Natural Resources Canada to analyze the short-term outlook for petroleum products markets. The 4 areas included refinery utilization rates and capability to increase production; any planned refinery turnaround that would affect petroleum product supplies; inventory levels compared to levels in previous years; and, any logistical problems that could affect product distribution. A graph depicting the relationship between Canadian production of gasoline and domestic sales clearly illustrated the seasonal nature of gasoline consumption and that production in Canada is much higher than consumption. Canada exports large volumes of gasoline, primarily to the United States eastern seabord from refineries in Atlantic Canada. The trend is similar for diesel fuel. Demand for both gasoline and diesel is expected to continue to grow in 2005 as high prices have had a limited impact on demand growth. In general, the Ontario/Quebec region is short of gasoline and must import gasoline during the summer months to cover the shortfall. It was noted that motorists and homeowners who heat with oil will bear the burden of higher

Oil outlook to 2005

International Nuclear Information System (INIS)

Shihab-Eldin, Adnan; Hamel, Mohamed; Brennand, Garry

2004-01-01

This paper presents the OPEC Secretariat's latest outlook to 2025 for oil supply and demand. The results have been developed using the OPEC World Energy Model, OWEM. The next two decades are expected to see increases in energy demand met predominantly by fossil fuels, with oil set to continue to maintain its major role. There is also a clear expectation that the oil resource base is sufficiently abundant to satisfy this demand growth. Global oil demand rises in the reference case by 12 million barrels per day to 89 mb/d from 2002 to 2010, an average annual growth rate of 1.5 mb/d, or 1.8 per cent per annum, over the period. In the following decade, demand grows by a further 17 mb/d to 106 mb/d by 2020, and then by another 9 mb/d to 115 mb/d by 2025. Almost three-quarters of the increase in demand over the period 2002-25 comes from developing countries. In the short-to-medium term, overall non-OPEC supply is expected to continue to increase - rising to a plateau of 55-57 mb/d in the post-2010 period. The key sources for the increase in non-OPEC supply will be Latin America, Africa, Russia and the Caspian. In the longer term, OPEC will increasingly be called upon to supply the incremental barrel. Uncertainties over future economic growth, government policies and the rate of development and diffusion of newer technologies raise questions over the future scale of investment that will be required. These uncertainties, coupled with long lead times, inevitably complicate the task of maintaining market stability. Medium-term prospects suggest that there is a need to ensure that spare capacity is not too high and that it is consistent with sustained market stability. There are genuine risks of downward pressure on oil prices, and this could sow the seeds of instability. (Author)

Oil outlook to 2025

International Nuclear Information System (INIS)

Adnan Shihab-Eldin; Mohamed Hamel; Brennand, G.

2004-01-01

This paper presents the OPEC Secretariat's latest outlook to 2025 for oil supply and demand. The results have been developed using the OPEC World Energy Model, OWEM. The next two decades are expected to see increases in energy demand met predominantly by fossil fuels, with oil set to continue to maintain its major role. There is also a clear expectation that the oil resource base is sufficiently abundant to satisfy this demand growth. Global oil demand rises in the reference case by 12 million barrels per day to 89 mb/d from 2002 to 2010, an average annual growth rate of 1.5 mb/d, or 1.8 per cent per annum, over the period. In the following decade, demand grows by a further 17 mb/d to 106 mb/d by 2020, and then by another 9 mb/d to 115 mb/d by 2025. Almost three-quarters of the increase in demand over the period 2002-25 comes from developing countries. In the short-to-medium term, overall non-OPEC supply is expected to continue to increase - rising to a plateau of 55-57 mb/d in the post-2010 period. The key sources for the increase in non-OPEC supply will be Latin America, Africa, Russia and the Caspian. In the longer term, OPEC will increasingly be called upon to supply the incremental barrel. Uncertainties over future economic growth, government policies and the rate of development and diffusion of newer technologies raise questions over the future scale of investment that will be required. These uncertainties, coupled with long lead times, inevitably complicate the task of maintaining market stability. Medium-term prospects suggest that there is a need to ensure that spare capacity is not too high and that it is consistent with sustained market stability. There are genuine risks of downward pressure on oil prices, and this could sow the seeds of instability. [Author

Emoções e pesquisa narrativa: transformando experiências de aprendizagem

Directory of Open Access Journals (Sweden)

Rodrigo Aragão

2008-01-01

Full Text Available Este artigo explora a influência de uma pesquisa narrativa nas experiências de aprendizagem de estudantes de Letras/Inglês. Ao refletir sobre suas histórias de aprendizagem, eles deram voz e sentido às suas experiências, sentindo-se valorizados. Suas histórias de aprendizagem expõem a relevância das emoções no desenvolvimento de habilidades orais, na reflexão e na responsabilidade por sua trajetória profissional. Três participantes transformaram suas experiências de aprendizagem de inglês ao refletir sobre as emoções que limitam seu desempenho oral e ao projetar imagens que representassem o desejo de se tornarem falantes fluentes. Porém, transformar os desejos em ações pode envolver investimentos que extrapolam a tomada de consciência na reflexão pela pesquisa.This article explores the influence of a narrative research on the language learning experiences of undergraduate students of English. As they reflect upon their language learning histories, they give voice and meaning to their experiences and their self-esteem improves. Their language learning histories reveal the relevance of emotions in their oral skills development, reflection, and responsibility for their professional trajectories. Three participants transformed their language experiences by reflecting on the emotions that restrained their speaking skills and projecting images that would represent their desire to become fluent speakers. However, transforming their desires into actions entails dealing with investments that may go beyond reflection fostered by this research.

Usabilidade e user experience: essencial para aceitabilidade de produtos e serviços

Directory of Open Access Journals (Sweden)

Antonio Mendes Silva Filho

2011-11-01

Full Text Available Usabilidade é um atributo de qualidade essencial que tem sido usado pelas empresas para conquistar novos consumidores. E, você quando busca adquirir um novo produto (ou serviço, você intenciona (a atingir objetivos (que atendam suas necessidades num determinado contexto; (b eficiência (obtendo um resultado ou solução, de modo eficiente e produtivo, para um problema que tenha em mãos; e (c satisfação (de maneira subjetiva no uso do produto ou serviço. Esses três aspectos destacados compreendem os fatores, utilizados pela Norma 9241-11 da ISO (International Organization for Standardization para definir a usabilidade. De acordo com a Norma 9241-11 da ISO (International Organization for Standardization, a usabilidade é definida como “The extent to which a product can be used by specified users to achieve specified goals with effectiveness, efficiency, and satisfaction in a specified context of use”. Esses objetivos compreendem a base do que é denominado “user experience”. Mas, o que é user experience? Trata-se da experiência do usuário quando interage com produtos ou serviços. Um produto pode ser qualquer coisa como, por exemplo, um tablet, um aparelho celular ou smartphone, um painel de automóvel ou software. Qualquer desses produtos ou até serviços (como oferecidos em web sites, têm a usabilidade como atributo determinante da qualidade perceptível aos usuários. Nesse sentido, o objetivo deste artigo é discutir a usabilidade e estratégias de sua avaliação.

From field schools and the lecture hall to online: Hands-on teaching based on the real science experience worldwide for MOOCs ?

Science.gov (United States)

Huettmann, F.

2015-12-01

University-teaching is among the most difficult teaching tasks. That's because it involves to present front-line research schemes to students with complex backgrounds as a precious human resource of the future using, latest teaching styles, and many institutional fallacies to handle well. Here I present 15 years of experience from teaching in field schools, in the class room, and with pedagogical methods such as traditional top-down teaching, inquiry-based learning, eLearning, and flipped classrooms. I contrast those with teaching Massive Open Access Online Classes (MOOC) style. Here I review pros and cons of all these teaching methods and provide and outlook taking class evaluations, cost models and satisfaction of students, teachers, the university and the wider good into account.

Perfil sociodemográfico e de experiências anômalas em indivíduos com vivências psicóticas e dissociativas em grupos religiosos Sociodemographic and anomalous experiences profile in subjects with psychotic and dissociative experiences in religious groups

Directory of Open Access Journals (Sweden)

Adair Menezes Jr.

2012-01-01

Full Text Available CONTEXTO: Vivências psicóticas e dissociativas não patológicas são comuns na população geral, especialmente em grupos religiosos. Há poucos estudos sobre o perfil da população não clínica com essas vivências, bem como há dúvidas sobre critérios para o diagnóstico diferencial dessas experiências. OBJETIVOS: Identificar o perfil sociodemográfico e de experiências anômalas (EA entre pessoas que buscaram ajuda em centros espíritas. MÉTODOS: Foram entrevistadas 115 pessoas que procuraram auxílio em seis centros espíritas de Juiz de Fora/MG por causa de vivências psicóticas e/ou dissociativas. Entrevista semiestruturada investigou dados sociodemográficos, experiências anômalas apresentadas e a presença de critérios propostos para identificar experiências espirituais não patológicas. RESULTADOS: Predomínio de mulheres (70%, de meia-idade, com alta escolaridade, ativas ocupacionalmente e cujas EA começaram na infância (65% ou adolescência (23%. As EA mais frequentes foram alucinações visuais (63%, auditivas (54%, "percepção espiritual" (53%, "sonhos paranormais" (38% e experiências fora do corpo (31%. Para a maioria da amostra, essas EA não traziam prejuízos sócio-ocupacionais, eram curtas, episódicas e benéficas; entretanto referiram sofrimento emocional e falta de controle sobre elas. CONCLUSÃO: A alta frequência e diversidade de EA encontradas, bem como suas implicações teóricas, clínicas e de saúde pública, indicam a urgência de maior atenção a esse tópico.BACKGROUND: Non-pathological psychotic and dissociative experiences are frequent in the general population, particularly in religious groups. There are few studies on the profile of non-clinical populations with these experiences, and on criteria for differential diagnosis. OBJECTIVES: To identify the sociodemographic profile and anomalous experiences (AE among people who sought help in spiritualist groups. METHODS: We interviewed 115

Empirical study on flow experience in China tourism e-commerce market

Directory of Open Access Journals (Sweden)

Jianling Wang

2015-04-01

Full Text Available Purpose: While tourism e-commerce develops rapidly in China, these channels are truly new to both web providers and web consumers, understanding the nature of these media attaches greater importance. This study investigates the mediation effects of flow experience on the relationship between motivation and behavior intention in tourism e-commerce.Design/methodology/approach: Based on the technology acceptance model, an empirical study is designed to test this relationship.we estimated the measurement model with 13 manifest indicators and 4 latent constructs by CFA to assess the reliability and validity of the construct measures, then tested hypotheses by OLS regression and a formal three-step mediation procedure.Findings: Overall, the results reveal that trust is incorporated in motivation and play it’s role together with other motivations; telepresence and concentration are confirmed in flow experience, and both partially mediated the relationship.Research limitations/implications: This study demonstrates that to improve consumers’ usage adoption, marketers should pay much attention to not only consumers’ motivation but also the areas such as flow experience.Originality/value: This study takes flow experience as a new perspective to explore china tourism e-commerce, estimates its measurement and tests its roles between motivation and behavior intention.

Review of e+e- experiments with PLUTO from 3 to 31 GeV

International Nuclear Information System (INIS)

Criegee, L.; Knies, G.

1981-07-01

The contributions of the PLUTO experiment to e + e - physics at collision energies in the range of 3-31 GeV are reviewed. The review briefly sketches the storage rings DORIS and PETRA at DESY, and describes the most important features of the PLUTO detector, of data processing, and of the analysis methods. It covers the physics results in the fields of electroweak interactions, of the heavy lepton tau and the search for still heavier leptons, of hadron production with evidence for quark and gluon jets, as well as multiparton effects, of UPSILON decays and their relation to QCD, and concludes with first results in high-energy photon-photon interactions. (orig.)

Apparel, Baking, Laundry and Dry Cleaning, and Textile Mill Products Industries. Reprinted from the Occupational Outlook Handbook, 1978-79 Edition.

Science.gov (United States)

Bureau of Labor Statistics (DOL), Washington, DC.

Focusing on occupations in the clothing and baking industries, this document is one in a series of forty-one reprints from the Occupational Outlook Handbook providing current information and employment projections for individual occupations and industries through 1985. The specific occupations covered in this document include occupations in the…

Inter-Generational Differences in Individualism/Collectivism Orientations: Implications for Outlook towards HRD/HRM Practices in India and the United States

Science.gov (United States)

Ghosh, Rajashi; Chaudhuri, Sanghamitra

2009-01-01

This article proposes a conceptual model to explore the effects of intergenerational transition in individualism/collectivism orientations on the outlook towards different human resource development (HRD) and management practices. It contributes to the existing cross-cultural research in HRD by defining three prominent generations in India and by…

Effects on U.S. Timber Outlook of Recent Economic Recession, Collapse in Housing Construction, and Wood Energy Trends

Science.gov (United States)

Peter J. Ince; Prakash Nepal

2012-01-01

This paper reviews recent trends and structural changes in U.S. forest product markets and projects their effects on the long-range U.S. timber market outlook. The analysis derives from the same U.S. and global economic model that produced 50-year projections for the 2010 RPA nationwide forest assessment, but analysis is revised to more accurately include the economic...

An Electron Fixed Target Experiment to Search for a New Vector Boson A' Decaying to e+e-

Energy Technology Data Exchange (ETDEWEB)

Essig, Rouven; Schuster, Philip; /SLAC; Toro, Natalia; /Stanford U., Phys. Dept.; Wojtsekhowski, Bogdan; /Jefferson Lab

2010-06-11

We describe an experiment to search for a new vector boson A' with weak coupling {alpha}' {approx}> 6 x 10{sup -8} {alpha} to electrons ({alpha} = e{sup 2}/4{pi}) in the mass range 65 MeV < m{sub A'} < 550 MeV. New vector bosons with such small couplings arise naturally from a small kinetic mixing of the 'dark photon' A' with the photon - one of the very few ways in which new forces can couple to the Standard Model - and have received considerable attention as an explanation of various dark matter related anomalies. A' bosons are produced by radiation off an electron beam, and could appear as narrow resonances with small production cross-section in the trident e{sup +}e{sup -} spectrum. We summarize the experimental approach described in a proposal submitted to Jefferson Laboratory's PAC35, PR-10-009. This experiment, the A' Experiment (APEX), uses the electron beam of the Continuous Electron Beam Accelerator Facility at Jefferson Laboratory (CEBAF) at energies of {approx} 1-4 GeV incident on 0.5-10% radiation length Tungsten wire mesh targets, and measures the resulting e{sup +}e{sup -} pairs to search for the A' using the High Resolution Spectrometer and the septum magnet in Hall A. With a {approx} 1 month run, APEX will achieve very good sensitivity because the statistics of e{sup +}e{sup -} pairs will be {approx} 10,000 times larger in the explored mass range than any previous search for the A' boson. These statistics and the excellent mass resolution of the spectrometers allow sensitivity to {alpha}'/{alpha} one to three orders of magnitude below current limits, in a region of parameter space of great theoretical and phenomenological interest. Similar experiments could also be performed at other facilities, such as the Mainz Microtron.

Gas Storage in Europe, recent developments and outlook to 2035

International Nuclear Information System (INIS)

Hureau, Geoffroy

2015-01-01

These slides present: the European gas storage market in 2014 (Review of 2014 trends, Current challenges, Role of storage); the Outlook to 2035 (Supply/Demand factors, Estimated Storage needs, Project backlog). In conclusion: an over capacity is expected until 2025.Supply and demand evolution, market liberalization and environmental constraints on coal will drive a new period of growth for UGS. Cedigaz estimates that European UGS capacity will increase by around 45 bcm by 2035. UGS projects represent 77 bcm Of which 22 bcm is under construction, there is a majority of salt-cavern projects (market liberalization), not so much new seasonal storage (security of supply?), not all planned storage will be built (Projects under competition for the same (regional) market, the situation is quite contrasted between NW Europe and South-Southeast Europe (and UK)). The challenges are the investment and the security of supply

The energy outlook in China-Minutes from the seminar organised by the Centre Geopolitique de l'Energie et des Matieres Premieres

International Nuclear Information System (INIS)

Keppler, J.H.; Meritet, S.

2004-01-01

As part of the seminars that are organised on a regular basis, the Centre de Geopolitique de l'Energie et des Matieres Premieres has devoted, on the 2. of June, a day to China, its energetics outlook and the resulting economic and geopolitical challenges. (authors)

Controlled Experiment Replication in Evaluation of E-Learning System's Educational Influence

Science.gov (United States)

Grubisic, Ani; Stankov, Slavomir; Rosic, Marko; Zitko, Branko

2009-01-01

We believe that every effectiveness evaluation should be replicated at least in order to verify the original results and to indicate evaluated e-learning system's advantages or disadvantages. This paper presents the methodology for conducting controlled experiment replication, as well as, results of a controlled experiment and an internal…

Outlooks for the development of ozone-safe refrigerant production at the Minatom facilities

International Nuclear Information System (INIS)

Shatalov, V.V.; Orekhov, V.T.; Dedov, A.S.; Zakharov, V.Yu.; Golubev, A.N.; Tsarev, V.A.

2001-01-01

Results of activities undertaken at the All-Russian Research Institute of Chemical Technology since 1988, which were aimed at search of new methods of synthesis of ozone-safe refrigerants, using depleted uranium hexafluoride waste formed at gas-diffusion plants as fluorinating agent, are considered. It is pointed out that major advantages of the flowsheets making use of UF 6 versus traditional method consist in the fact that the processes are conducted in gas phase under normal pressure and moderate temperatures with UF 6 transfer into a more environmentally friendly form. Outlooks for expansion of production of ozone-safe refrigerants by the method described are discussed [ru

The Social & Mobile Learning Experiences of Students Using Mobile E-Books

Science.gov (United States)

Kissinger, Jeff S.

2013-01-01

This research was designed to explore the learning experiences of state college students using mobile electronic textbook (e-book) readers. The purpose of the study was to build a rich description of how students used e-books delivered on mobile computing devices for college-level, introductory

Coking coal outlook from a coal producer's perspective

International Nuclear Information System (INIS)

Thrasher, E.

2008-01-01

Australian mine production is recovering from massive flooding while Canadian coal shipments are limited by mine and rail capacity. Polish, Czech, and Russian coking coal shipments have been reduced and United States coking coal shipments are reaching their maximum capacity. On the demand side, the Chinese government has increased export taxes on metallurgical coal, coking coal, and thermal coal. Customers seem to be purchasing in waves and steel prices are declining. This presentation addressed the global outlook for coal as well as the challenges ahead in terms of supply and demand. Supply challenges include regulatory uncertainty; environmental permitting; labor; and geology of remaining reserves. Demand challenges include global economic uncertainty; foreign exchange values; the effect of customers making direct investments in mining operations; and freight rates. Consolidation of the coal industry continued and several examples were provided. The presentation also discussed other topics such as coking coal production issues; delayed mining permits and environmental issues; coking coal contract negotiations; and stock values of coking coal producers in the United States. It was concluded that consolidation will continue throughout the natural resource sector. tabs., figs

Making music out of noise. The Sentara Healthcare Experience Implementing e-Care.

Science.gov (United States)

Abraham, Chon; Reese, Bertram

2010-01-01

This paper describes insights from the an implementation experience with a project titled eCare, a comprehensive health IT solution integrating all environments of care and the primary business functions at Sentara Healthcare, the largest system in southeastern Virginia and northeastern North Carolina. eCare is expected to account for more than $16 million by the end of 2009, from realized benefits in quality of care, process efficiencies and firm performance. Made evident by Sentara's experience, eCare-type technology may be as much of a market differentiator for healthcare as the ATM was for banking industry, but prudent management in the implementation process is key.

Bionic Hearing: the Science and the Experience

CERN Multimedia

CERN. Geneva

2018-01-01

Cochlear implants are the first device to successfully restore neural function.  They have instigated a popular but controversial revolution in the treatment of deafness, and they serve as a model for research in neuroscience and biomedical engineering.  After a visual tour of the physiology of natural hearing the function of cochlear implants will be described in the context of electrical engineering, psychophysics, clinical evaluation, and my own personal experience.  The audience will have the opportunity to experience speech and music heard through a cochlear implant. The social implications of cochlear implantation and the future outlook for auditory prostheses will also be discussed.                              ...

Calibrating the CERN ATLAS Experiment with $E/p$

CERN Document Server

Froeschl, R; Aleksa, M

2009-01-01

Inside the ATLAS experiment two proton beams will collide with a center of mass energy of 14 TeV. These proton beams will be delivered with unprecedented high collision rates by the Large Hadron Collider (LHC) at the European Center of Particle Physics, CERN. For important parts of the physics program of ATLAS, e.g. the search for the Higgs boson, the performance of the electromagnetic calorimeter, whose primary task is to measure the energy of electrons and photons, is crucial. The main topic of this thesis is the intercalibration of the energy scale of the electromagnetic calorimeter and the momentum scale of the inner detector. This is an important consistency test for these two detectors. The intercalibration is performed by investigating the ratio E/p for electrons, i.e. the ratio of the energy E measured by the electromagnetic calorimeter and the momentum p measured by the inner detector. The starting point is the Combined Test Beam (CTB) 2004, where a segment of the ATLAS detector was exposed to differ...

Providing pervasive Learning eXperiences by Combining Internet of Things and e-Learning standards

Directory of Open Access Journals (Sweden)

Aroua TAAMALLAH

2015-12-01

Full Text Available Nowadays, learning is more and more taking place anywhere and anytime. This implies that e-learning environments are expanded from only virtual learning environments to both virtual and physical ones. Thanks to the evolution of Internet, ICT (Information and Communication Technology and Internet of Things, new learning scenarios could be experienced by learners either individually or collaboratively. These learning scenarios are Pervasive in such a way that they allow to mix virtual and physical learning environments as well. They are therefore characterized by possible interactions of the learner with the physical environment, the Learner's contextual data detection as well as the adaptation of pedagogical strategies and services according to this context. This paper aims to take advantage of this trend and keep up also with existing e-Learning standards such as IMS LD and LOM. The solution proposed is therefore to extend these standards models with that of Internet of Things and to provide an adaptation approach of learning activities based on learner's context and her/his track using the eXperience API. In this context and in order to allow both reasoning capabilities and interoperability between the proposed models Ontological representations and implementation are therefore proposed. Moreover a technical architecture highlighting the required software components and their interactions is provided. And finally, a relevant pervasive learning scenario is implemented and experimented.

SUBJETIVIDADE, AMIZADE E MONTANHISMO: potencialidades das experiências de lazer e aventura na natureza

Directory of Open Access Journals (Sweden)

Sandoval Vilaverde Monteiro

2004-01-01

Full Text Available O principal objetivo do texto consiste em problematizar as práticas corporais vivenciadas como lazer e aventura em ambientes naturais, em especial aquelas ligadas ao montanhismo, buscando pensá-las no contexto das formas contemporâneas de sociabilidade e processos de subjetivação, indagando sobre os liames sociais suscitados a partir da relação com tais práticas. A partir dos dados provenientes do contexto dos grupos estudados, bem como do referencial teórico adotado, sustenta-se o argumento de que o envolvimento com estas práticas coletivas de lazer e aventura na natureza pode, em algumas situações, ser entendido como experiências existenciais férteis para o exercício de uma relação renovada do sujeito consigo mesmo, com o outro e com a natureza. Este exercício faculta aos sujeitos envolvidos a possibilidade de vivenciar processos renovados de subjetivação coletiva, podendo resultar em formas de amizade mais solidárias, livres e criativas. Palavras-chaves: subjetividade, amizade, lazer, natureza

Strategic Planning for scenarios in the natural environment. The case of the Nature Outlook 2050 GDP

International Nuclear Information System (INIS)

Urbano Lopez de Meneses, J.

2015-01-01

Forward planning is part of strategic planning. It is a regular tool in management and direction of the companies. Some European countries include it in environmental policy cycle. Scenarios approach is a proved qualitative foresight technique. It is useful in high variability and complexity environments. This paper shows how to implement the tool, mixing theoretical explanation and the practical performance done in project called: Nature Outlook 2050. This project has been done by the Netherlands agency for environmental assessment and foresight (PBL). (Author)

Mestres do Tao: tradição, experiência e etnografia

Directory of Open Access Journals (Sweden)

José Bizerril Neto

2005-12-01

Full Text Available Neste artigo analiso a dimensão performática constitutiva da transmissão da tradição em uma linhagem taoísta no Brasil, partindo de uma perspectiva baseada na antropologia da experiência. A idéia de conhecimento no taoísmo baseia-se em uma noção pragmática: conhece-se por experiência pessoal corporificada o legado da tradição. A possibilidade de conhecer está fundada em uma relação pessoal entre mestre e aprendiz, inserida em uma cadeia dialógica e genealógica.In this article I analyse the performative dimension that constitutes the transmission of tradition in taoist lineage located in Brazil, from the perspective of the anthropology of experience. The idea of knowing in taoism is based on a practical notion: one knows the legacy of tradition through personal embodied experience. The very possibility of knowing is based upon a personal relation between master and apprentice, inserted on a dialogical and genealogical.

Contatos imediatos: investigando personalidade, transtornos mentais e atribuição de causalidade em experiências subjetivas com óvnis e alienígenas

OpenAIRE

Leonardo Breno Martins

2012-01-01

Esta pesquisa compara pessoas que alegam experiências anômalas e que não as alegam quanto aos cinco grandes fatores da personalidade, indicadores de transtornos mentais e atribuições de causalidade. O recorte incide sobre experiências caracteristicamente contemporâneas, que mencionam objetos voadores não-identificados (óvnis) e eventos correlatos, como alegadas visões de alienígenas. As variáveis foram escolhidas para o estudo devido ao seu papel teórico na edificação das experiências e aos a...

Association of eHealth literacy with cancer information seeking and prior experience with cancer screening.

Science.gov (United States)

Park, Hyejin; Moon, Mikyung; Baeg, Jung Hoon

2014-09-01

Cancer is a critical disease with a high mortality rate in the US. Although useful information exists on the Internet, many people experience difficulty finding information about cancer prevention because they have limited eHealth literacy. This study aimed to identify relationships between the level of eHealth literacy and cancer information seeking experience or prior experience with cancer screening tests. A total of 108 adults participated in this study through questionnaires. Data covering demographics, eHealth literacy, cancer information seeking experience, educational needs for cancer information searching, and previous cancer screening tests were obtained. Study findings show that the level of eHealth literacy influences cancer information seeking. Individuals with low eHealth literacy are likely to be less confident about finding cancer information. In addition, people who have a low level of eHealth literacy need more education about seeking information than do those with a higher level of eHealth literacy. However, there is no significant relationship between eHealth literacy and cancer screening tests. More people today are using the Internet for access to information to maintain good health. It is therefore critical to educate those with low eHealth literacy so they can better self-manage their health.

Search for νμ→νe oscillations in the NOMAD experiment

International Nuclear Information System (INIS)

Krasnoperov, A.

2000-06-01

The NOMAD experiment is looking for ν μ →ν τ and ν→ν e oscillations in a predominantly ν μ beam at the CERN SPS. Neutrino oscillations are closely related with the existence of non-zero neutrino mass and mixing between different flavours. This document describes the search for ν μ →ν e oscillations in the full NOMAD data sample accumulated during four years of data-taking (1995-98). The search for ν e appearance was performed by studying the charged current (CC) interactions with in the NOMAD detector. The selection of ν e CC and ν μ interactions with the help of different particle identification algorithms, as well as using the event kinematic criteria, is described here in detail. We show that the NOMAD experiment is sensitive to the LSND allowed region of oscillation parameters with the squared mass difference larger than 10 eV 2 /C 4 . An upper limit on the probability of ν μ →ν e oscillations, based on a fraction of the NOMAD data, is given. (author)

18-month outlook : an assessment of the reliability of the Ontario Electricity System

International Nuclear Information System (INIS)

2005-01-01

This paper provides an 18 month forecast of the Ontario electricity system, as well as an outline of activities and recent developments relating to the issue of reliability. An additional aim of the paper was to identify potentially adverse conditions that may require adjustment or coordination of maintenance plans for generation and transmission equipment. Requests for proposals (RFPs) for renewable generation within the specified time-frame were also discussed, as well as the return to service of Ontario Power Generation's Pickering Unit 1. Reduced reserve levels for the summer of 2005 were anticipated, and details of forecasted peak demand, generator maintenance, new generation and price-responsive demand adjustments and forced outage rates were presented. It was suggested that adequate market mechanisms were in place to manage reserve levels. Developments concerning the new Parkway Transformer station were reviewed. A resource outlook was provided. Available resources were expected to exceed planning requirements with the exception of 6 weeks in the summer of 2005. A projected capacity increase was also anticipated, due to the return of Pickering 1 and an additional 515 MW in the fall of 2005. Price-responsive demands were forecasted to exceed 650 MW due to increases in dispatchable load. It was suggested that in order to ensure power demand during peak periods, imports may be required under extreme weather conditions, combined with the possible deferral or cancellation of generation maintenance. Transmission impacts due to shutdowns were discussed. Voltage system requirements were reviewed, along with details of the installation of additional shunt capacitors and transformer controls. The electricity market was reviewed in the context of current overall economic conditions. Data forecasting normal peak demand was presented for the entire outlook period. 19 tabs., 10 figs

Flex-prints for the Mu3e experiment

Energy Technology Data Exchange (ETDEWEB)

Dittmeier, Sebastian [Physikalisches Institut, Universitaet Heidelberg (Germany); Collaboration: Mu3e-Collaboration

2016-07-01

Mu3e is a novel experiment dedicated to the search for the charged lepton flavor violating decay μ{sup +} → e{sup +}e{sup -}e{sup +} with a targeted sensitivity of a branching ratio (BR) down to 10{sup -16}. Within the standard model of particle physics this process is extremely suppressed to BR<10{sup -54}. Thus, any observation would be a clear sign for new physics beyond the standard model. The Mu3e detector consists of a silicon pixel tracking detector using the novel HV-MAPS (High Voltage Monolithic Active Pixel Sensor) technology to measure the momentum of the decay products, and scintillating fibres and tiles for precise timing. The pixel sensors are thinned to 50 μ m to achieve a material budget of about 0.1% radiation length per tracking layer. The pixel sensors are powered and connected to readout frontend boards using custom designed flex-prints, which are low material interconnects with a high signal density. We present studies of high speed data transmission up to 3.2 Gb/s over flex-print prototypes produced in-house. The design of the flex-prints for the Mu3e detector will be discussed. A 3-layer design including power, ground and slow control distribution, as well as 9 1.25 Gb/s data transmission lines for the readout of the pixel sensors is foreseen.

Precise measurement in elastic electron scattering: HAPPEX and E-158 experiments

International Nuclear Information System (INIS)

Vacheret, A.

2004-12-01

Parity Violation asymmetry measurements in elastic electron scattering are in one hand an interesting way of retrieving new informations about the sea quarks of the nucleon and in the other hand a powerful test of the Standard Model electroweak sector at low energy. This thesis describes the HAPPEX experiment at JLab and the E-158 experiment at SLAC (USA) which measure de parity violation asymmetries in elastic scattering of polarized electron on nuclei like Hydrogen or Helium and on atomic electrons. With the measurements on hadronic targets one can extract the strange quarks contribution to the charge and current density of the nucleon. With the electron-electron scattering one can test the standard model at the loop level and far from the Z pole by extracting sin 2 θ W . In this thesis we describe the formalism associated with the electroweak probe. We present in detail the experimental methods used to make such precise measurements of parity violation asymmetry. Then, we describe the experimental set-up of each experiment and in particular the electron detector and the feedback loop on the beam current for the HAPPEX experiment and the analysis of E-158 run III with a dedicated systematic study on the beam sub-pulse fluctuations. We present the preliminary results for each experiment with a comparison with the other existing results and the future experiments. (author)

Beam Extinction Monitoring in the Mu2e Experiment

Energy Technology Data Exchange (ETDEWEB)

Prebys, Eric [Fermilab; Bartoszek, Larry [Technicare; Gaponenko, Andrei [Fermilab; Kasper, Peter [Fermilab

2015-06-01

The Mu2e Experiment at Fermilab will search for the conversion of a muon to an electron in the field of an atomic nucleus with unprecedented sensitivity. The experiment requires a beam consisting of proton bunches approximately 200ns FW long, separated by 1.7 microseconds, with no out-of-time protons at the 10⁻¹⁰ fractional level. The verification of this level of extinction is very challenging. The proposed technique uses a special purpose spectrometer which will observe particles scattered from the production target of the experiment. The acceptance will be limited such that there will be no saturation effects from the in-time beam. The precise level and profile of the out-of-time beam can then be built up statistically, by integrating over many bunches.

Feasibility of 81Br(nu,e-)81Kr solar neutrino experiment

International Nuclear Information System (INIS)

Hurst, G.S.; Allman, S.L.; Chen, C.H.; Kramer, S.D.; Thomson, J.O.; Cleveland, B.

1985-05-01

Several ingenious solutions have been offered for the solar neutrino problem - a defect in the solar model, the appearance of a new type of neutrino physics, the sun is no longer burning, etc. The range of these proffered solutions stresses the need for a new experiment to study the sun. The modern pulsed laser now makes possible a new solar neutrino test which examines an independent neutrino source in the sun. A recently proposed experiment would use the reaction 81 Br(nu,e - ) 81 Kr to measure the flux of 7 Be neutrinos from the sun. When 7 Be decays by electron capture to make 7 Li, a neutrino is emitted at 0.862 MeV and the flux of these on the earth is about 4 x 10 9 cm -2 s -1 , according to the standard model. Therefore, an experiment based on 81 Br(nu,e - ) 81 Kr which is sensitive to these lower energy neutrinos would be of fundamental importance. To first order, the chlorine experiment detects the 8 B neutrinos while bromine detects the much more abundant 7 Be neutrino source. In practice, the proposed bromine experiment would be very similar to the chlorine radiochemical experiment, except that 81 Kr with a half-life of 2 x 10 5 years cannot be counted by decay methods. With an experiment of about the same volume as the chlorine experiment (380 m 3 ) filled with CH 2 Br 2 , the model predicts about 2 atoms of 81 Kr per day. The bromine experiment depends entirely on the RIS method, implemented with pulsed lasers, for its success. 10 refs., 3 figs

Weak mixing and CP-violation involving heavy quarks and possible measurements in e+e- experiments

International Nuclear Information System (INIS)

Ali, A.; Aydin, Z.Z.

1978-09-01

We evaluate weak mass mixing among the neutral heavy mesons with a bottom (Q = -1/3) or top (Q = +2/3) quark and CP-violation in the frame work of six quark (V - A) models. It is argued that bottom and top mesons may distinguish the Higgs exchange mechanism of CP-violation from a complex phase in the quark mass matrix, if bottom and top quark masses are sufficiently different. Estimates of weak mixing-and CP-violating effects for e + e - experiments at PETRA, PEP and CESR energies are presented. (orig.) [de

Life cycle assessment of renewables: present issues, future outlook and implications for the calculation of external costs

International Nuclear Information System (INIS)

Frankl, P.

2002-01-01

In principle, Life Cycle Assessment (LCA) is certainly appropriate for estimating external costs of renewables, since major environmental impacts of the latter are generated in phases of the life cycle other than use. In practice however, several issues still remain. They are related to the availability and quality of Life Cycle Inventory (LCI) data, to the frit technological development of renewable energy technologies (RET), to the existence of many different applications of the latter and to a strong dependency on local conditions. Moreover, a 'static' picture of present technologies is not enough for policy indications. Therefore some kind of dynamic LCA is needed. These LCA issues are reflected in the calculation of external costs. First, the paper discusses these issues on the examples of two main technologies, namely photovoltaic (PV) and wind. Second, it discusses the results of ExternE for these two specific technologies and gives an outlook for the future. Future needs for a better use of LCA as a support tool for the calcination of external costs are identified. Finally, a new research project funded by the European Commission focused on LCI of renewables is briefly introduced and presented. (author)

As práticas educativas parentais e a experiência das crianças Parental education practices and children's experience

Directory of Open Access Journals (Sweden)

Cléopâtre Montandon

2005-08-01

Full Text Available Este artigo tenta mostrar o quanto é importante estudar a experiência das crianças e seus pontos de vista para podermos compreender os diferentes fenômenos sociais que lhes dizem respeito. Na perspectiva da sociologia da infância, sua experiência é considerada no âmbito das estruturas sociais e do contexto particular nos quais se insere. A partir de vários exemplos no campo da educação de crianças, a autora argumenta que não basta examinar as práticas educativas de seus educadores, mas que é necessário compreender as perspectivas das crianças ou, dito de modo mais simples, que importa analisar não apenas o que os educadores fazem com as crianças, como também o que estas fazem com o que se faz com elas. Duas pesquisas são apresentadas para apoiar essa abordagem: a primeira diz respeito à experiência que as crianças têm de sua educação no âmbito familiar e escolar; a segunda trata de um objetivo particular dos educadores modernos: o desenvolvimento da autonomia das crianças. Em ambos os estudos, a experiência das crianças foi apreendida por intermédio de suas representações, emoções e ações, e foi situada segundo suas características sociais e culturais.This paper tries to show that the experience of children and their points of view are paramount when one wants to understand the various social phenomena that concern them. According to the perspective of the Sociology of Childhood, children's experience is analyzed in the framework of the social structures and the particular contexts in which it takes place. Using different examples from the field of the education of children, the author argues that it is not sufficient to examine the educational practices of adults; it is equally important to examine the children's perspective. In other words, we should take into consideration what the children do with what is done to them. Two studies are presented to support this approach: the first one concerns the

The current and short term outlook for offshore exploration and development in the UK

International Nuclear Information System (INIS)

Precious, R.G.

1992-01-01

The United Kingdom offshore oil and gas industry began with the first North Sea discoveries in 1965. Of the total estimated hydrocarbon resources, 34% of the 32 billion bbl of oil and gas liquids and 23% of the 124 trillion ft 3 of natural gas have already been produced, and an additional 22% and 23% respectively are currently producing or under development. Average discovery size has declined as the region matures; nevertheless drilling activity has remained high. Low oil prices, increasing operating costs, and the worldwide recession have caused many companies to cut back on capital expenditures. The outlook for North Sea exploration is for smaller, more complex prospects and in areas with greater exploration potential. The outlook for development is for smaller, often economically marginal new fields and existing fields that are increasingly expensive to operate. In new fields, costs can be reduced by simplification and standardization of facilities, using horizontal drilling, lighter modular platforms, subsea technology, and multiphase pipelines. Examples of such developments at Shell/Esso's Osprey and Gannet fields are described. In existing fields, emphasis is on upgrading of facilites for extended field life; simplification and automation of facilities is also being carried out to reduce costs. Examples are provided from Shell/Esso's Brent and Leman fields. Other factors affecting future development are outlined. Total U.K. gas demand is forecast to rise to 7-8 billion ft 3 d by the late 1990s; imports may be required to meet total U.K. demand at that time. U.K. oil and liquids production is forecast to increase to a new peak of 2.7 million bbl/d in 1995. 13 figs

Experiência subjetiva do tempo e sua influência no comportamento: revisão e modelos

Directory of Open Access Journals (Sweden)

Alejandro Vásquez Echeverría

Full Text Available Pesquisadores têm tentado explicar, desde o início da psicologia, a experiência temporal das pessoas e sua influência nas cognições, emoções e comportamentos. Trata-se de uma das dimensões mais complexas e influentes da psique, que tem sido abordada a partir de concepções diferentes e sem uma estrutura consensual. Este artigo tem o objetivo de contribuir na sistematização da psicologia do tempo, ampliando um modelo de quatro níveis, aprofundando na percepção do tempo vital ou tempo III. Trabalhos incluídos foram selecionados segundo a sua importância na historia da psicologia ou índice de citação. Sugere-se um modelo explicativo do Tempo III, que inclui discussão e debate e visa integrar os diferentes modelos existentes na literatura.

QED in highly-charged high Z ions - experiments at the storage ring ESR

International Nuclear Information System (INIS)

Mokler, P.H.

1996-01-01

A survey on the fundamental structure aspects of very heavy few -electron ions, in particular H-like systems, is presented. Special emphasis is given to contribution from quantum-electro-dynamics at strong central potentials. The technical possibilities to produce highly-charged heavy ions are reviewed and the ground-state Lamb-shift experiments performed at the heavy ion storage ring ESR are summarized. A short outlook on further developments in this field is added. (author). 23 refs, 9 figs

Legitimidade e não legitimidade das experiências dos sofrimentos e adoecimentos de longa duração

OpenAIRE

Canesqui, Ana Maria

2018-01-01

Resumo Discute-se a legitimidade e não legitimidade das experiências de adoecimentos e sofrimentos de longa duração selecionados, considerados ou não doenças pelos diagnósticos médicos, como a dor, a fadiga crônica e a “pressão alta”, usando pesquisas internacionais e nacionais sociológicas e antropológicas em saúde. As análises dos relatos de adoecidos ou de profissionais de saúde nas pesquisas consideradas exploram o assunto, suas implicações, reflexos e ambiguidades geradas nos sujeitos e ...

Experimentos em bovinos com as favas de Enterolobium contortisiliquum e E. timbouva para verificar propriedades fotossensibilizantes e/ou abortivas Experiments in cattle with the pods of Enterolobium contortisiliquum e E. timbouva to determine photosensitive and abortive properties

Directory of Open Access Journals (Sweden)

Carlos Hubinger Tokarnia

1999-01-01

Full Text Available Em função de históricos obtidos, no presente estudo tentou-se reproduzir, em bovinos, fotossensibilização e/ou aborto com as favas de Enterolobium spp (Leg. Mimosoi-deae. As favas de E. contortisiliquum e E. timbouva ("tamboril" ou "timbaúba", de diversas procedências, inclusive as colhidas durante dois surtos de intoxicação caracterizados por fotossensiblilização e aborto, foram administradas em doses únicas e repetidas, a bovinos jovens e a vacas em gestação. Em todos os experimentos realizados, a resposta à ingestão das favas independentemente da procedência, sempre foi caracterizada por diarréia e diminuição do apetite, passageiras. Também ficou evidente que os animais mostram menor sensibilidade, à medida que ingerem as favas seguidamente. Os experimentos não revelaram possíveis fatores envolvidos ou eventuais condições necessárias para que as favas de Enterolobium contortisiliquum e E. timbouva causem fotossen-siblização e/ou aborto.The pods of Enterolobium spp (Leg.Mimosoideae are said to cause photsensitivity and abortion in cattle. The pods of E. contortisiliquum and E. timbouva ("tamboril" or "timbaúba", collected at various localities, in two occasions during outbreaks of photosensitization and abortions, were fed in single and repeated doses to young bovines and to cows in calf. In all experiments the animals showed only diarrhoea and loss of apetite, as it had been already seen in previous experiments with E. contortisiliquum performed in Fortaleza, northeastern Brazil. Also it was seen again that the animals become tolerant to the toxicity of the pods if they get successive doses. The experiments did not reveal possible conditions necessary for the pods of Enterolobium contortisiliquum and E. timbouva to cause photosensitization and/or abortion.

Etnografia como prática e experiência

Directory of Open Access Journals (Sweden)

José Guilherme Cantor Magnani

2009-12-01

Full Text Available Este artigo, a partir de alguns usos pouco ortodoxos da etnografia, fora do campo da antropologia, propõe uma discussão sobre a especificidade desse método de pesquisa, com base em pesquisas e reflexões realizadas sobre o tema no Núcleo de Antropologia Urbana da USP (NAU. Tomando como ponto de partida uma citação de Lévi-Strauss, repassa alguns autores - Goldman, Peirano, DaMatta, Favret-Saada, entre outros - para estabelecer parâmetros na busca de traços que considera específicos do fazer etnográfico e assim chega a três considerações principais: etnografia como experiência, como prática e com base numa certa noção de totalidade. O relato de uma etnografia sobre jovens surdos é apresentado para oferecer um suporte empírico àquelas conclusões.Considering some less orthodox uses of ethnography, not belonging to the anthropological field, this article proposes a discussion on the specificities of the ethnographical research method, based on reflections and researches undertaken at the Urban Anthropology Nucleus (NAU. Taking a Lévi-Strauss's quotation as its starting point, it examines the ideas of authors like Goldman, Peirano, Da Matta, Favret-Saada, among others, in order to establish parameters to guide the search for specific features in the ethnographic métier. Such a discussion leads to three considerations: ethnography as experience, as practice, and as based on a certain concept of "totality". The report of an ethnography on deaf young people is included in the article as empirical support to the conclusions.

Future electricity supplies must be secured - Swiss outlook for 2035 / 2050

International Nuclear Information System (INIS)

2009-01-01

This comprehensive article reviews an update made in 2009 by the Swiss Association of Electricity Enterprises VSE on their paper 'Outlook 2006 on Swiss electricity supply for the period up to 2035 / 2050'. The association is of the opinion that the paper can still form the basis for issue-related public discussion on energy-related questions. The Swiss 'four-pillar' strategy - energy efficiency, renewable energy, large power stations and international energy policy - is noted and supported. The special role played by electricity in the Swiss energy mix is discussed and the issue of security of supply is examined. Possible shortages that could occur in the future are discussed, as is the question of carbon dioxide emissions. Economic viability and power prices are discussed. Energy efficiency and power production options are also examined. Combined heat and power, hydropower and nuclear power are examined and, finally, import and export options reviewed

The outlook of the Korean petroleum industry and its deregulation process

International Nuclear Information System (INIS)

Youngseok Moon

1997-01-01

This paper explores the outlook for the oil product supply and demand balance in Korea and the implications for future refinery market conditions. Forecasts of demand growth are compared with the industry's recent capacity expansion to evaluate potential future market positions. The possible impact of the current deregulation process, started in January 1977, is summarized. In addition, the short-term and long-term uncertainties of the market are discussed. The future business environment for refiners in Korea is likely to be tougher than expected. Although substantial new refining capacity was added recently, the demand for oil products is expected to increase less rapidly. The overall product balance and the threat of imports from outside the region indicate that refiners may suffer from a decrease in utilization rate. Challenges lie ahead if Korean oil refiners are to be part of a successful and mature industry. (author)

Overview and outlook on muon survey tomography based on micromegas detectors for unreachable sites technology

Directory of Open Access Journals (Sweden)

Roche I. Lázaro

2016-01-01

Full Text Available The present document describes the functioning principles of the Muon Survey Tomography based on Micromegas detectors for Unreachable Sites Technology and its distinguishing features from other Micromegas-like detectors. Additionally, it addresses the challenges found while operating the first generation and the resulting improvements. Currently, the project Temporal Tomography of the Densitometry by the Measurement of Muons is focused on obtaining a reliable pulse from the micromesh, associated to the passing of a muon, in order to trigger the acquisition and operate in standalone mode. An outlook of the future steps of the project is provided as well.

"Antes e depois da LMC": experiências e dimensões da leucemia mieloide crônica como uma ruptura biográfica

Directory of Open Access Journals (Sweden)

Yeimi Alexandra Alzate López

2014-10-01

Full Text Available O artigo analisa as experiências de enfermidade de pacientes com leucemia mieloide crônica (LMC, centrando nas dimensões que apontam a chegada da doença como uma ruptura biográfica. Este estudo qualitativo baseou-se na análise das narrativas de seis pacientes, com idades entre 23 e 62 anos, usuários do Sistema Único de Saúde (SUS e pacientes de um hospital – centro de referência em atenção hematológica na cidade de Salvador, Bahia, Brasil. Nos resultados apresenta-se a experiência de ruptura com base em três categorias (1 os significados da doença e a LMC como ameaça; (2 rupturas físicas, sociais e as experiências estigmatizantes; (3 a percepção de um “antes” e um “depois” da LMC, apontando para as mudanças no self, nas relações sociais e na vida cotidiana. Concluiu-se que os impactos biográficos, sociais e dos sistemas de saúde (considerando o custo das medicações atualizam e ampliam questões como o acesso a tratamentos, assim como o enfrentamento do certo e do incerto, em que o “conhecido” da LMC encontra-se pouco acessível ao estoque de conhecimento da vida cotidiana.

Search for {nu}{sub {mu}}{yields}{nu}{sub e} oscillations in the NOMAD experiment; Recherche des oscillations {nu}{sub {mu}}{yields}{nu}{sub e} dans l'experience NOMAD

Energy Technology Data Exchange (ETDEWEB)

Krasnoperov, A

2000-06-01

The NOMAD experiment is looking for {nu}{sub {mu}}{yields}{nu}{sub {tau}} and {nu}{yields}{nu}{sub e} oscillations in a predominantly {nu}{sub {mu}} beam at the CERN SPS. Neutrino oscillations are closely related with the existence of non-zero neutrino mass and mixing between different flavours. This document describes the search for {nu}{sub {mu}}{yields}{nu}{sub e} oscillations in the full NOMAD data sample accumulated during four years of data-taking (1995-98). The search for {nu}{sub e} appearance was performed by studying the charged current (CC) interactions with in the NOMAD detector. The selection of {nu}{sub e} CC and {nu}{sub {mu}} interactions with the help of different particle identification algorithms, as well as using the event kinematic criteria, is described here in detail. We show that the NOMAD experiment is sensitive to the LSND allowed region of oscillation parameters with the squared mass difference larger than 10 eV{sup 2}/C{sup 4}. An upper limit on the probability of {nu}{sub {mu}}{yields}{nu}{sub e} oscillations, based on a fraction of the NOMAD data, is given. (author)

Comparison of the effects of 665 nm low level diode Laser Hat versus and a combination of 665 nm and 808nm low level diode Laser Scanner of hair growth in androgenic alopecia.

Science.gov (United States)

Barikbin, Behrooz; Khodamrdi, Zeinab; Kholoosi, Leila; Akhgri, Mohammad Reza; Haj Abbasi, Majid; Hajabbasi, Mojgan; Razzaghi, Zahra; Akbarpour, Samaneh

2017-05-17

This study aimed to evaluate the effectiveness of a combined set of low level diode laser scanner (665 nm and 808nm) on hair growth, and assessment of safety and effectiveness of a new laser scanner on hair growth treatment procedure in androgenic alopecia. 90 patients (18 to 70 years) with androgenic alopecia were randomized into three groups. The first group (n=30) received 655 nm red light using laser hat, the second group (n=30) received 655 nm red laser plus 808 nm infrared laser using a laser scanner of hair growth device (with the patent number: 77733) and the third group (n=30) received no laser as the control group. Patients in laser scanner group had better results and showed a higher increase in terminal hair density compared with laser hat group (mean of 9.61 versus 9.16 per cm 2 ). We found significant decrease in terminal hair density from baseline in control group (mean -1.8 per cm 2 , plaser scanner of the hair growth group compared with laser hat and the control group. The study showed that treatment with new laser devise had a promising result without any observable adverse effects.

Seiberg duality and e+e- experiments

International Nuclear Information System (INIS)

De Gouvea, Andre; Friedland, Alexander; Murayama, Hitoshi

1998-01-01

Seiberg duality in supersymmetric gauge theories is the claim that two different theories describe the same physics in the infrared limit. However, one cannot easily work out physical quantities in strongly coupled theories and hence it has been difficult to compare the physics of the electric and magnetic theories. In order to gain more insight into the equivalence of two theories, we study the ''e + e - '' cross sections into ''hadrons'' for both theories in the superconformal window. We describe a technique which allows us to compute the cross sections exactly in the infrared limit. They are indeed equal in the low-energy limit and the equality is guaranteed because of the anomaly matching condition. The ultraviolet behavior of the total ''e + e - '' cross section is different for the two theories. We comment on proposed nonsupersymmetric dualities. We also analyze the agreement of the ''γγ'' and ''WW'' scattering amplitudes in both theories, and in particular try to understand if their equivalence can be explained by the anomaly matching condition

Book Review "Advances on remote laboratories and e-learning experiences"

Directory of Open Access Journals (Sweden)

Jesús A. del Alamo

2007-08-01

Full Text Available Book Review "Advances on remote laboratories and e-learning experiences", book editors: Luís Gomes and Javier García-Zubía, University of Deusto, Spain. Reviewed by Jesús A. del Alamo, Massachusetts Institute of Technology, M.I.T.

Evaluating the Effects of Vocational Training in Africa (based on the "African Economic Outlook 2008"), OECD Development Centre Policy Insights, No. 61

Science.gov (United States)

Kingombe, Christian

2008-01-01

The impact of vocational training on economic growth and poverty reduction in African countries is unknown. Without such knowledge, however, countries and donors cannot formulate appropriate policies. Even the 35 countries surveyed in the 2008 "African Economic Outlook" can only supply approximate data. More and better data are needed to…

Iran's petroleum policy: Current trends and the future outlook

International Nuclear Information System (INIS)

Pezeshki, S.; Fesharaki, F.

1994-12-01

The Iranian economy and political situation have undergone radical changes since the 1979 Islamic revolution. The excesses of the early years of the revolution have gradually given way to moderation and a more pragmatic economic policy--based on the principles of the free market. The petroleum policy, as a subset of the economic policies, has been somewhat affected by the political and economic developments in Iran. The petroleum policy has changed from a position of no foreign participation to a position that includes a desire for foreign participation, the text of a model contract, and an attempt to introduce new technologies in the upstream sector. This report provides an overview of the key issues facing the Iranian oil industry and the economic context in which the oil industry is operating in Iran. It describes the evolution of policies meant to move the oil industry toward the free market; it discusses Iran's oil trading partners, the outlook for refining and project investments, and current and likely future developments in the natural gas and petrochemical sectors. In short, the report provides an up-to-date assessment of the Iranian petroleum sector and its likely evolution in the future

Muon Intensity Increase by Wedge Absorbers for Low-E Muon Experiments

Energy Technology Data Exchange (ETDEWEB)

Neuffer, D. V. [Fermilab; Stratakis, D. [Fermilab; Bradley, J. [Fermilab

2017-09-01

Low energy muon experiments such as mu2e and g-2 have a limited energy spread acceptance. Following techniques developed in muon cooling studies and the MICE experiment, the number of muons within the desired energy spread can be increased by the matched use of wedge absorbers. More generally, the phase space of muon beams can be manipulated by absorbers in beam transport lines. Applications with simulation results are presented.

Predicting wildfire ignitions, escapes, and large fire activity using Predictive Service’s 7-Day Fire Potential Outlook in the western USA

Science.gov (United States)

Karin L. Riley; Crystal Stonesifer; Haiganoush Preisler; Dave Calkin

2014-01-01

Can fire potential forecasts assist with pre-positioning of fire suppression resources, which could result in a cost savings to the United States government? Here, we present a preliminary assessment of the 7-Day Fire Potential Outlook forecasts made by the Predictive Services program. We utilized historical fire occurrence data and archived forecasts to assess how...

Human performance tools in nuclear power plants. Introduction, implementation and experiences

International Nuclear Information System (INIS)

Dexheimer, Kai; Bassing, Gerd; Kreuzer, Peter

2015-01-01

The basis of safe nuclear power plant operation (NPP) and a strong safety culture is the professional application of Human Performance Optimisation Tools (HPO). HPO trainings have been carried out by German NPPs for a number of years and recently also by Swiss NPPs. This article describes the origination, the bases, experiences and thereby the special features of the HPO training programme applied by German NPP operators. Moreover, this article provides an outlook on future developments - in particular when considering the requirements of the ongoing phase out of nuclear energy in Germany.

Status of soft photons in experiment E855

International Nuclear Information System (INIS)

Woody, C.; Lissauer, D.; Gomez del Campo, J.; Ray, A.; Shapira, D.; Tincknell, M.; Clark, R.; Erd, C.; Schukraft, J.; Willis, W.

1990-01-01

Experiment E855 was carried out at the AGS at Brookhaven National Laboratory to study soft photon production near center of mass rapidity Y cm ∼ 0 in proton-nucleus collisions at 10 at 18 GeV/c. This was the first dedicated experiment to study this phenomenon at these lower energies. It is important to note that the related process of low mass dilepton pair production has been studied extensively at these energies and an excess signal of dileptons above known hadronic backgrounds has been firmly established. E855 was designed to measure photon production from P t ∼ 5 MeV/c up to several GeV/c. A search will be made for an excess of soft photons in the P t region below the Jacobian peak from π 0 decays, above that which is expected from hadronic bremsstrahlung. Any observed signal will be correlated with the total charged multiplicity in the event in order to determine its production mechanism. This correlation can be used to distinguish purely hadronic sources of soft photons, such as mesons decays and bremsstrahlung, which vary linearly with the charged multiplicity, and a thermal source of soft photons which would exhibit a quadratic dependence on the charged multiplicity. In addition, E855 will measure low energy photons from nuclear decays which can be a background for measuring soft photons near Y cm ∼ 0. These photons are also interesting from a nuclear physics point of view, since the spectrum of photons from nuclei excited by incident high energy protons gives a measure of the temperature of the excited nucleus and the amount of excitation energy which can be transferred to a nucleus in a high energy proton collision

The interplay between value and service quality experience: e-loyalty development process through the eTailQ scale and value perception

OpenAIRE

Li, Honglei; Aham-Anyanwu, Nnanyelugo; Tevrizci, Cemal; Luo, Xin

2015-01-01

This research aims to investigate the process and factors relevant for developing customer e-loyalty from an e-service quality experience perspective. Based on previously published loyalty studies and e-commerce literature, an integrated model of e-loyalty development process is proposed by including and validating value perception and the e-service quality scale eTailQ scale. The eTailQ scale consists of website design, security/privacy, value perception, reliability and customer support and...

User Experience: essencial no projeto de produtos e serviços

Directory of Open Access Journals (Sweden)

Antonio Mendes Silva Filho

2012-03-01

Full Text Available Simplicidade é um desejo inconsciente buscado pelo ser humano quando utiliza um produto para executar uma tarefa. Simplicidade é um objetivo de projeto que todo projetista deve ter em mente quando projeta um novo produto. O projetista deve se colocar no lugar do usuário do produto, buscando entender se as funcionalidades implementadas pelo sistema e a maneira pela qual elas podem ser acessadas são facilmente assimiladas pelos usuários. Ter essa preocupação é considerar a usabilidade como determinante no processo de desenvolvimento de um produto ou sistema. Essa atitude impacta diretamente sobre a aceitabilidade e sucesso do produto. Este artigo aborda como a experiência do usuário (user experience é essencial no desenvolvimento de novos produtos.

Efeitos da experiência nas dimensões de intensidade, direção e frequência da ansiedade e autoconfiança competitiva: Um estudo em atletas de desportos individuais e coletivos

OpenAIRE

Fernandes, Marcos Gimenes; Nunes, Sandra Adriana Neves; Raposo, José Vasconcelos; Fernandes, Helder Miguel

2014-01-01

O presente estudo teve os seguintes objetivos: i) examinar as correlações inter-escalas entre as três dimensões de respostas (intensidade, direção e frequência) do CSAI-2R e sua relação com a experiência competitiva; e ii) verificar o efeito da experiência competitiva na ansiedade (cognitiva e somática) e na autoconfiança na amostra total e em função de diferentes tipos de modalidades (individuais vs. coletivas). A amostra foi composta por 267 atletas (196 do sexo masculino e 71 do sexo femin...

Insights for the third Global Environment Outlook from related global scenario anlayses. Working paper for GEO-3

OpenAIRE

Bakkes JA; Goldewijk CGM; Meijer JR; Rothman DS; Vries HJM de; Woerden JW van; United Nations Environment Programme (UNEP); MNV

2001-01-01

This report relates to the ongoing development of scenarios for the third Global Environment Outlook (GEO-3) of UNEP. It illustrates the scale and type of environmental impacts that GEO-3 needs to consider. It does so by quantifying impacts using existing, recent studies whose scenarios come closest to the current tentative global storylines for GEO-3. With a view to GEO-3;s envisaged role as input for the Rio+10 Earth Summit in 2002, this report suggests a focus for the GEO-3 scenario analys...

Tempo e Trânsito na Experiência Subjetiva de Motoristas

Directory of Open Access Journals (Sweden)

Ana Inez Oka Elvas de Lima

2015-03-01

Full Text Available Esta pesquisa investiga como são percebidos e vivenciados o tempo e a pressa no trânsito por motoristas de Fortaleza, identificando e analisando seus estados subjetivos e comportamentos associados a essa experiência. Para a coleta de dados, organizaram-se quatro grupos focais, a partir dos quais emergiram diversos elementos relacionados ao tempo e à pressa e à incidência de comportamentos inadequados no trânsito, segundo o sexo e a idade dos participantes. Para analisar os dados obtidos nas discussões grupais utilizaram-se os critérios da Análise Clássica de Conteúdo. Os resultados levaram à conclusão de que a questão do tempo e da pressa constitui um potencial gerador de erros e violações na condução de veículos, pois exerce influência decisiva sobre os comportamentos dos motoristas e configura uma realidade importante para se compreender os fatores humanos envolvidos na dinâmica do trânsito e do ambiente urbano como um todo.

“Aniversário Guanabara”: comunicação, consumo e experiência comum

Directory of Open Access Journals (Sweden)

João Luis de Araújo Maia

2015-12-01

Full Text Available Neste artigo, discutimos como experiências de consumo podem compreender muito mais que a simples venda e aquisição de bens ou serviços. Nosso foco está na experiência vivida de forma compartilhada, onde o desejo de estar junto, em meio à multidão, ganha mais destaque e relevância que a prática econômica do consumo. No evento “Aniversário Guanabara”, comprar barato é apenas um dos dados que orientam os consumidores. Tocar-se, esbarrar-se e vivenciar a confusão nos corredores do supermercado assumem um caráter de divertimento e prazer para muitos que ali estão.

Rapid Damage Assessment by Means of Multi-Temporal SAR — A Comprehensive Review and Outlook to Sentinel-1

Directory of Open Access Journals (Sweden)

Simon Plank

2014-05-01

Full Text Available Fast crisis response after natural disasters, such as earthquakes and tropical storms, is necessary to support, for instance, rescue, humanitarian, and reconstruction operations in the crisis area. Therefore, rapid damage mapping after a disaster is crucial, i.e., to detect the affected area, including grade and type of damage. Thereby, satellite remote sensing plays a key role due to its fast response, wide field of view, and low cost. With the increasing availability of remote sensing data, numerous methods have been developed for damage assessment. This article gives a comprehensive review of these techniques focusing on multi-temporal SAR procedures for rapid damage assessment: interferometric coherence and intensity correlation. The review is divided into six parts: First, methods based on coherence; second, the ones using intensity correlation; and third, techniques using both methodologies combined to increase the accuracy of the damage assessment are reviewed. Next, studies using additional data (e.g., GIS and optical imagery to support the damage assessment and increase its accuracy are reported. Moreover, selected studies on post-event SAR damage assessment techniques and examples of other applications of the interferometric coherence are presented. Then, the preconditions for a successful worldwide application of multi-temporal SAR methods for damage assessment and the limitations of current SAR satellite missions are reported. Finally, an outlook to the Sentinel-1 SAR mission shows possible solutions of these limitations, enabling a worldwide applicability of the presented damage assessment methods.

Oil outlook to 2020

International Nuclear Information System (INIS)

Shihab-Eldin, A.; Hamel, M.; Brennand, G.

2003-01-01

OPEC's World Energy Model, OWEM, is used to develop the outlook for oil demand and supply to 2020. The reference case assumes world economic growth averaging 3.3 per cent per annum, while OPEC's Reference Basket of seven crudes remains mainly in the target range of US $22-28 a barrel, in nominal terms. With no additional assumed policy measures, for example, to reduce CO 2 emissions, the reference case sees world oil demand rising from 76 million barrels a day in 2000 to 89 mb/d in 2010 and 107 mb/d in 2020. More than three-quarters of this increase comes from developing countries. The most important sector for a demand increase is transportation, accounting for 60 per cent of the rise globally. On the supply side, the oil resource base is not considered a constraint to satisfying this increase in demand. Non-OPEC production is expected to continue to grow during the current decade, and to stabilise at a level of 53-55 mb/d beyond 2010. OPEC production is projected to reach 36 mb/d by 2010 and 52 mb/d in 2020. It is important, however, to recognise the uncertainties pervading such an assessment. For example, it is not clear how future economic growth, energy policies and technology will develop over this time horizon, and this inevitably clouds any assessment of future oil demand and supply. In an attempt to quantify one aspect of such uncertainty, other feasible economic growth rates have been assumed, the results of which suggest that OPEC output by 2010 could be 4-5 mb/d higher or lower than in the reference case, while the range is clearly even greater in the years to 2020. Moreover, policy reactions to such developments could compound the uncertainty. On the other hand, such alternative economic growth could place pressure upon oil prices to move outside OPEC's price band of $22-28/b. These uncertainties illustrate the scope of the challenges confronting the oil industry, especially given the long lead-time nature of oil industry investment, in making

The outlook for natural gas markets in the GRI baseline projection

International Nuclear Information System (INIS)

Holtberg, P.D.

1990-01-01

Gas Research Institute is an independent, not-for-profit organization that plans, manages, and develops financing for a cooperative research and development program for the mutual benefit of the natural gas industry and its customers. The research program consists of over 500 active research projects in natural gas supply and end use, and in gas industry operations, as well as related basic research. This paper summarizes the U.S. natural gas demand and supply outlook projected in a preliminary version of the 191 edition of the GRI Baseline Projection of U.S. Energy Supply and Demand. The projection used for this paper is from an early run of the GRI modeling structure. As such, it is subject to substantial revision before the Baseline Projection is finalized. The paper presents a projection of natural gas demand in the major end-use sectors and the slate of supply sources expected to meet that demand over the period from 1989 to 2010

World Energy Outlook Special Report 2013: Redrawing the Energy Climate Map

Energy Technology Data Exchange (ETDEWEB)

NONE

2013-06-01

Governments have decided collectively that the world needs to limit the average global temperature increase to no more than 2°C and international negotiations are engaged to that end. Yet any resulting agreement will not emerge before 2015 and new legal obligations will not begin before 2020. Meanwhile, despite many countries taking new actions, the world is drifting further and further from the track it needs to follow. The energy sector is the single largest source of climate-changing greenhouse-gas emissions and limiting these is an essential focus of action. The World Energy Outlook has published detailed analysis of the energy contribution to climate change for many years. But, amid major international economic preoccupations, there are worrying signs that the issue of climate change has slipped down the policy agenda. This Special Report seeks to bring it right back on top by showing that the dilemma can be tackled at no net economic cost.

Current status and future outlook for bonded neodymium permanent magnets (invited)

International Nuclear Information System (INIS)

Croat, J.J.

1997-01-01

Bonded neodymium magnets can provide significant size and weight reduction and/or performance enhancement over sintered and, particularly, bonded ferrite permanent magnets and, moreover, provide these benefits at reasonable cost. Primarily for these reasons, these bonded magnets are now used in a wide and growing range of computer peripheral, office automation, and consumer electronic applications and now constitute the fastest growing segment of the permanent magnet market. The current status of these materials will be reviewed. Included is a brief overview of the manufacture of these magnetically isotropic magnets and a discussion of their unique properties and features from the perspective of both bonded magnet producer and user. Major applications are discussed as are some of the factors that will drive the market for these materials in the future. New technical developments, including the status and outlook for anisotropic bonded materials, high remanance isotropic materials and high temperature bonded magnets will also be discussed. copyright 1997 American Institute of Physics

Development of a Pilot Data Management Infrastructure for Biomedical Researchers at University of Manchester – Approach, Findings, Challenges and Outlook of the MaDAM Project

Directory of Open Access Journals (Sweden)

Meik Poschen

2012-12-01

Full Text Available Management and curation of digital data has been becoming ever more important in a higher education and research environment characterised by large and complex data, demand for more interdisciplinary and collaborative work, extended funder requirements and use of e-infrastructures to facilitate new research methods and paradigms. This paper presents the approach, technical infrastructure, findings, challenges and outlook (including future development within the successor project, MiSS of the ‘MaDAM: Pilot data management infrastructure for biomedical researchers at University of Manchester’ project funded under the infrastructure strand of the JISC Managing Research Data (JISCMRD programme. MaDAM developed a pilot research data management solution at the University of Manchester based on biomedical researchers’ requirements, which includes technical and governance components with the flexibility to meet future needs across multiple research groups and disciplines.

Midlatitude Continental Convective Clouds Experiment (MC3E)

Energy Technology Data Exchange (ETDEWEB)

Jensen, MP; Petersen, WA; Del Genio, AD; Giangrande, SE; Heymsfield, A; Heymsfield, G; Hou, AY; Kollias, P; Orr, B; Rutledge, SA; Schwaller, MR; Zipser, E

2010-04-10

The Midlatitude Continental Convective Clouds Experiment (MC3E) will take place in central Oklahoma during the April–May 2011 period. The experiment is a collaborative effort between the U.S. Department of Energy (DOE) Atmospheric Radiation Measurement (ARM) Climate Research Facility and the National Aeronautics and Space Administration’s (NASA) Global Precipitation Measurement (GPM) mission Ground Validation (GV) program. The field campaign leverages the unprecedented observing infrastructure currently available in the central United States, combined with an extensive sounding array, remote sensing and in situ aircraft observations, NASA GPM ground validation remote sensors, and new ARM instrumentation purchased with American Recovery and Reinvestment Act funding. The overarching goal is to provide the most complete characterization of convective cloud systems, precipitation, and the environment that has ever been obtained, providing constraints for model cumulus parameterizations and space-based rainfall retrieval algorithms over land that have never before been available.

Women's expectations and experiences regarding e-health treatment: A systematic review.

Science.gov (United States)

Verhoeks, Carmen; Teunissen, Doreth; van der Stelt-Steenbergen, Anke; Lagro-Janssen, Antoine

2017-08-01

There is a gap in knowledge of women's perceptions of e-health treatment. This review aims to investigate women's expectations and experiences regarding e-health. A search was conducted in MEDLINE, EMBASE, CINAHL and PsycInfo in March 2016. We included articles published between 2000 and March 2016, reporting on e-health interventions. The initial search yielded 2987 articles. Eventually, 16 articles reporting on 16 studies were included. Barriers to e-health treatment were lower for women than barriers to face-to-face treatment, such as feelings of shame and time constraints. Women were able to develop an online therapeutic relationship. As reduced feelings of obligation and lack of motivation were women's greatest challenges in completing e-health treatment, they expressed a wish for more support during e-health treatment, preferably blended care. e-Health lowers the threshold for women to seek healthcare. Combining e-health interventions with face-to-face sessions may enhance women's motivation to complete treatment.

Pixel sensor evaluation and online event selection for the Mu3e experiment

Energy Technology Data Exchange (ETDEWEB)

Bruch, Dorothea vom

2017-10-27

Despite having survived numerous experimental tests, the standard model of particle physics is not a complete description of nature. The Mu3e experiment tests theories beyond the standard model by searching for the lepton flavour violating decay μ→e{sup +}e{sup -}e{sup +}, aiming at a branching ratio sensitivity of 2.10{sup -15} in a first phase of the experiment. A high precision magnetic spectrometer combined with scintillation detectors will measure the momenta, vertices and timing of the decay products of 1.10{sup 8} μ/s stopped on a target. In this work, a prototype of the high voltage monolithic active pixel sensor envisaged for the spectrometer was characterised. With an efficiency >99% and a time resolution of 14 ns, it meets the requirements imposed on the final sensor. Furthermore, an online signal selection process was developed and implemented on a graphics processing unit (GPU), keeping 98% of signal decays, while reducing the data rate of 80 Gbit/s by a factor of 140; resulting in a rate that can be stored to disk. With the computing performance achieved on the GPU, the selection process can run on the hardware planned for the experiment. Both the online selection and the silicon sensor are key aspects for the success of Mu3e.

Inclusive (e,e'N), (e,e'NN), (e,e'π),... reactions in nuclei

International Nuclear Information System (INIS)

Gil, A.; Oset, E.

1997-01-01

We study the inclusive (e,e'N), (e,e'NN), (e,e'π), (e,e'πN) reactions in nuclei using a Monte Carlo simulation method to treat the multichannel problem of the final state. The input consists of reaction probabilities for the different steps evaluated using microscopical many body methods. We obtain a good agreement with experiment in some channels where there is data and make predictions for other channels which are presently under investigation in several electron laboratories. The comparison of the theoretical results with experiment for several kinematical conditions and diverse channels can serve to learn about different physical processes occurring in the reaction. The potential of this theoretical tool to make prospections for possible experiments, aiming at pinning down certain reaction probabilities, is also emphasized. (orig.)

"Nicarágua na encruzilhada": Cortázar, Vargas Llosa e a experiência sandinista

Directory of Open Access Journals (Sweden)

Adriane Vidal Costa

2009-12-01

Full Text Available No final dos anos 1970 e início dos 80, Julio Cortázar e Mario Vargas Llosa compararam a Nicarágua sandinista com a Cuba de Fidel Castro, colocando em dia o debate sobre a revolução e o socialismo na América Latina. O presente trabalho analisa os artigos de Cortázar e Vargas Llosa para mostrar como eles compreenderam e traduziram a experiência sandinista. Em fins dos anos 1970, muitos intelectuais passaram a defender a Revolução Sandinista, como a possível revolução ideal ou uma nova chance para a experiência socialista na América Latina, como foi o caso de Cortázar. Vargas Llosa, desencantado com as esquerdas, apontava os "erros" do regime que poderiam levar a experiência sandinista a transformar o país centro-americano em uma "nova Cuba".

Direito, opinião pública e racismo nos Estados Unidos e no Brasil: duas experiências de ações afirmativas

Directory of Open Access Journals (Sweden)

Monica Grin

2011-09-01

Full Text Available O presente artigo busca tratar comparativamente duas experiências recentes de reserva de vagas em universidades públicas, nos EUA e no Brasil, que utilizaram o critério racial, e seus impactos na opinião pública. Trata-se, no primeiro caso, da pioneira introdução de cotas para negros na UERJ, em janeiro de 2003; e, no segundo, da decisão da Suprema Corte norte-americana envolvendo a graduação (college e a Escola de Direito (Law School da Universidade de Michigan, em junho de 2003. Como hipótese inicial, sugiro que as duas experiências de cotas raciais em universidades públicas, ainda que assemelhadas, ativam princípios sociológicos, éticos e jurídicos substantivamente diferenciados.

An example of e-p colliding machine experiments at TRISTAN

International Nuclear Information System (INIS)

1980-01-01

This is a design report of a possible detector system of the e-p colliding machine experiment at TRISTAN. The aim of this note is to know what kind of detectors should be developed and what kind of requirements the TRISTAN machines and the environmental supporting facilities should fulfill. (author)

Outlook for activity and structural change

International Nuclear Information System (INIS)

Anon.

1992-01-01

The level of energy-using activities is continuing to increase throughout the world, but the rates of likely growth differ among regions. Over the next 20 years, manufacturing production is expected to grow at a rapid pace in parts of the developing world, and moderately in the OECD countries. In the Former East Bloc, it seems likely to stagnate or decline for much of the 1990s, but could then grow at a moderate pace if the transition to a market economy is successfully managed. Domestic passenger travel seems likely to increase everywhere, and growth in international travel will be especially strong. Freight transport activity is difficult to evaluate in the aggregate, since the composition of goods changes over time, but increase is expected in all regions, especially in the developing countries. Structural change within sectors will have significant impacts on energy use. In manufacturing, faster growth in light industry will lead to lower energy intensity in the OECD countries and especially in the Former East Bloc. The outlook in the LDCs suggests somewhat higher growth in energy-intensive industries, but this trend will vary among countries. In passenger travel, structural change is pointing toward higher energy intensity in most of the world as the role of automobiles and air travel continues to grow. Increase in the use of trucks is pushing in a similar direction in freight transport. In the residential sector, structural change will have only a moderate impact in the OECD countries, where per capita levels of home services are already high, but will push energy use significantly upward in the LDCs, and to a lesser extent, in the Former East Bloc. 17 refs., 4 figs., 1 tab

Public gaming: eSport and event marketing in the experience economy

OpenAIRE

Borowy, Michael

2012-01-01

This thesis situates organized competitive digital gaming (eSport) in the context of historical sport, the rise of the computer and video games industry, event marketing, and the experience economy. It argues that the oftentimes misattributed origins of eSport in truth first took place during the early 1980s in arcades, when the various criteria for sport, including public contest, a structured framework for victory and defeat, mediatization and promotion, professionalization, record-keeping,...

50 CFR 665.121 - Definitions.

Science.gov (United States)

2010-10-01

... margaritaceus. uloulo-gatala, patagaloa surge wrasse Thalassoma purpureum. lape-moana red ribbon wrasse... undulated moray eel Gymnothorax undulatus. Octopodidae (Octopus) fe'e fe'e octopus octopus Octopus cyanea, Octopus ornatus. Polynemidae umiumia, i'ausi threadfin Polydactylus sexfilis. Pricanthidae (Bigeye...

Energy outlook to 2035 in Asia and its pathways towards a low carbon energy system

Energy Technology Data Exchange (ETDEWEB)

Komiyama, Ryoichi

2010-09-15

This report analyzes energy outlook in Asia and the world to 2035. In Technologically Advanced Scenario, advanced low-carbon technology yields, in 2035, 2,305 Mtoe or 14% of the saving in world primary energy demand and 12.3 Gt or 30% of the reduction in global CO2 emissions compared with the Reference Scenario. In these savings, Asia will account for 58% in the world primary energy reduction and 55% of the world CO2 mitigation, emphasizing immense potential of energy and CO2 saving in Asia and the importance of the deployment of clean energy technology through technology transfer to Asian region.

World energy outlook: how to share the efforts to be achieved by 2030?

International Nuclear Information System (INIS)

2008-01-01

This conference was organized a month after the publication by the International Energy Agency (IEA) of the 2007 World Energy Outlook (WEO) study. The energy situation at that time was marked by the repercussions on the environment and on the security of supplies in relation with the accelerated development of China and India. This document gathers the transparencies of the two presentations given at this conference. The first presentation by Fatih Birol, Chief Economist at the IEA, is entitled 'World Energy Outlook 2007: China and India Insights'. It presents the Cooperation with China's National Development and Reform Commission (NDRC) and Energy Research Institute (ERI), and with India's Energy and Resources Institute (TERI) for the establishment of energy scenarios. Then the different scenarios are reviewed: Reference Scenario, Alternative Policy Scenario and 450 Stabilisation Case, High Growth Scenario (China/India). Finally, a full global update of projections (all scenarios) is presented and the impact of China and India on global economy, energy markets and environment is analyzed. The conclusions are as follows: - Global energy system is on an increasingly unsustainable path; - China and India are transforming the global energy system by their sheer size; - Challenge for all countries is to achieve transition to a more secure, lower carbon energy system; - New policies now under consideration would make a major contribution; - Next 10 years are critical (The pace of capacity additions will be most rapid, Technology will be 'locked-in' for decades, Growing tightness in oil and gas markets); - Challenge is global so solutions must be global. The second presentation by Jean-Charles Hourcade (CIRED) is entitled 'The WEO 2007 A few comments about the Emerging Giants... and us'. The presentation focusses on 4 points: - What implications of higher growth in the Asian Giants on the world economy through higher pressure on energy resources; - Economic questions

Em busca de um território: Limites e perspectivas dos campos disciplinar e aplicado na visão dos diplomados em relações públicas pela UFPB / Looking for a territory: boundaries and outlooks of the theoretical and applied fields in the view of the public relations graduates by the UFPB

Directory of Open Access Journals (Sweden)

Josilene Ribeiro de Oliveira

2013-12-01

Full Text Available Este artigo discute os limites e as perspectivas para as relações públicas nos campos teórico e prático, por meio da identificação dos estágios de desenvolvimento da doutrina e do levantamento das percepções de egressos formados pe la Universidade Federal da Paraíba sobre o mercado de trabalho. A pesquisa descritivo-explicativa, desenvolvida em três etapas, compreendeu: a revisão dos pressupostos teóricos do paradigma sistêmico e da comunicação organizacional; o levantamento da opinião de 132 respostas através de questionários; o aprofundamento dos dados com a escuta direta de diplomados. Os resultados sugerem que o lugar das relações públicas está na fronteira entre a comunicação e a administração, um território contestado que obriga seus habitantes a serem flexíveis e manterem uma identidade mutante, tal qual todas as outras profissões que nasceram sob osigno da modernidade. / This paper discusses the boundaries and the outlooks in the theoretical and applied fields through of the identification of development stages of discipline and of the collect of perceptions of the public relations graduates by the Federal University of Paraíba (UFPB on professional activity. The descriptive and explicative research was developed in three steps: bibliographic revision of the systemic paradigm and of the organizational communication; opinion collect applied to 132 Public Relations Professionals through electronic survey; execution of the focal group with the graduates. The results suggests that the place of the public relations is on the border between the communication and administration, a contested territory that forces their residents to be flexible and to sustain a mutant identity, as the others professions that appeared about the modernity stamp.

Emission and costs up to and including 2030 for the current environmental policy. Background information for the National Environmental Outlook 5

International Nuclear Information System (INIS)

Van Wee, G.P.; Kuijpers-Linde, M.A.J.; Van Gerwen, O.J.

2001-03-01

Every four years the Dutch National Institute of Public Health and the Environment (RIVM) publishes an Environmental Outlook in preparation for the National Environmental Policy Plan (NEPP). The fifth National Environmental Outlook (NEOS) describes developments in the quality of the environment in the Netherlands for 2000-2030 against a background of developments on the European and global scales. The two macro-economic scenarios of the Netherlands Bureau for Economic and Policy Analysis (CPB) used are the European Coordination (EC) scenario and the Global Competition scenario (GC). Consequences for public health, nature and the human physical environment are also indicated. 'Fixed policy' scenarios are used in the Environmental Outlook for the Netherlands. In 'fixed policy' scenarios it is assumed that all policy measures agreed on by the year 2000 will be implemented, but no new measures taken. In this way the Outlook offers baseline scenarios that can be compared with targets and objectives to facilitate the development of new policy. The Fifth National Environmental Outlook was realised with the assistance of many other Dutch research institutes. This background document to NEOS presents estimated levels of energy use, emissions and costs of environmental measures for the 1995-2020 period. The main conclusions are: The environmental problems most difficult to tackle are climate change and noise nuisance. These problems are highly related to energy use and transportation; The policy as presented in the 'Uitvoeringsnota Klimaatbeleid', a document describing the Dutch Kyoto-related climate policy, results in a reduction of greenhouse gases of 15 Mton CO2 equivalents (GS scenario) with respect to the pre-Kyoto policy in 2010. To meet the Kyoto agreements a further reduction of approximately 45 Mton CO2 equivalents is needed. If policies in the 'Uitvoeringsnota Klimaatbeleid' are further instrumentalised and made concrete, an extra reduction of 10 Mton is possible

Capital social e qualidade da atenção à saúde: as experiências do Brasil e da Catalunha

Directory of Open Access Journals (Sweden)

Selma Cristina Franco

2013-07-01

Full Text Available Os diferentes modelos de gestão da saúde refletem as concepções que os embasam e seus arranjos institucionais podem propiciar o aprimoramento da política de saúde. O presente artigo objetiva fazer uma reflexão sobre as potencialidades e os limites da estrutura organizacional e do capital social para produzirem mudanças no desempenho das organizações públicas de saúde na busca de melhor qualidade assistencial. A descrição e a análise de duas experiências de organização de sistemas públicos de saúde universais, na Catalunha e no Brasil, mostram similaridades nos marcos legais, porém com uma diversidade de caminhos trilhados, que deu origem a experiências distintas de gestão, uma priorizando a organização gerencial e a outra o protagonismo de atores sociais promovendo a institucionalização do capital social. Sugere-se que em modelos de gestão onde há diálogo entre um desenho organizacional eficiente e participação cidadã capaz de construir capital social, pode-se promover mudanças na cultura organizacional em prol da qualidade assistencial.

O caminho, a experiência e a aventura

Directory of Open Access Journals (Sweden)

Marcelo Rodrigues Souza Ribeiro

2009-01-01

Full Text Available http://dx.doi.org/10.5007/2178-4582.2009v43n1p265 Acompanhando o itinerário demarcado pelas palavras do título, o artigo se divide em quatro partes. Na primeira, após um prelúdio sobre os escritos de Georg Simmel, o tema do milagre do caminho como diferença do humano em relação ao animal orienta, por meio de uma interrogação histórica, um questionamento sobre o conceito de vida na modernidade. Na segunda, a questão da modernidade é desdobrada em torno do motivo da destruição ou expropriação da experiência, tal como discutido por Simmel e Walter Benjamin (entre outros. Na terceira, uma leitura de A aventura, ensaio de 1911 de Simmel, possibilita interrogar a colonialidade como condição da modernidade. Na quarta, retomando a questão da diferença entre humano e animal em relação à discussão sobre aventura, colonialidade e modernidade, esboça-se uma compreensão do conjunto das narrativas de Tarzan como exemplo paradigmático de narrativas de aventura coloniais-modernas que, ademais, articulam discursos sobre a diferença entre humano e animal.

Fast optical readout for Mu3e experiment

Energy Technology Data Exchange (ETDEWEB)

Huang, Qinhua [Institut fuer Kernphysik, Universitaet Mainz, Mainz (Germany); Collaboration: Mu3e-Collaboration

2016-07-01

Charged lepton flavour violation is highly suppressed in the Standard Model, which results in a prediction for the branching ratio of μ{sup +}→e{sup +}e{sup +}e{sup -} below O(10{sup -54}). The Mu3e experiment will search for this rare decay with a sensitivity of 10{sup -16}. An observation would be a clear sign for new physics. A high muon stopping rate of 2.10{sup 9} Hz is required so that sufficient statistics can be accumulated in about one year of data taking. The high event rate and the requirement of a full online track reconstruction demand a fast readout system which should provide a bandwidth above 1 Tbit/s. Reconfigurable devices, namely FPGAs, can easily parallelise the data processing, so it becomes possible to sort, merge, pack and route the data with low latency at high throughput. Optical fibres are the only option for the interconnection between different FPGA-based boards. The fibres also reduce the crosstalk and signal attenuation, especially over long distance links. As part of the readout system prototyping, firmware for synchronous merging of different data streams is being developed. In addition, the optical links have been tested and show a bit error rate below O(10{sup -16}) at 6.4 Gbit/s for a single fibre.

E-Cigarettes Use Behavior and Experience of Adults: Qualitative Research Findings to Inform E-Cigarette Use Measure Development.

Science.gov (United States)

Kim, Hyoshin; Davis, Andrew H; Dohack, Jaime L; Clark, Pamela I

2017-02-01

To gain a better understanding of electronic cigarette (e-cigarette) use behavior and experience among adult e-cigarette users, with the goal of informing development of future e-cigarette use measures. Between August and October 2014 six focus groups were conducted in Seattle. Participants (63% male; 60% >35 years old; 60% White): e-cigarette users who used combustible tobacco products either currently or in the past. E-cigarette discussion topics covered: their daily use pattern (eg, frequency), product-related characteristics (eg, nicotine levels), and perceptions about health risks and benefits. Participants' descriptions of daily use were so varied that no common "unit" of a "session" easily summarized frequency or quantity of typical e-cigarette use. Most users had difficulty in tracking their own use. Participants reported nicotine craving relief when using e-cigarettes, but described e-cigarettes use as less satisfying than combustible cigarettes. Valued characteristics included "ready availability" and the possibility of using indoors. A unique aspect of the e-cigarette use experience is the option of adding flavors and having the ability to exhale "big clouds" of vapor/aerosol. Most perceived e-cigarettes as a better and safer alternative to conventional cigarettes, yet still sought further information about health consequences and safety of e-cigarettes from trusted sources. E-cigarettes users are far from homogeneous in their behavior and motivation for adopting e-cigarettes. A range of use patterns arising from both hedonic and utilitarian factors, along with product characteristics (eg, variable nicotine levels and flavors) extending beyond those of conventional cigarettes, suggest that new, specific e-cigarette use measures must be developed. The current study provides timely information on adult e-cigarette use behavior, which is a crucial step in measuring this new phenomenon and assessing the risks associated with using e-cigarette products. Our