WorldWideScience

Sample records for e1 radiative strength

  1. E1 and M1 strength functions at low energy

    Science.gov (United States)

    Schwengner, Ronald; Massarczyk, Ralph; Bemmerer, Daniel; Beyer, Roland; Junghans, Arnd R.; Kögler, Toni; Rusev, Gencho; Tonchev, Anton P.; Tornow, Werner; Wagner, Andreas

    2017-09-01

    We report photon-scattering experiments using bremsstrahlung at the γELBE facility of Helmholtz-Zentrum Dresden-Rossendorf and using quasi-monoenergetic, polarized γ beams at the HIγS facility of the Triangle Universities Nuclear Laboratory in Durham. To deduce the photoabsorption cross sections at high excitation energy and high level density, unresolved strength in the quasicontinuum of nuclear states has been taken into account. In the analysis of the spectra measured by using bremsstrahlung at γELBE, we perform simulations of statistical γ-ray cascades using the code γDEX to estimate intensities of inelastic transitions to low-lying excited states. Simulated average branching ratios are compared with model-independent branching ratios obtained from spectra measured by using monoenergetic γ beams at HIγS. E1 strength in the energy region of the pygmy dipole resonance is discussed in nuclei around mass 90 and in xenon isotopes. M1 strength in the region of the spin-flip resonance is also considered for xenon isotopes. The dipole strength function of 74Ge deduced from γELBE experiments is compared with the one obtained from experiments at the Oslo Cyclotron Laboratory. The low-energy upbend seen in the Oslo data is interpreted as M1 strength on the basis of shell-model calculations.

  2. E1 oscillator strengths and transition rates among levels of Cl I

    Science.gov (United States)

    Oliver, P.; Hibbert, A.

    2013-07-01

    We present oscillator strengths and transition rates of E1 transitions between the fine-structure levels belonging to the configurations 3s23p5, 3s3p6, and 3s23p4nl, where nl= 4s, 5s, 6s, 4p, 5p, 3d, 4d. The calculations have used extensive configuration interaction (CI) wavefunctions, with the associated Hamiltonian matrix adjusted to ensure that the eigenenergies agree with experimental energy level data ('fine tuning'). There are consequential small changes in the CI mixing coefficients from their ab initio values and these corrected coefficients are used in the calculation of the transition data. The method of optimization of the orbital radial functions (expressed in terms of Slater-type orbitals) is described and the radial function parameters are also presented. We show some comparisons between our work and those of earlier calculations and demonstrate how the inclusion of relativistic effects (which we achieve through the use of the Breit-Pauli approximation) can result in a substantial redistribution of the oscillator strength from the LS calculation. We also demonstrate that the fine-tuning process can make, particularly for intercombination lines, a substantial improvement in the agreement between theoretical and experimental oscillator strengths.

  3. Radiative Strength Functions and Level Densities

    Energy Technology Data Exchange (ETDEWEB)

    Schiller, A; Becker, J A; Bernstein, L A; Voinov, A; Guttormsen, M; Hjorth-Jensen, M; Rekstad, J; Siem, S; Mitchell, G E; Tavukcu, E

    2002-08-28

    Radiative strength functions and level densities have been extracted from primary {gamma}-ray spectra for {sup 27,28}Si, {sup 56,57}Fe, {sup 96,97}Mo, and several rare earth nuclei. An unexpectedly strong ({approx} 1 mb MeV) resonance at 3 MeV in the radiative strength function has been observed for well-deformed rare earth nuclei. The physical origin of this resonance and its connection to the scissors mode is discussed.

  4. ON THE QUESTIONS OF THE NUCLEAR LEVEL DENSITY AND THE E1 PHOTON STRENGTH FUNCTIONS

    Energy Technology Data Exchange (ETDEWEB)

    MUGHABGHAB,S.F.; DUNFORD,C.L.

    1999-11-15

    New results were derived from average level spacings of neutron resonances for the spin dispersion parameter of the nuclear level density, which demonstrated the influence of shell effects, as well as the interplay of nucleon pairing correlations for nuclei in the mass range from {sup 29}Si to {sup 241}Pu. The volume and surface components of the nuclear level density parameter, as well as the shell-damping factor, were determined as, a{sub v} = 0.076 {+-} 0.009 MeV{sup {minus}1} , a{sub s} = 0.180 {+-} 0.047 MeV{sup {minus}1}, and y{sub 0} = 0.047 {+-} 0.04 MeV{+-}, respectively. The effective nucleon mass at the Fermi surface is derived as m*/m = 1.09 {+-} 0.13. New evidence is presented for a dipole-quadrupole interaction term in the primary E1 transitions of average resonance capture data. This evidence is obtained by testing a proposed generalized Landau Fermi liquid model for spherical and deformed nuclei, which includes the effect of the dipole-quadrupole interaction. The Landau-Migdal interaction constant and the effective nucleon mass, are determined as F{sub 0}{prime} = 1.49 {+-} 0.08, and m*/m=1.04 {+-} 0.07, respectively.

  5. Study of interrelation between electromagnetic radiation and rock strength

    Science.gov (United States)

    Yavorovich, L. V.; Bespal'ko, A. A.; Fedotov, P. I.; Pomishin, E. K.

    2016-02-01

    The paper presents the study of the electromagnetic radiation of real rock samples under acoustic impact. The test samples are made of kerns from the iron ore mine with different petrophysical features and strength. The study has shown that the electromagnetic radiation parameters are related to the sample strength. However, this dependence is not observed for samples with magnetite that can be due to individual structural-textural features and quartz inclusions.

  6. Leading E1 and M1 contributions to radiative neutron capture on lithium-7

    Energy Technology Data Exchange (ETDEWEB)

    Fernando, L.; Rupak, G. [Mississippi State University, Department of Physics and Astronomy and HPC2 Center for Computational Sciences, Mississippi State, MS (United States); Higa, R. [University of Groningen, Kernfysisch Versneller Instituut, Theory Group, Groningen (Netherlands); Universidade de Sao Paulo, Instituto de Fisica, C.P. 66318, Sao Paulo, SP (Brazil)

    2012-02-15

    Using halo effective field theory, we provide a model-independent calculation of the radiative neutron capture on lithium-7 over an energy range where the contribution from the 3{sup +} resonance becomes important. We also present power counting arguments that establish a hierarchy for electromagnetic one- and two-body currents. One finds that a satisfactory description of the capture reaction, in the present single-particle approximation, requires a resonance width about three times larger than the experimentally quoted value. (orig.)

  7. Study of the radiative strength function in /sup 148,150/Sm

    Energy Technology Data Exchange (ETDEWEB)

    Becvar, F.; Montero-Cabrera, M.E.; Rigol, J.; Telezhnikov, S.A.; Hiep, H.T.

    1987-07-01

    The spectra of ..gamma.. rays accompanying neutron capture by the nuclei /sup 147//sup ,//sup 149/Sm is isolated resonances have been measured by the time-of-flight method in the IBR-30 reactor. Absolute intensities have been obtained for a number of transitions. From a combination of the results of the present work and published data we have determined the radiative strength function of the nuclei /sup 148/Sm and /sup 150/Sm for E1 transitions in the ..gamma..-ray energy region 5--7.5 MeV. The values obtained are 2.8 and 1.7 times smaller than the respective values expected from extrapolation of the Lorentz curves of the giant electric dipole resonance. An analysis of the behavior of the radiative strength function of nuclei with A = 148--157 is carried out.

  8. A Monitor of the Focusing Strength of Plasma Lenses Using MeV Synchrotron Radiation

    CERN Document Server

    Field, C; Ng, J S T; Field, Clive; Mazaheri, Gholam; Ng, Johnny S.T.

    2002-01-01

    The focusing strength of plasma lenses used with high energy electron or positron beams can give rise to synchrotron radiation with critical energies in the MeV range. A method is described for measuring the characteristic energy of this radiation as a way of monitoring the strength of the focus. The principle has been implemented in a plasma lens experiment with a 28.5 GeV positron beam.

  9. Shear bond strength after Er:YAG laser radiation conditioning of enamel and dentin

    Science.gov (United States)

    Dostalova, Tatjana; Jelinkova, Helena; Dolezalova, Libuse; Kubelka, Jiri; Prochazka, Stanislav; Hamal, Karel; Krejsa, Otakar

    1997-12-01

    This study compares bond shear strength between hard dental tissues and composite resin filling material after a classical acid etching treatment procedure and Er:YAG laser surface conditioning. The retention of composite resin was evaluated for three cases: (1) the flat dental substrate without any conditioning, (2) the classical drilling machine prepared surface with acid etching and (3) the Er:YAG laser conditioning of enamel and dentin. None significant differences between bond shear strength of the classical drilling machine prepared surface with acid etching in comparison with the laser radiation conditioning were found.

  10. Photon strength functions in Gd isotopes studied from radiative capture of resonance neutrons

    Directory of Open Access Journals (Sweden)

    Kroll J.

    2014-04-01

    Full Text Available The experimental spectra of γ rays following radiative neutron capture on isolated resonances of stable 152,154–158Gd targets were measured by the DANCE calorimeter installed at the Los Alamos Neutron Scattering Center in New Mexico, USA. These spectra were analyzed within the extreme statistical model to get new information on the photon strength functions. Special emphasis was put on study of the scissors vibrational mode present in these isotopes. Our data show that the scissors-mode resonances are built not only on the ground states but also on the excited levels of all studied Gd isotopes. The scissors mode strength observed in 157,159Gd products is significantly higher than in neighboring even-even nuclei 156,158Gd. Such a difference indicates the existence of an odd-even effect in the scissors mode strength. Moreover, there exists no universal parameter-free model of the electric dipole photon strength function describing the experimental data in all of the Gd isotopes studied. The results for the scissors mode are compared with the (γ, γ′ data for the ground-state transitions and with the results from 3He-induced reactions.

  11. The E1 proteins

    Energy Technology Data Exchange (ETDEWEB)

    Bergvall, Monika [Molecular Virology Laboratory, Institut de recherches cliniques de Montréal (IRCM), 110 Pine avenue West, Montreal, QC, Canada H2W 1R7 (Canada); Department of Microbiology and Immunology, McGill University, Montreal, QC (Canada); Melendy, Thomas [Departments of Microbiology and Immunology, Biochemistry and the Witebsky Center for Microbial Pathogenesis, University of Buffalo, 210 Biomedical Research Building, School of Medicine and Biomedical Sciences, Buffalo, NY 14214 (United States); Archambault, Jacques, E-mail: jacques.archambault@ircm.qc.ca [Molecular Virology Laboratory, Institut de recherches cliniques de Montréal (IRCM), 110 Pine avenue West, Montreal, QC, Canada H2W 1R7 (Canada); Department of Microbiology and Immunology, McGill University, Montreal, QC (Canada); Department of Biochemistry and Molecular Medicine, Université de Montréal, Montreal, QC (Canada)

    2013-10-15

    E1, an ATP-dependent DNA helicase, is the only enzyme encoded by papillomaviruses (PVs). It is essential for replication and amplification of the viral episome in the nucleus of infected cells. To do so, E1 assembles into a double-hexamer at the viral origin, unwinds DNA at the origin and ahead of the replication fork and interacts with cellular DNA replication factors. Biochemical and structural studies have revealed the assembly pathway of E1 at the origin and how the enzyme unwinds DNA using a spiral escalator mechanism. E1 is tightly regulated in vivo, in particular by post-translational modifications that restrict its accumulation in the nucleus. Here we review how different functional domains of E1 orchestrate viral DNA replication, with an emphasis on their interactions with substrate DNA, host DNA replication factors and modifying enzymes. These studies have made E1 one of the best characterized helicases and provided unique insights on how PVs usurp different host-cell machineries to replicate and amplify their genome in a tightly controlled manner. - Highlights: • The papillomavirus E1 helicase orchestrates replication of the viral DNA genome. • E1 assembles into a double-hexamer at the viral origin with the help of E2. • E1 interacts with cellular DNA replication factors. • E1 unwinds DNA using a spiral escalator mechanism. • Nuclear accumulation of E1 is regulated by post-translational modifications.

  12. Spin resonance strengths for radiative polarization and vertical momentum recoils using the spin response formalism

    Energy Technology Data Exchange (ETDEWEB)

    Mane, S.R. [Convergent Computing Inc., P.O. Box 561, Shoreham, NY 11786 (United States)], E-mail: srmane@optonline.net

    2008-08-21

    The radiative polarization of electrons and positrons in storage rings includes spin resonances driven by vertical momentum recoils due to spin flip photon emissions. This is in addition to the spin resonances driven by longitudinal momentum recoils. The underlying physics for the vertical momentum recoils is similar to the perturbations induced by a radial field (rf) dipole spin flipper. This paper derives the spin resonance strengths driven by the vertical momentum recoils using known techniques for spin flippers, such as the spin response formalism.

  13. Radiative lifetimes, branching fractions and oscillator strengths in Pd I and the solar palladium abundance

    Science.gov (United States)

    Xu, H. L.; Sun, Z. W.; Dai, Z. W.; Jiang, Z. K.; Palmeri, P.; Quinet, P.; Biémont, É.

    2006-06-01

    Transition probabilities have been derived for 20 5s-5p transitions of Pd I from a combination of radiative lifetime measurements for 6 odd-parity levels with time-resolved laser-induced fluorescence spectroscopy and of branching fraction determination using a hollow cathode discharge lamp. Additional oscillator strengths for 18 transitions have been determined from measured lifetimes and theoretical branching fractions obtained from configuration interaction calculations with core-polarization effects included. These new results have allowed us to refine the palladium abundance in the solar photosphere: A_Pd = 1.66 ± 0.04, in the usual logarithmic scale, a result in close agreement with the meteoritic value.

  14. Acute Ultraviolet Radiation Perturbs Epithelialization but not the Biomechanical Strength of Full-thickness Cutaneous Wounds

    DEFF Research Database (Denmark)

    Danielsen, Patricia L; Lerche, Catharina M; Wulf, Hans Christian

    2016-01-01

    We hypothesized that priming of the skin with ultraviolet radiation (UVR) before being injured would enhance wound healing. Four groups, each comprising 20 immunocompetent hairless mice, were exposed to simulated solar irradiation in escalating UVR doses; 0 standard erythema dose (SED) = control, 1...... SED, 3 SED and 5 SED. Twenty-four hours after UV irradiation, inflammation was quantified by skin reflectance (erythema) and myeloperoxidase (MPO) tissue levels, and two 6 mm full-thickness excisional wounds and one 3 cm incisional wound were inflicted. Epidermal hyperplasia was assessed...... by quantitative histology. Five days after wounding, wound coverage by neoepithelium and wound width of the excisional wounds was quantified in hematoxylin-eosin sections, and breaking strength was measured in strips from incisional wounds. Erythema (P

  15. Theoretical oscillator strengths, transition probabilities, and radiative lifetimes of levels in Pb V

    Energy Technology Data Exchange (ETDEWEB)

    Colón, C., E-mail: cristobal.colon@upm.es [Dpto. Física Aplicada. E.U.I.T. Industrial, Universidad Politécnica de Madrid, Ronda de Valencia 3, 28012 Madrid (Spain); Alonso-Medina, A. [Dpto. Física Aplicada. E.U.I.T. Industrial, Universidad Politécnica de Madrid, Ronda de Valencia 3, 28012 Madrid (Spain); Porcher, P. [Laboratoire de Chimie Appliquée de l’Etat Solide, CNRS-UMR 7574, Paris (France)

    2014-01-15

    Theoretical values of oscillator strengths and transition probabilities for 306 spectral lines arising from the 5d{sup 9}ns(n=7,8,9),5d{sup 9}np(n=6,7),5d{sup 9}6d, and 5d{sup 9} 5f configurations, and radiative lifetimes of 9 levels, of Pb V have been obtained. These values were obtained in intermediate coupling (IC) and using ab initio relativistic Hartree–Fock calculations including core-polarization effects. We use for the IC calculations the standard method of least squares fitting of experimental energy levels by means of computer codes from Cowan. We included in these calculations the 5d{sup 8}6s6p and 5d{sup 8}6s{sup 2} configurations. These calculations have facilitated the identification of the 214.25, 216.79, and 227.66 nm spectral lines of Pb V. In the absence of experimental results of oscillator strengths and transition probabilities, we could not make a direct comparison with our results. However, the Stark broadening parameters calculated from these values are in excellent agreement with experimental widening found in the literature. -- Highlights: •Theoretical values of transition probabilities of Pb V have been obtained. •We use for the IC calculations the standard method of least square. •The parameters calculated from these values are in agreement with the experimental values.

  16. Study on gamma-ray strength function of neutron radiative capture for middle and heavy nuclei

    CERN Document Server

    LiuJianFeng; Su Zong Di

    2002-01-01

    Using the hypothesis as well as the gamma-ray strength function proposed, the neutron radiative capture reaction cross sections and the gamma energy spectra have been calculated for sup 9 sup 3 Nb, natural Ag and sup 1 sup 8 sup 1 Ta in the neutron incident energy region from 0.01 to 5 MeV as well as for sup 1 sup 9 sup 7 Au in the neutron incident energy region from 0.01 to 10 MeV. The results which are coincident better with the experimental values were obtained. The comparisons with the experimental values have shown that, not only the abnormal protuberances near and after 5.5 MeV of the gamma spectra in the nuclear mass regions about 110 < A < 140 and 180 < A < 210 are explained better, but also the gamma production data can be theoretically calculated for the middle and heavy nuclei by means of this hypothesis and the gamma-ray strength function deduced from this hypothesis

  17. Examination of photon strength functions for Dy,164162 from radiative capture of resonance neutrons

    Science.gov (United States)

    Valenta, S.; Baramsai, B.; Bredeweg, T. A.; Couture, A.; Chyzh, A.; Jandel, M.; Kroll, J.; Krtička, M.; Mitchell, G. E.; O'Donnell, J. M.; Rusev, G.; Ullmann, J. L.; Walker, C. L.

    2017-11-01

    The γ rays following radiative neutron capture on Dy,163161 targets were measured with the highly segmented γ -ray calorimeter Detector for Advanced Neutron Capture Experiments at the Los Alamos Neutron Science Center. The γ -ray energy spectra for different multiplicities were gathered for tens of s -wave resonances of both possible spins in each nucleus. Analysis of these spectra within the statistical model enabled us to draw conclusions about dipole photon strength functions with emphasis on the scissors mode. The photon strength functions best describing Dy data are very similar to previously published results on even-even Gd isotopes. It was shown that the scissors mode plays a significant role in the decay of highly excited states up to the neutron separation energy. Measurement of multiple resonances allowed us to assess the fluctuations of experimental spectra and to compare the fluctuations with simulated ones. The size of measured fluctuations is on average smaller than predicted from simulations. However, the results are puzzling as the difference between simulations within the statistical model and experiment is not consistent for both nuclei.

  18. Chang'E-1

    Indian Academy of Sciences (India)

    China plans to implement its first lunar exploration mission Chang'E-1 by 2007. The mission objectives are. • to obtain a three-dimensional stereo image of the lunar surface,. • to determine distribution of some useful elements and to estimate their abundance,. • to survey the thickness of lunar soil and to evaluate resource of.

  19. Level Densities and Radiative Strength Functions in 56FE and 57FE

    Energy Technology Data Exchange (ETDEWEB)

    Tavukcu, Emel [North Carolina State Univ., Raleigh, NC (United States)

    2002-12-10

    Understanding nuclear level densities and radiative strength functions is important for pure and applied nuclear physics. Recently, the Oslo Cyclotron Group has developed an experimental method to extract level densities and radiative strength functions simultaneously from the primary γ rays after a light-ion reaction. A primary γ-ray spectrum represents the γ-decay probability distribution. The Oslo method is based on the Axel-Brink hypothesis, according to which the primary γ-ray spectrum is proportional to the product of the level density at the final energy and the radiative strength function. The level density and the radiative strength function are fit to the experimental primary γ-ray spectra, and then normalized to known data. The method works well for heavy nuclei. The present measurements extend the Oslo method to the lighter mass nuclei 56Fe and 57Fe. The experimental level densities in 56Fe and 57Fe reveal step structure. This step structure is a signature for nucleon pair breaking. The predicted pairing gap parameter is in good agreement with the step corresponding to the first pair breaking. Thermodynamic quantities for 56Fe and 57Fe are derived within the microcanonical and canonical ensembles using the experimental level densities. Energy-temperature relations are considered using caloric curves and probability density functions. The differences between the thermodynamics of small and large systems are emphasized. The experimental heat capacities are compared with the recent theoretical calculations obtained in the Shell Model Monte Carlo method. Radiative strength functions in 56Fe and 57Fe have surprisingly high values at low γ-ray energies. This behavior has not been observed for heavy nuclei, but has been observed in other light- and medium-mass nuclei. The origin of this low γ-ray energy effect remains unknown.

  20. An evaluation on shear strength of composite resin bonded to primary teeth dentin after Nd: YAG laser radiation

    Directory of Open Access Journals (Sweden)

    Kowsari A

    2002-06-01

    Full Text Available Due to the differences in the composite and morphology of dentin in primary and permanent teeth, it is necessary to make improvements in bonding techniques to promote the strength of composite resins bonded to the dentinal surface, in primary teeth. The use of lower radiation, to make structural and chemical changes in dentinal surfaces has been investigated. This research was conducted to evaluate the shear strength of the composite bonded to primary teeth dentin after Nd: YAG laser radiation and acid etching for conditioning. Peripheral dentin of the buccal and lingua! surfaces of 60 extracted posterior primary teeth were exposed and polished with 600 grit with Sic paper. The teeth were divided randomly in 3 groups of 20 teeth. In group 1 etching gel, primer and adhesive of scotch bond multipurpose system (SMP, in group 2 laser at 1.6 w and 80 mj/pulse, and in group 3 laser at 2 s and 700 mj/pulse were used. Moreover, in groups 2 and 3, after laser radiation, acid etching, primer and adhesive of SMP system were applied. After necessary laboratory tests, the mean shear bond strength in MPa were 20.99±5.3 (group 1, 23.82±6.31 (group 2 and 26.58±5.59 (group 3. ANOVA, scheffe, tukey statistical tests showed that the bond strengths of group 3 were statistically higher than group 1. The frequency of dentin cohesive failures were significantly higher in groups 2 and 3, compared to group 1 that indicates a higher bond strength in these groups. Scanning electron mirographs of laser radiated surfaces, show a porous and rough surface morphology that enhances the mechanical bond of the composite.

  1. Infrared-microwave double resonance: signal dependence on microwave radiation strength

    NARCIS (Netherlands)

    Vreede, J.P.M. de; Dijkerman, H.A.

    1980-01-01

    The influence of MW radiation on the magnitude of double resonance signals is studied in the case of steady-state 3-level IR-MW double resonance, using IR or MW radiation as probe field. The measurements reveal a strong signal dependence on the microwave power level. Changes in the absorption factor

  2. Nanosecond lifetime measurements of Iπ=9/2- intrinsic excited states and low-lying B(E1) strengths in 183Re using combined HPGe-LaBr3 coincidence spectroscopy

    Science.gov (United States)

    Gurgi, L. A.; Regan, P. H.; Daniel, T.; Podolyák, Zs.; Bruce, A. M.; Mason, P. J. R.; Mǎrginean, N.; Mǎrginean, R.; Werner, V.; Alharbi, T.; Alkhomashi, N.; Bajoga, A. D.; Britton, R.; Cǎta-Danil, I.; Carroll, R. J.; Deleanu, D.; Bucurescu, D.; Florea, N.; Gheorghe, I.; Ghita, D. G.; Glodariu, T.; Lice, R.; Mihai, C.; Mulholland, K. F.; Negret, A.; Olacel, A.; Roberts, O. J.; Sava, T.; Söderström, P.-A.; Stroe, L.; Suvaila, R.; Toma, S.; Wilson, E.; Wood, R. T.

    2017-08-01

    This paper presents precision measurements of electromagnetic decay probabilities associated with electric dipole transitions in the prolate-deformed nucleus 183Re. The nucleus of interest was formed using the fusion evaporation reaction 180Hf(7Li,4n)183Re at a beam energy of 30 MeV at the tandem accelerator at the HH-IFIN Institute, Bucharest Romania. Coincident decay gamma rays from near-yrast cascades were detected using the combined HPGe-LaBr3 detector array ROSPHERE. The time differences between cascade gamma rays were measured using the LaBr3 detectors to determine the half-lives of the two lowest lying spin-parity 9/2- states at excitation energies of 496 and 617 keV to be 5.65(5) and 2.08(3) ns respectively. The deduced E1 transition rates from these two states are discussed in terms of the K-hindrance between the low-lying structures in this prolate-deformed nucleus.

  3. Radiative lifetime measurements and oscillator strengths of astrophysical interest in HoIII

    OpenAIRE

    Zhang, Zhiguo; Somesfalean, Gabriel; Svanberg, Sune; Palmeri, P.; Quinet, P.; Biemont, E.

    2002-01-01

    Radiative lifetimes of three long-lived levels belonging to the 4f(10)5d configuration of Ho III have been measured, for the first time, using the time-resolved laser-induced fluorescence technique. A good agreement between the experimental lifetimes and theoretical results obtained within a multiconfigurational pseudo-relativistic Hartree-Fock (HFR) approach including core-polarization (CP) effects is observed provided an adequate scaling factor is applied to the <4f&VERBAR;r&VERB...

  4. Mechanical strength of cortical allografts with gamma radiation versus ethylene oxide sterilization.

    Science.gov (United States)

    Zhou, Zongke; Qin, Tingwu; Yang, Jing; Shen, Bin; Kang, Pengde; Peil, Fuxing

    2011-10-01

    We investigated the effects of gamma irradiation versus ethylene oxide (ETO) sterilization on the mechanical strength of cortical bone grafts. Tibias were collected from cadavers of mature goats. Sixty test specimens were randomized into four groups: fresh (no processing), frozen (freezing at -70 degrees C), gamma-irradiated, and ETO-sterilized specimens. Torsion, three-point bending, and compression testing were separately performed with a material testing machine. Parameters studied included maximum stress, strain, deflection, extension, load, shear modulus, and E-modulus. Compared with findings for the fresh specimens, findings were as follows for gamma-irradiated specimens: maximal shear modulus, reduced by 48%; shear stress, by 55%; deflection, by 71%; bending stress, by 51%; bending strain, by 74%; extension, by 60%; and compression strain, by 50%. However, there were no reductions in those parameters for the frozen specimens or the ETO-sterilized specimens. These findings confirm that shear, bending, and compression strength of cortical allografts are weakened by gamma irradiation at room temperature. To maintain optimum mechanical properties, ETO sterilization of allografts is better than gamma sterilization, especially for cortical bone, because it is usually used in load-bearing settings.

  5. UV stability of HMS-PP (high melt strength polypropylene) obtained by radiation process

    Energy Technology Data Exchange (ETDEWEB)

    Oliani, W.L., E-mail: washoliani@usp.b [Nuclear Energy Research Institute-IPEN-CNEN/SP, Av. Prof. Lineu Prestes, 2242, 05508-900 Sao Paulo (Brazil); Parra, D.F.; Lugao, A.B. [Nuclear Energy Research Institute-IPEN-CNEN/SP, Av. Prof. Lineu Prestes, 2242, 05508-900 Sao Paulo (Brazil)

    2010-03-15

    HMS-PP in grains was synthesized by the gamma irradiation of PP under a crosslinking atmosphere of acetylene, followed by thermal treatment for radical recombination and thermal treatment for annihilation of the remaining radicals. The UV stability of the material was evaluated in pellet form. The accelerated weathering test of HMS-PP samples were performed under artificial ultra-violet light and in a condensation chamber Comexim (C-UV type) apparatus with UV exposure for 120 and 240 h. The results were compared to those from ageing caused by sunlight and dew under natural exposition. This work investigated changes in mechanical proprieties (elongation and rupture strength), Fourier transform infrared spectroscopy (FTIR), optical microscopy (MO), scanning electron microscopy (SEM) and rheological properties of HMS-PP after the UV ageing. We find that the HMS-PP has more degradation than regular PP and undergoes predominate chain scission in aggressive UV ageing conditions.

  6. An Improved Measurement Method for the Strength of Radiation of Reflective Beam in an Industrial Optical Sensor Based on Laser Displacement Meter

    Directory of Open Access Journals (Sweden)

    Youngchul Bae

    2016-05-01

    Full Text Available An optical sensor such as a laser range finder (LRF or laser displacement meter (LDM uses reflected and returned laser beam from a target. The optical sensor has been mainly used to measure the distance between a launch position and the target. However, optical sensor based LRF and LDM have numerous and various errors such as statistical errors, drift errors, cyclic errors, alignment errors and slope errors. Among these errors, an alignment error that contains measurement error for the strength of radiation of returned laser beam from the target is the most serious error in industrial optical sensors. It is caused by the dependence of the measurement offset upon the strength of radiation of returned beam incident upon the focusing lens from the target. In this paper, in order to solve these problems, we propose a novel method for the measurement of the output of direct current (DC voltage that is proportional to the strength of radiation of returned laser beam in the received avalanche photo diode (APD circuit. We implemented a measuring circuit that is able to provide an exact measurement of reflected laser beam. By using the proposed method, we can measure the intensity or strength of radiation of laser beam in real time and with a high degree of precision.

  7. Influence of gamma radiation on the colour strength and fastness properties of fabric using turmeric (Curcuma longa L.) as natural dye

    Energy Technology Data Exchange (ETDEWEB)

    Bhatti, Ijaz A., E-mail: ijazchem@yahoo.co [Department of Chemistry, University of Agriculture, Faisalabad 38040 (Pakistan); Adeel, Shahid [Department of Chemistry, University of Agriculture, Faisalabad 38040 (Pakistan); Jamal, M. Asghar [Department of Chemistry, G.C. University, Faisalabad 38040 (Pakistan); Safdar, Muhammad [Department of Chemistry, University of A J and K, Muzaffarabad, Azad Kashmir (Pakistan); Abbas, Muhammad [Haris Dyes and Chemicals, Faisalabad 38040 (Pakistan)

    2010-05-15

    The effect of gamma radiation on the dyeing of cotton with extract of turmeric (Curcuma longa L.) powder has been investigated. Cotton fabric and turmeric powder were irradiated to absorbed doses of 1, 2, 3, 4 and 6 kGy using Co-60 gamma irradiator. Dyeing parameters such as temperature, pH and mordant concentration were optimized. Dyeing was performed using un-irradiated and irradiated cotton with the extracts of un-irradiated and irradiated turmeric powder in order to investigate the effect of radiation treatment on the colour strength of dyed fabric. The reported data of un-irradiated and irradiated fabrics dyed with un-irradiated and irradiated dyes were obtained using the spectraflash SF-650. The colourfastness to light, rubbing- and washing-fastness properties showed that gamma irradiation has improved the dyeing characteristics from fair to good.

  8. Influence of gamma radiation on the colour strength and fastness properties of fabric using turmeric (Curcuma longa L .) as natural dye

    Science.gov (United States)

    Bhatti, Ijaz A.; Adeel, Shahid; Jamal, M. Asghar; Safdar, Muhammad; Abbas, Muhammad

    2010-05-01

    The effect of gamma radiation on the dyeing of cotton with extract of turmeric ( Curcuma longa L.) powder has been investigated. Cotton fabric and turmeric powder were irradiated to absorbed doses of 1, 2, 3, 4 and 6 kGy using Co-60 gamma irradiator. Dyeing parameters such as temperature, pH and mordant concentration were optimized. Dyeing was performed using un-irradiated and irradiated cotton with the extracts of un-irradiated and irradiated turmeric powder in order to investigate the effect of radiation treatment on the colour strength of dyed fabric. The reported data of un-irradiated and irradiated fabrics dyed with un-irradiated and irradiated dyes were obtained using the spectraflash SF-650. The colourfastness to light, rubbing- and washing-fastness properties showed that gamma irradiation has improved the dyeing characteristics from fair to good.

  9. Semi-empirical calculations of radiative decay rates in Mo II. A comparison between oscillator strength parametrization and core-polarization-corrected relativistic Hartree-Fock approaches

    Science.gov (United States)

    Bouazza, Safa; Palmeri, Patrick; Quinet, Pascal

    2017-09-01

    We present a semi-empirical determination of Mo II radiative parameters in a wide wavelength range 1716-8789 Å. Our fitting procedure to experimental oscillator strengths available in the literature permits us to provide reliable values for a large number of Mo II lines, predicting previously unmeasured oscillator strengths of lines involving 4d45p and 4d35s5p odd-parity configurations. The extracted transition radial integral values are compared with ab-initio calculations: on average they are 0.88 times the values obtained with the basic pseudo-relativistic Hartree Fock method and they agree well when core polarization effects are included. When making a survey of our present and previous studies and including also those given in the literature we observe as general trends a decreasing of transition radial integral values with filling nd shells of the same principal quantum numbers for ndk(n + 1)s → ndk(n + 1)p transitions.

  10. New technique for a simultaneous estimation of the level density and radiative strength functions of dipole transitions at E sub e sub x<=B sub n -0.5 MeV

    CERN Document Server

    Khitrov, V A

    2001-01-01

    The new, model-independent method to estimate simultaneously the level densities excited in the (n,gamma) reaction and the radiative strength functions of dipole transitions is developed. The method can be applied for any nucleus and reaction followed by cascade gamma-emission. It is just necessary to measure the intensities of two-step gamma-cascades depopulating one or several high-excited states and determine the quanta ordering in the main portion of the observed cascades. The method provides a sufficiently narrow interval of most probable densities of levels with given J suppi and radiative strength functions of dipole transitions populating them.

  11. Production of plastified wood with stronger static bending strength means of polymerization induced by gamma radiation; Producao da madeira plastificada de elevada resistencia a flexao estatica mediante polimerizacao induzida por raios gama

    Energy Technology Data Exchange (ETDEWEB)

    Silva Filho, Elias [Pernambuco Univ., Recife, PE (Brazil). Dept. de Energia Nuclear]. E-mail: leocadie@elogica.com.br

    1999-07-01

    The use of gamma radiation to obtain wood-polymer composites is one of the applications of radiation that presents the most commercial interest. The process, denominated radiopolymerization, comprises the impregnation of monomers into the completely dried wood followed by exposure to gamma radiation to induce polymerization of the impregnated monomers. I this context, the present work aimed the application of this process to seven kinds of wood existing in the brazilian forests. The considered monomer is styrene and the gamma source is Cobalt-60. The obtained wood-polystyrene composites were found to have stronger static bending strength. (author)

  12. Test of gamma-ray strength functions in nuclear reaction model calculations

    Energy Technology Data Exchange (ETDEWEB)

    Kopecky, J. (Netherlands Energy Research Foundation ECN, P.O. Box 1, 1755 ZG Petten, (The Netherlands)); Uhl, M. (Institut fuer Radiumforschung und Kernphysik, Universitaet Wien, A1090 Wien, Boltzmanngasse 3, (Austria))

    1990-05-01

    The impact of models for {ital E}1 and {ital M}1 gamma-ray strength functions on the results of nuclear model calculations of total average radiation widths, radiative capture cross sections, and gamma-ray spectra has been studied. We considered strength functions that reproduce photoabsorption and/or average resonance data but significantly differ from each other at low gamma-ray energies. As the calculated quantities critically depend on the strength functions in this energy region, model calculations can be used to test the low-energy behavior of strength functions. By analyzing the {sup 197}Au, {sup 143}Nd, {sup 105}Pd, and {sup 93}Nd neutron capture reactions we found strong evidence for a model of the {ital E}1 strength function, which is characterized by the following properties: (i) an energy dependent spreading width of the underlying Lorentzian for the photoabsorption cross section and (ii) a nonzero, temperature dependent, limit as the transition energy tends to zero. This model is founded in theoretical work by Zaretskij, Sirotkin, and Kadmenskij and represents a partial breakdown of Brink's hypothesis.

  13. Adenovirus E1A/E1B Transformed Amniotic Fluid Cells Support Human Cytomegalovirus Replication

    Directory of Open Access Journals (Sweden)

    Natascha Krömmelbein

    2016-02-01

    Full Text Available The human cytomegalovirus (HCMV replicates to high titers in primary human fibroblast cell cultures. A variety of primary human cells and some tumor-derived cell lines do also support permissive HCMV replication, yet at low levels. Cell lines established by transfection of the transforming functions of adenoviruses have been notoriously resistant to HCMV replication and progeny production. Here, we provide first-time evidence that a permanent cell line immortalized by adenovirus type 5 E1A and E1B (CAP is supporting the full HCMV replication cycle and is releasing infectious progeny. The CAP cell line had previously been established from amniotic fluid cells which were likely derived from membranes of the developing fetus. These cells can be grown under serum-free conditions. HCMV efficiently penetrated CAP cells, expressed its immediate-early proteins and dispersed restrictive PML-bodies. Viral DNA replication was initiated and viral progeny became detectable by electron microscopy in CAP cells. Furthermore, infectious virus was released from CAP cells, yet to lower levels compared to fibroblasts. Subviral dense bodies were also secreted from CAP cells. The results show that E1A/E1B expression in transformed cells is not generally repressive to HCMV replication and that CAP cells may be a good substrate for dense body based vaccine production.

  14. Strength Training

    Science.gov (United States)

    ... big difference between strength training, powerlifting, and competitive bodybuilding! Strength training uses resistance methods like free weights, ... a person can lift at one time. Competitive bodybuilding involves evaluating muscle definition and symmetry, as well ...

  15. Many trained at E1 Salvador center.

    Science.gov (United States)

    1970-02-01

    The Family Planning Association of E1 Salvador is conducting regular week-long courses in family planning for doctors, nurses, social workers and other interested people in El Salvador and the surrounding countries of Guatemala, Honduras, Nicaragua, Costa Rica and Panama. Twelve regional courses on population dynamics, the physiology of reproduction and family planning were held in the academic year 1968-69 at the Faculty of Medicine at the University of El Salvador. Because the demand for places far exceeds the capacity of the Association's training unit, careful selection of candidates is made through consultation with the national family planning associations. Most of those trained are doctors who are being specially equipped to carry out family planning work either as part of government maternal and child health centres or in Association clinics. Many places are also found for nurses and some social workers also attend in order to build up teams for effective clinic management. A few journalists and teachers have been among the trainees as well as groups of religious leaders including Roman Catholics. Lecturers are mainly university personnel drawn from a wide range of disciplines in order to relate family planning not only to health and medicine but also to socio-economic aspects and community welfare. The El Salvador Association, an IPPF member, gets financial support from the Population Council for the training programme but hopes eventually that responsibility for continuing the courses will be taken over by the Government, probably through the Ministry of Education. Another pace-setting activity of the Association has been its close contacts with industry, particulary through the efforts of its President, Mr. Lucio Burgos, General Manager of the El Salvador Power Company, who has gained the interest and support of business and union leaders. Not only do these groups help the work of the Association through fund-raising and public relations activities, but

  16. Main: 1E1E [RPSD[Archive

    Lifescience Database Archive (English)

    Full Text Available 1E1E トウモロコシ Corn Zea mays L. Beta-Glucosidase, Chloroplast Precursor Name=Glu1; Zea...TDDAYASQEVNGPDGKPIGPPMGNPWIYMYPEGLKDLLMIMKNKYGNPPIYITENGIGDVDTKETPLPMEAALNDYKRLDYIQRHIATLKESIDLGSNVQGYFAWSLLDNFEWFAGFTERYGIVYVDRNNNCTRYMKESAKWLKEFNTAKKPSKKILTPA corn_1E1E.jpg ...

  17. E1a promotes c-Myc-dependent replicative stress: Implications in glioblastoma radiosensitization

    OpenAIRE

    Valero, María Llanos; Cimas, Francisco Jose; Arias, Laura; Melgar-Rojas, Pedro; García, Elena; Callejas-Valera, Juan Luis; García-Cano, Jesús; Serrano-Oviedo, Leticia; Ángel de la Cruz-Morcillo, Miguel; Sánchez-Pérez, Isabel; Sánchez-Prieto, Ricardo

    2013-01-01

    The E1a gene from adenovirus is known to be a potent inducer of chemo/radiosensitivity in a wide range of tumors. However, the molecular bases of its radiosensitizer properties are still poorly understood. In an attempt to study this effect, U87MG cells, derived from a radio-resistant tumor as glioblastoma, where infected with lentivirus carrying E1a gene developing an acute sensitivity to ionizing radiation. The induction of radiosensitivity correlated with a marked G2/M phase accumulation a...

  18. Radiation dosimetry in magnetic fields with Farmer-type ionization chambers: determination of magnetic field correction factors for different magnetic field strengths and field orientations.

    Science.gov (United States)

    Spindeldreier, C K; Schrenk, O; Bakenecker, A; Kawrakow, I; Burigo, L; Karger, C P; Greilich, S; Pfaffenberger, A

    2017-08-01

    The aim of this work was to determine magnetic field correction factors that are needed for dosimetry in hybrid devices for MR-guided radiotherapy for Farmer-type ionization chambers for different magnetic field strengths and field orientations. The response of six custom-built Farmer-type chambers irradiated at a 6 MV linac was measured in a water tank positioned in a magnet with magnetic field strengths between 0.0 T and 1.1 T. Chamber axis, beam and magnetic field were perpendicular to each other and both magnetic field directions were investigated. EGSnrc Monte Carlo simulations were compared to the measurements and simulations with different field orientations were performed. For all geometries, magnetic field correction factors, [Formula: see text], and perturbation factors were calculated. A maximum increase of 8.8% in chamber response was measured for the magnetic field perpendicular to chamber and beam axis. The measured chamber response could be reproduced by adjusting the dead volume layer near the chamber stem in the Monte Carlo simulations. For the magnetic field parallel to the chamber axis or parallel to the beam, the simulated response increased by 1.1% at maximum for field strengths up to 1.1 T. A complex dependence of the response was found on chamber radius, magnetic field strength and orientation of beam, chamber axis and magnetic field direction. Especially for magnetic fields perpendicular to beam and chamber axis, the exact sensitive volume has to be considered in the simulations. To minimize magnetic field correction factors and the influence of dead volumes on the response of Farmer chambers, a measurement set-up with the magnetic field parallel to the chamber axis or parallel to the beam is recommended for dosimetry.

  19. INTERACTION OF LASER RADIATION WITH MATTER: Influence of Ca and Pb impurities on the bulk optical strength of ultrapure NaCl and KCl crystals

    Science.gov (United States)

    Vinogradov, An V.; Voszka, R.; Kovalev, Valerii I.; Faĭzullov, F. S.; Janszky, J.

    1987-06-01

    A significant increase (by a factor of about 3) of the bulk damage threshold in the case of interaction of CO2 laser radiation pulses with ultrapure NaCl and KCl crystals grown in a reactive atmosphere was observed on introduction of divalent metal ions Ca and Pb in concentrations of 10-5-10-6 mol/mol. Impurities were introduced in concentrations of 10-8-10-3 and 2×10-7-10-4 mol/mol into the melts of KCl and NaCl, respectively. The concentration of other impurities (including OH) did not exceed ~10-6 mol/mol. A physical model was developed to account for the observed dependence on the basis of an analogy between a system of colloidal particles and F centers in a crystal and a liquid-vapor system.

  20. 29 CFR 2584.8477(e)-1 - General.

    Science.gov (United States)

    2010-07-01

    ... Regulations Relating to Labor (Continued) EMPLOYEE BENEFITS SECURITY ADMINISTRATION, DEPARTMENT OF LABOR FIDUCIARY RESPONSIBILITY UNDER THE FEDERAL EMPLOYEES' RETIREMENT SYSTEM ACT OF 1986 RULES AND REGULATIONS FOR THE ALLOCATION OF FIDUCIARY RESPONSIBILITY § 2584.8477(e)-1 General. 5 U.S.C. 8477(e)(1)(E...

  1. 26 CFR 1.642(e)-1 - Depreciation and depletion.

    Science.gov (United States)

    2010-04-01

    ... 26 Internal Revenue 8 2010-04-01 2010-04-01 false Depreciation and depletion. 1.642(e)-1 Section 1... (CONTINUED) INCOME TAXES Estates, Trusts, and Beneficiaries § 1.642(e)-1 Depreciation and depletion. An estate or trust is allowed the deductions for depreciation and depletion, but only to the extent the...

  2. Radiation shield

    Energy Technology Data Exchange (ETDEWEB)

    Nemezawa, Isao; Kimura, Tadahiro [Hitachi Ltd., Tokyo (Japan); Omori, Tetsu; Mizuochi, Akira

    1997-11-18

    A radiation shield is constituted by using a flexible bag made of a synthetic resin, a rubber plate or a composite member of them. Water is charged therein as a shielding liquid. Water injection ports are formed at the lower surface, and gas exhaustion ports are formed on the upper surface of the radiation shield. A plurality of vertical ribs made of the same material as the bag of the radiation shield are formed, integral with the bag, each at a space on the outer surface of the radiation shield. A reinforcing tube are inserted to the vertical ribs integral with the bag. The reinforcing tube may be made of an metal or non-metal material, but material having a bending strength greater than that of the bag is used. When wide surfaces are constituted in the horizontal direction as radiation shielding surfaces, a plurality of the radiation shields are used being in adjacent in the horizontal direction. The reinforcing tubes in adjacent with each other among the adjacent radiation shields are connected by connectors. (I.N.)

  3. CYP2E1 hydroxylation of aniline involves negative cooperativity.

    Science.gov (United States)

    Hartman, Jessica H; Knott, Katie; Miller, Grover P

    2014-02-01

    CYP2E1 plays a role in the metabolic activation and elimination of aniline, yet there are conflicting reports on its mechanism of action, and hence relevance, in aniline metabolism. Based on our work with similar compounds, we hypothesized that aniline binds two CYP2E1 sites during metabolism resulting in cooperative reaction kinetics and tested this hypothesis through rigorous in vitro studies. The kinetic profile for recombinant CYP2E1 demonstrated significant negative cooperativity based on a fit of data to the Hill equation (n=0.56). Mechanistically, the data were best explained through a two-binding site cooperative model in which aniline binds with high affinity (K(s)=30 μM) followed by a second weaker binding event (K(ss)=1100 uM) resulting in a threefold increase in the oxidation rate. Binding sites for aniline were confirmed by inhibition studies with 4-methylpyrazole. Inhibitor phenotyping experiments with human liver microsomes validated the central role for CYP2E1 in aniline hydroxylation and indicated minor roles for CYP2A6 and CYP2C9. Importantly, inhibition of minor metabolic pathways resulted in a kinetic profile for microsomal CYP2E1 that replicated the preferred mechanism and parameters observed with the recombinant enzyme. Scaled modeling of in vitro CYP2E1 metabolism of aniline to in vivo clearance, especially at low aniline levels, led to significant deviations from the traditional model based on non-cooperative, Michaelis-Menten kinetics. These findings provide a critical mechanistic perspective on the potential importance of CYP2E1 in the metabolic activation and elimination of aniline as well as the first experimental evidence of a negatively cooperative metabolic reaction catalyzed by CYP2E1. Copyright © 2013 Elsevier Inc. All rights reserved.

  4. Resolvin E1 Reverses Experimental Periodontitis and Dysbiosis.

    Science.gov (United States)

    Lee, Chun-Teh; Teles, Ricardo; Kantarci, Alpdogan; Chen, Tsute; McCafferty, Jon; Starr, Jacqueline R; Brito, Luciana Carla Neves; Paster, Bruce J; Van Dyke, Thomas E

    2016-10-01

    Periodontitis is a biofilm-induced inflammatory disease characterized by dysbiosis of the commensal periodontal microbiota. It is unclear how natural regulation of inflammation affects the periodontal biofilm. Promoters of active resolution of inflammation, including resolvin E1 (RvE1), effectively treat inflammatory periodontitis in animal models. The goals of this study were 1) to compare periodontal tissue gene expression in different clinical conditions, 2) to determine the impact of local inflammation on the composition of subgingival bacteria, and 3) to understand how inflammation impacts these changes. Two clinically relevant experiments were performed in rats: prevention and treatment of ligature-induced periodontitis with RvE1 topical treatment. The gingival transcriptome was evaluated by RNA sequencing of mRNA. The composition of the subgingival microbiota was characterized by 16S rDNA sequencing. Periodontitis was assessed by bone morphometric measurements and histomorphometry of block sections. H&E and tartrate-resistant acid phosphatase staining were used to characterize and quantify inflammatory changes. RvE1 treatment prevented bone loss in ligature-induced periodontitis. Osteoclast density and inflammatory cell infiltration in the RvE1 groups were lower than those in the placebo group. RvE1 treatment reduced expression of inflammation-related genes, returning the expression profile to one more similar to health. Treatment of established periodontitis with RvE1 reversed bone loss, reversed inflammatory gene expression, and reduced osteoclast density. Assessment of the rat subgingival microbiota after RvE1 treatment revealed marked changes in both prevention and treatment experiments. The data suggest that modulation of local inflammation has a major role in shaping the composition of the subgingival microbiota. Copyright © 2016 by The American Association of Immunologists, Inc.

  5. On the Binding Strength Sequence for Nucleic Acid Bases and C60 with Density Functional and Dispersion-corrected Density Functional Theories: Whether C60 could protect nucleic acid bases from radiation-induced damage?

    Science.gov (United States)

    Sun, Wenming; Bu, Yuxiang; Wang, Yixuan

    2011-01-01

    The major objective of this paper is to address a controversial binding sequence between nucleic acid bases (NABs) and C60 by investigating adsorptions of NABs and their cations on C60 fullerene with a variety of density functional theories including two novel hybrid meta-GGA functionals, M05-2x and M06-2x, as well as a dispersion-corrected density functional, PBE-D. The M05-2x/6-311++G** provides the same binding sequence as previously reported, guanine(G) > cytosine(C) > adenine (A) > thymine (T); however, M06-2x switches the binding strengths of A and C, and PBE-D eventually results in the following sequence, G>A>T>C, which is the same as the widely accepted hierarchy for the stacking of NABs on other carbon nanomaterials such as single-walled carbon nanotube and graphite. The results indicate that the questionable relative binding strength is due to insufficient electron correlation treatment with the M05-2x or even the M06-2x method. The binding energy of G@C60 obtained with the M06-2x/6-311++G(d,p) and the PBE-D/cc-pVDZ is −7.10 and −8.07 kcal/mol, respectively, and the latter is only slightly weaker than that predicted by the MP2/6-31G(d,p) (−8.10kca/mol). Thus, the PDE-D performs better than the M06-2x for the observed NAB@C60 π-stacked complexes. To discuss whether C60 could prevent NABs from radiation-induced damage, ionization potentials of NABs and C60, and frontier molecular orbitals of the complexes NABs@C60 and (NABs@C60)+ are also extensively investigated. These results revealed that when an electron escapes from the complexes, a hole was preferentially created in C60 for T and C complexes, while for G and A the hole delocalizes over the entire complex, rather than a localization on the C60 moiety. The interesting finding might open a new strategy for protecting DNA from radiation-induced damage and offer a new idea for designing C60-based antiradiation drugs. PMID:21625361

  6. Oncolytic Replication of E1b-Deleted Adenoviruses

    Directory of Open Access Journals (Sweden)

    Pei-Hsin Cheng

    2015-11-01

    Full Text Available Various viruses have been studied and developed for oncolytic virotherapies. In virotherapy, a relatively small amount of viruses used in an intratumoral injection preferentially replicate in and lyse cancer cells, leading to the release of amplified viral particles that spread the infection to the surrounding tumor cells and reduce the tumor mass. Adenoviruses (Ads are most commonly used for oncolytic virotherapy due to their infection efficacy, high titer production, safety, easy genetic modification, and well-studied replication characteristics. Ads with deletion of E1b55K preferentially replicate in and destroy cancer cells and have been used in multiple clinical trials. H101, one of the E1b55K-deleted Ads, has been used for the treatment of late-stage cancers as the first approved virotherapy agent. However, the mechanism of selective replication of E1b-deleted Ads in cancer cells is still not well characterized. This review will focus on three potential molecular mechanisms of oncolytic replication of E1b55K-deleted Ads. These mechanisms are based upon the functions of the viral E1B55K protein that are associated with p53 inhibition, late viralmRNAexport, and cell cycle disruption.

  7. Electromagnetic Radiation Analysis

    Science.gov (United States)

    1978-04-10

    A methodology is given for determining whether electromagnetic radiation of sufficient strength to cause performance degradation to the test item...exists at the test item location. The results of an electromagnetic radiation effects test are used to identify the radio frequencies and electromagnetic ... radiation levels to which the test item is susceptible. Further, using a test bed, comparisons are made with the representative signal levels to

  8. Energy levels and radiative rates for transitions in Ti VI

    Science.gov (United States)

    Aggarwal, K. M.; Keenan, F. P.; Msezane, A. Z.

    2013-08-01

    We report on calculations of energy levels, radiative rates, oscillator strengths and line strengths for transitions among the lowest 253 levels of the (1s22s22p6) 3s23p5, 3s3p6, 3s23p43d, 3s3p53d, 3s23p33d2, 3s23p44s, 3s23p44p and 3s23p44d configurations of Ti VI. The general-purpose relativistic atomic structure package and flexible atomic code are adopted for the calculations. Radiative rates, oscillator strengths and line strengths are reported for all electric dipole (E1), magnetic dipole (M1), electric quadrupole (E2) and magnetic quadrupole (M2) transitions among the 253 levels, although calculations have been performed for a much larger number of levels. Comparisons are made with existing available results and the accuracy of the data is assessed. Additionally, lifetimes for all 253 levels are listed, although comparisons with other theoretical results are limited to only 88 levels. Our energy levels are estimated to be accurate to better than 1% (within 0.03 Ryd), whereas results for other parameters are probably accurate to better than 20%. A reassessment of the energy level data on the National Institute of Standards and Technology website for Ti VI is suggested.

  9. Project FOOTPRINT: Substation modeling and simulations for E1 pulses

    Energy Technology Data Exchange (ETDEWEB)

    Nelson, Scott D. [Lawrence Livermore National Lab. (LLNL), Livermore, CA (United States); Larson, D. J. [Lawrence Livermore National Lab. (LLNL), Livermore, CA (United States); Kirkendall, B. A. [Lawrence Livermore National Lab. (LLNL), Livermore, CA (United States)

    2017-11-06

    This report includes a presentation with an: Introduction to CW coupling; Introduction to single-pulse coupling; Description of E1 waveforms; Structures in a substation yard --articulated (as part of the substation's defined electrical functionality)--unarticulated (not as part of the substation's defined electrical functionality); Coupling --electrical coupling (capacitive coupling) --magnetic coupling (inductive coupling); Connectivity to long-line transmission lines; Control infrastructure; Summary; and References.

  10. Discovery and Classification of DES15E1iuh

    Science.gov (United States)

    Smith, M.; Sullivan, M.; Childress, M.; D'Andrea, C.; Lewis, G. F.; Mould, J.; Lidman, C.; Tucker, B. E.; Sharp, R.; Yuan, F.; Martini, P.; Brown, P. J.; Krisciunas, K.; Suntzeff, N.; Nichol, R.; Papadopoulos, A.; Maartens, R.; Gupta, R.; Kovacs, E.; Kuhlmann, S.; Spinka, H.; Ahn, E.; Finley, D. A.; Frieman, J.; Marriner, J.; Wester, W.; Aldering, G.; Kim, A. G.; Thomas, R. C.; Barbary, K.; Bloom, J. S.; Goldstein, D.; Nugent, P.; Perlmutter, S.; Foley, R. J.; Casas, R.; Castander, F. J.; Desai, S.; Paech, K.; Smith, R. C.; Schubnell, M.; Kessler, R.; Lasker, J.; Scolnic, D.; Brout, D. J.; Gladney, L.; Sako, M.; Wolf, R. C.

    2015-10-01

    We report optical spectroscopy of DES15E1iuh discovered by the Dark Energy Survey. We obtained spectra using the X-SHOOTER instrument (wavelength range 380-950nm) on the Very Large Telescope (VLT) of the European Southern Observatory (ESO) and the AAOmega Spectrograph (Saunders et al. 2004, SPIE, 5492, 389; wavelength range 370-885nm) and the 2dF fibre positioner at the Anglo-Australian Telescope (AAT).

  11. Therapeutic Strategies against Cyclin E1-Amplified Ovarian Cancers

    Science.gov (United States)

    2016-10-01

    resistance to platinum, management of CCNE1-amplified ovarian cancers is challenging. In this research, we evaluate three novel strategies against...AWARD NUMBER: W81XWH-15-1-0564 TITLE: Therapeutic Strategies against Cyclin E1-Amplified Ovarian Cancers PRINCIPAL INVESTIGATOR: Panagiotis A...Form Approved OMB No. 0704-0188 Public reporting burden for this collection of information is estimated to average 1 hour per response, including

  12. Method and apparatus for measuring electromagnetic radiation

    Science.gov (United States)

    Been, J. F. (Inventor)

    1973-01-01

    An apparatus and method are described in which the capacitance of a semiconductor junction subjected to an electromagnetic radiation field is utilized to indicate the intensity or strength of the radiation.

  13. Quasiparticle random phase approximation predictions of the gamma-ray strength functions using the Gogny force

    Science.gov (United States)

    Hilaire, Stéphane; Goriely, Stéphane; Péru, Sophie; Lechaftois, François; Deloncle, Isabelle; Martini, Marco

    2017-09-01

    Dipole excitations of nuclei are crucial since they play an important role in nuclear reaction modeling in connection with the photoabsorption and the radiative capture processes. We present here results for the gamma-ray strength function obtained in large-scale axially-symmetric deformed quasiparticle (qp) random phase approximations approach using the finite-range Gogny force, with a particular emphasis on the E1 mode. The convergence with respect to the number of harmonic oscillator shells adopted and the cut-off introduced in the 2-quasiparticle excitation energy space is analyzed. The microscopic nature of our self-consistent Hartree-Fock-Bogoliubov plus QRPA (HFB+QRPA) calculation has unfortunately to be broken, some phenomenological corrections being needed to take into account effects beyond the standard 2-qp QRPA excitations and the coupling between the single-particle and low-lying collective phonon degrees of freedom. The corresponding phenomenological parameters are adjusted on experimental photoabsorption data. In such a procedure, a rather satisfactory description of experimental data is obtained. To study the sensitivity of these phenomenological corrections on the extrapolation, both at low energies and towards exotic neutron-rich nuclei, three different prescriptions are considered. They are shown to lead to rather similar predictions of the E1 strength at low energies as well as for exotic neutron-rich nuclei. The Gogny-HFB+QRPA strength is finally applied to the calculation of radiative neutron capture cross sections and the predictions compared with those obtained with more traditional Lorentzian-type approaches.

  14. The chang’E-1 topographic atlas of the Moon

    CERN Document Server

    Li, Chunlai; Mu, Lingli; Ren, Xin; Zuo, Wei

    2016-01-01

    This atlas is based on the lunar global Digital Elevation Models (DEM) of Chang'E-1 (CE-1), and presents CCD stereo image data with digital photogrammetry. The spatial resolution of the DEM in this atlas is 500m, with horizontal accuracy of 192m and vertical accuracy of 120m. Color-shaded relief maps with contour lines are used to show the lunar topographical characteristics. The topographical data gathered by CE-1 can provide fundamental information for the study of lunar topographical, morphological and geological structures, as well as for lunar evolution research.

  15. Radiation vulcanization of rubbers

    Energy Technology Data Exchange (ETDEWEB)

    Makuuchi, Keizo [Japan Atomic Energy Research Inst., Takasaki, Gunma (Japan). Takasaki Radiation Chemistry Research Establishment

    2002-02-01

    An abstract of the radiation process of polymer materials and the polymer reaction by radiation is explained. Main radiation is 250 keV to 10 MeV of electron rays in the industry. Radiation cross-linked rubber has less the tensile strength than that by sulfur and organic peroxide crosslinking. The main origins of low tensile strength are caused by cut of backbone chain and ozone depend on radiation. Acceleration of crosslinking and short time of radiation are necessary to improve these defects. To accelerate crosslinking, we used crosslinking accelerators, for example, three poly-functional monomers (PFM). The maximum tensile strength of styrene-butadiene rubber (SBR) not added crosslinking accelerators showed 3 MPa at 110 kGy, but SBR added A-TMMT (tetramethylolmethane tetraacrylate) showed 5.5 MPa at 110 kGy. Radiation crosslinking of many kinds of rubber: isoprene (IR), SBR, CR, nitrile rubber (NBR), hydrogenated nitrile rubber (HNBR), butyl rubber (IIR), chlorinated butyl rubber (CIIR), EPM and TPE are explained. (S.Y.)

  16. The radiative potential method for calculations of QED radiative corrections to energy levels and electromagnetic amplitudes in many-electron atoms

    OpenAIRE

    Flambaum, V. V.; Ginges, J. S. M.

    2005-01-01

    We derive an approximate expression for a "radiative potential" which can be used to calculate QED strong Coulomb field radiative corrections to energies and electric dipole (E1) transition amplitudes in many-electron atoms with an accuracy of a few percent. The expectation value of the radiative potential gives radiative corrections to the energies. Radiative corrections to E1 amplitudes can be expressed in terms of the radiative potential and its energy derivative (the low-energy theorem): ...

  17. Dissecting the roles of E1A and E1B in adenoviral replication and RCAd-enhanced RDAd transduction efficacy on tumor cells.

    Science.gov (United States)

    Wei, Fang; Wang, Huiping; Chen, Xiafang; Li, Chuanyuan; Huang, Qian

    2014-10-01

    Oncolytic viruses have recently received widespread attention for their potential in innovative cancer therapy. Many telomerase promoter-regulated oncolytic adenoviral vectors retain E1A and E1B. However, the functions of E1A and E1B proteins in the oncolytic role of replication-competent adenovirus (RCAd) and RCAd enhanced transduction of replication defective adenoviruses (RDAd) have not been addressed well. In this study, we constructed viruses expressing E1A alone, E1A plus E1B-19 kDa, and E1A plus E1B-19 kDa/55 kDa. We then tested their roles in oncolysis and replication of RCAd as well as their roles in RCAd enhanced transfection rate and transgene expression of RDAd in various cancer cells in vitro and in xenografted human NCI-H460 tumors in nude mice. We demonstrated that RCAds expressing E1A alone and plus E1B-19 kDa exhibited an obvious ability in replication and oncolytic effects as well as enhanced RDAd replication and transgene expression, with the former showed more effective oncolysis, while the latter exhibited superior viral replication and transgene promotion activity. However, RCAd expressing both E1A and E1B-19 kDa/55 kDa was clearly worst in all these abilities. The effects of E1A and E1B observed through using RCAd were further validated by using plasmids expressing E1A alone, E1A plus E1B-19 kDa, and E1A plus E1B-19 kDa/55 kDa proteins. Our study provided evidence that E1A was essential for inducing replication and oncolytic effects of RCAd as well as RCAd enhanced RDAd transduction, and expression of E1B-19 kDa other than E1B-55 kDa could promote these effects. E1B-55 kDa is not necessary for the oncolytic effects of adenoviruses and somehow inhibits RCAd-mediated RDAd replication and transgene expression.

  18. Low Cost Network Emulator with Ethernet and E1 Interfaces

    Directory of Open Access Journals (Sweden)

    Zbynek Kocur

    2010-01-01

    Full Text Available Contemporary Next Generation Networks (NGN are mainly built on the Internet Protocol (IP and Ethernet. Major challenge for emerging types of wired and wireless IP-based networks is to provide an adequate Quality of Service (QoS for different services. The quality of evaluation requires a detailed knowledge of the performance requirements for particular services and applications. The paper is primarily oriented to the end-to-end testing for the Ethernet-based terminal equipment. The low cost Ethernet network emulator was developed on the Department of Telecommunication Technology of the Faculty of Electrical Engineering of the Czech Technical University in Prague. The extension for emulation network with the E1 interfaces and TDM over IP transmission can be used with external converters.

  19. Description of dipole strength in heavy nuclei in conformity with their quadrupole degrees of freedom

    Directory of Open Access Journals (Sweden)

    Schramm G.

    2012-02-01

    Full Text Available In conformity to new findings about the widespread occurrence of triaxiality arguments are given in favor of a description of the giant dipole resonance in heavy nuclei by the sum of three Lorentzians. This TLO parameterization allows a strict use of resonance widths Γ in accordance to the theoretically founded power law relation to the resonance energy. No additional variation of Γ with the photon energy and no violation of the sum rule are necessary to obtain a good agreement to nuclear photo-effect, photon scattering and radiative capture data. Photon strength other than E1 has a small effect, but the influence of the level density on photon emission probabilities needs further investigation.

  20. Effects Of Radiation On Insulators

    Science.gov (United States)

    Bouquet, Frank L.

    1988-01-01

    Report presents data on responses of electrically insulating thermosetting and thermoplastic polymers to radiation. Lowest-threshold-dose (LTD) levels and 25-percent-change levels presented for such properties as tensile strength and electrical resistivity. Data on radiation-induced outgassing also given.

  1. Radiation Therapy

    Science.gov (United States)

    ... Be extra careful not to spend time with children or pregnant women. Internal Radiation Therapy Makes You Give Off Radiation With systemic radiation, your body fluids ( urine , sweat, and saliva ) will give off radiation for a while. With ...

  2. Radiation enteritis

    Science.gov (United States)

    Radiation enteropathy; Radiation-induced small bowel injury; Post-radiation enteritis ... Radiation therapy uses high-powered x-rays, particles, or radioactive seeds to kill cancer cells. The therapy ...

  3. Energy levels, lifetimes and radiative data of W LV

    Science.gov (United States)

    Ding, Xiao-bin; Sun, Rui; Koike, Fumihiro; Murakami, Izumi; Kato, Daiji; Sakaue, Hiroyuki A.; Nakamura, Nobuyuki; Dong, Chen-zhong

    2018-01-01

    Calculations of energy levels, radiative data and lifetimes are reported for tungsten Ca-like ion (W LV) by using multi-configuration Dirac-Fock (MCDF) method. The GRASP2K package is adopted to carry out a large-scale systematic computation with a restricted active space treatment; the Breit interaction and QED effects are included in subsequent relativistic configuration interaction calculations. The energies and lifetimes of the lowest 119 levels are listed; the main leading configuration of the levels is of the ground state configuration [Ne]3s23p63d2 and the first excited configuration [Ne]3s23p53d3. The wavelengths, radiative rates and oscillator strengths for relatively strong E1, E2, M1, and M2 transitions are listed. Comparisons with earlier experimental and theoretical values are made. The average relative deviations of energy levels from the NIST results and E1 transition wavelengths from the EBIT experimental results have turned to be only 0.20% and 0.13%, respectively. The other present results are in reasonable agreement with available data. These agreements confirm the reliability and accuracy of the current results. The present datasets may help us with the investigation of the electron-electron correlation effects in complex multi-electron highly charged heavy ions and of the diagnosis of tungsten impurity plasmas in fusion science.

  4. Infection with E1B-mutant adenovirus stabilizes p53 but blocks p53 acetylation and activity through E1A

    DEFF Research Database (Denmark)

    Savelyeva, I.; Dobbelstein, M.

    2011-01-01

    Wild-type adenovirus type 5 eliminates p53 through the E1B-55 kDa and E4-34 kDa gene products. Deletion or mutation of E1B-55 kDa has long been thought to confer p53-selective replication of oncolytic viruses. We show here that infection with E1B-defective adenovirus mutants induces massive...... acetylation in infected cells. Mutating either of these E1A regions, in addition to E1B, partially restored p21 mRNA levels. Our findings argue that adenovirus attenuates p53-mediated p21 induction, through at least two E1B-independent mechanisms. Other virus species and cancer cells may employ analogous...

  5. Strengths-based Learning

    DEFF Research Database (Denmark)

    Ledertoug, Mette Marie

    Strength-based learning - Children͛s Character Strengths as Means to their Learning Potential͛ is a Ph.D.-project aiming to create a strength-based mindset in school settings and at the same time introducing strength-based interventions as specific tools to improve both learning and well......-being. The Ph.D.-project in Strength-based learning took place in a Danish school with 750 pupils age 6-16 and a similar school was functioning as a control group. The presentation will focus on both the aware-explore-apply processes and the practical implications for the schools involved, and on measurable...

  6. Strength Modeling Report

    Science.gov (United States)

    Badler, N. I.; Lee, P.; Wong, S.

    1985-01-01

    Strength modeling is a complex and multi-dimensional issue. There are numerous parameters to the problem of characterizing human strength, most notably: (1) position and orientation of body joints; (2) isometric versus dynamic strength; (3) effector force versus joint torque; (4) instantaneous versus steady force; (5) active force versus reactive force; (6) presence or absence of gravity; (7) body somatotype and composition; (8) body (segment) masses; (9) muscle group envolvement; (10) muscle size; (11) fatigue; and (12) practice (training) or familiarity. In surveying the available literature on strength measurement and modeling an attempt was made to examine as many of these parameters as possible. The conclusions reached at this point toward the feasibility of implementing computationally reasonable human strength models. The assessment of accuracy of any model against a specific individual, however, will probably not be possible on any realistic scale. Taken statistically, strength modeling may be an effective tool for general questions of task feasibility and strength requirements.

  7. PprM is necessary for up-regulation of katE1, encoding the major catalase of Deinococcus radiodurans, under unstressed culture conditions.

    Science.gov (United States)

    Jeong, Sun-Wook; Seo, Ho Seong; Kim, Min-Kyu; Choi, Jong-Il; Lim, Heon-Man; Lim, Sangyong

    2016-06-01

    Deinococcus radiodurans is a poly-extremophilic organism, capable of tolerating a wide variety of different stresses, such as gamma/ultraviolet radiation, desiccation, and oxidative stress. PprM, a cold shock protein homolog, is involved in the radiation resistance of D. radiodurans, but its role in the oxidative stress response has not been investigated. In this study, we investigated the effect of pprM mutation on catalase gene expression. pprM disruption decreased the mRNA and protein levels of KatE1, which is the major catalase in D. radiodurans, under normal culture conditions. A pprM mutant strain (pprM MT) exhibited decreased catalase activity, and its resistance to hydrogen peroxide (H2O2) decreased accordingly compared with that of the wild-type strain. We confirmed that RecG helicase negatively regulates katE1 under normal culture conditions. Among katE1 transcriptional regulators, the positive regulator drRRA was not altered in pprM (-), while the negative regulators perR, dtxR, and recG were activated more than 2.5-fold in pprM MT. These findings suggest that PprM is necessary for KatE1 production under normal culture conditions by down-regulation of katE1 negative regulators.

  8. Data of evolutionary structure change: 1E1EA-2RGMB [Confc[Archive

    Lifescience Database Archive (English)

    Full Text Available 1E1EA-2RGMB 1E1E 2RGM A B MLSPSEIPQRDWFPSDFTFGAATSAYQIEGAWNEDGKGESNWDHFCHNHPERILDG...SNSDIGANSYHMYKTDVRLLKEMGMDAYRFSISWPRILPKGTKEGGINPDGIKYYRNLINLLLENGIEPYVTIFHWDVPQALEEKYGGFLDKSHKSIVED...KEFNTA ---WLGGLSRAAFPKRFVFGTVTSAYQVEGMAASGGRGPSIWDAFAHT-PGNVAGNQNGDVATDQYHRYKEDVNLMKSLN...TPTSYSADWQVTYVFAK-NGKPIGPQANSNWLYIVPWGMYGCVNYIKQKYGNPTVVITENGMDQPAN----LSRDQYLRDTTRVHFYRSYLTQLKKAIDE... 2RGM B 2RGMB

  9. Data of evolutionary structure change: 1E1EB-2RGMB [Confc[Archive

    Lifescience Database Archive (English)

    Full Text Available 1E1EB-2RGMB 1E1E 2RGM B B QNGVQMLSPSEIPQRDWFPSDFTFGAATSAYQIEGAWNEDGKGESNWDHFCHNHPE...RILDGSNSDIGANSYHMYKTDVRLLKEMGMDAYRFSISWPRILPKGTKEGGINPDGIKYYRNLINLLLENGIEPYVTIFHWDVPQALEEKYGGFLDKSHK...A --------WLGGLSRAAFPKRFVFGTVTSAYQVEGMAASGGRGPSIWDAFAHT-PGNVAGNQNGDVATDQYHRYKEDVNLMKSLN...TPTSYSADWQVTYVFAK-NGKPIGPQANSNWLYIVPWGMYGCVNYIKQKYGNPTVVITENGMDQPAN----LSRDQYLRDTTRVHFYRSYLTQLKKAIDE... 2RGM B 2RGMB

  10. Energy levels, oscillator strengths, line strengths, and transition probabilities in Si-like ions of La XLIII, Er LIV, Tm LV, and Yb LVI

    Energy Technology Data Exchange (ETDEWEB)

    Chen, Zhan-Bin, E-mail: chenzb008@qq.com [College of Science, National University of Defense Technology, Changsha, Hunan 410073 (China); Ma, Kun [School of Information Engineering, Huangshan University, Huangshan 245041 (China); Wang, Hong-Jian [Chongqing Key Laboratory for Design and Control of Manufacturing Equipment, Chongqing Technology and Business University, Chongqing 40067 (China); Wang, Kai, E-mail: wangkai@hbu.edu.cn [Hebei Key Lab of Optic-electronic Information and Materials, The College of Physics Science and Technology, Hebei University, Baoding 071002 (China); Liu, Xiao-Bin [Department of Physics, Tianshui Normal University, Tianshui 741001 (China); Zeng, Jiao-Long [College of Science, National University of Defense Technology, Changsha, Hunan 410073 (China)

    2017-01-15

    Detailed calculations using the multi-configuration Dirac–Fock (MCDF) method are carried out for the lowest 64 fine-structure levels of the 3s{sup 2}3p{sup 2}, 3s{sup 2}3p3d, 3s3p{sup 3}, 3s3p{sup 2}3d, 3s{sup 2}3d{sup 2}, and 3p{sup 4} configurations in Si-like ions of La XLIII, Er LIV, Tm LV, and Yb LVI. Energies, oscillator strengths, wavelengths, line strengths, and radiative electric dipole transition rates are given for all ions. A parallel calculation using the many-body perturbation theory (MBPT) method is also carried out to assess the present energy levels accuracy. Comparisons are performed between these two sets of energy levels, as well as with other available results, showing that they are in good agreement with each other within 0.5%. These high accuracy results can be used to the modeling and the interpretation of astrophysical objects and fusion plasmas. - Highlights: • Energy levels and E1 transition rates of Si-like ions are presented. • Breit interaction and Quantum Electrodynamics effects are discussed. • Present results should be useful in the astrophysical application and plasma modeling.

  11. Heat denaturation of Brazil nut allergen Ber e 1 in relation to food processing

    NARCIS (Netherlands)

    Boxtel, E.L. van; Koppelman, S.J.; Broek, L.A.M. van den; Gruppen, H.

    2008-01-01

    Ber e 1, a major allergen from Brazil nuts, is very stable to in vitro peptic digestion. As heat-induced denaturation may affect protein digestibility, the denaturation behaviour of Ber e 1 was investigated. The denaturation temperature of Ber e 1 varies from approximately 80-110 °C, depending on

  12. 17 CFR 270.30e-1 - Reports to stockholders of management companies.

    Science.gov (United States)

    2010-04-01

    ... shared address unless the company receives contrary instructions; (B) Include a toll-free telephone... management companies. 270.30e-1 Section 270.30e-1 Commodity and Securities Exchanges SECURITIES AND EXCHANGE COMMISSION (CONTINUED) RULES AND REGULATIONS, INVESTMENT COMPANY ACT OF 1940 § 270.30e-1 Reports to...

  13. 26 CFR 1.669(e)-1A - Pro rata portion of taxes deemed distributed.

    Science.gov (United States)

    2010-04-01

    ... 26 Internal Revenue 8 2010-04-01 2010-04-01 false Pro rata portion of taxes deemed distributed. 1.669(e)-1A Section 1.669(e)-1A Internal Revenue INTERNAL REVENUE SERVICE, DEPARTMENT OF THE TREASURY... Taxable Years Beginning Before January 1, 1969 § 1.669(e)-1A Pro rata portion of taxes deemed distributed...

  14. Heat denaturation of Brazil nut allergen Ber e 1 in relation to food processing

    NARCIS (Netherlands)

    Boxtel, van E.L.; Koppelman, S.J.; Broek, van den L.A.M.; Gruppen, H.

    2008-01-01

    Ber e 1, a major allergen from Brazil nuts, is very stable to in vitro peptic digestion. As heat-induced denaturation may affect protein digestibility, the denaturation behaviour of Ber e 1 was investigated. The denaturation temperature of Ber e 1 varies from approximately 80¿110 °C, depending on

  15. Absence of NR2E1 mutations in patients with aniridia

    DEFF Research Database (Denmark)

    Corso-Díaz, Ximena; Borrie, Adrienne E; Bonaguro, Russell

    2012-01-01

    Nuclear receptor 2E1 (NR2E1) is a transcription factor with many roles during eye development and thus may be responsible for the occurrence of certain congenital eye disorders in humans. To test this hypothesis, we screened NR2E1 for candidate mutations in patients with aniridia and other...

  16. Radiation Therapy

    Science.gov (United States)

    Radiation therapy is a cancer treatment. It uses high doses of radiation to kill cancer cells and stop them from ... half of all cancer patients receive it. The radiation may be external, from special machines, or internal, ...

  17. CYP2E1 Rsa I/Pst I polymorphism contributes to oral cancer susceptibility: a meta-analysis.

    Science.gov (United States)

    Niu, Yuming; Hu, Yuanyuan; Wu, Mingyue; Jiang, Fei; Shen, Ming; Tang, Chunbo; Chen, Ning

    2012-01-01

    Previous data on association between CYP2E1 Rsa I/Pst I polymorphism and oral cancer risk were controversial. To investigate the association between CYP2E1 Rsa I/Pst I polymorphism and oral cancer risk. We performed a meta-analysis to assess the relationship between oral cancer and genotype with English language until June 2010. Twelve published case-control studies of 1259 patients with oral cancer and 2262 controls were acquired. Odds ratios (ORs) with 95% confidence intervals (CIs) were used to assess the strength of the association in codominant and dominant models. Overall, the pooled ORs indicated a significant association between CYP2E1 Rsa I/Pst I polymorphism and oral cancer risk (for c1/c2 vs. c1/c1: OR=1.30, 95% CI=1.04-1.62, Pheterogeneity=0.57; for (c1/c2+c2/c2) vs. c1/c1: OR=1.32, 95% CI=1.07-1.64, Pheterogeneity=0.57, respectively). In subgroup analysis by race, the same significant risks were found among Asian (for c1/c2 vs. c1/c1: OR=1.41, 95% CI=1.05-1.91, Pheterogeneity=0.92; for (c1/c2+c2/c2) vs. c1/c1: OR=1.43, 95% CI=1.08-1.88, Pheterogeneity=0.97, respectively). In conclusion, this meta-analysis demonstrates that CYP2E1 Rsa I/Pst I c2 allele may be a biomarker for oral cancer, especially among Asian populations.

  18. Radiation dosimetry

    CERN Document Server

    Hine, Gerald J; Hine, Gerald J

    1956-01-01

    Radiation Dosimetry focuses on the advancements, processes, technologies, techniques, and principles involved in radiation dosimetry, including counters and calibration and standardization techniques. The selection first offers information on radiation units and the theory of ionization dosimetry and interaction of radiation with matter. Topics include quantities derivable from roentgens, determination of dose in roentgens, ionization dosimetry of high-energy photons and corpuscular radiations, and heavy charged particles. The text then examines the biological and medical effects of radiation,

  19. Pioglitazone, quercetin and hydroxy citric acid effect on cytochrome P450 2E1 (CYP2E1) enzyme levels in experimentally induced non alcoholic steatohepatitis (NASH).

    Science.gov (United States)

    Surapaneni, K M; Priya, V V; Mallika, J

    2014-01-01

    Non-Alcoholic Steatohepatitis (NASH) is a severe form of Non Alcoholic Fatty Liver Disease (NAFLD) spectrum, which progresses to the end stage liver disease. A common denominator in the pathogenesis of insulin resistance and nonalcoholic steatohepatitis is increased oxidative stress. Hepatic induction of the pro-oxidant enzyme Cytochrome P450 2E1 (CYP2E1) occurs in both NAFLD and type-2 diabetes. In this study, the comparative effect of pioglitazone, quercetin and hydroxy citric acid on liver CYP2E1 enzyme levels in experimentally induced NASH has been studied. The experimental protocol consists of 5 groups viz. Control (n = 6); NASH Induced (n=6); NASH + Pioglitazone (n=6); NASH + Quercetin (n=6); NASH + Hydroxy Citric Acid (n=6). CYP2E1 enzyme levels were detected in liver by immunoblot analysis in all the groups. CYP2E1 catalytic activity was increased in experimentally induced NASH group compared to control group as evidenced by the Immunoblot analysis. It revealed low CYP2E1 in the experimentally induced NASH, treated with pioglitazone, quercetin and hydroxy citric acid. Mild decrease in the levels of CYP2E1 level was observed in experimental NASH treated with pioglitazone compared to NASH group. Treatment with hydroxy citric acid also showed mild decrease in the levels of CYP2E1. On contrary to the action of pioglitazone and hydroxy citric acid, quercetin showed an approximate 2-fold decrease in the level of CYP2E1 in experimental NASH treated with quercetin compared to NASH group. Being a powerful antioxidant, quercetin offers absolute protection to liver against NASH by reducing the levels of CYP2E1 and, thereby, reducing CYP2E1 mediated oxidative stress, which is believed to be the one of the key factor in the pathogenesis of NASH. On the other hand, pioglitazone and hydroxy citric acid exerted limited effect on the levels of CYP2E1. This study showed the therapeutic value of quercetin, pioglitazone and hydroxy citric acid in treating NASH.

  20. The strength compass

    DEFF Research Database (Denmark)

    Ledertoug, Mette Marie

    Individual paper presentation: The ‘Strength Compass’. The results of a PhDresearch project among schoolchildren (age 6-16) identifying VIAstrengths concerning age, gender, mother-tongue-langue and possible child psychiatric diagnosis. Strengths-based interventions in schools have a theoretical...... the results for strengths display for children aged 6-16 in different categories: • Different age groups – are the same strengths present in both small children and youths? • Gender – Do the results show differences between the two genders? • Danish as a mother- tongue language. Do the results show any...

  1. Low-lying dipole strength in 52Cr

    Science.gov (United States)

    Shizuma, T.; Hayakawa, T.; Daito, I.; Ohgaki, H.; Miyamoto, S.; Minato, F.

    2017-10-01

    The low-lying dipole strength in 52Cr was measured in nuclear resonance fluorescence experiments using a quasimonochromatic, linearly polarized photon beam. The parities of the excited dipole states were determined by the intensity asymmetry of resonantly scattered γ rays with respect to the polarization plane of the incident photon beam. We observed 62 resonances at excitation energies between 7.5 and 12.1 MeV. The observed M 1 and E 1 strengths were compared via random-phase-approximation calculations using the Skyrme interaction. The effects of two-particle-two-hole configuration mixing and tensor force on dipole strength distributions were investigated.

  2. Anisotropic Concrete Compressive Strength

    DEFF Research Database (Denmark)

    Gustenhoff Hansen, Søren; Jørgensen, Henrik Brøner; Hoang, Linh Cao

    2017-01-01

    When the load carrying capacity of existing concrete structures is (re-)assessed it is often based on compressive strength of cores drilled out from the structure. Existing studies show that the core compressive strength is anisotropic; i.e. it depends on whether the cores are drilled parallel...

  3. AAV-2 Rep78 and HPV-16 E1 interact in vitro, modulating their ATPase activity.

    Science.gov (United States)

    Bandyopadhyay, Sarmistha; Raney, Kevin D; Liu, Yong; Hermonat, Paul L

    2008-01-15

    Adeno-associated virus (AAV) is a nonpathogenic single-stranded human parvovirus which usually requires the presence of a "helper" virus for strong DNA replication. In addition to adeno- and herpes viruses, human papillomavirus (HPV) can serve as an AAV helper. We recently published that HPV type 16 (HPV-16) E1 protein contributes significantly as an individual helper gene for AAV-2 DNA replication and transcription. As Rep78 and E1 are the corresponding DNA helicase/replication proteins of AAV and HPV, respectively, and Rep78 and E1 have a degree of homology, we assayed whether these two proteins interact physically. The full length proteins were purified from bacteria as GST-E1 and MBP-Rep78 and used in five assays to observe Rep78-E1 interactions. All five assays (pull-down, coimmunoprecipitation, enzyme-linked immunosorbent assay (ELISA), chemical cross-linking, and ATPase activity) provided evidence consistent with Rep78-E1 interaction. Most intriguing, an overall decrease in ATPase activity was observed when both proteins were present together. These data strongly suggest that E1 and Rep78 interact and that this interaction modulates at least some of their individual biochemical functions. This study adds to our understanding of AAV-HPV interaction biology, E1's modulation of Rep78 biochemistry, Rep78's modulation of E1 biochemistry and provides initial clues which may lead to the underlying mechanism of HPV E1 helper function for AAV DNA replication.

  4. Improved Plant-based Production of E1 endoglucanase Using Potato: Expression Optimization and Tissue Targeting

    Energy Technology Data Exchange (ETDEWEB)

    Dai, Ziyu [Pacific Northwest National Lab. (PNNL), Richland, WA (United States); Hooker, Brian S. [Pacific Northwest National Lab. (PNNL), Richland, WA (United States); Anderson, Daniel B. [Pacific Northwest National Lab. (PNNL), Richland, WA (United States); Thomas, Steven R. [National Renewable Energy Lab. (NREL), Golden, CO (United States)

    2000-06-01

    Optimization of Acidothermus cellulolyticus endoglucanase (E1) gene expression in transgenic potato (Solanum tuberosum L.) was examined in this study, where the E1 coding sequence was transcribed under control of a leaf specific promoter (tomato RbcS-3C) or the Mac promoter (a hybrid promoter of mannopine synthase promoter and cauliflower mosaic virus 35S promoter enhancer region). Average E1 activity in leaf extracts of potato transformants, in which E1 protein was targeted by a chloroplast signal peptide and an apoplast signal peptide were much higher than those by an E1 native signal peptide and a vacuole signal peptide. E1 protein accumulated up to 2.6% of total leaf soluble protein, where E1 gene was under control of the RbcS-3C promoter, alfalfa mosaic virus 5-untranslated leader, and RbcS-2A signal peptide. E1 protein production, based on average E1 activity and E1 protein accumulation in leaf extracts, is higher in potato than those measured previously in transgenic tobacco bearing the same transgene constructs. Comparisons of E1 activity, protein accumulation, and relative mRNA levels showed that E1 expression under control of tomato RbcS-3C promoter was specifically localized in leaf tissues, while E1 gene was expressed in both leaf and tuber tissues under control of Mac promoter. This suggests dual-crop applications in which potato vines serve as enzyme production `bioreactors' while tubers are preserved for culinary applications.

  5. The Role of CYP2E1 in the Drug Metabolism or Bioactivation in the Brain

    Directory of Open Access Journals (Sweden)

    W. A. García-Suástegui

    2017-01-01

    Full Text Available Organisms have metabolic pathways that are responsible for removing toxic agents. We always associate the liver as the major organ responsible for detoxification of the body; however this process occurs in many tissues. In the same way, as in the liver, the brain expresses metabolic pathways associated with the elimination of xenobiotics. Besides the detoxifying role of CYP2E1 for compounds such as electrophilic agents, reactive oxygen species, free radical products, and the bioactivation of xenobiotics, CYP2E1 is also related in several diseases and pathophysiological conditions. In this review, we describe the presence of phase I monooxygenase CYP2E1 in regions of the brain. We also explore the conditions where protein, mRNA, and the activity of CYP2E1 are induced. Finally, we describe the relation of CYP2E1 in brain disorders, including the behavioral relations for alcohol consumption via CYP2E1 metabolism.

  6. Largazole and its derivatives selectively inhibit ubiquitin activating enzyme (e1.

    Directory of Open Access Journals (Sweden)

    Dana Ungermannova

    Full Text Available Protein ubiquitination plays an important role in the regulation of almost every aspect of eukaryotic cellular function; therefore, its destabilization is often observed in most human diseases and cancers. Consequently, developing inhibitors of the ubiquitination system for the treatment of cancer has been a recent area of interest. Currently, only a few classes of compounds have been discovered to inhibit the ubiquitin-activating enzyme (E1 and only one class is relatively selective in E1 inhibition in cells. We now report that Largazole and its ester and ketone analogs selectively inhibit ubiquitin conjugation to p27(Kip1 and TRF1 in vitro. The inhibitory activity of these small molecules on ubiquitin conjugation has been traced to their inhibition of the ubiquitin E1 enzyme. To further dissect the mechanism of E1 inhibition, we analyzed the effects of these inhibitors on each of the two steps of E1 activation. We show that Largazole and its derivatives specifically inhibit the adenylation step of the E1 reaction while having no effect on thioester bond formation between ubiquitin and E1. E1 inhibition appears to be specific to human E1 as Largazole ketone fails to inhibit the activation of Uba1p, a homolog of E1 in Schizosaccharomyces pombe. Moreover, Largazole analogs do not significantly inhibit SUMO E1. Thus, Largazole and select analogs are a novel class of ubiquitin E1 inhibitors and valuable tools for studying ubiquitination in vitro. This class of compounds could be further developed and potentially be a useful tool in cells.

  7. 26 CFR 1.1059(e)-1 - Non-pro rata redemptions.

    Science.gov (United States)

    2010-04-01

    ... 26 Internal Revenue 11 2010-04-01 2010-04-01 true Non-pro rata redemptions. 1.1059(e)-1 Section 1... (CONTINUED) INCOME TAXES Special Rules § 1.1059(e)-1 Non-pro rata redemptions. (a) In general. Section 1059(d... 1059(e)(1). For example, if a redemption of stock is not pro rata as to all shareholders, any amount...

  8. Graphene Oxide Hybridized nHAC/PLGA Scaffolds Facilitate the Proliferation of MC3T3-E1 Cells

    Science.gov (United States)

    Liang, Chunyong; Luo, Yongchao; Yang, Guodong; Xia, Dan; Liu, Lei; Zhang, Xiaomin; Wang, Hongshui

    2018-01-01

    Biodegradable porous biomaterial scaffolds play a critical role in bone regeneration. In this study, the porous nano-hydroxyapatite/collagen/poly(lactic-co-glycolic acid)/graphene oxide (nHAC/PLGA/GO) composite scaffolds containing different amount of GO were fabricated by freeze-drying method. The results show that the synthesized scaffolds possess a three-dimensional porous structure. GO slightly improves the hydrophilicity of the scaffolds and reinforces their mechanical strength. Young's modulus of the 1.5 wt% GO incorporated scaffold is greatly increased compared to the control sample. The in vitro experiments show that the nHAC/PLGA/GO (1.5 wt%) scaffolds significantly cell adhesion and proliferation of osteoblast cells (MC3T3-E1). This present study indicates that the nHAC/PLGA/GO scaffolds have excellent cytocompatibility and bone regeneration ability, thus it has high potential to be used as scaffolds in the field of bone tissue engineering.

  9. Anisotropic Concrete Compressive Strength

    DEFF Research Database (Denmark)

    Gustenhoff Hansen, Søren; Jørgensen, Henrik Brøner; Hoang, Linh Cao

    2017-01-01

    When the load carrying capacity of existing concrete structures is (re-)assessed it is often based on compressive strength of cores drilled out from the structure. Existing studies show that the core compressive strength is anisotropic; i.e. it depends on whether the cores are drilled parallel...... correlation to the curing time. The experiments show no correlation between the anisotropy and the curing time and a small strength difference between the two drilling directions. The literature shows variations on which drilling direction that is strongest. Based on a Monto Carlo simulation of the expected...

  10. Strength of human pulleys.

    Science.gov (United States)

    Manske, P R; Lesker, P A

    1977-06-01

    The length, breaking stength, and tensile strength of each of the annular fibroosseous pulleys of digital flexor sheath in ten fresh human cadaver specimens were measured. The first annular pulley and the fourth annular pulley were found to be the strongest, while the second annular pulley was the weakest. The design of artificial pulleys should reproduce the strength of the first annular and fourth annular pulleys. Suggested minimum requirements for the breaking strength of artificial implant pulleys may be made based on these studies.

  11. Fabric space radiators

    Energy Technology Data Exchange (ETDEWEB)

    Antoniak, Z.I.; Krotiuk, W.J.; Webb, B.J.; Prater, J.T.; Bates, J.M.

    1988-01-01

    Future Air Force space missions will require thermal radiators that both survive in the hostile space environment and stow away for minimal bulk during launch. Advances in all aspects of radiator design, construction, and analysis will be necessary to enable such future missions. Currently, the best means for obtaining high strength along with flexibility is through structures known as fabrics. The development of new materials and bonding techniques has extended the application range of fabrics into areas traditionally dominated by monolithic and/or metallic structures. Given that even current spacecraft heat rejection considerations tend to dominate spacecraft design and mass, the larger and more complex designs of the future face daunting challenges in thermal control. Ceramic fabrics bonded to ultra-thin metal liners (foils) have the potential of achieving radiator performance levels heretofore unattainable, and of readily matching the advances made in other branches of spacecraft design. The research effort documented here indicates that both pumped loops and heat pipes constructed in ceramic fabrics stand to benefit in multiple ways. Flexibility and low mass are the main advantages exhibited by fabric radiators over conventional metal ones. We feel that fabric radiators have intrinsic merits not possessed by any other radiator design and need to be researched further. 26 refs., 16 figs., 17 tabs.

  12. Identification and characterization of multiple conserved nuclear localization signals within adenovirus E1A

    Energy Technology Data Exchange (ETDEWEB)

    Marshall, Kris S.; Cohen, Michael J.; Fonseca, Greg J.; Todorovic, Biljana; King, Cason R. [Department of Microbiology and Immunology, Western University, London Regional Cancer Program, London, ON, Canada N6A 4L6 (Canada); Yousef, Ahmed F. [Department of Chemical and Environmental Engineering, Masdar Institute, Abu Dhabi (United Arab Emirates); Zhang, Zhiying [College of Animal Science and Technologies, Northwest A and F University, Yangling, Shaanxi 712100 (China); Mymryk, Joe S., E-mail: jmymryk@uwo.ca [Department of Microbiology and Immunology, Western University, London Regional Cancer Program, London, ON, Canada N6A 4L6 (Canada); Department of Oncology, Western University, London Regional Cancer Program, London, ON, Canada N6A 4L6 (Canada)

    2014-04-15

    The human adenovirus 5 (HAdV-5) E1A protein has a well defined canonical nuclear localization signal (NLS) located at its C-terminus. We used a genetic assay in the yeast Saccharomyces cerevisiae to demonstrate that the canonical NLS is present and functional in the E1A proteins of each of the six HAdV species. This assay also detects a previously described non-canonical NLS within conserved region 3 and a novel active NLS within the N-terminal/conserved region 1 portion of HAdV-5 E1A. These activities were also present in the E1A proteins of each of the other five HAdV species. These results demonstrate that, despite substantial differences in primary sequence, HAdV E1A proteins are remarkably consistent in that they contain one canonical and two non-canonical NLSs. By utilizing independent mechanisms, these multiple NLSs ensure nuclear localization of E1A in the infected cell. - Highlights: • HAdV E1A uses multiple mechanisms for nuclear import. • We identified an additional non-canonical NLS in the N-terminal/CR1 portion of E1A. • The new NLS does not contact importin-alpha directly. • All NLSs are functionally conserved in the E1A proteins of all 6 HAdV species.

  13. HPV E1 up-regulates replication-related biochemistries of AAV Rep78.

    Science.gov (United States)

    Bandyopadhyay, Sarmistha; Cao, Maohua; Liu, Yong; Hermonat, Paul L

    2010-06-20

    Human papillomavirus type 16 (HPV) E1 protein provides helper function for the adeno-associated virus type 2 (AAV) life cycle. E1 is the replication protein of HPV, analogous to AAV Rep78, but without the endonuclease/covalent attachment activity of Rep78. Previously we have shown that E1 and Rep78 interact in vitro. Here we investigated E1's effects on Rep78 interaction with AAV's inverted terminal repeat (ITR) DNA in vitro, using purified Rep78 and E1 proteins from bacteria. E1 enhanced Rep78-ITR binding, ATPase activity, Rep78-ITR-covalent linkage and Rep78-ITR-endonuclease activity (central to AAV replication). These enhancements occurred in a dose-dependent manner whenever assayed. However, overall Rep78-plus-E1 helicase activity was lower than Rep78's helicase activity. These data suggest that E1's broad-based helper function for the AAV life cycle (AAV DNA, mRNA, and protein levels are up-regulated by E1) is likely through its ability to enhance Rep78's critical replication-required biochemistries on ITR DNA. Published by Elsevier Inc.

  14. In vivo induction of hepatic P4502E1 by ethanol: role of increased enzyme synthesis.

    Science.gov (United States)

    Tsutsumi, M; Lasker, J M; Takahashi, T; Lieber, C S

    1993-07-01

    P4502E1 (2E1), an ethanol-inducible P450 enzyme, plays an important role in the bioactivation of certain hepatotoxins and chemical carcinogens. Different mechanisms of 2E1 induction by ethanol and other agents (e.g., acetone) have been proposed, ranging from enhanced de novo enzyme synthesis caused by an increase in 2E1 mRNA and/or the efficiency with which it is translated to decreased enzyme degradation stemming from substrate stabilization. To evaluate these mechanisms, we first examined the time course of hepatic 2E1 protein induction in rats pair-fed liquid diets containing 36% of total calories as either ethanol or dextrin-maltose (controls) for 28 days. Western blot analysis with anti-2E1 immunoglobulins revealed that 2E1 reached a new steady-state level (eightfold greater than that found with controls) after ethanol feeding for 10 days and remained elevated for the duration of treatment. Microsomal p-nitrophenol hydroxylation, a 2E1-catalyzed reaction, exhibited a similar induction time course, with the maximal increase in enzyme activity also observed on Day 10 of ethanol administration. We then determined steady-state 2E1 protein turnover in ethanol-fed and control animals that were given [35S]methionine plus[3H]aminolevulinate to radiolabel 2E1 apoprotein and the prosthetic heme group, respectively. Monophasic exponential decay curves showed that hepatic 2E1 protein and heme half-lives (27-28 h and 17 h, respectively) did not differ between the treatment groups. However, rates of 2E1 synthesis, assessed by measuring initial rates of incorporation of [35S]methionine and [3H]aminolevulinate into 2E1 apoprotein and heme, were increased in animals fed ethanol. Our results indicate that the in vivo induction of hepatic 2E1 protein by ethanol involves increased enzyme synthesis rather than decreased enzyme degradation. This enhancement of de novo 2E1 synthesis most likely entails the ethanol-mediated increase of steady-state levels of 2E1 mRNA and/or the

  15. Microarray-based analysis and clinical validation identify ubiquitin-conjugating enzyme E2E1 (UBE2E1 as a prognostic factor in acute myeloid leukemia

    Directory of Open Access Journals (Sweden)

    Hongmei Luo

    2016-11-01

    Full Text Available Abstract Background Previous research suggested that single gene expression might be correlated with acute myeloid leukemia (AML survival. Therefore, we conducted a systematical analysis for AML prognostic gene expressions. Methods We performed a microarray-based analysis for correlations between gene expression and adult AML overall survival (OS using datasets GSE12417 and GSE8970. Positive findings were validated in an independent cohort of 50 newly diagnosed, non-acute promyelocytic leukemia (APL AML patients by quantitative RT-PCR and survival analysis. Results Microarray-based analysis suggested that expression of eight genes was each associated with 1-year and 3-year AML OS in both GSE12417 and GSE8970 datasets (p < 0.05. Next, we validated our findings in an independent cohort of AML samples collected in our hospital. We found that ubiquitin-conjugating enzyme E2E1 (UBE2E1 expression was adversely correlated with AML survival (p = 0.04. Multivariable analysis showed that UBE2E1 high patients had a significant shorter OS and shorter progression-free survival after adjusting other known prognostic factors (p = 0.03. At last, we found that UBE2E1 expression was negatively correlated with patients’ response to induction chemotherapy (p < 0.05. Conclusions In summary, we demonstrated that UBE2E1 expression was a novel prognostic factor in adult, non-APL AML patients.

  16. A systematic evaluation of microRNAs in regulating human hepatic CYP2E1

    Science.gov (United States)

    Wang, Yong; Yu, Dianke; Tolleson, William H.; Yu, Li-Rong; Green, Bridgett; Zeng, Linjuan; Chen, Yinting; Chen, Si; Ren, Zhen; Guo, Lei; Tong, Weida; Guan, Huaijin; Ning, Baitang

    2017-01-01

    Cytochrome P450 2E1 (CYP2E1) is an important drug metabolizing enzyme for processing numerous xenobiotics in the liver, including acetaminophen and ethanol. Previous studies have shown that microRNAs (miRNAs) can suppress CYP2E1 expression by binding to the 3′-untranslated region (3′-UTR) of its transcript. However, a systematic analysis of CYP2E1 regulation by miRNAs has not been described. Here, we applied in silico, in vivo, and in vitro approaches to investigate miRNAs involved in the regulation of CYP2E1. Initially, potential miRNA binding sites in the CYP2E1 mRNA transcript were identified and screened using in silico methods. Next, inverse correlations were found in human liver samples between the expression of CYP2E1 mRNA and the levels of two miRNA species, hsa-miR-214-3p and hsa-miR-942-5p. In a HepG2-derived CYP2E1 over-expression cell model, hsa-miR-214-3p exhibited strong suppression of CYP2E1 expression by targeting the coding region of its mRNA transcript, but hsa-miR-942-5p did not inhibit CYP2E1 levels. Electrophoretic mobility shift assays confirmed that hsa-miR-214-3p recruited other cellular protein factors to form stable complexes with specific sequences present in the CYP2E1 mRNA open reading frame. Transfection of HepaRG cells with hsa-miR-214-3p mimics inhibited expression of the endogenous CYP2E1 gene. Further, hsa-miR-214-3p mimics partially blocked ethanol-dependent increases in CYP2E1 mRNA and protein levels in HepG2 cells and they reduced the release of alanine aminotransferase from CYP2E1-overexpressing HepG2 cells exposed to acetaminophen. These results substantiate the suppressing effect of hsa-miR-214-3p on CYP2E1 expression. PMID:28438567

  17. [E1A gene transfection of human undifferentiated thyroid cancer cell line HTC/3 by nanoparticles].

    Science.gov (United States)

    He, Xiang-Liang; He, Dong-Hua; Liao, Xiao-Xing; Zhan, Hong; Ma, Zhong-Fu; Wang, Xi-Fu; Li, Qing; Li, Xin; Li, Yu-Jie

    2007-12-01

    To prepare nanoparticles containing E1A gene and observe the efficiency and feasibility of transfecting E1A gene into human undifferentiated thyroid cancer cell line HTC/3. To examine the sensitivity of transgene cells to X-ray and X-ray-induced apoptosis in those cells. Nanoparticle-DNA complex was prepared with PLGA coating adenoviral early expression gene E1A, and the package efficiency, release progress in vitro, and size of the complex were determined. The nanoparticle-DNA was transfected into the HTC/3 cells. Lipofectamine was used to transfect E1A gene as a control. RT-PCR was used to examine E1A gene mRNA expression in the transfected cells. The survival ratio of HTC/3-E1A and control cells, and the growth inhibition ratio induced by different doses of X-ray in HTC/3-E1A cells were examined by MTT assay. The apoptosis in HTC/3-E1A cells induced by 2 Gy X-ray iradiation was examined by flow cytometry and DNA electrophoresis. The package efficiency, release progress in vitro, and size of the nanoparticle-DNA complex were 0.78%, 18 days, and 150-280 nm, respectively when transfected the plasmid at the same level, the nanoparticle group got more positive transgene cell clones than that in lipofectamine group, with a statistically significant difference (P HTC/3-E1A cells grew slowly, and their doubling time was prolongated (1.44 times in comparison with that in parental cells). According to IC50, the sensitivity of HTC/3-E1A cells to X-ray was improved 2.9 and 2.8 times, respectively, in comparison with that in HTC/3-Vect and HTC/3 cells. The ratio of subG0/G1 phase of HTC/3-E1A cells was significantly higher than that in HTC/3-Vect and HTC/3 cells (P HTC/3-E1A cells was significantly lower than that in HTC/3-Vect and HTC/3 cells (P HTC/3-E1A cells was observed by electrophoresis, but not found in HTC/3-Vect and HTC/3 cells. A nanoparticle-DNA complex has been successfully prepared, and it may carry a foreign gene into cells. The sensitivity of HTC/3-E1A cells

  18. Intracanal delivery of Resolvin E1 controls inflammation in necrotic immature rat teeth.

    Science.gov (United States)

    Scarparo, Roberta Kochenborger; Dondoni, Lenara; Böttcher, Daiana Elisabeth; Grecca, Fabiana Soares; Figueiredo, Jose Antonio P; Kantarci, Alpdogan; Van Dyke, Thomas E; Batista, Eraldo Luiz

    2014-05-01

    Pulp necrosis in immature teeth and the resulting periodontal apical inflammation negatively affect root formation. Resolvin E1 (RvE1) is a lipid-derived endogenous pro-resolution molecule that controls inflammation. The aim of this investigation was to evaluate the impact of RvE1 applied as an intracanal medication on root formation in nonvital immature teeth. To arrest root development, pulpectomy was performed in the lower first molars of 4-week-old Wistar rats. After 3 weeks, irrigation with 2.5% sodium hypochlorite and 0.9% sterile saline was performed, and either a triple antibiotic paste (TAP) or RvE1 in saline was applied into the root canals. In the control group, access openings drilled into molars were left exposed to the oral environment. Root development and periapical repair were evaluated radiographically and histologically at 3 and 6 weeks after treatment. RvE1 reduced periapical lesion size compared with the control at 3 weeks, which was similar to TAP. Inflammatory response in the RvE1-treated group was markedly reduced compared with both TAP and control specimens. At 6 weeks, root development was observed in both groups, but RvE1 treatment produced less cellularity with more regular calcified tissue deposition. RvE1 and TAP had a positive impact on reducing inflammation and promoting root formation. RvE1 was more effective in reducing inflammation at earlier stages. RvE1 has potential to be used as root canal dressing to control inflammation in endodontically compromised teeth before complete root formation. Stability of RvE1 within the root canal and its delivery are issues to be addressed before its clinical use. Copyright © 2014 American Association of Endodontists. Published by Elsevier Inc. All rights reserved.

  19. Radiation Therapy: Professions in Radiation Therapy

    Science.gov (United States)

    ... Resources Professions Site Index A-Z Professions in Radiation Therapy Radiation Oncologist Therapeutic Medical Physicist Radiation Therapist Dosimetrist Radiation Oncology Nurse Social Worker Dietitian Radiation Oncologist Radiation oncologists are physicians who oversee the ...

  20. Data of evolutionary structure change: 1E1CA-3BICA [Confc[Archive

    Lifescience Database Archive (English)

    Full Text Available 1E1CA-3BICA 1E1C 3BIC A A STLPRFDSVDLGNAPVPADAARRFEELAAKAGTGE----...yChain> 3BIC A 3BICA...ryChain> 3BIC A 3BICA LIEKMFQPKNS...D> 2 3BIC A 3BICAA 3BICA DNIKQ--QGLSV

  1. 40 CFR Figure E-1 to Subpart E of... - Designation Testing Checklist

    Science.gov (United States)

    2010-07-01

    ... Equivalent Methods for PM2.5 or PM10â2.5 Pt. 53, Subpt. E, Fig. E-1 Figure E-1 to Subpart E of Part 53... 40 Protection of Environment 5 2010-07-01 2010-07-01 false Designation Testing Checklist E Figure...) AIR PROGRAMS (CONTINUED) AMBIENT AIR MONITORING REFERENCE AND EQUIVALENT METHODS Procedures for...

  2. Data of evolutionary structure change: 1AHPA-1E1YA [Confc[Archive

    Lifescience Database Archive (English)

    Full Text Available 1AHPA-1E1YA 1AHP 1E1Y A A -------------SQPIFNDKQFQEALSRQWQ-RYGLNSAAEMTPRQWWLAVSEAL...1AHP A 1AHPA KLAVV---HDKQV...1AHP A 1AHPA QATHAHPFDLTK...1AHP A 1AHPA RRHHLAGRELHEL...1AHP A 1AHPA SIGKQGGDPYLV

  3. Nr2e1 Deficiency Augments Palmitate-Induced Oxidative Stress in Beta Cells

    Directory of Open Access Journals (Sweden)

    Xiaoli Shi

    2016-01-01

    Full Text Available Nuclear receptor subfamily 2 group E member 1 (Nr2e1 has been regarded as an essential regulator of the growth of neural stem cells. However, its function elsewhere is unknown. In the present study, we generated Nr2e1 knockdown MIN6 cells and studied whether Nr2e1 knockdown affected basal beta cell functions such as proliferation, cell death, and insulin secretion. We showed that knockdown of Nr2e1 in MIN6 cells resulted in increased sensitivity to lipotoxicity, decreased proliferation, a partial G0/G1 cell-cycle arrest, and higher rates of apoptosis. Moreover, Nr2e1 deficiency exaggerates palmitate-induced impairment in insulin secretion. At the molecular level, Nr2e1 deficiency augments palmitate-induced oxidative stress. Nr2e1 deficiency also resulted in decreases in antioxidant enzymes and expression level of Nrf2. Together, this study indicated a potential protective effect of Nr2e1 on beta cells, which may serve as a target for the development of novel therapies for diabetes.

  4. Morbidly Obese Patients Exhibit Increased CYP2E1-Mediated Oxidation of Acetaminophen

    NARCIS (Netherlands)

    A. van Rongen (Anne); P.A.J. Välitalo (Pyry A. J.); M.Y. Peeters (Mariska); D. Boerma (Djamila); F.W. Huisman (Fokko W.); B. van Ramshorst (Bert); E.H.P.A. van Dongen (Eric); J.N. van den Anker (John); C.A.J. Knibbe (Catherijne)

    2016-01-01

    textabstractIntroduction: Acetaminophen (paracetamol) is mainly metabolized via glucuronidation and sulphation, while the minor pathway through cytochrome P450 (CYP) 2E1 is held responsible for hepatotoxicity. In obese patients, CYP2E1 activity is reported to be induced, thereby potentially

  5. Morbidly Obese Patients Exhibit Increased CYP2E1-Mediated Oxidation of Acetaminophen.

    NARCIS (Netherlands)

    Rongen, van A.; Välitalo, P.A.J.; Peeters, M.Y.; Boerma, D.; Huisman, F.W.; Ramshorst, van B.; Dongen, van E.P.; Anker, van den J.N.; Knibbe, C.A.J.

    2016-01-01

    INTRODUCTION Acetaminophen (paracetamol) is mainly metabolized via glucuronidation and sulphation, while the minor pathway through cytochrome P450 (CYP) 2E1 is held responsible for hepatotoxicity. In obese patients, CYP2E1 activity is reported to be induced, thereby potentially worsening the safety

  6. 26 CFR 31.3402(e)-1 - Included and excluded wages.

    Science.gov (United States)

    2010-04-01

    ... 26 Internal Revenue 15 2010-04-01 2010-04-01 false Included and excluded wages. 31.3402(e)-1... SOURCE Collection of Income Tax at Source § 31.3402(e)-1 Included and excluded wages. (a) If a portion of... not more than 31 consecutive days constitutes wages, and the remainder does not constitute wages, all...

  7. 77 FR 42677 - Special Conditions: General Electric CT7-2E1 Turboshaft Engine

    Science.gov (United States)

    2012-07-20

    ... Federal Aviation Administration 14 CFR Part 33 Special Conditions: General Electric CT7-2E1 Turboshaft Engine AGENCY: Federal Aviation Administration (FAA), DOT. ACTION: Notice of proposed special conditions. SUMMARY: This action proposes special conditions for the General Electric CT7-2E1 engine model. This...

  8. 29 CFR 2589.1 - Civil penalties under section 8477(e)(1)(B) of FERSA.

    Science.gov (United States)

    2010-07-01

    ... transaction penalty proceedings under FERSA section 8477(e)(1)(B). ... transaction with respect to the Thrift Savings Fund. The initial penalty under section 8477(e)(1)(B) is five percent of the “amount involved” in each such transaction for each year or part thereof during which the...

  9. Solar and infrared radiation measurements

    CERN Document Server

    Vignola, Frank; Michalsky, Joseph

    2012-01-01

    The rather specialized field of solar and infrared radiation measurement has become more and more important in the face of growing demands by the renewable energy and climate change research communities for data that are more accurate and have increased temporal and spatial resolution. Updating decades of acquired knowledge in the field, Solar and Infrared Radiation Measurements details the strengths and weaknesses of instruments used to conduct such solar and infrared radiation measurements. Topics covered include: Radiometer design and performance Equipment calibration, installation, operati

  10. Distinct Features of Cap Binding by eIF4E1b Proteins

    Science.gov (United States)

    Kubacka, Dorota; Miguel, Ricardo Núñez; Minshall, Nicola; Darzynkiewicz, Edward; Standart, Nancy; Zuberek, Joanna

    2015-01-01

    eIF4E1b, closely related to the canonical translation initiation factor 4E (eIF4E1a), cap-binding protein is highly expressed in mouse, Xenopus and zebrafish oocytes. We have previously characterized eIF4E1b as a component of the CPEB mRNP translation repressor complex along with the eIF4E-binding protein 4E-Transporter, the Xp54/DDX6 RNA helicase and additional RNA-binding proteins. eIF4E1b exhibited only very weak interactions with m7GTP-Sepharose and, rather than binding eIF4G, interacted with 4E-T. Here we undertook a detailed examination of both Xenopus and human eIF4E1b interactions with cap analogues using fluorescence titration and homology modeling. The predicted structure of eIF4E1b maintains the α + β fold characteristic of eIF4E proteins and its cap-binding pocket is similarly arranged by critical amino acids: Trp56, Trp102, Glu103, Trp166, Arg112, Arg157 and Lys162 and residues of the C-terminal loop. However, we demonstrate that eIF4E1b is 3-fold less well able to bind the cap than eIF4E1a, both proteins being highly stimulated by methylation at N7 of guanine. Moreover, eIF4E1b proteins are distinguishable from eIF4E1a by a set of conserved amino acid substitutions, several of which are located near to cap-binding residues. Indeed, eIF4E1b possesses several distinct features, namely, enhancement of cap binding by a benzyl group at N7 position of guanine, a reduced response to increasing length of the phosphate chain and increased binding to a cap separated by a linker from Sepharose, suggesting differences in the arrangement of the protein's core. In agreement, mutagenesis of the amino acids differentiating eIF4E1b from eIF4E1a reduces cap binding by eIF4E1a 2-fold, demonstrating their role in modulating cap binding. PMID:25463438

  11. New Protein Vector ApE1 for Targeted Delivery of Anticancer Drugs

    Directory of Open Access Journals (Sweden)

    N. V. Pozdniakova

    2012-01-01

    Full Text Available A new chimeric gene ApE1 encoding the receptor-binding domain of the human alpha-fetoprotein fused to a sequence of 22 glutamic acid residues was constructed. A new bacterial producer strain E. coli SHExT7 ApE1 was selected for ApE1 production in a soluble state. A simplified method was developed to purify ApE1 from bacterial biomass. It was shown that the new vector protein selectively interacts with AFP receptors on the tumor cell surface and can be efficiently accumulated in tumor cells. In addition, ApE1 was shown to be stable in storage and during its chemical modification. An increased number of carboxyl groups in the molecule allows the production of cytotoxic compound conjugates with higher drug-loading capacity and enhanced tumor targeting potential.

  12. RADIATION ACOUSTICS

    OpenAIRE

    Lyamshev, L.

    1990-01-01

    Radiation acoustics is a new branch of acoustics. Its' fundamentals are lying in the research of acoustical effects due to the interaction of a radiation with matter. The sound excitation in liquids and solids by modulated or pulsed particle beams (electron, proton, ion beams, γ-radiation and single high-energy elementary particles) and some practical applications are discussed.

  13. Studies on EB radiation effect on PA610

    Energy Technology Data Exchange (ETDEWEB)

    Yang Kebin; Zhang Huaming; Li Xiurong; Xiong Ruilin [Sichuan Forever Group Co. Ltd., China Academy of Engineering Physics, Miangany (China)

    2000-03-01

    Radiation effect of PA610 with polyfunctional monomer trially isocyanurate (TAIC) was studied, the results show that crosslinking effect of EB radiation on PA610 is obvious. After the PA610 samples were radiated by EB with dosage 75KGY, the physical characters of PA610 materials were greatly improved, especially their tensile strength being increased about 18% and their impact strength about 50%, but their water and oil absorption were decreased. So, EB radiation can enhance PA610 materials physical strength, resistance to solvents and water and increase their thermal-deformation temperature. (author)

  14. Effect of the pro-resolution lipid mediator Resolvin E1 (RvE1) on pulp tissues exposed to the oral environment.

    Science.gov (United States)

    Dondoni, L; Scarparo, R K; Kantarci, A; Van Dyke, T E; Figueiredo, J A P; Batista, E L

    2014-09-01

    To evaluate the effects of topical Resolvin E1 (RvE1) application on infected dental pulps. Forty-two male Wistar rats (n = 6 per three groups/and two time periods) were used. To induce inflammation, pulps in mandibular right first molars were accessed and then left exposed to the oral environment for 24 h. After this period, topical medication with a corticosteroid/antibiotic blend, or RvE1, or its vehicle (Ethanol 0.1%) was directly applied onto the pulp tissue and teeth were restored with silver amalgam. The effects of the protocols were evaluated histologically and compared with control pulps not exposed to the oral environment. The inflammatory changes after 24 and 72 h were assessed through a scoring method and analysed using the Kruskal-Wallis test followed by Dunn's. Differences were considered significant if P corticosteroid/antibiotic treatment were not effective in arresting severe inflammatory alterations of exposed pulps at 24 and 72 h (P 0.05, CI = 95%). A protective role for RvE1 in pulp inflammation was observed even in the presence of contamination, suggesting that it may be a candidate for a novel therapeutic strategy for conservative dental pulp treatment. © 2013 International Endodontic Journal. Published by John Wiley & Sons Ltd.

  15. Strength of Fibrous Composites

    CERN Document Server

    Huang, Zheng-Ming

    2012-01-01

    "Strength of Fibrous Composites" addresses evaluation of the strength of a fibrous composite by using its constituent material properties and its fiber architecture parameters. Having gone through the book, a reader is able to predict the progressive failure behavior and ultimate strength of a fibrous laminate subjected to an arbitrary load condition in terms of the constituent fiber and matrix properties, as well as fiber geometric parameters. The book is useful to researchers and engineers working on design and analysis for composite materials. Dr. Zheng-Ming Huang is a professor at the School of Aerospace Engineering & Applied Mechanics, Tongji University, China. Mr. Ye-Xin Zhou is a PhD candidate at the Department of Mechanical Engineering, the University of Hong Kong, China.

  16. Chang’E-1 precision orbit determination and lunar gravity field solution

    Science.gov (United States)

    Jianguo, Yan; Jinsong, Ping; Fei, Li; Jianfeng, Cao; Qian, Huang; Lihe, Fung

    2010-07-01

    In this paper we present results assessing the role of Very Long Baseline Interferometry (VLBI) tracking data through precision orbit determination (POD) during the check-out phase for Chang'E-1, and the lunar gravity field solution CEGM-01 based on the orbital tracking data acquired during the nominal phase of the mission. The POD of Chang'E-1 is performed using S-band two-way Range and Range Rate (R&RR) data, together with VLBI delay and delay rate observations. The role of the VLBI data in the POD of Chang'E-1 is analyzed, and the resulting orbital accuracies are estimated for different solution strategies. The final orbital accuracies proved that the VLBI tracking data can improve the Chang'E-1 POD significantly. Consequently, CEGM-01 based on six-month tracking data during Chang'E-1 nominal mission phase is presented, and the accuracy of the model is assessed by means of the gravity field power spectrum, admittance and coherence between gravity and topography, lunar surface gravity anomaly and POD for both Chang'E-1 and Lunar Prospector (LP). Our analysis indicates that CEGM-01 has significant improvements over a prior model (i.e. GLGM-2), and shows the potential of Chang'E-1 tracking data in high resolution lunar gravity field model solution by combining with SELENE and LP tracking data.

  17. Long-Term Prostaglandin E1 Infusion for Newborns with Critical Congenital Heart Disease.

    Science.gov (United States)

    Aykanat, Alper; Yavuz, Taner; Özalkaya, Elif; Topçuoğlu, Sevilay; Ovalı, Fahri; Karatekin, Güner

    2016-01-01

    Prostaglandin E1 is crucial for keeping the patent ductus arteriosus in critical congenital heart disease for the survival and palliation of particularly prematurely born babies until a cardiosurgical intervention is available. In this study, the side effects of prostaglandin E1 in newborns with critical congenital heart disease and clinical outcomes were evaluated. Thirty-five newborns diagnosed with critical congenital heart disease were treated with prostaglandin E1 between January 2012 and September 2014 at our hospital. Patient charts were examined for prostaglandin E1 side effects (metabolic, gastric outlet obstruction, apnea), clinical status, and prognosis. Acquired data were analyzed in the SPSS 20.0 program. Patients with birth weight under 2500 g needed more days of prostaglandin E1 infusion than ones with birthweight over 2500 g (P = 0.016). The ratio of patients with birth weight under 2500 g who received prostaglandin E1 longer than 7 days was higher than the patients with birth weight over 2500 g (P = 0.02). Eighteen side effects were encountered in 11 of 35 patients (31%). Of these side effects, 1 patient had 4, 4 patients had 2, and 6 patients had only 1 side effect. Discontinuation of the therapy was never needed. Prostaglandin E1 is an accepted therapy modality for survival and outcome in critical congenital heart disease in particularly low-birth-weight babies until a surgical intervention is available. Side effects are not less encountered but are almost always manageable, and discontinuation is not needed.

  18. Pathological aggression in "fierce" mice corrected by human nuclear receptor 2E1.

    Science.gov (United States)

    Abrahams, Brett S; Kwok, Melvin C H; Trinh, Eric; Budaghzadeh, Saeed; Hossain, Sazzad M; Simpson, Elizabeth M

    2005-07-06

    "Fierce" mice, homozygous for the deletion of nuclear receptor 2E1 (NR2E1), show abnormal brain-eye development and pathological aggression. To evaluate functional equivalency between mouse and human NR2E1, we generated mice transgenic for a genomic clone spanning the human NR2E1 locus and bred these animals to fierce mice deleted for the corresponding mouse gene. In fierce mutants carrying human NR2E1, structural brain defects were eliminated and eye abnormalities ameliorated. Excitingly, behavior in these "rescue" mice was indistinguishable from controls. Because no artificial promoter was used to drive transgene expression, promoter and regulatory elements within the human NR2E1 clone are functional in mouse. Normal behavior in rescue animals suggests that mechanisms underlying the behavioral abnormalities in fierce mice may also be conserved in humans. Our data support the hypothesis that variation at NR2E1 may contribute to human behavioral disorders. Use of this rescue paradigm with other genes will permit the direct evaluation of human genes hypothesized to play a causal role in psychiatric disease but for which evidence is lacking or equivocal.

  19. Impact of phonon coupling on the radiative nuclear reaction characteristics

    Directory of Open Access Journals (Sweden)

    Achakovskiy Oleg

    2016-01-01

    Full Text Available The pygmy dipole resonance and photon strength functions (PSF in stable and unstable Ni and Sn isotopes are calculated within the microscopic self-consistent version of the extended theory of finite Fermi systems in the quasiparticle time blocking approximation. The approach includes phonon coupling (PC effects in addition to the standard QRPA approach. The Skyrme force SLy4 is used. A pygmy dipole resonance in 72Ni is predicted at the mean energy of 12.4 MeV exhausting 25.7% of the total energy-weighted sum rule. With our microscopic E1 PSFs in the EMPIRE 3.1 code, the following radiative nuclear reaction characteristics have been calculated for several stable and unstable even-even Sn and Ni isotopes: 1 neutron capture cross sections, 2 corresponding neutron capture gamma-spectra, 3 average radiative widths of neutron resonances. Here, three variants of the microscopic nuclear level density models have been used and a comparison with the phenomenological generalized superfluid model has been performed. In all the considered properties, including the recent experimental data for PSF in Sn isotopes, the PC contributions turned out to be significant, as compared with the QRPA one, and necessary to explain the available experimental data.

  20. Radiation hydrodynamics

    Energy Technology Data Exchange (ETDEWEB)

    Pomraning, G.C.

    1982-12-31

    This course was intended to provide the participant with an introduction to the theory of radiative transfer, and an understanding of the coupling of radiative processes to the equations describing compressible flow. At moderate temperatures (thousands of degrees), the role of the radiation is primarily one of transporting energy by radiative processes. At higher temperatures (millions of degrees), the energy and momentum densities of the radiation field may become comparable to or even dominate the corresponding fluid quantities. In this case, the radiation field significantly affects the dynamics of the fluid, and it is the description of this regime which is generally the charter of radiation hydrodynamics. The course provided a discussion of the relevant physics and a derivation of the corresponding equations, as well as an examination of several simplified models. Practical applications include astrophysics and nuclear weapons effects phenomena.

  1. Role of CYP2E1 genotypes in susceptibility to colorectal cancer in the Kashmiri population

    Directory of Open Access Journals (Sweden)

    Sameer A

    2011-10-01

    Full Text Available Abstract Cytochrome P450 2E1 (CYP2E1 is a key enzyme involved in the metabolic activation of procarcinogens such as N-nitrosoamines and low-molecular-weight organic compounds. The main aim of this study was to determine whether CYP450 2E1 polymorphisms are associated with the risk of colorectal cancer (CRC. We investigated the genotype distribution of the CYP2E1 gene RsaI and a 96-base pair (bp insertion in 86 CRC cases in comparison with 160 healthy subjects. We found the frequency of the CYP2E1 RsaI genotype to be 53.5 per cent (46/86 for c1/c1, 17.4 per cent (15/86 for c1/c2 and 29.1 per cent (25/86 for c2/c2, and the CYP2E1 98-bp insertion frequencies to be 63.9 per cent (55/86 for non-insertion (i/i, 22.1 per cent (19/86 for heterozygous insertion (i/I and 36.0 per cent (12/86 for homozygous insertion (I/I among CRC cases. We also found the CYP2E1 RsaI c2/c2 and CYP2E1 98-bp heterozygous i/I genotypes to be significantly associated with an increased risk of CRC (p = 0.01. We suggest that CYP2E1 polymorphisms are involved in the susceptibility to developing CRC in the ethnic Kashmiri population.

  2. High strength alloys

    Energy Technology Data Exchange (ETDEWEB)

    Maziasz, Phillip James; Shingledecker, John Paul; Santella, Michael Leonard; Schneibel, Joachim Hugo; Sikka, Vinod Kumar; Vinegar, Harold J.; John, Randy Carl; Kim, Dong Sub

    2012-06-05

    High strength metal alloys are described herein. At least one composition of a metal alloy includes chromium, nickel, copper, manganese, silicon, niobium, tungsten and iron. System, methods, and heaters that include the high strength metal alloys are described herein. At least one heater system may include a canister at least partially made from material containing at least one of the metal alloys. At least one system for heating a subterranean formation may include a tublar that is at least partially made from a material containing at least one of the metal alloys.

  3. High strength alloys

    Energy Technology Data Exchange (ETDEWEB)

    Maziasz, Phillip James [Oak Ridge, TN; Shingledecker, John Paul [Knoxville, TN; Santella, Michael Leonard [Knoxville, TN; Schneibel, Joachim Hugo [Knoxville, TN; Sikka, Vinod Kumar [Oak Ridge, TN; Vinegar, Harold J [Bellaire, TX; John, Randy Carl [Houston, TX; Kim, Dong Sub [Sugar Land, TX

    2010-08-31

    High strength metal alloys are described herein. At least one composition of a metal alloy includes chromium, nickel, copper, manganese, silicon, niobium, tungsten and iron. System, methods, and heaters that include the high strength metal alloys are described herein. At least one heater system may include a canister at least partially made from material containing at least one of the metal alloys. At least one system for heating a subterranean formation may include a tubular that is at least partially made from a material containing at least one of the metal alloys.

  4. Hand grip strength

    DEFF Research Database (Denmark)

    Frederiksen, Henrik; Gaist, David; Petersen, Hans Christian

    2002-01-01

    in life is a major problem in terms of prevalence, morbidity, functional limitations, and quality of life. It is therefore of interest to find a phenotype reflecting physical functioning which has a relatively high heritability and which can be measured in large samples. Hand grip strength is known......-55%). A powerful design to detect genes associated with a phenotype is obtained using the extreme discordant and concordant sib pairs, of whom 28 and 77 dizygotic twin pairs, respectively, were found in this study. Hence grip strength is a suitable phenotype for identifying genetic variants of importance to mid...

  5. Enterasys Networks delivers 10-Gigabit ethernet for the enterprise with new matrix E1 switching family

    CERN Multimedia

    2001-01-01

    Enterasys Networks Inc., today announced its new Matrix E1 family of 10-Gigabit and Gigabit Ethernet switches. The Matrix E1 Optical Access Switch (OAS) enables organizations to deliver applications at 10-Gb speeds across a single fibre optic pair. Jacques Altaber, deputy leader of IT at CERN said "High-bandwith solutions are essential to leveraging more computing power, so 10-Gb Ethernet is the next logical step for us...The Matrix E1 allows us to provide the networking support that our scientists need and gives us a certain future for bandwidth and computing expansion".

  6. Absence of NR2E1 mutations in patients with aniridia

    Science.gov (United States)

    Corso-Díaz, Ximena; Borrie, Adrienne E.; Bonaguro, Russell; Schuetz, Johanna M.; Rosenberg, Thomas; Jensen, Hanne; Brooks, Brian P.; MacDonald, Ian M.; Pasutto, Francesca; Walter, Michael A.; Grønskov, Karen; Brooks-Wilson, Angela

    2012-01-01

    Purpose Nuclear receptor 2E1 (NR2E1) is a transcription factor with many roles during eye development and thus may be responsible for the occurrence of certain congenital eye disorders in humans. To test this hypothesis, we screened NR2E1 for candidate mutations in patients with aniridia and other congenital ocular malformations (anterior segment dysgenesis, congenital optic nerve malformation, and microphthalmia). Methods The NR2E1 coding region, 5′ and 3′ untranslated regions (UTRs), exon flanking regions including consensus splice sites, and six evolutionarily conserved non-coding candidate regulatory regions were analyzed by sequencing 58 probands with aniridia of whom 42 were negative for PAX6 mutations. Nineteen probands with anterior segment dysgenesis, one proband with optic nerve malformation, and two probands with microphthalmia were also sequenced. The control population comprised 376 healthy individuals. All sequences were analyzed against the GenBank sequence AL078596.8 for NR2E1. In addition, the coding region and flanking intronic sequences of FOXE3, FOXC1, PITX2, CYP1B1, PAX6, and B3GALTL were sequenced in one patient and his relatives. Results Sequencing analysis showed 17 NR2E1 variants including two novel rare non-coding variants (g.-1507G>A, g.14258C>T), and one novel rare coding variant (p.Arg274Gly). The latter was present in a male diagnosed with Peters’ anomaly who subsequently was found to have a known causative mutation for Peters’ plus syndrome in B3GALTL (c.660+1G>A). In addition, the NR2E1 novel rare variant Arg274Gly was present in the unaffected mother of the patient but absent in 746 control chromosomes. Conclusions We eliminated a major role for NR2E1 regulatory and coding mutations in aniridia and found a novel rare coding variant in NR2E1. In addition, we found no coding region variation in the control population for NR2E1, which further supports its previously reported high level of conservation and low genetic diversity

  7. DprE1 Is a Vulnerable Tuberculosis Drug Target Due to Its Cell Wall Localization.

    Science.gov (United States)

    Brecik, Miroslav; Centárová, Ivana; Mukherjee, Raju; Kolly, Gaëlle S; Huszár, Stanislav; Bobovská, Adela; Kilacsková, Emöke; Mokošová, Veronika; Svetlíková, Zuzana; Šarkan, Michal; Neres, João; Korduláková, Jana; Cole, Stewart T; Mikušová, Katarína

    2015-07-17

    The flavo-enzyme DprE1 catalyzes a key epimerization step in the decaprenyl-phosphoryl d-arabinose (DPA) pathway, which is essential for mycobacterial cell wall biogenesis and targeted by several new tuberculosis drug candidates. Here, using differential radiolabeling with DPA precursors and high-resolution fluorescence microscopy, we disclose the unexpected extracytoplasmic localization of DprE1 and periplasmic synthesis of DPA. Collectively, this explains the vulnerability of DprE1 and the remarkable potency of the best inhibitors.

  8. Atoms, Radiation, and Radiation Protection

    CERN Document Server

    Turner, James E

    2007-01-01

    Atoms, Radiation, and Radiation Protection offers professionals and advanced students a comprehensive coverage of the major concepts that underlie the origins and transport of ionizing radiation in matter. Understanding atomic structure and the physical mechanisms of radiation interactions is the foundation on which much of the current practice of radiological health protection is based. The work covers the detection and measurement of radiation and the statistical interpretation of the data. The procedures that are used to protect man and the environment from the potential harmful effects of

  9. Radiation Chemistry

    Science.gov (United States)

    Wojnárovits, L.

    Ionizing radiation causes chemical changes in the molecules of the interacting medium. The initial molecules change to new molecules, resulting in changes of the physical, chemical, and eventually biological properties of the material. For instance, water decomposes to its elements H2 and O2. In polymers, degradation and crosslinking take place. In biopolymers, e.g., DNS strand breaks and other alterations occur. Such changes are to be avoided in some cases (radiation protection), however, in other cases they are used for technological purposes (radiation processing). This chapter introduces radiation chemistry by discussing the sources of ionizing radiation (radionuclide sources, machine sources), absorption of radiation energy, techniques used in radiation chemistry research, and methods of absorbed energy (absorbed dose) measurements. Radiation chemistry of different classes of inorganic (water and aqueous solutions, inorganic solids, ionic liquids (ILs)) and organic substances (hydrocarbons, halogenated compounds, polymers, and biomolecules) is discussed in concise form together with theoretical and experimental backgrounds. An essential part of the chapter is the introduction of radiation processing technologies in the fields of polymer chemistry, food processing, and sterilization. The application of radiation chemistry to nuclear technology and to protection of environment (flue gas treatment, wastewater treatment) is also discussed.

  10. The Strength Compass

    DEFF Research Database (Denmark)

    Ledertoug, Mette Marie

    present in both small children and youths? Gender: Do the results show differences between the two genders? Danish as a mother- tongue language: Do the results show any differences in the strengths display when considering different language and cultural backgrounds? Children with Special Needs: Do...

  11. Acetato(N-[(E-1-(6-methyl-2-pyridylmethylidene]-2-{2-[(E-1-(6-methyl-2-pyridylmethylideneamino]phenethyl}anilinenickel(II perchlorate

    Directory of Open Access Journals (Sweden)

    Hong-In Lee

    2010-10-01

    Full Text Available In the title complex, [Ni(CH3COO(C28H26N4]ClO4, the NiII atom is coordinated by two imine N atoms and two pyridine N atoms of the N-[(E-1-(6-methyl-2-pyridylmethylidene]-2-(2-[(E-1-(6-methyl-2-pyridylmethylideneamino]phenethylaniline donor ligand and two O atoms of the acetate ion in a distorted octahedral coordination. The average Ni—N and Ni—O bond lengths are 2.131 (13 and 2.098 (11 Å, respectively. An intramolecular N—H...O interaction occurs. Relatively weak intermolecular C—H...O interactions between the ligands and the ClO4− ions result in a chain extending along the b axis.

  12. E1, M1, E2 transition energies and probabilities of W$^{54+}$ ions

    CERN Document Server

    Ding, Xiao-bin; Liu, Jia-xin; Koike, Fumihiro; Murakami, Izumi; Kato, Daiji; Sakaue, Hiroyuki A; Nakamura, Nobuyuki; Dong, Chen-zhong

    2016-01-01

    A comprehensive theoretical study of the E1, M1, E2 transitions of Ca-like tungsten ions is presented. Using multi-configuration Dirac-Fock (MCDF) method with a restricted active space treatment, the wavelengths and probabilities of the M1 and E2 transitions between the multiplets of the ground state configuration ([Ne]3s$^{2}$3p$^{6}$3d$^{2}$) and of the E1 transitions between [Ne]3s$^{2}$3p$^{5}$3d$^{3}$ and [Ne]3s$^{2}$3p$^{6}$3d$^{2}$ have been calculated. The results are in reasonable agreement with available experimental data. The present E1 and M1 calculations are compared with previous theoretical values. For E2 transitions, the importance of electron correlation from 3s and 3p orbitals is pointed out. Several strong E1 transitions are predicted, which have potential advantage for plasma diagnostics.

  13. The C-terminal region of E1A: a molecular tool for cellular cartography.

    Science.gov (United States)

    Yousef, Ahmed F; Fonseca, Gregory J; Cohen, Michael J; Mymryk, Joe S

    2012-04-01

    The adenovirus E1A proteins function via protein-protein interactions. By making many connections with the cellular protein network, individual modules of this virally encoded hub reprogram numerous aspects of cell function and behavior. Although many of these interactions have been thoroughly studied, those mediated by the C-terminal region of E1A are less well understood. This review focuses on how this region of E1A affects cell cycle progression, apoptosis, senescence, transformation, and conversion of cells to an epithelial state through interactions with CTBP1/2, DYRK1A/B, FOXK1/2, and importin-α. Furthermore, novel potential pathways that the C-terminus of E1A influences through these connections with the cellular interaction network are discussed.

  14. Ber e 1 protein: the versatile major allergen from Brazil nut seeds.

    Science.gov (United States)

    Alcocer, Marcos; Rundqvist, Louise; Larsson, Göran

    2012-04-01

    Due mainly to its extremely high content of sulphur amino acids, Ber e 1 protein, the major allergen from Brazil nut, has attracted much scientific and press attention. Ber e 1 was the main target protein in early biotechnology transgenic work, in early processing studies of plant storage proteins, in plant vacuolar targeting studies and as the main protein in early nutritional supplementation experiments. Ber e 1 was also one of the first food allergens to be unintentionally transferred from one plant to another and was involved in the first reported case of systemic allergic reaction caused by a food allergen transferred in semen. In this review, many of the Ber e 1 unique biotechnological and structural functions are discussed with a particular emphasis on its use as model protein for studies of intrinsic allergenicity of food proteins.

  15. Tumor Suppression and Sensitization to Taxol Induced Apoptosis of E1A In Breast Cancer Cells

    National Research Council Canada - National Science Library

    Liao, Yong

    2004-01-01

    The purpose of this project is to study the molecular mechanisms underlying E1A's proapoptotic effect and anti-tumor activity and to dissect the functional domains of El A that are critical for its antitumor activity...

  16. Wipe testing of sealed radiation sources using a radiation protection assistant robot

    Directory of Open Access Journals (Sweden)

    Zeb Jahan

    2009-01-01

    Full Text Available Sealed radiation sources are commonly used in different research institutes, industries, and hospitals. The sources of various strengths are manufactured in different sizes and shapes. It is a regulatory requirement that these sources must be monitored frequently for their integrity and to avoid any radiological contamination hazard. Mainly, a wipe test is recommended for the contamination detection due to the leakage of sealed radiation sources. A radiation protection assistant robot has been fabricated to execute different tasks in a hazardous radiation environment. In this study, the robot was used to conduct the wipe test of five sealed radiation sources. The sealed radiation sources were tested safely and securely without giving any radiation dose to the radiation worker. The radiation doses received by the robot gripper and waist during the wipe test were 3.4 Gy and 208.9 mGy, respectively.

  17. Characterization of DprE1-Mediated Benzothiazinone Resistance in Mycobacterium tuberculosis.

    Science.gov (United States)

    Foo, Caroline Shi-Yan; Lechartier, Benoit; Kolly, Gaëlle S; Boy-Röttger, Stefanie; Neres, João; Rybniker, Jan; Lupien, Andréanne; Sala, Claudia; Piton, Jérémie; Cole, Stewart T

    2016-11-01

    Benzothiazinones (BTZs) are a class of compounds found to be extremely potent against both drug-susceptible and drug-resistant Mycobacterium tuberculosis strains. The potency of BTZs is explained by their specificity for their target decaprenylphosphoryl-d-ribose oxidase (DprE1), in particular by covalent binding of the activated form of the compound to the critical cysteine 387 residue of the enzyme. To probe the role of C387, we used promiscuous site-directed mutagenesis to introduce other codons at this position into dprE1 of M. tuberculosis The resultant viable BTZ-resistant mutants were characterized in vitro, ex vivo, and biochemically to gain insight into the effects of these mutations on DprE1 function and on M. tuberculosis Five different mutations (C387G, C387A, C387S, C387N, and C387T) conferred various levels of resistance to BTZ and exhibited different phenotypes. The C387G and C387N mutations resulted in a lower growth rate of the mycobacterium on solid medium, which could be attributed to the significant decrease in the catalytic efficiency of the DprE1 enzyme. All five mutations rendered the mycobacterium less cytotoxic to macrophages. Finally, differences in the potencies of covalent and noncovalent DprE1 inhibitors in the presence of C387 mutations were revealed by enzymatic assays. As expected from the mechanism of action, the covalent inhibitor PBTZ169 only partially inhibited the mutant DprE1 enzymes compared to the near-complete inhibition with a noncovalent DprE1 inhibitor, Ty38c. This study emphasizes the importance of the C387 residue for DprE1 activity and for the killing action of covalent inhibitors such as BTZs and other recently identified nitroaromatic inhibitors. Copyright © 2016, American Society for Microbiology. All Rights Reserved.

  18. Water promoted allylic nucleophilic substitution reactions of (E)-1,3 diphenylallyl acetate

    KAUST Repository

    Ghorpade, Seema Arun

    2017-11-30

    Transition metal free, water based, greener protocol for allylic alkylation, allylic amination, O-allylation of (E)-1,3-diphenylallyl acetate is described. The developed methodology is applicable for a wide range of nucleophiles furnishing excellent yields of corresponding products up to 87% under mild reaction conditions. A Distinct effect of water and base is explored for allylic nucleophilic substitution reactions of (E)-1,3-diphenylallyl acetate.

  19. Evolution of the ubiquitin-activating enzyme Uba1 (E1)

    Science.gov (United States)

    Allan, Douglas C.; Phillips, J. C.

    2017-10-01

    Ubiquitin tags diseased proteins and initiates an enzyme conjugation cascade, which has three stages. The first-stage enzyme Uba1 (E1) has evolved only modestly from slime mold to humans, and is > 14 times larger than Ub. Here we use critical point thermodynamic scaling theory to connect Uba1 (E1) evolution from yeast and slime mold to fruit flies and humans to subtle changes in its amino acid sequences.

  20. The esg locus of Myxococcus xanthus encodes the E1 alpha and E1 beta subunits of a branched-chain keto acid dehydrogenase.

    Science.gov (United States)

    Toal, D R; Clifton, S W; Roe, B A; Downard, J

    1995-04-01

    The esg locus of Myxococcus xanthus appears to control the production of a signal that must be transmitted between cells for the completion of multicellular development. DNA sequence analysis suggested that the esg locus encodes the E1 decarboxylase (composed of E1 alpha and E1 beta subunits) of a branched-chain keto acid dehydrogenase (BCKAD) that is involved in branched-chain amino acid (BCAA) metabolism. The properties of an esg::Tn5 insertion mutant supported this conclusion. These properties include: (i) the growth yield of the mutant was reduced with increasing concentrations of the BCAAs in the medium while the growth yield of wild-type cells increased, (ii) mutant extracts were deficient in BCKAD activity, and (iii) growth of the mutant in media with short branched-chain fatty acids related to the expected products of the BCKAD helped to correct the mutant defects in growth, pigmentation and development. The esg BCKAD appears to be involved in the synthesis of long branched-chain fatty acids since the mutant contained reduced levels of this class of compounds. Our results are consistent with a model in which the esg-encoded enzyme is involved in the synthesis of branched-chain fatty acids during vegetative growth, and these compounds are used later in cell-cell signalling during development.

  1. The Frequency of Cytochrome P450 2E1 Polymorphisms in Black South Africans

    Directory of Open Access Journals (Sweden)

    Paul K. Chelule

    2006-01-01

    Full Text Available Polymorphisms in the promoter region of the Cytochrome P4502E1 (CYP2E1 gene reportedly modify the metabolic activity of CYP2E1 enzyme, and have been associated with increased susceptibility to squamous cell carcinoma (SCC of the oesophagus in high prevalence areas such as China. To assess the frequency of these polymorphisms in Black South Africans, a population with a high incidence of oesophageal SCC, this study examined genomic DNA from 331 subjects for restriction fragment length polymorphisms in the CYP2E1 (RsaI and PstI digestion. The frequency of the CYP2E1 c1/c1 and c1/c3 genotypes was 95% and 5% respectively. The frequency of the CYP2E1 allele distribution was found to be markedly different between Chinese and South African populations; hence it is important to place racial differences into consideration when proposing allelic variants as genetic markers for cancer.

  2. Catalytic activity and quantitation of cytochrome P-450 2E1 in prenatal human brain.

    Science.gov (United States)

    Brzezinski, M R; Boutelet-Bochan, H; Person, R E; Fantel, A G; Juchau, M R

    1999-06-01

    Cytochrome P-450 2E1 (CYP2E1) is a readily inducible hemoprotein that catalyzes the oxidation of endogenous compounds and many low molecular weight xenobiotics. As the major component of the microsomal ethanol oxidizing system, it contributes significantly to ethanol metabolism and the formation of the highly reactive metabolite acetaldehyde. The leaky property of this enzyme results in the generation of reactive oxygen species that can induce oxidative stress and cytotoxic conditions deleterious to development. To further investigate the proposed role of CYP2E1 in the etiology of alcohol teratogenesis, the current study focused on the quantification of CYP2E1 in prenatal human brain, a tissue that is highly vulnerable to the damaging effects of ethanol throughout gestation. In microsomal samples prepared from pools of brain tissues, immunoreactive protein was detected by Western blot analysis using enhanced chemiluminescence, whereas functional protein was estimated with an enzymatic assay using p-nitrophenol and an electrochemical detection system. CYP2E1 transcript was consistently detected in RNA samples prepared from individual brain tissues using the ribonuclease protection assay. Quantitative data were collected by scanning densitometry and phosphorimaging technology. There was a dramatic increase in human brain CYP2E1 content around gestational day 50 and a fairly constant level was maintained throughout the early fetal period, until at least day 113. The relatively low levels of the P-450 isoform present in conceptal brain may be sufficient to generate reactive intermediates that elicit neuroembryotoxicity following maternal alcohol consumption.

  3. Dipole strength functions in the actinide mass region

    Energy Technology Data Exchange (ETDEWEB)

    Gardner, D.G.; Gardner, M.A.; Hoff, R.W.

    1987-07-15

    We have calculated a number of neutron- and photon-induced reactions for the actinide nuclei /sup 232/Th, /sup 238/U, and /sup 237/Np. By fitting average resonance capture (ARC) measurements and total neutron capture data, we deduced absolute dipole strength functions for /sup 233/Th and /sup 239/U. We have found that the M1/E1 ratio is the same as in the /sup 176/Lu case, but the total transition strength was larger by about 27%. 17 refs., 4 figs., 1 tab.

  4. Radiation carcinogenesis

    Energy Technology Data Exchange (ETDEWEB)

    Fry, R.J.M.

    1976-01-01

    The risk of iatrogenic tumors with radiation therapy is so outweighed by the benefit of cure that estimates of risk have not been considered necessary. However, with the introduction of chemotherapy, combined therapy, and particle radiation therapy, the comparative risks should be examined. In the case of radiation, total dose, fractionation, dose rate, dose distribution, and radiation quality should be considered in the estimation of risk. The biological factors that must be considered include incidence of tumors, latent period, degree of malignancy, and multiplicity of tumors. The risk of radiation induction of tumors is influenced by the genotype, sex, and age of the patient, the tissues that will be exposed, and previous therapy. With chemotherapy the number of cells at risk is usually markedly higher than with radiation therapy. Clearly the problem of the estimation of comparative risks is complex. This paper presents the current views on the comparative risks and the importance of the various factors that influence the estimation of risk.

  5. Hawking radiation

    Science.gov (United States)

    Parentani, Renaud; Spindel, Philippe

    2011-12-01

    Hawking radiation is the thermal radiation predicted to be spontaneously emitted by black holes. It arises from the steady conversion of quantum vacuum fluctuations into pairs of particles, one of which escaping at infinity while the other is trapped inside the black hole horizon. It is named after the physicist Stephen Hawking who derived its existence in 1974. This radiation reduces the mass of black holes and is therefore also known as black hole evaporation.

  6. Enhancement of octupole strength in near spherical nuclei

    Energy Technology Data Exchange (ETDEWEB)

    Robledo, L.M. [Universidad Autonoma de Madrid, Dep. Fisica Teorica, Facultad de Ciencias, Madrid (Spain)

    2016-09-15

    The validity of the rotational formula used to compute E1 and E3 transition strengths in even-even nuclei is analyzed within the Generator Coordinate Method framework based on mean field wave functions. It turns out that those nuclei with spherical or near spherical shapes the E1 and E3 strengths computed with this formula are strongly underestimated and a sound evaluation of them requires angular-momentum projected wave functions. Results for several isotopic chains with proton number equal to or near magic numbers are analyzed and compared with experimental data. The use of angular-momentum projected wave functions greatly improves the agreement with the scarce experimental data. (orig.)

  7. GRAVITATIONAL RADIATION

    Directory of Open Access Journals (Sweden)

    Metin SALTIK

    1996-03-01

    Full Text Available According to classical electromagnetic theory, an accelerated charge or system of charges radiates electromagnetic waves. In a radio transmitter antenna charges are accelerated along the antenna and release electromagnetic waves, which is radiated at the velocity of light in the surrounding medium. All of the radio transmitters work on this principle today. In this study an analogy is established between the principles by which accelerated charge systems markes radiation and the accelerated mass system, and the systems cousing gravitational radiation are investigated.

  8. Autophagy Protects against CYP2E1/Chronic Ethanol-Induced Hepatotoxicity

    Directory of Open Access Journals (Sweden)

    Yongke Lu

    2015-10-01

    Full Text Available Autophagy is an intracellular pathway by which lysosomes degrade and recycle long-lived proteins and cellular organelles. The effects of ethanol on autophagy are complex but recent studies have shown that autophagy serves a protective function against ethanol-induced liver injury. Autophagy was found to also be protective against CYP2E1-dependent toxicity in vitro in HepG2 cells which express CYP2E1 and in vivo in an acute alcohol/CYPE1-dependent liver injury model. The goal of the current report was to extend the previous in vitro and acute in vivo experiments to a chronic ethanol model to evaluate whether autophagy is also protective against CYP2E1-dependent liver injury in a chronic ethanol-fed mouse model. Wild type (WT, CYP2E1 knockout (KO or CYP2E1 humanized transgenic knockin (KI, mice were fed an ethanol liquid diet or control dextrose diet for four weeks. In the last week, some mice received either saline or 3-methyladenine (3-MA, an inhibitor of autophagy, or rapamycin, which stimulates autophagy. Inhibition of autophagy by 3-MA potentiated the ethanol-induced increases in serum transaminase and triglyceride levels in the WT and KI mice but not KO mice, while rapamycin prevented the ethanol liver injury. Treatment with 3-MA enhanced the ethanol-induced fat accumulation in WT mice and caused necrosis in the KI mice; little or no effect was found in the ethanol-fed KO mice or any of the dextrose-fed mice. 3-MA treatment further lowered the ethanol-decrease in hepatic GSH levels and further increased formation of TBARS in WT and KI mice, whereas rapamycin blunted these effects of ethanol. Neither 3-MA nor rapamycin treatment affected CYP2E1 catalytic activity or content or the induction CYP2E1 by ethanol. The 3-MA treatment decreased levels of Beclin-1 and Atg 7 but increased levels of p62 in the ethanol-fed WT and KI mice whereas rapamycin had the opposite effects, validating inhibition and stimulation of autophagy, respectively. These

  9. Requirement for the E1 Helicase C-Terminal Domain in Papillomavirus DNA Replication In Vivo.

    Science.gov (United States)

    Bergvall, Monika; Gagnon, David; Titolo, Steve; Lehoux, Michaël; D'Abramo, Claudia M; Melendy, Thomas; Archambault, Jacques

    2016-01-06

    The papillomavirus (PV) E1 helicase contains a conserved C-terminal domain (CTD), located next to its ATP-binding site, whose function in vivo is still poorly understood. The CTD is comprised of an alpha helix followed by an acidic region (AR) and a C-terminal extension termed the C-tail. Recent biochemical studies on bovine papillomavirus 1 (BPV1) E1 showed that the AR and C-tail regulate the oligomerization of the protein into a double hexamer at the origin. In this study, we assessed the importance of the CTD of human papillomavirus 11 (HPV11) E1 in vivo, using a cell-based DNA replication assay. Our results indicate that combined deletion of the AR and C-tail drastically reduces DNA replication, by 85%, and that further truncation into the alpha-helical region compromises the structural integrity of the E1 helicase domain and its interaction with E2. Surprisingly, removal of the C-tail alone or mutation of highly conserved residues within the domain still allows significant levels of DNA replication (55%). This is in contrast to the absolute requirement for the C-tail reported for BPV1 E1 in vitro and confirmed here in vivo. Characterization of chimeric proteins in which the AR and C-tail from HPV11 E1 were replaced by those of BPV1 indicated that while the function of the AR is transferable, that of the C-tail is not. Collectively, these findings define the contribution of the three CTD subdomains to the DNA replication activity of E1 in vivo and suggest that the function of the C-tail has evolved in a PV type-specific manner. While much is known about hexameric DNA helicases from superfamily 3, the papillomavirus E1 helicase contains a unique C-terminal domain (CTD) adjacent to its ATP-binding site. We show here that this CTD is important for the DNA replication activity of HPV11 E1 in vivo and that it can be divided into three functional subdomains that roughly correspond to the three conserved regions of the CTD: an alpha helix, needed for the structural

  10. Requirement for the E1 Helicase C-Terminal Domain in Papillomavirus DNA Replication In Vivo

    Science.gov (United States)

    Bergvall, Monika; Gagnon, David; Titolo, Steve; Lehoux, Michaël; D'Abramo, Claudia M.

    2016-01-01

    ABSTRACT The papillomavirus (PV) E1 helicase contains a conserved C-terminal domain (CTD), located next to its ATP-binding site, whose function in vivo is still poorly understood. The CTD is comprised of an alpha helix followed by an acidic region (AR) and a C-terminal extension termed the C-tail. Recent biochemical studies on bovine papillomavirus 1 (BPV1) E1 showed that the AR and C-tail regulate the oligomerization of the protein into a double hexamer at the origin. In this study, we assessed the importance of the CTD of human papillomavirus 11 (HPV11) E1 in vivo, using a cell-based DNA replication assay. Our results indicate that combined deletion of the AR and C-tail drastically reduces DNA replication, by 85%, and that further truncation into the alpha-helical region compromises the structural integrity of the E1 helicase domain and its interaction with E2. Surprisingly, removal of the C-tail alone or mutation of highly conserved residues within the domain still allows significant levels of DNA replication (55%). This is in contrast to the absolute requirement for the C-tail reported for BPV1 E1 in vitro and confirmed here in vivo. Characterization of chimeric proteins in which the AR and C-tail from HPV11 E1 were replaced by those of BPV1 indicated that while the function of the AR is transferable, that of the C-tail is not. Collectively, these findings define the contribution of the three CTD subdomains to the DNA replication activity of E1 in vivo and suggest that the function of the C-tail has evolved in a PV type-specific manner. IMPORTANCE While much is known about hexameric DNA helicases from superfamily 3, the papillomavirus E1 helicase contains a unique C-terminal domain (CTD) adjacent to its ATP-binding site. We show here that this CTD is important for the DNA replication activity of HPV11 E1 in vivo and that it can be divided into three functional subdomains that roughly correspond to the three conserved regions of the CTD: an alpha helix, needed

  11. Pollen from different olive tree cultivars contains varying amounts of the major allergen Ole e 1.

    Science.gov (United States)

    Castro, Antonio Jesús; de Dios Alché, Juan; Cuevas, Julián; Romero, Pedro José; Alché, Víctor; Rodríguez-García, María Isabel

    2003-07-01

    Commercial olive pollen from uncertain cultivar origin is the common material used for clinical and biological studies. We aimed to assess the putative heterogeneity of olive cultivars with regard to the presence of the major pollen allergen Ole e 1 and to determine whether these differences have clinical relevance. The Ole e 1 content of several cultivars was determined by immunoblotting and ultrastructural immunocytochemistry and compared to that of a commercially available olive pollen extract designed for diagnosis. Reverse transcription-polymerase chain reaction analysis of Ole e 1 transcripts was also performed. Crude protein extracts were used to carry out skin prick tests (SPTs) on 30 allergic patients in order to evaluate the clinical importance of such differences. Ole e 1 was present in all cultivars, although significant quantitative differences were detected. Ole e 1 transcripts positively correlated with the amount of the allergen. Significant variations in the average reactivity of allergic patients to SPTs were observed depending on the cultivar considered. The presence of the Ole e 1 allergen in all the cultivars suggests that this allergen may play an essential biological role. The expression of the allergen is controlled at the transcriptional level. The significant differences in the Ole e 1 content are likely responsible for the different average reactivity exhibited by patients to the cultivars studied, although the role of other allergens cannot be excluded. Our results suggest that the use of the commercial pollen mixtures currently available may lead to mistakes in allergy diagnosis and to limited success in immunotherapy. Therefore, further standardization is strongly recommended. Copyright 2003 S. Karger AG, Basel

  12. Ethanol-mediated transplacental induction of CYP2E1 in fetal rat liver.

    Science.gov (United States)

    Carpenter, S P; Savage, D D; Schultz, E D; Raucy, J L

    1997-08-01

    We examined the potential for the widely consumed xenobiotic ethanol to transplacentally induce fetal rat CYP2E1. Throughout gestation, rat dams were fed a liquid diet containing 5% ethanol or two separate control diets. At 2 days before term, the dams were killed, and maternal and embryonic tissues were collected. Immunoblot analysis of microsomes from fetal liver, placenta and maternal brain revealed a band that comigrated with adult liver CYP2E1. The identity of the immunoreactive protein in placenta, brain and fetal liver was substantiated as CYP2E1 through restriction enzyme digestion of a reverse transcription-polymerase chain reaction product. Quantification of immunoblots containing microsomes from maternal and fetal liver of ethanol-treated dams displayed a 1.4- and 2.4-fold increase in CYP2E1, respectively, compared with microsomes from pair-fed controls. Chlorzoxazone and low substrate concentrations of N-nitrosodimethylamine were used as metabolic probes for CYP2E1. The rate of chlorzoxazone metabolism by maternal hepatic microsomes from dams fed the 5% ethanol diet was 2.6-fold greater than that of controls. Conversely, a negligible increase was observed in the rate of metabolism by hepatic microsomes from ethanol-exposed fetuses compared with pair-fed animals. When N-nitrosodimethylamine demethylation was examined, these same fetal samples exhibited greater rates of activity (1.5-fold) compared with microsomes from control animals. However, this increase was not as great as expected considering the 2.4-fold increase in CYP2E1 protein. Collectively, fetuses exposed to a 5% ethanol diet throughout gestation exhibited transplacental induction of an hepatic CYP2E1 that may possess different catalytic properties from the analogous adult enzyme.

  13. Radiation Protection

    Energy Technology Data Exchange (ETDEWEB)

    Loos, M

    2002-04-01

    Major achievements of SCK-CEN's Radiation Protection Department in 2001 are described. The main areas for R and D of the department are enviromnental remediation, emergency planning, radiation protection research, low-level radioactvity measurements, safeguards and physics measurements, decision strategy research and policy support and social sciences in nuclear research. Main achievements for 2001 in these areas are reported.

  14. E1-mediated recruitment of a UAF1-USP deubiquitinase complex facilitates human papillomavirus DNA replication.

    Science.gov (United States)

    Lehoux, Michaël; Gagnon, David; Archambault, Jacques

    2014-08-01

    The human papillomavirus (HPV) E1 helicase promotes viral DNA replication through its DNA unwinding activity and association with host factors. The E1 proteins from anogenital HPV types interact with the cellular WD repeat-containing factor UAF1 (formerly known as p80). Specific amino acid substitutions in E1 that impair this interaction inhibit maintenance of the viral episome in immortalized keratinocytes and reduce viral DNA replication by up to 70% in transient assays. In this study, we determined by affinity purification of UAF1 that it interacts with three deubiquitinating enzymes in C33A cervical carcinoma cells: USP1, a nuclear protein, and the two cytoplasmic enzymes USP12 and USP46. Coimmunoprecipitation experiments indicated that E1 assembles into a ternary complex with UAF1 and any one of these three USPs. Moreover, expression of E1 leads to a redistribution of USP12 and USP46 from the cytoplasm to the nucleus. Chromatin immunoprecipitation studies further revealed that E1 recruits these threes USPs to the viral origin in association with UAF1. The function of USP1, USP12, and USP46 in viral DNA replication was investigated by overproduction of catalytically inactive versions of these enzymes in transient assays. All three dominant negative USPs reduced HPV31 DNA replication by up to 60%, an effect that was specific, as it was not observed in assays performed with a truncated E1 lacking the UAF1-binding domain or with bovine papillomavirus 1 E1, which does not bind UAF1. These results highlight the importance of the USP1, USP12, and USP46 deubiquitinating enzymes in anogenital HPV DNA replication. Human papillomaviruses are small DNA tumor viruses that induce benign and malignant lesions of the skin and mucosa. HPV types that infect the anogenital tract are the etiological agents of cervical cancer, the majority of anal cancers, and a growing proportion of head-and-neck cancers. Replication of the HPV genome requires the viral protein E1, a DNA helicase

  15. Strengths only or strengths and relative weaknesses? A preliminary study.

    Science.gov (United States)

    Rust, Teri; Diessner, Rhett; Reade, Lindsay

    2009-10-01

    Does working on developing character strengths and relative character weaknesses cause lower life satisfaction than working on developing character strengths only? The present study provides a preliminary answer. After 76 college students completed the Values in Action Inventory of Strengths (C. Peterson & M. E. P. Seligman, 2004), the authors randomly assigned them to work on 2 character strengths or on 1 character strength and 1 relative weakness. Combined, these groups showed significant gains on the Satisfaction With Life Scale (E. Diener, R. A. Emmons, R. J. Larsen, & S. Griffin, 1985), compared with a 32-student no-treatment group. However, there was no significant difference in gain scores between the 2-strengths group and the 1-character-strength-and-1-relative-character-weakness group. The authors discuss how focusing on relative character weaknesses (along with strengths) does not diminish-and may assist in increasing-life satisfaction.

  16. Inhibition of urethane-induced genotoxicity and cell proliferation in CYP2E1-null mice

    Energy Technology Data Exchange (ETDEWEB)

    Hoffler, Undi [Department of Pharmacology, Meharry Medical College, Nashville, TN (United States); Laboratory of Pharmacology and Chemistry, National Institute of Environmental Health Sciences, National Institute of Health, Research Triangle Park, NC 27709 (United States); Dixon, Darlene [Laboratory of Experimental Pathology, National Institute of Environmental Health Sciences, National Institute of Health, Research Triangle Park, NC 27709 (United States); Peddada, Shyamal [Biostatics Branch, National Institute of Environmental Health Sciences, National Institute of Health, Research Triangle Park, NC 27709 (United States); Ghanayem, Burhan I. [Department of Pharmacology, Meharry Medical College, Nashville, TN (United States) and Laboratory of Pharmacology and Chemistry, National Institute of Environmental Health Sciences, National Institute of Health, Research Triangle Park, NC 27709 (United States)]. E-mail: ghanayem@niehs.nih.gov

    2005-05-02

    Urethane is a multi-site animal carcinogen and was classified as 'reasonably anticipated to be a human carcinogen.' Urethane is a fermentation by-product and found at appreciable levels in alcoholic beverages and foods such as bread and cheese. Recent work in this laboratory demonstrated for the first time that CYP2E1 is the principal enzyme responsible for urethane metabolism. The current studies were undertaken to assess the relationships between CYP2E1-mediated metabolism and urethane-induced genotoxicity and cell proliferation as determined by induction of micronucleated erythrocytes (MN) and expression of Ki-67, respectively, using CYP2E1-null and wild-type mice. Urethane was administered at 0 (vehicle), 1, 10, or 100 mg/kg/day (p.o.), 5 days/week for 6 weeks. A significant dose-dependent increase in MN was observed in wild-type mice; however, a slight increase was measured in the MN-polychromatic erythrocytes in CYP2E1-null mice treated with 100 mg/kg. A significant increase in the expression of Ki-67 was detected in the livers and the lungs (terminal bronchioles, alveoli, and bronchi) of wild-type mice administered 100 mg urethane/kg in comparison to controls. In contrast, CYP2E1-null mice administered this dose exhibited negligible alterations in Ki-67 expression in the livers and lungs compared to controls. Interestingly, while Ki-67 expression in the forestomach decreased in wild-type mice, it increased in CYP2E1-null mice. Subsequent comparative metabolism studies demonstrated that total urethane-derived radioactivity in the plasma, liver, and lung was significantly higher in CYP2E1-null versus wild-type mice and un-metabolized urethane constituted greater than 83% of the radioactivity in CYP2E1-null mice. Un-metabolized urethane was not detectable in the plasma, liver, and lung of wild-type mice. In conclusion, these data demonstrated that CYP2E1-mediated metabolism of urethane, presumably via epoxide formation, is necessary for the induction

  17. Expression and Characterization of Acidothermus celluloyticus E1 Endoglucanase in Transgenic Duckweed Lemna minor 8627

    Energy Technology Data Exchange (ETDEWEB)

    Sun, Y.; Cheng, J. J.; Himmel, M. E.; Skory, C. D.; Adney, W. S.; Thomas, S. R.; Tisserat, B.; Nishimura, Y.; Yamamoto, Y. T.

    2007-01-01

    Endoglucanase E1 from Acidothermus cellulolyticus was expressed cytosolically under control of the cauliflower mosaic virus 35S promoter in transgenic duckweed, Lemna minor 8627 without any obvious observable phenotypic effects on morphology or rate of growth. The recombinant enzyme co-migrated with the purified catalytic domain fraction of the native E1 protein on western blot analysis, revealing that the cellulose-binding domain was cleaved near or in the linker region. The duckweed-expressed enzyme was biologically active and the expression level was up to 0.24% of total soluble protein. The endoglucanase activity with carboxymethylcellulose averaged 0.2 units mg protein{sup -1} extracted from fresh duckweed. The optimal temperature and pH for E1 enzyme activity were about 80 C and pH 5, respectively. While extraction with HEPES (N-[2-hydroxyethyl]piperazine-N{prime}-[2-ethanesulfonic acid]) buffer (pH 8) resulted in the highest recovery of total soluble proteins and E1 enzyme, extraction with citrate buffer (pH 4.8) at 65 C enriched relative amounts of E1 enzyme in the extract. This study demonstrates that duckweed may offer new options for the expression of cellulolytic enzymes in transgenic plants.

  18. E1B and E4 oncoproteins of adenovirus antagonize the effect of apoptosis inducing factor

    Energy Technology Data Exchange (ETDEWEB)

    Turner, Roberta L. [Department of Microbiology and Immunology, Wake Forest School of Medicine, Winston-Salem, NC 27157 (United States); Wilkinson, John C., E-mail: john.wilkinson@ndsu.edu [Department of Biochemistry, Wake Forest School of Medicine, Winston-Salem, NC 27157 (United States); Ornelles, David A., E-mail: ornelles@wakehealth.edu [Department of Microbiology and Immunology, Wake Forest School of Medicine, Winston-Salem, NC 27157 (United States)

    2014-05-15

    Adenovirus inundates the productively infected cell with linear, double-stranded DNA and an abundance of single-stranded DNA. The cellular response to this stimulus is antagonized by the adenoviral E1B and E4 early genes. A mutant group C adenovirus that fails to express the E1B-55K and E4ORF3 genes is unable to suppress the DNA-damage response. Cells infected with this double-mutant virus display significant morphological heterogeneity at late times of infection and frequently contain fragmented nuclei. Nuclear fragmentation was due to the translocation of apoptosis inducing factor (AIF) from the mitochondria into the nucleus. The release of AIF was dependent on active poly(ADP-ribose) polymerase-1 (PARP-1), which appeared to be activated by viral DNA replication. Nuclear fragmentation did not occur in AIF-deficient cells or in cells treated with a PARP-1 inhibitor. The E1B-55K or E4ORF3 proteins independently prevented nuclear fragmentation subsequent to PARP-1 activation, possibly by altering the intracellular distribution of PAR-modified proteins. - Highlights: • E1B-55K or E4orf3 prevents nuclear fragmentation. • Nuclear fragmentation requires AIF and PARP-1 activity. • Adenovirus DNA replication activates PARP-1. • E1B-55K or E4orf3 proteins alter the distribution of PAR.

  19. Olive cultivar origin is a major cause of polymorphism for Ole e 1 pollen allergen

    Directory of Open Access Journals (Sweden)

    Alché Juan

    2008-01-01

    Full Text Available Abstract Background Pollens from different olive (Olea europaea L. cultivars have been shown to differ significantly in their content in Ole e 1 and in their overall allergenicity. This allergen is, in addition, characterized by a high degree of polymorphism in its sequence. The purpose of this study is to evaluate the putative presence of divergences in Ole e 1 sequences from different olive cultivars. Results RNA from pollen individually collected from 10 olive cultivars was used to amplify Ole e 1 sequences by RT-PCR, and the sequences were analyzed by using different bioinformatics tools. Numerous nucleotide substitutions were detected throughout the sequences, many of which resulted in amino acid substitutions in the deduced protein sequences. In most cases variability within a single variety was much lower than among varieties. Key amino acid changes in comparison with "canonical" sequences previously described in the literature included: a the substitution of C19-relevant to the disulphide bond structure of the protein-, b the presence of an additional N-glycosylation motif, and c point substitutions affecting regions of Ole e 1 already described like relevant for the immunogenicity/allergenicity of the protein. Conclusion Varietal origin of olive pollen is a major factor determining the diversity of Ole e 1 variants. We consider this information of capital importance for the optimal design of efficient and safe allergen formulations, and useful for the genetic engineering of modified forms of the allergen among other applications.

  20. 2-Carboxyquinoxalines kill mycobacterium tuberculosis through noncovalent inhibition of DprE1.

    Science.gov (United States)

    Neres, João; Hartkoorn, Ruben C; Chiarelli, Laurent R; Gadupudi, Ramakrishna; Pasca, Maria Rosalia; Mori, Giorgia; Venturelli, Alberto; Savina, Svetlana; Makarov, Vadim; Kolly, Gaelle S; Molteni, Elisabetta; Binda, Claudia; Dhar, Neeraj; Ferrari, Stefania; Brodin, Priscille; Delorme, Vincent; Landry, Valérie; de Jesus Lopes Ribeiro, Ana Luisa; Farina, Davide; Saxena, Puneet; Pojer, Florence; Carta, Antonio; Luciani, Rosaria; Porta, Alessio; Zanoni, Giuseppe; De Rossi, Edda; Costi, Maria Paola; Riccardi, Giovanna; Cole, Stewart T

    2015-03-20

    Phenotypic screening of a quinoxaline library against replicating Mycobacterium tuberculosis led to the identification of lead compound Ty38c (3-((4-methoxybenzyl)amino)-6-(trifluoromethyl)quinoxaline-2-carboxylic acid). With an MIC99 and MBC of 3.1 μM, Ty38c is bactericidal and active against intracellular bacteria. To investigate its mechanism of action, we isolated mutants resistant to Ty38c and sequenced their genomes. Mutations were found in rv3405c, coding for the transcriptional repressor of the divergently expressed rv3406 gene. Biochemical studies clearly showed that Rv3406 decarboxylates Ty38c into its inactive keto metabolite. The actual target was then identified by isolating Ty38c-resistant mutants of an M. tuberculosis strain lacking rv3406. Here, mutations were found in dprE1, encoding the decaprenylphosphoryl-d-ribose oxidase DprE1, essential for biogenesis of the mycobacterial cell wall. Genetics, biochemical validation, and X-ray crystallography revealed Ty38c to be a noncovalent, noncompetitive DprE1 inhibitor. Structure-activity relationship studies generated a family of DprE1 inhibitors with a range of IC50's and bactericidal activity. Co-crystal structures of DprE1 in complex with eight different quinoxaline analogs provided a high-resolution interaction map of the active site of this extremely vulnerable target in M. tuberculosis.

  1. Wipe testing of sealed radiation sources using a radiation protection assistant robot

    OpenAIRE

    Zeb Jahan; Rashid Farooq; Iqbal Naeem; Ahmad Nasir

    2009-01-01

    Sealed radiation sources are commonly used in different research institutes, industries, and hospitals. The sources of various strengths are manufactured in different sizes and shapes. It is a regulatory requirement that these sources must be monitored frequently for their integrity and to avoid any radiological contamination hazard. Mainly, a wipe test is recommended for the contamination detection due to the leakage of sealed radiation sources. A radiation protection assistant robot has bee...

  2. CYP2E1 Potentiates Ethanol-induction of Hypoxia and HIF-1α in vivo

    Science.gov (United States)

    Wang, Xiaodong; Wu, Defeng; Yang, Lili; Gan, Lixia; Cederbaum, Arthur I

    2013-01-01

    Ethanol induces hypoxia and elevates HIF-1α in the liver. CYP2E1 plays a role in the mechanisms by which ethanol generates oxidative stress, fatty liver and liver injury. The current study evaluated whether CYP2E1 contributes to ethanol-induced hypoxia and activation of HIF-1α in vivo and whether HIF-1α protects against or promotes CYP2E1-dependent toxicity in vitro. Wild type (WT), CYP2E1-knockin (KI) and CYP2E1 knockout (KO) mice were fed ethanol chronically; pair fed controls received isocaloric dextrose. Ethanol produced liver injury in the KI mice to a much greater extent than in the WT and KO mice. Protein levels of HIF-1α and downstream targets of HIF-1α activation were elevated in the ethanol-fed KI mice compared to the WT and KO mice. Levels of HIF prolylhydroxlase 2 which promotes HIF-1α degradation were decreased in the ethanol-fed KI mice in association with the increases in HIF-1α. Hypoxia occurred in the ethanol-fed CYP2E1 KI mice as shown by an increased area of staining using the hypoxia-specific marker pimonidazole. Hypoxia was lower in the ethanol-fed WT mice and lowest in the ethanol fed KO mice and all the dextrose-fed mice. In situ double staining showed that pimonidazole and CYP2E1 were co-localized to the same area of injury in the hepatic centrilobule. Increased protein levels of HIF-1α were also found after acute ethanol treatment of KI mice. Treatment of HepG2 E47 cells which express CYP2E1 with ethanol plus arachidonic (AA) acid or ethanol plus buthionine sulfoximine (BSO) which depletes GSH caused loss of cell viability to greater extent than in HepG2 C34 cells which do not express CYP2E1. These treatments elevated protein levels of HIF-1α to a greater extent in E47 cells than C34 cells. 2-Methoxyestradiol, an inhibitor of HIF-1α, blunted the toxic effects of ethanol plus AA and ethanol plus BSO in the E47 cells in association with inhibition of HIF-1α. The HIF-1α inhibitor also blocked the elevated oxidative stress produced

  3. Lightweight, High Strength Nano-Composite Magnesium for Radiators Project

    Data.gov (United States)

    National Aeronautics and Space Administration — In this Phase I SBIR, Terves will develop processing routes to produce high thermal conductivity magnesium composites for use in heat transfer applications such as...

  4. Quercetin prevents type 1 diabetic liver damage through inhibition of CYP2E1.

    Science.gov (United States)

    Maksymchuk, Oksana; Shysh, Angela; Rosohatska, Inna; Chashchyn, Mykola

    2017-12-01

    Increased CYP2E1 protein and activity levels can be the main cause of stress-mediated liver damage in diabetes. In this work we investigated the quercetin properties to prevent diabetic oxidative liver injury through inhibition of CYP2E1. Animals were randomly divided into three groups (n=5 for each group): non-diabetic control, STZ-diabetic rats and STZ-diabetic rats administered with quercetin (50mg/kg bw, per day, during 30days). Markers of oxidative stress and liver injury, hepatocyte ultrastructure and levels of CYP2E1 protein and activity were examined using biochemical, electron microscopy and molecular biological methods. It was shown that symptoms of diabetes (hyperglycemia, bodyweight loss, damaged hepatocyte ultrastructure), signs of oxidative stress in liver (2-fold intensification of peroxide process and 2-fold depletion of antioxidants) and serum markers of liver damage (3.5-, 1.5- and 5-fold increase in levels of ALT, AST and GGT, respectively) were present in STZ-diabetic rats. We found 3- and 2.5-fold increase in levels of protein and activity of CYP2E1 in the liver of STZ-diabetic rats. We demonstrated that the administration of quercetin leads to significant decrease in CYP2E1 activity (5- and 2-times compared to STZ-diabetic and control group, respectively). That was accompanied by normalization of pro-oxidant-antioxidant balance, improving the ultrastructure of hepatocytes and rates of serum markers of liver injury. CYP2E1 can play a crucial role in stress-induced pathological processes in the liver in diabetes, and the inhibition of the enzyme by quercetin during the development of diabetes mainly prevents the oxidative damage in liver. Copyright © 2017 Institute of Pharmacology, Polish Academy of Sciences. Published by Elsevier Urban & Partner Sp. z o.o. All rights reserved.

  5. Resolvin E1 Attenuates Atherosclerotic Plaque Formation in Diet and Inflammation Induced Atherogenesis

    Science.gov (United States)

    Hasturk, Hatice; Abdallah, Rima; Kantarci, Alpdogan; Nguyen, Daniel; Giordano, Nicholas; Hamilton, James; Van Dyke, Thomas E.

    2015-01-01

    Objective Epidemiological and recent clinical studies implicate periodontitis as an independent risk factor for cardiovascular disease. Previously, we demonstrated that rabbits with experimental periodontitis and cholesterol diet exhibit more aortic plaque compared to diet alone. We also showed that a proresolution mediator, Resolvin E1 (RvE1), reverses the experimental periodontitis. Here, we determined whether oral/topical application of RvE1 attenuates aortic atherosclerosis induced by both diet and periodontal inflammation. Approach and Results Thirty-nine rabbits on a 13-week regimen of 0.5% cholesterol diet were included. Periodontitis was induced by P. gingivalis in 24 rabbits and 15 rabbits were placed in no-periodontitis groups. Interventions were no-treatment, vehicle, and RvE1 treatment (4μg/site or 0.4 μg/site) topically applied 3-times/ week. At 13 weeks, both periodontitis and atherosclerosis were quantified. Atherosclerotic plaques were assessed by Sudan IV staining, histology and ex vivo MRI. Serum levels of C-reactive protein (CRP) were evaluated as a measure of systemic inflammation.RvE1, used as an oral/topical agent, significantly diminished atherogenesis and prevented periodontitis (pperiodontal inflammation, oral/topical application of RvE1 resulted in significantly less arterial plaque, a lower intima/media ratio, and decreased inflammatory cell infiltration compared to no-treatment (pperiodontitis and prevents vascular inflammation and atherogenesis in the absence of periodontitis. The inhibition of vascular inflammation with endogenous mediators of resolution of inflammation provides a novel approach in the prevention of atherogenic events. PMID:25792445

  6. Radar detection of radiation-induced ionization in air

    Science.gov (United States)

    Gopalsami, Nachappa; Heifetz, Alexander; Chien, Hual-Te; Liao, Shaolin; Koehl, Eugene R.; Raptis, Apostolos C.

    2015-07-21

    A millimeter wave measurement system has been developed for remote detection of airborne nuclear radiation, based on electromagnetic scattering from radiation-induced ionization in air. Specifically, methods of monitoring radiation-induced ionization of air have been investigated, and the ionized air has been identified as a source of millimeter wave radar reflection, which can be utilized to determine the size and strength of a radiation source.

  7. Thionin-D4E1 chimeric protein protects plants against bacterial infections

    Energy Technology Data Exchange (ETDEWEB)

    Stover, Eddie W; Gupta, Goutam; Hao, Guixia

    2017-08-08

    The generation of a chimeric protein containing a first domain encoding either a pro-thionon or thionin, a second domain encoding D4E1 or pro-D4E1, and a third domain encoding a peptide linker located between the first domain and second domain is described. Either the first domain or the second domain is located at the amino terminal of the chimeric protein and the other domain (second domain or first domain, respectively) is located at the carboxyl terminal. The chimeric protein has antibacterial activity. Genetically altered plants and their progeny expressing a polynucleotide encoding the chimeric protein resist diseases caused by bacteria.

  8. CYP2E1-dependent elevation of serum cholesterol, triglycerides, and hepatic bile acids by isoniazid

    Energy Technology Data Exchange (ETDEWEB)

    Cheng, Jie; Krausz, Kristopher W. [Laboratory of Metabolism, Center for Cancer Research, National Cancer Institute, National Institutes of Health, Bethesda, MD 20892 (United States); Li, Feng; Ma, Xiaochao [Department of Pharmacology, Toxicology and Therapeutics, The University of Kansas Medical Center, 4089 KLSIC, MS 1018, 3901 Rainbow Boulevard, Kansas City, KS 66160 (United States); Gonzalez, Frank J., E-mail: fjgonz@helix.nih.gov [Laboratory of Metabolism, Center for Cancer Research, National Cancer Institute, National Institutes of Health, Bethesda, MD 20892 (United States)

    2013-01-15

    Isoniazid is the first-line medication in the prevention and treatment of tuberculosis. Isoniazid is known to have a biphasic effect on the inhibition–induction of CYP2E1 and is also considered to be involved in isoniazid-induced hepatotoxicity. However, the full extent and mechanism of involvement of CYP2E1 in isoniazid-induced hepatotoxicity remain to be thoroughly investigated. In the current study, isoniazid was administered to wild-type and Cyp2e1-null mice to investigate the potential toxicity of isoniazid in vivo. The results revealed that isoniazid caused no hepatotoxicity in wild-type and Cyp2e1-null mice, but produced elevated serum cholesterol and triglycerides, and hepatic bile acids in wild-type mice, as well as decreased abundance of free fatty acids in wild-type mice and not in Cyp2e1-null mice. Metabolomic analysis demonstrated that production of isoniazid metabolites was elevated in wild-type mice along with a higher abundance of bile acids, bile acid metabolites, carnitine and carnitine derivatives; these were not observed in Cyp2e1-null mice. In addition, the enzymes responsible for bile acid synthesis were decreased and proteins involved in bile acid transport were significantly increased in wild-type mice. Lastly, treatment of targeted isoniazid metabolites to wild-type mice led to similar changes in cholesterol, triglycerides and free fatty acids. These findings suggest that while CYP2E1 is not involved in isoniazid-induced hepatotoxicity, while an isoniazid metabolite might play a role in isoniazid-induced cholestasis through enhancement of bile acid accumulation and mitochondria β-oxidation. -- Highlights: ► Isoniazid metabolites were elevated only in wild-type mice. ► Isoniazid caused no hepatotoxicity in wild-type and Cyp2e1-null mice. ► Isoniazid elevated serum cholesterol and triglycerides, and hepatic bile acids. ► Bile acid transporters were significantly decreased in isoniazid-treated mice.

  9. A bilateral antidiuresis to renal artery infusion of prostaglandin E1 in dogs treated with phenylbutazone

    Science.gov (United States)

    Hall, W. J.; Hensey, O. J.; O'Neill, P.; Sheehan, J. D.

    1978-01-01

    1. In acute experiments, high levels of endogenous prostaglandins, provoked by operative stress, could obscure or alter the actions of infused prostaglandins on the kidney. For this reason we decided to compare the effects of infusing prostaglandin E1 into the renal artery of the dog before and after the administration of phenylbutazone, a prostaglandin synthetase inhibitor. 2. Infusion of prostaglandin E1 into the left renal artery of the pre-phenylbutazone treated dog undergoing a mannitol diuresis increased renal plasma flow, glomerular filtration rate and the excretion of salt and water. The findings are in general agreement with those reported by others. 3. Following phenylbutazone administration the vascular and saluretic actions of prostaglandin E1 were unchanged but a reduced diuretic effect was observed. The response to a low dose of prostaglandin E1 (0·05 μg/min) was reduced from 1·46 ± 0·15 to 0·96 ± 0·16 ml./min (P phenylbutazone treatment than before. The reduction in the diuretic response was of the same order as the decrease in the free water clearance response, while the increase in osmolar clearance was unchanged. 5. In water-loaded dogs treated with phenylbutazone, infusion of prostaglandin E1 into the left renal artery had a biphasic effect on urine output from the left kidney. An initial diuretic response to a low dose of prostaglandin E1 disappeared with the infusion of higher doses, and antidiuresis developed in the immediate post-infusion period. 6. As prostaglandin was infused into the left kidney progressive antidiuresis was seen in the non-infused right kidney. 7. It is concluded that endogenous prostaglandins do not obscure or alter the vascular and saluretic actions of intrarenal prostaglandin E1. The findings question the proposed link between the vascular and saluretic actions of this compound. 8. It is suggested that the reduced diuretic effect of prostaglandin E1 in series no. 1, and the antidiuresis in the water-loaded dogs

  10. Radiation Hydrodynamics

    Energy Technology Data Exchange (ETDEWEB)

    Castor, J I

    2003-10-16

    The discipline of radiation hydrodynamics is the branch of hydrodynamics in which the moving fluid absorbs and emits electromagnetic radiation, and in so doing modifies its dynamical behavior. That is, the net gain or loss of energy by parcels of the fluid material through absorption or emission of radiation are sufficient to change the pressure of the material, and therefore change its motion; alternatively, the net momentum exchange between radiation and matter may alter the motion of the matter directly. Ignoring the radiation contributions to energy and momentum will give a wrong prediction of the hydrodynamic motion when the correct description is radiation hydrodynamics. Of course, there are circumstances when a large quantity of radiation is present, yet can be ignored without causing the model to be in error. This happens when radiation from an exterior source streams through the problem, but the latter is so transparent that the energy and momentum coupling is negligible. Everything we say about radiation hydrodynamics applies equally well to neutrinos and photons (apart from the Einstein relations, specific to bosons), but in almost every area of astrophysics neutrino hydrodynamics is ignored, simply because the systems are exceedingly transparent to neutrinos, even though the energy flux in neutrinos may be substantial. Another place where we can do ''radiation hydrodynamics'' without using any sophisticated theory is deep within stars or other bodies, where the material is so opaque to the radiation that the mean free path of photons is entirely negligible compared with the size of the system, the distance over which any fluid quantity varies, and so on. In this case we can suppose that the radiation is in equilibrium with the matter locally, and its energy, pressure and momentum can be lumped in with those of the rest of the fluid. That is, it is no more necessary to distinguish photons from atoms, nuclei and electrons, than it is

  11. Strength Development for Young Adolescents

    Science.gov (United States)

    McDaniel, Larry W.; Jackson, Allen; Gaudet, Laura

    2009-01-01

    Participation in strength training is important for older children or young adolescences who wish to improve fitness or participate in sports. When designing strength training programs for our youth this age group is immature anatomically, physiologically, and psychologically. For the younger or inexperienced group the strength training activities…

  12. Developing A Radiation Protection Hub.

    Science.gov (United States)

    Hertel, Nolan E

    2017-02-01

    The Where are the Radiation Professionals (WARP)? statement issued by the National Council on Radiation Protection and Measurements estimates that in 10 y, there will be a human capital crisis across the radiation safety community. The ability to respond to this shortage will be amplified by the fact that many radiation protection (health physics) academic programs will find it difficult to justify their continued existence since they are low-volume programs, both in terms of enrollment and research funding, compared to the research funding return and visibility of more highly subscribed and highly funded academic disciplines. In addition, across the national laboratory complex, radiation protection research groups have been disbanded or dramatically reduced in size. The loss of both of these national resources is being accelerated by low and uncertain government funding priorities. The most effective solution to this problem would be to form a consortium that would bring together the radiation protection research, academic, and training communities. The goal of such a consortium would be to engage in research, education, and training of the next generation of radiation protection professionals. Furthermore, the consortium could bring together the strengths of different universities, national laboratory programs, and other entities in a strategic manner to accomplish a multifaceted research, educational, and training agenda. This vision would forge a working and funded relationship between major research universities, national laboratories, 4-y degree institutions, technical colleges, and other partners.

  13. The fracture strength and frictional strength of Weber Sandstone

    Science.gov (United States)

    Byerlee, J.D.

    1975-01-01

    The fracture strength and frictional strength of Weber Sandstone have been measured as a function of confining pressure and pore pressure. Both the fracture strength and the frictional strength obey the law of effective stress, that is, the strength is determined not by the confining pressure alone but by the difference between the confining pressure and the pore pressure. The fracture strength of the rock varies by as much as 20 per cent depending on the cement between the grains, but the frictional strength is independent of lithology. Over the range 0 2 kb, ??=0??5 + 0??6??n. This relationship also holds for other rocks such as gabbro, dunite, serpentinite, granite and limestone. ?? 1975.

  14. Radiation damage

    CERN Document Server

    Heijne, Erik H M; CERN. Geneva

    1998-01-01

    a) Radiation damage in organic materials. This series of lectures will give an overview of radiation effects on materials and components frequently used in accelerator engineering and experiments. Basic degradation phenomena will be presented for organic materials with comprehensive damage threshold doses for commonly used rubbers, thermoplastics, thermosets and composite materials. Some indications will be given for glass, scintillators and optical fibres. b) Radiation effects in semiconductor materials and devices. The major part of the time will be devoted to treat radiation effects in semiconductor sensors and the associated electronics, in particular displacement damage, interface and single event phenomena. Evaluation methods and practical aspects will be shown. Strategies will be developed for the survival of the materials under the expected environmental conditions of the LHC machine and detectors. I will describe profound revolution in our understanding of black holes and their relation to quantum me...

  15. Radiation Transport

    Energy Technology Data Exchange (ETDEWEB)

    Urbatsch, Todd James [Los Alamos National Lab. (LANL), Los Alamos, NM (United States)

    2015-06-15

    We present an overview of radiation transport, covering terminology, blackbody raditation, opacities, Boltzmann transport theory, approximations to the transport equation. Next we introduce several transport methods. We present a section on Caseology, observing transport boundary layers. We briefly broach topics of software development, including verification and validation, and we close with a section on high energy-density experiments that highlight and support radiation transport.

  16. Radiation Protection

    Energy Technology Data Exchange (ETDEWEB)

    Loos, M

    2001-04-01

    Major achievements of SCK-CEN's Radiation Protection Department in 2000 are described. The main areas for R and D of the department remain neutron dosimetry and neutron activation analysis, safeguards information handling and non-destructive assay techniques. Further activities include low-level radioactivity measurements in environmental and biological samples and radiation protection research. Finally, achievements in decision strategy research and social sciences in nuclear research are reported.

  17. Emerging Concepts in the Resolution of Periodontal Inflammation: A Role for Resolvin E1

    Directory of Open Access Journals (Sweden)

    Maria G. Balta

    2017-12-01

    Full Text Available Inflammatory response is a protective biological process intended to eliminate the harmful effect of the insulting influx. Resolution of inflammation constitutes an active sequence of overlapping events mediated by specialized proresolving mediators, such as lipoxins, resolvins, protectins, and maresins, which originate from the enzymatic conversion of polyunsaturated fatty acids (PUFAs. An unresolved acute inflammatory response results in chronic inflammation, which is a leading cause of several common pathological conditions. Periodontitis is a biofilm-induced chronic inflammatory disease, which results in loss of periodontal connective tissue and alveolar bone support around the teeth, leading to tooth exfoliation. An inadequate proresolving host response may constitute a mechanism explaining the pathogenesis of periodontal disease. An emerging body of clinical and experimental evidence has focused on the underlying molecular mechanisms of resolvins and particularly Resolvin E1 (RvE1 in periodontitis. Recently, RvE1 has been directly correlated with the resolution of inflammation in periodontal disease. Herein, we provide a comprehensive overview of the literature regarding the role and possible mechanisms of action of RvE1 on different cell populations recruited in periodontal inflammation as well as its potential therapeutic implications. Along with recent data on the benefits of PUFAs supplementation in periodontal clinical parameters, we touch upon suggested future directions for research.

  18. Data of evolutionary structure change: 1B06E-1UNFX [Confc[Archive

    Lifescience Database Archive (English)

    Full Text Available 1B06E-1UNFX 1B06 1UNF E X VIQLKRYEFPQLPYKVDALEPYISKDIIDVHYNGHHKGY...GGG EEEEEEE EEE EEE HHHH HHHHHHHHHH EEHHHHHHHHHHHHHH EVID> LEU CA 300 PRO CA 361 1UNF... X 1UNFX AVNPLVWGGYY....128504991531372 5.267780780792236 EVID>

  19. 26 CFR 301.6223(e)-1 - Effect of Internal Revenue Service's failure to provide notice.

    Science.gov (United States)

    2010-04-01

    ... 26 Internal Revenue 18 2010-04-01 2010-04-01 false Effect of Internal Revenue Service's failure to... General § 301.6223(e)-1 Effect of Internal Revenue Service's failure to provide notice. (a) Notice group...), the Internal Revenue Service's failure to provide notice to a pass-thru partner entitled to notice...

  20. Heat denaturation of Brazil nut allergen Ber e 1 in relation to food processing.

    Science.gov (United States)

    van Boxtel, Evelien L; Koppelman, Stef J; van den Broek, Lambertus A M; Gruppen, Harry

    2008-10-15

    Ber e 1, a major allergen from Brazil nuts, is very stable to in vitro peptic digestion. As heat-induced denaturation may affect protein digestibility, the denaturation behaviour of Ber e 1 was investigated. The denaturation temperature of Ber e 1 varies from approximately 80-110°C, depending on the pH. Upon heating above its denaturation temperature at pH 7.0, the protein partly forms insoluble aggregates and partly dissociates into its polypeptides, whereas heating at pH 5.0 does neither induce aggregation, nor dissociation of the protein. The denaturation temperature of approximately 110°C at pH values corresponding to the general pH values of foods (pH 5-7) is very high and is expected to be even higher in Brazil nuts themselves. As a result, it is unlikely that heat processing causes the denaturation of all Ber e 1 present in food products. Consequently, the allergen is assumed to be consumed (mainly) in its native form, having a high stability towards pepsin digestion. Copyright © 2008 Elsevier Ltd. All rights reserved.

  1. 26 CFR 301.6511(e)-1 - Special rules applicable to manufactured sugar.

    Science.gov (United States)

    2010-04-01

    ... 26 Internal Revenue 18 2010-04-01 2010-04-01 false Special rules applicable to manufactured sugar... Assessment and Collection § 301.6511(e)-1 Special rules applicable to manufactured sugar. (a) Use as... the person entitled thereto. Such right accrues as of the date the manufactured sugar, or article...

  2. Two-step method for curing Escherichia coli of ColE1-derived plasmids

    DEFF Research Database (Denmark)

    Hove-Jensen, Bjarne

    2008-01-01

    To cure Escherichia coli for plasmids derived from the ColE1 replicon advantage is taken of the fact that maintenance of this replicon requires a wild-type allele of polA, encoding DNA polymerase I. Curing is achieved by cotransduction of a mutant polA allele with metE::Tn10, fadAB::Tn10 or other...

  3. E-1 Dynamic Fluid-Flow Model Update: EASY/ROCETS Enhancement and Model Development Support

    Science.gov (United States)

    Follett, Randolph F.; Taylor, Robert P.

    1998-01-01

    This report documents the research conducted to update computer models for dynamic fluid flow simulation of the E-1 test stand subsystems at te NASA John C. Stennis Space Center.Work also involved significant upgrades to the capabilities of EASY/ROCKETS library through the inclusion of the NIST-12 thermodynamic property database and development of new control system modules.

  4. The 8-Pyrrole-Benzothiazinones Are Noncovalent Inhibitors of DprE1 from Mycobacterium tuberculosis.

    Science.gov (United States)

    Makarov, Vadim; Neres, João; Hartkoorn, Ruben C; Ryabova, Olga B; Kazakova, Elena; Šarkan, Michal; Huszár, Stanislav; Piton, Jérémie; Kolly, Gaëlle S; Vocat, Anthony; Conroy, Trent M; Mikušová, Katarína; Cole, Stewart T

    2015-08-01

    8-Nitro-benzothiazinones (BTZs), such as BTZ043 and PBTZ169, inhibit decaprenylphosphoryl-β-d-ribose 2'-oxidase (DprE1) and display nanomolar bactericidal activity against Mycobacterium tuberculosis in vitro. Structure-activity relationship (SAR) studies revealed the 8-nitro group of the BTZ scaffold to be crucial for the mechanism of action, which involves formation of a semimercaptal bond with Cys387 in the active site of DprE1. To date, substitution of the 8-nitro group has led to extensive loss of antimycobacterial activity. Here, we report the synthesis and characterization of the pyrrole-benzothiazinones PyrBTZ01 and PyrBTZ02, non-nitro-benzothiazinones that retain significant antimycobacterial activity, with MICs of 0.16 μg/ml against M. tuberculosis. These compounds inhibit DprE1 with 50% inhibitory concentration (IC50) values of <8 μM and present favorable in vitro absorption-distribution-metabolism-excretion/toxicity (ADME/T) and in vivo pharmacokinetic profiles. The most promising compound, PyrBTZ01, did not show efficacy in a mouse model of acute tuberculosis, suggesting that BTZ-mediated killing through DprE1 inhibition requires a combination of both covalent bond formation and compound potency. Copyright © 2015, American Society for Microbiology. All Rights Reserved.

  5. US NDC Modernization Iteration E1 Prototyping Report: User Interface Framework

    Energy Technology Data Exchange (ETDEWEB)

    Lober, Randall R. [Sandia National Lab. (SNL-NM), Albuquerque, NM (United States)

    2014-12-01

    During the first iteration of the US NDC Modernization Elaboration phase (E1), the SNL US NDC modernization project team completed an initial survey of applicable COTS solutions, and established exploratory prototyping related to the User Interface Framework (UIF) in support of system architecture definition. This report summarizes these activities and discusses planned follow-on work.

  6. US NDC Modernization Iteration E1 Prototyping Report: Processing Control Framework

    Energy Technology Data Exchange (ETDEWEB)

    Prescott, Ryan [Sandia National Lab. (SNL-NM), Albuquerque, NM (United States); Hamlet, Benjamin R. [Sandia National Lab. (SNL-NM), Albuquerque, NM (United States)

    2014-12-01

    During the first iteration of the US NDC Modernization Elaboration phase (E1), the SNL US NDC modernization project team developed an initial survey of applicable COTS solutions, and established exploratory prototyping related to the processing control framework in support of system architecture definition. This report summarizes these activities and discusses planned follow-on work.

  7. US NDC Modernization Iteration E1 Prototyping Report: Common Object Interface

    Energy Technology Data Exchange (ETDEWEB)

    Lewis, Jennifer E. [Sandia National Lab. (SNL-NM), Albuquerque, NM (United States); Hess, Michael M. [Sandia National Lab. (SNL-NM), Albuquerque, NM (United States)

    2014-12-01

    During the first iteration of the US NDC Modernization Elaboration phase (E1), the SNL US NDC modernization project team completed an initial survey of applicable COTS solutions, and established exploratory prototyping related to the Common Object Interface (COI) in support of system architecture definition. This report summarizes these activities and discusses planned follow-on work.

  8. PDH-E1alpha dephosphorylation and activation in human skeletal muscle during exercise

    DEFF Research Database (Denmark)

    Pilegaard, Henriette; Birk, Jesper Bratz; Sacchetti, Massimo

    2006-01-01

    exercise similarly in the two trials. After 3 h of exercise, PDHa activity remained elevated in the intralipid trial but returned to resting levels in the control trial. Accordingly, in both trials PDH-P1 and PDH-P2 decreased during exercise, and the decrease was more marked during intralipid infusion...... extensor exercise at moderate intensity. During the 4-h resting period, activity of PDH in the active form (PDHa) did not change in either trial, yet phosphorylation of PDH-E1a site 1 (PDH-P1) and site 2 (PDH-P2) was elevated in the intralipid compared with the control trial. PDHa activity increased during....... Phosphorylation had returned to resting levels at 3 h of exercise only in the control trial. Thus, an inverse association between PDH-E1a phosphorylation and PDHa activity exists. Short-term elevation in plasma FFA at rest increases PDH-E1a phosphorylation, but exercise overrules this effect of FFA on PDH-E1a...

  9. 26 CFR 1.665(e)-1A - Preceding taxable year.

    Science.gov (United States)

    2010-04-01

    ....665(e)-1A Internal Revenue INTERNAL REVENUE SERVICE, DEPARTMENT OF THE TREASURY (CONTINUED) INCOME TAX... trust to which an accumulation distribution consisting of undistributed net income or undistributed... distribution consisting of undistributed net income or undistributed capital gain may not be allocated or...

  10. 26 CFR 1.1397E-1T - Qualified zone academy bonds (temporary).

    Science.gov (United States)

    2010-04-01

    ... (CONTINUED) INCOME TAX (CONTINUED) INCOME TAXES Empowerment Zone Employment Credit § 1.1397E-1T Qualified... materials for education to be provided at such academy, and training teachers and other school personnel in... or train teachers. Section 1397E(d)(5)(C) and (D) provides that the term qualified purpose with...

  11. Osteogenic gene expression of murine osteoblastic (MC3T3-E1) cells under cyclic tension

    Science.gov (United States)

    Kao, C. T.; Chen, C. C.; Cheong, U.-I.; Liu, S. L.; Huang, T. H.

    2014-08-01

    Low-level laser therapy (LLLT) can promote cell proliferation. The remodeling ability of the tension side of orthodontic teeth affects post-orthodontic stability. The purpose of the present study was to investigate the osteogenic effects of LLLT on osteoblast-like cells treated with a simulated tension system that provides a mechanical tension regimen. Murine osteoblastic (MC3T3-E1) cells were cultured in a Flexcell strain unit with programmed loads of 12% elongation at a frequency of 0.5 Hz for 24 and 48 h. The cultured cells were treated with a low-level diode laser using powers of 5 J and 10 J. The proliferation of MC3T3-E1 cells was determined using the Alamar Blue assay. The expression of osteogenic genes (type I collagen (Col-1), osteopontin (OPN), osteocalcin (OC), osteoprotegerin (OPG), receptor activator of nuclear factor kappa B ligand (RANKL), bone morphologic protein (BMP-2), and bone morphologic protein (BMP-4)) in MC3T3-E1 cells was analyzed using reverse transcription polymerase chain reaction (RT-PCR). The data were analyzed using one-way analysis of variance. The proliferation rate of tension-cultured MC3T3-E1 cells under 5 J and 10 J LLLT increased compared with that of the control group (p < 0.05). Prominent mineralization of the MC3T3-E1 cells was visible using a von Kossa stain in the 5 J LLLT group. Osteogenic genes (Col-1, OC, OPG and BMP-2) were significantly expressed in the MC3T3-E1 cells treated with 5 J and 10 J LLLT (p < 0.05). LLLT in tension-cultured MC3T3-E1 cells showed synergistic osteogenic effects, including increases in cell proliferation and Col-1, OPN, OC, OPG and BMP-2 gene expression. LLLT might be beneficial for bone remodeling on the tension side of orthodontics.

  12. Gender difference in NASH susceptibility: Roles of hepatocyte Ikkβ and Sult1e1

    Science.gov (United States)

    Matsushita, Noriko; Hassanein, Mohamed T.; Martinez-Clemente, Marcos; Lazaro, Raul; French, Samuel W.; Xie, Wen; Lai, Keane; Karin, Michael; Tsukamoto, Hidekazu

    2017-01-01

    Myeloid cell and hepatocyte IKKβ may mediate the genesis of obesity and insulin resistance in mice fed high fat diet. However, their gender-specific roles in the pathogenesis of non-alcoholic steatohepatitis (NASH) are not known. Here we demonstrate myeloid IKKβ deficiency prevents Western diet-induced obesity and visceral adiposity in females but not in males, and attenuates hyperglycemia, global IR, and NASH in both genders. In contrast, all metabolic sequela including NASH are aggravated by hepatocyte IKKβ deficiency (IkbkbΔhep) in male but not female mice. Gene profiling identifies sulfotransferase family 1E (Sult1e1), which encodes a sulfotransferase E1 responsible for inactivation of estrogen, as a gene upregulated in NASH in both genders and most conspicuously in male IkbkbΔhep mice having worst NASH and lowest plasma estradiol levels. LXRα is enriched to LXRE on Sult1e1 promoter in male WT and IkbkbΔhep mice with NASH, and a Sult1e1 promoter activity is increased by LXRα and its ligand and augmented by expression of a S32A mutant of IκBα. These results demonstrate striking gender differences in regulation by IKKβ of high cholesterol saturated fat diet-induced metabolic changes including NASH and suggest hepatocyte IKKβ is protective in male due at least in part to its ability to repress LXR-induced Sult1e1. Our findings also raise a caution for systemic IKK inhibition for the treatment of NASH as it may exacerbate the disease in male patients. PMID:28797077

  13. Gender difference in NASH susceptibility: Roles of hepatocyte Ikkβ and Sult1e1.

    Directory of Open Access Journals (Sweden)

    Noriko Matsushita

    Full Text Available Myeloid cell and hepatocyte IKKβ may mediate the genesis of obesity and insulin resistance in mice fed high fat diet. However, their gender-specific roles in the pathogenesis of non-alcoholic steatohepatitis (NASH are not known. Here we demonstrate myeloid IKKβ deficiency prevents Western diet-induced obesity and visceral adiposity in females but not in males, and attenuates hyperglycemia, global IR, and NASH in both genders. In contrast, all metabolic sequela including NASH are aggravated by hepatocyte IKKβ deficiency (IkbkbΔhep in male but not female mice. Gene profiling identifies sulfotransferase family 1E (Sult1e1, which encodes a sulfotransferase E1 responsible for inactivation of estrogen, as a gene upregulated in NASH in both genders and most conspicuously in male IkbkbΔhep mice having worst NASH and lowest plasma estradiol levels. LXRα is enriched to LXRE on Sult1e1 promoter in male WT and IkbkbΔhep mice with NASH, and a Sult1e1 promoter activity is increased by LXRα and its ligand and augmented by expression of a S32A mutant of IκBα. These results demonstrate striking gender differences in regulation by IKKβ of high cholesterol saturated fat diet-induced metabolic changes including NASH and suggest hepatocyte IKKβ is protective in male due at least in part to its ability to repress LXR-induced Sult1e1. Our findings also raise a caution for systemic IKK inhibition for the treatment of NASH as it may exacerbate the disease in male patients.

  14. On strength of porous material

    DEFF Research Database (Denmark)

    Nielsen, Lauge Fuglsang

    1999-01-01

    The question of non-destructive testing of porous materials has always been of interest for the engineering profession. A number of empirically based MOE-MOR relations between stiffness (Modulus Of Elasticity) and strength (Modulus OF Rupture) of materials have been established in order to control...... to the theoretical research on non-destructive testing of such materials relating strength to stiffness and pore geometry.It is demonstrated that solutions for stiffness, tensile strength, and pore strength (damaging pore pressure, frost, fire) for some ideal porous materials can be determined theoretically only...... from knowing about pore geometry, solid phase stiffness, and zero-porosity strength. Pore geometry is the very important common denominator which controls both both stiffness and strength.The accurate results obtained are finally used to suggest generalizations with respect to strength in general...

  15. Adenovirus E1A proteins direct subcellular redistribution of Nek9, a NimA-related kinase.

    Science.gov (United States)

    Pelka, Peter; Scimè, Anthony; Mandalfino, Christina; Joch, Monica; Abdulla, Parween; Whyte, Peter

    2007-07-01

    A monoclonal antibody raised against adenovirus E1A-associated cellular proteins recognized Nek9, a NimA-related protein kinase. Subcellular fractionation and immunofluorescence indicated that Nek9 was primarily cytoplasmic with a small portion located in the nucleus whereas E1A was primarily nuclear. Although co-immunoprecipitation experiments indicated that nuclear Nek9 interacted, directly or indirectly, with E1A, the major effect of E1A was to diminish the amount of Nek9 in the nucleus suggesting that E1A alters the subcellular distribution of Nek9 and that the interaction is transient. A Nek9 deletion mutant lacking a central RCC1-like domain interacted stably with E1A and accumulated in the nucleus in the presence of E1A, possibly representing an intermediate stage of the normally transient Nek9/E1A interaction. The interaction of Nek9 with E1A was dependent on the N-terminal sequences of E1A. Attempts to stably overexpress either Nek9 or the kinase-inactive mutant in various cell lines were unsuccessful; however, the presence of E1A allowed stable overexpression of both proteins. These results suggest that E1A disrupts a nuclear function of Nek9.

  16. Study of gamma-ray strength functions

    Energy Technology Data Exchange (ETDEWEB)

    Gardner, D.G.; Gardner, M.A.; Dietrich, F.S.

    1980-08-07

    The use of gamma-ray strength function systematics to calculate neutron capture cross sections and capture gamma-ray spectra is discussed. The ratio of the average capture width, GAMMA/sub ..gamma../-bar, to the average level spacing, D/sub obs/, both at the neutron separation energy, can be derived from such systematics with much less uncertainty than from separate systematics for values of GAMMA/sub ..gamma../-bar and D/sub obs/. In particular, the E1 gamma-ray strength function is defined in terms of the giant dipole resonance (GDR). The GDR line shape is modeled with the usual Lorentzian function and also with a new energy-dependent, Breit-Wigner (EDBW) function. This latter form is further parameterized in terms of two overlapping resonances, even for nuclei where photonuclear measurements do not resolve two peaks. In the mass ranges studied, such modeling is successful for all nuclei away from the N = 50 closed neutron shell. Near the N = 50 shell, a one-peak EDBW appears to be more appropriate. Examples of calculated neutron capture excitation functions and capture gamma-ray spectra using the EDBW form are given for target nuclei in the mass-90 region and also in the Ta-Au mass region. 20 figures.

  17. Radiation hardening of diagnostics

    Science.gov (United States)

    Siemon, R. E.

    The world fusion program has advanced to the stage where it is appropriate to construct a number of devices for the purpose of burning DT fuel. In these next-generation experiments, the expected flux and fluence of 14 MeV neutrons and associated gamma rays will pose a significant challenge to the operation and diagnostics of the fusion device. Radiation effects include structural damage to materials such as vacuum windows and seals, modifications to electrical properties such as electrical conductivity and dielectric strength and impaired optical properties such as reduced transparency and luminescence of windows and fiber optics during irradiation. In preparation for construction and operation of these new facilities, the fusion diagnostics community needs to work with materials scientists to develop a better understanding of radiation effects, and to undertake a testing program aimed at developing workable solutions for this multi-faceted problem. A unique facility to help in this regard is the Los Alamos Spallation Radiation Effects Facility, a neutron source located at the beam stop of the world's most powerful accelerator, the Los Alamos Meson Physics Facility (LAMPF). The LAMPF proton beam generates 10(exp 16) neutrons per second because of spallation'reactions when the protons collide with the copper nuclei in the beam stop.

  18. Water's Hydrogen Bond Strength

    CERN Document Server

    Chaplin, Martin

    2007-01-01

    Water is necessary both for the evolution of life and its continuance. It possesses particular properties that cannot be found in other materials and that are required for life-giving processes. These properties are brought about by the hydrogen bonded environment particularly evident in liquid water. Each liquid water molecule is involved in about four hydrogen bonds with strengths considerably less than covalent bonds but considerably greater than the natural thermal energy. These hydrogen bonds are roughly tetrahedrally arranged such that when strongly formed the local clustering expands, decreasing the density. Such low density structuring naturally occurs at low and supercooled temperatures and gives rise to many physical and chemical properties that evidence the particular uniqueness of liquid water. If aqueous hydrogen bonds were actually somewhat stronger then water would behave similar to a glass, whereas if they were weaker then water would be a gas and only exist as a liquid at sub-zero temperature...

  19. Ad E1A 243R oncoprotein promotes association of proto-oncogene product MYC with the NuA4/Tip60 complex via the E1A N-terminal repression domain.

    Science.gov (United States)

    Zhao, Ling-Jun; Loewenstein, Paul M; Green, Maurice

    2016-12-01

    The adenovirus E1A 243R oncoprotein targets TRRAP, a scaffold protein that assembles histone acetyltransferase (HAT) complexes, such as the NuA4/Tip60 complex which mediates transcriptional activity of the proto-oncogene MYC and helps determine the cancer cell phenotype. How E1A transforms cells through TRRAP remains obscure. We performed proteomic analysis with the N-terminal transcriptional repression domain of E1A 243R (E1A 1-80) and showed that E1A 1-80 interacts with TRRAP, p400, and three other members of the NuA4 complex - DMAP1, RUVBL1 and RUVBL2 - not previously shown to associate with E1A 243R. E1A 1-80 interacts with these NuA4 components and MYC through the E1A TRRAP-targeting domain. E1A 243R association with the NuA4 complex was demonstrated by co-immunoprecipitation and analysis with DMAP1, Tip60, and MYC. Significantly, E1A 243R promotes association of MYC/MAX with the NuA4/Tip60 complex, implicating the importance of the MYC/NuA4 pathway in cellular transformation by both MYC and E1A. Copyright © 2016 Elsevier Inc. All rights reserved.

  20. Brain radiation - discharge

    Science.gov (United States)

    Radiation - brain - discharge; Cancer-brain radiation; Lymphoma - brain radiation; Leukemia - brain radiation ... Decadron) while you are getting radiation to the brain. It may make you hungrier, cause leg swelling ...

  1. Radiation Therapy (For Parents)

    Science.gov (United States)

    ... Giving Teens a Voice in Health Care Decisions Radiation Therapy KidsHealth > For Parents > Radiation Therapy Print A ... have many questions and concerns about it. About Radiation Therapy In radiation therapy, high-energy radiation from ...

  2. Abdominal radiation - discharge

    Science.gov (United States)

    Radiation - abdomen - discharge; Cancer - abdominal radiation; Lymphoma - abdominal radiation ... When you have radiation treatment for cancer, your body goes through changes. About 2 weeks after radiation treatment starts, you might notice changes ...

  3. Scattering by an electromagnetic radiation field

    OpenAIRE

    Bini, Donato; Geralico, Andrea

    2014-01-01

    Motion of test particles in the gravitational field associated with an electromagnetic plane wave is investigated. The interaction with the radiation field is modeled by a force term {\\it \\`a la} Poynting-Robertson entering the equations of motion given by the 4-momentum density of radiation observed in the particle's rest frame with a multiplicative constant factor expressing the strength of the interaction itself. Explicit analytical solutions are obtained. Scattering of fields by the elect...

  4. Radiation myelopathy

    Energy Technology Data Exchange (ETDEWEB)

    Sutherland, I.A.; Myers, S.J.

    1976-02-01

    Myelopathy secondary to radiation is a relatively uncommon entity which was reported initially in 1941 by Ahlbom. From a total of 65 patients who were seen in our spinal injury clinic during the past four years, three patients have received a diagnosis of radiation myelopathy. This is 4.6 percent of the total number. The case histories of two patients with radiation myelopathy are presented. The clinical and pathologic features are discussed. Since the three patients with this diagnosis whose cases are followed in the clinic are still alive, the second case that is reported is taken from the files of the pathology department so that autopsy and histologic data also can be presented.

  5. Sonochemical synthesis of novel pyrano[3,4-e][1,3]oxazines: A green protocol.

    Science.gov (United States)

    Saleh, Tamer S; Al-Bogami, Abdullah S; Mekky, Ahmed E M; Alkhathlan, Hamad Z

    2017-05-01

    The atom-efficient and green protocol for formation of pyrano[3,4-e][1,3]oxazines utilizing dimethyl carbonate under ultrasound irradiation in a presence of KF/basic alumina was reported. We provide a novel series of pyrano[3,4-e][1,3]oxazine derivatives interesting for biological screening tests. In general, it was found that ultrasound irradiations enable the reactions to occur which could not be carried out under silent conditions. These remarkable effects appeared in sonicated reactions can be reasonably interpreted in terms of acoustic cavitation phenomenon. Structures of the products were established on analytical and spectral data. This protocol offers several advantages attain many principles of green chemistry including, save energy, atom economy, clean reactions, inexpensive green reagent and use catalysts rather than stoichiometric reagents. Copyright © 2016 Elsevier B.V. All rights reserved.

  6. Directional radiation detectors

    Energy Technology Data Exchange (ETDEWEB)

    Dowell, Jonathan L.

    2017-09-12

    Directional radiation detectors and systems, methods, and computer-readable media for using directional radiation detectors to locate a radiation source are provided herein. A directional radiation detector includes a radiation sensor. A radiation attenuator partially surrounds the radiation sensor and defines an aperture through which incident radiation is received by the radiation sensor. The aperture is positioned such that when incident radiation is received directly through the aperture and by the radiation sensor, a source of the incident radiation is located within a solid angle defined by the aperture. The radiation sensor senses at least one of alpha particles, beta particles, gamma particles, or neutrons.

  7. Ultrasound associated uptake of chitosan nanoparticles in MC3T3-E1 cells

    Science.gov (United States)

    Wu, Junyi

    Chitosan is a natural linear polysaccharide that has been well known for its applications in drug delivery system due to its unique physicochemical and biological properties. However, challenges still remain for it to become a fully realized therapeutic agent. In this study, we investigated the uptake of chitosan nanoparticles (CNP) under the ultrasound stimulation, using a model cell culture system (MC3T3-E1 mouse pre-osteoblasts). The CNP were fabricated by an ionic gelation method and were lyophilized prior to characterization and delivery to cells. Particle size and zeta potential were measured using Dynamic Light Scattering (DLS); the efficiency of chitosan complexation was measured using the ninhydrin assay. Cytotoxicity was examined by neutral red assay within 48 hours after delivery. The effect of ultrasound (US) on the efficiency of nanoparticle delivery to the MC3T3-E1 cells was examined at 1MHz and at either 1 or 2 W/cm2. Fluorescein isothiocyanate (FITC)-conjugated-CNP were used to visualize the internalized particles within the cytosol. The uptake of FITC-CNP exhibits a dose and time dependent effect, a strong FITC fluorescence was detected at the concentration of 500microg/mL under fluorescence microscope. Ultrasound assisted uptake of FITC-CNP performed a significant positive effect at 2W/cm2 with 60s of ultrasound exposure time. CNP displayed a slightly decrease in cell viability from 25microg/mL to 100microg/mL, while higher concentration of CNP facilitates the proliferation of MC3T3-E1 cells. Less than 10% of reduction in cell viability was observed for US at 1W/cm2 and 2W/cm2 with 30s and 60s of exposure time, which suggest a mild effect of US to MC3T3-E1 cell line.

  8. E1-catalyzed ubiquitin C-terminal amidation for the facile synthesis of deubiquitinase substrates.

    Science.gov (United States)

    Wang, Xiaoyan Aria; Kurra, Yadagiri; Huang, Ying; Lee, Yan-Jiun; Liu, Wenshe R

    2014-01-03

    Will Ub my partner? The ubiquitin (Ub)-activating enzyme (E1) was used to catalyze an amidation reaction to functionalize the C terminus of Ub with unique functional groups, such as thiol, azide, alkyne, and alkene groups, with high efficiency and yield (>90 %). These groups were then applied for the facile synthesis of fluorophore-conjugated ubiquitin and specifically conjugated diubiquitin substrates for deubiquitinases. Copyright © 2014 WILEY-VCH Verlag GmbH & Co. KGaA, Weinheim.

  9. A very simple and convenient synthesis of tosylethylene and (E)-1,2-ditosylethylene

    Energy Technology Data Exchange (ETDEWEB)

    Alonso, D.A.; Arques, A.; Najera, C.; Sansano, J.M. [Departamento Quimica Organica, Facultad de Ciencias, Universidad de Alicante (Spain)

    1995-12-31

    A two-steps procedure for the synthesis of p-totyl vinyl sulfone in 80% yield by reaction of sodium p-toluenesulfinate with 1-bromo-2-chloro ethane followed by in situ dehydrochlorination with triethylamine is described. Iodosulfonylation of p-totyl vinyl sulfone with tosyl iodine and further in situ dehydroiodination with trietylamine affords stereo selectively (E)-1,2-ditosylethylene in 70% overall yield. (Author) 11 refs.

  10. Negatively cooperative binding properties of human cytochrome P450 2E1 with monocyclic substrates.

    Science.gov (United States)

    Ping, Jie; Wang, Ya-Jun; Wang, Jing-Fang; Li, Xuan; Li, Yi-Xue; Hao, Pei

    2012-09-01

    Human CYP2E1 accounts for almost 2% of total CYP enzymes in the liver cells, and plays a crucial role in the metabolism of small molecular weight compounds. This enzyme is associated with the nearly 6% metabolisms of the currently clinical drugs. However, it is found that CYP2E1 has a non-hyperbolic kinetic profile that can not be explained by the common Michaelis-Menten mechanism. Further studies show that the non-hyperbolic kinetic behaviors are associated with multiple substrate binding, which is also known as the cooperative binding properties. However, the detailed mechanism for the cooperative binding is not clear by now. In this paper, we summarized the experimental and theoretical studies on the cooperative binding mechanism. Based on the structural analysis, a second substrate binding site is confirmed in human CYP2E1, which is located neither in the region near Leu103, Leu210 and Phe478, nor far from the active site. Additionally, two important residues Thr303 and Phe478 are also identified to be the key factors in the cooperative binding on the short-range and long-range effects, respectively. The former plays a crucial role in the positioning of substrates and in proton delivery to the active site; the latter is located between the substrate access channel and the active site, and exhibits directly effects on substrate access or on substrate positioning in the active site. All these points can provide useful information for the cooperative binding in human CYP2E1, revealing the detailed mechanism for the non-hyperbolic kinetic behaviors.

  11. Mouse Spermatocytes Express CYP2E1 and Respond to Acrylamide Exposure

    Science.gov (United States)

    Nixon, Belinda J.; Katen, Aimee L.; Stanger, Simone J.; Schjenken, John E.; Nixon, Brett; Roman, Shaun D.

    2014-01-01

    Metabolism of xenobiotics by cytochrome P450s (encoded by the CYP genes) often leads to bio-activation, producing reactive metabolites that interfere with cellular processes and cause DNA damage. In the testes, DNA damage induced by xenobiotics has been associated with impaired spermatogenesis and adverse effects on reproductive health. We previously reported that chronic exposure to the reproductive toxicant, acrylamide, produced high levels of DNA damage in spermatocytes of Swiss mice. CYP2E1 metabolises acrylamide to glycidamide, which, unlike acrylamide, readily forms adducts with DNA. Thus, to investigate the mechanisms of acrylamide toxicity in mouse male germ cells, we examined the expression of the CYP, CYP2E1, which metabolises acrylamide. Using Q-PCR and immunohistochemistry, we establish that CYP2E1 is expressed in germ cells, in particular in spermatocytes. Additionally, CYP2E1 gene expression was upregulated in these cells following in vitro acrylamide exposure (1 µM, 18 h). Spermatocytes were isolated and treated with 1 µM acrylamide or 0.5 µM glycidamide for 18 hours and the presence of DNA-adducts was investigated using the comet assay, modified to detect DNA-adducts. Both compounds produced significant levels of DNA damage in spermatocytes, with a greater response observed following glycidamide exposure. A modified comet assay indicated that direct adduction of DNA by glycidamide was a major source of DNA damage. Oxidative stress played a small role in eliciting this damage, as a relatively modest effect was found in a comet assay modified to detect oxidative adducts following glycidamide exposure, and glutathione levels remained unchanged following treatment with either compound. Our results indicate that the male germ line has the capacity to respond to xenobiotic exposure by inducing detoxifying enzymes, and the DNA damage elicited by acrylamide in male germ cells is likely due to the formation of glycidamide adducts. PMID:24788432

  12. Effects of 6-Hydroxyflavone on Osteoblast Differentiation in MC3T3-E1 Cells

    Directory of Open Access Journals (Sweden)

    Chien-Hung Lai

    2014-01-01

    Full Text Available Osteoblast differentiation plays an essential role in bone integrity. Isoflavones and some flavonoids are reported to have osteogenic activity and potentially possess the ability to treat osteoporosis. However, limited information concerning the osteogenic characteristics of hydroxyflavones is available. This study investigates the effects of various hydroxyflavones on osteoblast differentiation in MC3T3-E1 cells. The results showed that 6-hydroxyflavone (6-OH-F and 7-hydroxyflavone (7-OH-F stimulated ALP activity. However, baicalein and luteolin inhibited ALP activity and flavone showed no effect. Up to 50 μM of each compound was used for cytotoxic effects study; flavone, 6-OH-F, and 7-OH-F had no cytotoxicity on MC3T3-E1 cells. Moreover, 6-OH-F activated AKT and serine/threonine kinases (also known as protein kinase B or PKB, extracellular signal-regulated kinases (ERK 1/2, and the c-Jun N-terminal kinase (JNK signaling pathways. On the other hand, 7-OH-F promoted osteoblast differentiation mainly by activating ERK 1/ 2 signaling pathways. Finally, after 5 weeks of 6-OH-F induction, MC3T3-E1 cells showed a significant increase in the calcein staining intensity relative to merely visible mineralization observed in cells cultured in the osteogenic medium only. These results suggested that 6-OH-F could activate AKT, ERK 1/2, and JNK signaling pathways to effectively promote osteoblastic differentiation.

  13. Comparison of chlorzoxazone one-sample methods to estimate CYP2E1 activity in humans

    DEFF Research Database (Denmark)

    Kramer, Iza; Dalhoff, Kim; Clemmesen, Jens O

    2003-01-01

    OBJECTIVE: Comparison of a one-sample with a multi-sample method (the metabolic fractional clearance) to estimate CYP2E1 activity in humans. METHODS: Healthy, male Caucasians ( n=19) were included. The multi-sample fractional clearance (Cl(fe)) of chlorzoxazone was compared with one-time-point cl......OBJECTIVE: Comparison of a one-sample with a multi-sample method (the metabolic fractional clearance) to estimate CYP2E1 activity in humans. METHODS: Healthy, male Caucasians ( n=19) were included. The multi-sample fractional clearance (Cl(fe)) of chlorzoxazone was compared with one......-time-point clearance estimation (Cl(est)) at 3, 4, 5 and 6 h. Furthermore, the metabolite/drug ratios (MRs) estimated from one-time-point samples at 1, 2, 3, 4, 5 and 6 h were compared with Cl(fe). RESULTS: The concordance between Cl(est) and Cl(fe) was highest at 6 h. The minimal mean prediction error (MPE) of Cl......-dose-sample estimates, Cl(est) at 3 h or 6 h, and MR at 3 h, can serve as reliable markers of CYP2E1 activity. The one-sample clearance method is an accurate, renal function-independent measure of the intrinsic activity; it is simple to use and easily applicable to humans....

  14. Ovarian Hormone Estrone Glucuronide (E1G) quantification-impedimetric electrochemical spectroscopy approach

    KAUST Repository

    Zia, Asif I.

    2013-12-01

    A study was conducted on detection and concentration measurement of estrone glucuronide (E1G), an important metabolite of the ovarian hormone estradiol, by using Electrochemical Impedance Spectroscopy (EIS) technique. A miniature planar Inter-digital (ID) capacitive sensor fabricated on single crystal silicon substrate with sputtered gold electrodes coupled with EIS was used to measure conductivity, permeability and dielectric properties of the said hormone metabolite. A thin film of Silicon Nitride (50 um) was coated on the sensor as passivation layer to avoid Faradic currents through the sensor. Impedance spectrums were obtained with various concentrations of E1G in buffer solution by exposing the samples to electrical perturbations at certain frequency range. Relationship of sample conductance with E1G concentration was studied on basis Randle\\'s equivalent circuit model and results were analyzed to deduce Constant Phase Equivalent (CPE) Circuit model in order to evaluate the double layer capacitance produced at the solution-electrode interface due to kinetic processes taking place in the electrochemical cell. The sensitivity of the sensor was evaluated against concentration. The result analysis confirmed that fabricated ID sensor together with EIS can provide a rapid and successful low cost sensing system which can help a lay user to determine peak time for feminine reproductive fertility at home without submitting samples for an expensive and time consuming laboratory test. © 2013 IEEE.

  15. Bacteriocin synthesis in uropathogenic and commensal Escherichia coli: colicin E1 is a potential virulence factor

    Directory of Open Access Journals (Sweden)

    Vališová Zuzana

    2010-11-01

    Full Text Available Abstract Background Bacteriocin production is an important characteristic of E. coli strains of human origin. To date, 26 colicin and 9 microcin types have been analyzed on a molecular level allowing molecular detection of the corresponding genes. The production incidence of 29 bacteriocin types and E. coli phylogroups were tested in a set of 361 E. coli strains isolated from human urinary tract infections (UTI and in 411 control strains isolated from feces of patients without bacterial gut infection. Results Production of 17 and 20 individual bacteriocin types was found in the UTI and control strains, respectively. Microcin H47 encoding determinants were found more often among UTI strains compared to controls (37.9% and 27.0% respectively, p = 0.02 and strains producing microcin H47 belonged predominantly to phylogroup B2 when compared to other bacteriocin producers (67.4% and 36.7%, respectively; p vice versa suggesting that pColE1 was independently associated with pColIa in UTI strains. Conclusion E. coli strains isolated from human urinary tract infections showed increased incidence of microcin H47 and colicin E1 production, respectively. Moreover, colicin E1 itself appears to be a potentially important virulence factor of certain uropathogenic E. coli strains.

  16. Effects of nicotine on cytochrome P450 2A6 and 2E1 activities

    Science.gov (United States)

    Hukkanen, Janne; Jacob, Peyton; Peng, Margaret; Dempsey, Delia; Benowitz, Neal L

    2010-01-01

    AIMS Smoking slows the metabolism of nicotine and accelerates the metabolism of chlorzoxazone, which are probe reactions for cytochrome P450 2A6 (CYP2A6) and CYP2E1 activities, respectively. We aimed to determine the role of nicotine in these metabolic effects of cigarette smoking. METHODS The study had a single-blind, randomized, crossover two-arm design. Twelve healthy smokers were given two transdermal patches with 42-mg nicotine a day or placebo patches, each for 10 days. The subjects abstained from smoking during the study arms. Oral chlorzoxazone was given on day 7 and deuterium-labelled nicotine-d2 and cotinine-d4 infusion on day 8. RESULTS There was no significant influence of transdermal nicotine administration on pharmacokinetic parameters of nicotine-d2 or on the formation of cotinine-d2. Nicotine decreased the volume of distribution (62.6 vs. 67.7 l, 95% confidence interval of the difference −9.7, −0.6, P= 0.047) of infused cotinine-d4. There were no significant differences in disposition kinetics of chlorzoxazone between the treatments. CONCLUSIONS CYP2A6 and CYP2E1 activities are not affected by nicotine. The tobacco smoke constituents responsible for the reduced CYP2A6 and increased CYP2E1 activities remain unknown. PMID:20233178

  17. In vivo and in vitro characterization of CYP2E1 activity in Japanese and Caucasians.

    Science.gov (United States)

    Kim, R B; Yamazaki, H; Chiba, K; O'Shea, D; Mimura, M; Guengerich, F P; Ishizaki, T; Shimada, T; Wilkinson, G R

    1996-10-01

    Chlorzoxazone's disposition after oral administration was determined in 20 young healthy Caucasian men and a similar group of Japanese men. The drug's plasma concentrations were significantly higher and its rate of elimination slower in Japanese compared to Caucasian men. Accordingly, chlorzoxazone's oral clearance was smaller (40%) in Japanese men and a similar difference (30%) was still apparent after normalizing for body weight (3.74 +/- 1.23 versus 5.05 +/- 1.41 ml.min-1.kg-1, P relationships were found between measures of CYP2E1 activity, both in vivo and in vitro, and genomic polymorphisms in the CYP2E1 gene identified by Rsal/Pstl and Dral restriction fragment length polymorphisms. Collectively, these data show an interracial difference in CYP2E1 activity. Because this enzyme is importantly involved in the activation of environmental procarcinogens, such a difference may account, in part, for the lower rate of some cancers, e.g., lung cancer, in Japanese compared to Caucasians men.

  18. Ubiquitination independent of E1 and E2 enzymes by bacterial effectors

    Energy Technology Data Exchange (ETDEWEB)

    Qiu, Jiazhang; Sheedlo, Michael J.; Yu, Kaiwen; Tan, Yunhao; Nakayasu, Ernesto S.; Das, Chittaranjan; Liu, Xiaoyun; Luo, Zhao-Qing

    2016-04-06

    Signaling by ubiquitination regulates virtually every cellular process in eukaryotes. Covalent attachment of ubiquitin to a substrate is catalyzed by the E1, E2 and E3 three-enzyme cascade 1, which links the C terminus of ubiquitin via an isopeptide bond mostly to the ε-amino group of a lysine of the substrate. Given the essential roles of ubiquitination in the regulation of the immune system, it is not surprising that the ubiquitination network is a common target for diverse infectious agents 2. For example, many bacterial pathogens exploit ubiquitin signaling using virulence factors that function as E3 ligases, deubiquitinases 3 or as enzymes that directly attack ubiquitin 4. The bacterial pathogen Legionella pneumophila utilizes approximately 300 effectors that modulate diverse host processes to create a niche permissive for its replication in phagocytes 5. Here we demonstrate that members of the SidE effector family (SidEs) of L. pneumophila ubiquitinate multiple Rab small GTPases associated with the endoplasmic reticulum (ER). Moreover, we show that these proteins are capable of catalyzing ubiquitination without the need for the E1 and E2 enzymes. The E1/E2-independent ubiquitination catalyzed by these enzymes requires NAD but not ATP and Mg2+. A putative mono ADP-ribosyltransferase (mART) motif critical for the ubiquitination activity is also essential for the role of SidEs in intracellular bacterial replication in a protozoan host. These results establish that ubiquitination can be catalyzed by a single enzyme.

  19. A Canonical Password Strength Measure

    OpenAIRE

    Panferov, Eugene

    2015-01-01

    We notice that the "password security" discourse is missing the most fundamental notion of the "password strength" -- it was never properly defined. We propose a canonical definition of the "password strength", based on the assessment of the efficiency of a set of possible guessing attack. Unlike naive password strength assessments our metric takes into account the attacker's strategy, and we demonstrate the necessity of that feature. This paper does NOT advise you to include "at least three ...

  20. Commitee III.1 Ultimate Strength

    DEFF Research Database (Denmark)

    Jensen, Jørgen Juncher

    1997-01-01

    This report addresses the subject of ductile collapse of ships and offshore structures and their components due to buckling and excessive yielding under overload conditions. Consideration is given to load-deflection predictions for components with fabrication imperfections and in-service damage a...... and to the ultimate strength and post-ultimate behaviour of structural systems in order to identify the reserve strength. The effect of uncertainties in the modelling on the strength predictions is highlighted in two design examples....

  1. Airborne field strength monitoring

    Science.gov (United States)

    Bredemeyer, J.; Kleine-Ostmann, T.; Schrader, T.; Münter, K.; Ritter, J.

    2007-06-01

    In civil and military aviation, ground based navigation aids (NAVAIDS) are still crucial for flight guidance even though the acceptance of satellite based systems (GNSS) increases. Part of the calibration process for NAVAIDS (ILS, DME, VOR) is to perform a flight inspection according to specified methods as stated in a document (DOC8071, 2000) by the International Civil Aviation Organization (ICAO). One major task is to determine the coverage, or, in other words, the true signal-in-space field strength of a ground transmitter. This has always been a challenge to flight inspection up to now, since, especially in the L-band (DME, 1GHz), the antenna installed performance was known with an uncertainty of 10 dB or even more. In order to meet ICAO's required accuracy of ±3 dB it is necessary to have a precise 3-D antenna factor of the receiving antenna operating on the airborne platform including all losses and impedance mismatching. Introducing precise, effective antenna factors to flight inspection to achieve the required accuracy is new and not published in relevant papers yet. The authors try to establish a new balanced procedure between simulation and validation by airborne and ground measurements. This involves the interpretation of measured scattering parameters gained both on the ground and airborne in comparison with numerical results obtained by the multilevel fast multipole algorithm (MLFMA) accelerated method of moments (MoM) using a complex geometric model of the aircraft. First results will be presented in this paper.

  2. Strength of Chemical Bonds

    Science.gov (United States)

    Christian, Jerry D.

    1973-01-01

    Students are not generally made aware of the extraordinary magnitude of the strengths of chemical bonds in terms of the forces required to pull them apart. Molecular bonds are usually considered in terms of the energies required to break them, and we are not astonished at the values encountered. For example, the Cl2 bond energy, 57.00 kcal/mole, amounts to only 9.46 x 10(sup -20) cal/molecule, a very small amount of energy, indeed, and impossible to measure directly. However, the forces involved in realizing the energy when breaking the bond operate over a very small distance, only 2.94 A, and, thus, f(sub ave) approx. equals De/(r - r(sub e)) must be very large. The forces involved in dissociating the molecule are discussed in the following. In consideration of average forces, the molecule shall be assumed arbitrarily to be dissociated when the atoms are far enough separated so that the potential, relative to that of the infinitely separated atoms, is reduced by 99.5% from the potential of the molecule at the equilibrium bond length (r(sub e)) for Cl2 of 1.988 A this occurs at 4.928 A.

  3. Cancer Prevention: Distinguishing Strength of Evidence from Strength of Opinion

    Science.gov (United States)

    Barnett S. Kramer, MD, MPH, Associate Director for Disease Prevention and Director of the Office of Medical Applications of Research in the Office of Disease Prevention, Office of the Director, National Institutes of Health, Bethesda, MD, presented "Cancer Prevention: Distinguishing Strength of Evidence from Strength of Opinion".

  4. The adenovirus E1A N-terminal repression domain represses transcription from a chromatin template in vitro.

    Science.gov (United States)

    Loewenstein, Paul M; Wu, Shwu-Yuan; Chiang, Cheng-Ming; Green, Maurice

    2012-06-20

    The adenovirus repression domain of E1A 243R at the E1A N-terminus (E1A 1-80) transcriptionally represses genes involved in differentiation and cell cycle progression. E1A 1-80 represses transcription in vitro from naked DNA templates through its interaction with p300 and TFIID. E1A 1-80 can also interact with several chromatin remodeling factors and associates with chromatin in vivo. We show here that E1A 243R and E1A 1-80 can repress transcription from a reconstituted chromatin template in vitro. Temporal analysis reveals strong repression by E1A 1-80 when added at pre-activation, activation and early transcription stages. Interestingly, E1A 1-80 can greatly enhance transcription from chromatin templates, but not from naked DNA, when added at pre-initiation complex (PIC) formation and transcription-initiation stages. These data reveal a new dimension for E1A 1-80's interface with chromatin and may reflect its interaction with key players in PIC formation, p300 and TFIID, and/or possibly a role in chromatin remodeling. Copyright © 2012 Elsevier Inc. All rights reserved.

  5. Farnesoid X receptor regulates SULT1E1 expression through inhibition of PGC1α binding to HNF4α.

    Science.gov (United States)

    Wang, Shuai; Yuan, Xue; Lu, Danyi; Guo, Lianxia; Wu, Baojian

    2017-12-01

    Sulfotransferase 1E1 (SULT1E1, also known as estrogen sulfotransferase) plays an important role in metabolism and detoxification of many endogenous and exogenous compounds (e.g., estrogens and flavonoids). Here we aimed to assess the effects of farnesoid X receptor (FXR) activation on SULT1E1 expression, and to determine the mechanism thereof. Treatment with specific FXR agonists (i.e., GW4064 and CDCA) significantly decreased both mRNA and protein levels of SULT1E1 in HepG2 cells. This was accompanied by a decrease in the enzymatic activity. The inhibitory effect was potentiated by FXR overexpression but attenuated by FXR knockdown, confirming FXR-dependent regulation of SULT1E1. Surprisingly, direct regulation of SULT1E1 by FXR was unlikely because FXR did not bind to SULT1E1 promoter or enhancer as revealed by chromatin immunoprecipitation (ChIP). Interestingly, SULT1E1 regulation was abolished when HNF4α (hepatocyte nuclear factor 4α, a known activator of SULT1E1) was silenced, supporting a critical role for HNF4α in FXR regulation of SULT1E1. Furthermore, a combination of ChIP, luciferase reporter and co-immunoprecipitation assays showed that FXR inhibited HNF4α transactivation of SULT1E1 by suppressed binding of the co-activator PGC1α (peroxisome proliferator-activated receptor-γ coactivator 1α) to HNF4α. In conclusion, FXR transcriptionally regulates SULT1E1 through inhibition of PGC1α binding to HNF4α. Targeting the FXR-SULT1E1 axis may represent a promising approach for management of estrogen-related diseases. Copyright © 2017 Elsevier Inc. All rights reserved.

  6. 78 FR 15597 - Special Conditions: GE Aviation CT7-2E1 Turboshaft Engine Model

    Science.gov (United States)

    2013-03-12

    ... published on July 20, 2012 (77 FR 42677). We received six comments from European Aviation Safety Agency..., compressor, fan, and turbosupercharger rotor overspeed. In addition to the requirements of Sec. 33.27(b): (1) The turbine and compressor rotors must have sufficient strength to withstand the test conditions...

  7. Achievable field strength in reverberation chambers

    Directory of Open Access Journals (Sweden)

    N. Eulig

    2003-01-01

    Full Text Available Feldvariable Kammern (FVK, engl.: modestirred- chamber werden unter anderem für EMV-Störfestigkeitsprüfungen verwendet. Ein häufig genanntes Argument, das die Einführung dieser Kammern als normgerechte Prüfumgebung vorantreiben soll, ist eine hohe Feldstärke, die im Vergleich zu anderen Testumgebungen mit relativ moderaten HF-Leistungen erreicht werden kann. Besonders für sicherheitskritische Geräte, wie Komponenten aus der Avionik- oder KFZ-Industrie, sind heutzutage Testfeldstärken von mehreren 100 V/m notwendig. Derart hohe Feldstärken können in Umgebungen, die ein ebenes Wellenfeld erzeugen oder nachbilden, nur mit großen HFLeistungen generiert werden. Durch die Resonanzeigenschaften einer FVK können demgegenüber mit sehr viel weniger Leistung und damit Verstärkeraufwand vergleichbare Werte der Feldstärke erzeugt werden. Allerdings sinkt mit zunehmendem Volumen die erreichbare Feldstärke bei gleicher Speiseleistung. Idealerweise sollen Feldvariable Kammern bei möglichst niedrigen Frequenzen für EMVTests nutzbar sein, was jedoch ein großes Kammervolumen erfordert. Das Problem, bei niedrigen Frequenzen hohe Feldstärken erzeugen zu können, relativiert deshalb den Vorteil von FVKn gegenüber bekannten Testumgebungen bei niedrigen Testfrequenzen. Der Posterbeitrag erläutert, welche Feldstärken in verschieden großen Feldvariablen Kammern beim Einspeisen einer bestimmten hochfrequenten Leistung erreicht werden können. Anhand dieser Ergebnisse wird aufgezeigt, oberhalb welcher Grenzfrequenz eine Anwendung von FVKn nur sinnvoll erscheint. Mode-stirred chambers (MSCs can be used for radiated immunity tests in EMC testing. Advantageous compared to conventional test methods is the high field strength which can here be generated with less RF-Power. This point is often the main argument for pushing the standardization of MSCs as an other EMC testing environment. Especially for safety-critical electronic equipment like avionic or

  8. On microscopic theory of radiative nuclear reaction characteristics

    Energy Technology Data Exchange (ETDEWEB)

    Kamerdzhiev, S. P. [National Research Centre “Kurchatov Institute” (Russian Federation); Achakovskiy, O. I., E-mail: oachakovskiy@ippe.ru; Avdeenkov, A. V. [Institute for Physics and Power Engineering (Russian Federation); Goriely, S. [Institut d’Astronomie et d’Astrophysique (Belgium)

    2016-07-15

    A survey of some results in the modern microscopic theory of properties of nuclear reactions with gamma rays is given. First of all, we discuss the impact of Phonon Coupling (PC) on the Photon Strength Function (PSF) because it represents the most natural physical source of additional strength found for Sn isotopes in recent experiments that could not be explained within the standard HFB + QRPA approach. The self-consistent version of the Extended Theory of Finite Fermi Systems in the Quasiparticle Time Blocking Approximation is applied. It uses the HFB mean field and includes both the QRPA and PC effects on the basis of the SLy4 Skyrme force. With our microscopic E1 PSFs, the following properties have been calculated for many stable and unstable even–even semi-magic Sn and Ni isotopes as well as for double-magic {sup 132}Sn and {sup 208}Pb using the reaction codes EMPIRE and TALYS with several Nuclear Level Density (NLD) models: (1) the neutron capture cross sections; (2) the corresponding neutron capture gamma spectra; (3) the average radiative widths of neutron resonances. In all the properties considered, the PC contribution turned out to be significant, as compared with the standard QRPA one, and necessary to explain the available experimental data. The results with the phenomenological so-called generalized superfluid NLD model turned out to be worse, on the whole, than those obtained with the microscopic HFB + combinatorial NLD model. The very topical question about the M1 resonance contribution to PSFs is also discussed.Finally, we also discuss the modern microscopic NLD models based on the self-consistent HFB method and show their relevance to explain the experimental data as compared with the phenomenological models. The use of these self-consistent microscopic approaches is of particular relevance for nuclear astrophysics, but also for the study of double-magic nuclei.

  9. E1A expression dysregulates IL-8 production and suppresses IL-6 production by lung epithelial cells

    Directory of Open Access Journals (Sweden)

    Snoek Mieke

    2005-09-01

    Full Text Available Abstract Background The adenoviral protein E1A has been proposed to play a role in the pathophysiology of COPD, in particular by increasing IL-8 gene transcription of lung epithelial cells in response to cigarette smoke-constituents such as LPS. As IL-8 production is also under tight post-transcriptional control, we planned to study whether E1A affected IL-8 production post-transcriptionally. The production of IL-6 by E1A-positive cells had not been addressed and was studied in parallel. Based on our previous work into the regulation of IL-8 and IL-6 production in airway epithelial cells, we used the lung epithelial-like cell line NCI-H292 to generate stable transfectants expressing either E1A and/or E1B, which is known to frequently co-integrate with E1A. We analyzed IL-8 and IL-6 production and the underlying regulatory processes in response to LPS and TNF-α. Methods Stable transfectants were generated and characterized with immunohistochemistry, western blot and flow cytometry. IL-8 and IL-6 protein production was measured by ELISA. Levels of IL-8 and IL-6 mRNA were measured using specific radiolabeled probes. EMSA was used to assess transcriptional activation of relevant transcription factors. Post-transcriptional regulation of mRNA half-life was measured by Actinomycin D chase experiments. Results Most of the sixteen E1A-expressing transfectants showed suppression of IL-6 production, indicative of biologically active E1A. Significant but no uniform effects on IL-8 production, nor on transcriptional and post-transcriptional regulation of IL-8 production, were observed in the panel of E1A-expressing transfectants. E1B expression exerted similar effects as E1A on IL-8 production. Conclusion Our results indicate that integration of adenoviral DNA and expression of E1A and E1B can either increase or decrease IL-8 production. Furthermore, we conclude that expression of E1A suppresses IL-6 production. These findings question the unique role of E1

  10. Strength Training for Young Athletes.

    Science.gov (United States)

    Kraemer, William J.; Fleck, Steven J.

    This guide is designed to serve as a resource for developing strength training programs for children. Chapter 1 uses research findings to explain why strength training is appropriate for children. Chapter 2 explains some of the important physiological concepts involved in children's growth and development as they apply to developing strength…

  11. Loading Conditions and Longitudinal Strength

    DEFF Research Database (Denmark)

    Sørensen, Herman

    1995-01-01

    Methods for the calculation of the lightweight of the ship.Loading conditions satisfying draught, trim and intact stability requirements and analysis of the corresponding stillwater longitudinal strength.......Methods for the calculation of the lightweight of the ship.Loading conditions satisfying draught, trim and intact stability requirements and analysis of the corresponding stillwater longitudinal strength....

  12. Phase strength and super lattices

    Indian Academy of Sciences (India)

    Unknown

    Abstract. Powder XRD investigations on dotriacontane-decane and dotriacontane-decanol mixtures are made. Phase strength, phase separation and formation of superlattices are discussed. The role of tunnel-like defects is considered. Keywords. Hydrocarbons; mixtures; phase strength; tunnel-like defects; super lattices. 1.

  13. Effects of ethanol on CYP2E1 levels and related oxidative stress using a standard balanced diet.

    Science.gov (United States)

    Azzalis, Ligia A; Fonseca, Fernando L A; Simon, Karin A; Schindler, Fernanda; Giavarotti, Leandro; Monteiro, Hugo P; Videla, Luis A; Junqueira, Virgínia B C

    2012-07-01

    Expression of cytochrome P4502E1 (CYP2E1) is very much influenced by nutritional factors, especially carbohydrate consumption, and various results concerning the expression of CYP2E1 were obtained with a low-carbohydrate diet. This study describes the effects of ethanol treatment on CYP2E1 levels and its relationship with oxidative stress using a balanced standard diet to avoid low or high carbohydrate consumption. Rats were fed for 1, 2, 3, or 4 weeks a commercial diet plus an ethanol-sucrose solution. The results have shown that ethanol administration was associated with CYP2E1 induction and stabilization without related oxidative stress. Our findings suggest that experimental models with a low-carbohydrate/high-fat diet produce some undesirable CYP2E1 changes that are not present when a balanced standard diet is given.

  14. STRENGTH OF NANOMODIFIED HIGH-STRENGTH LIGHTWEIGHT CONCRETES

    Directory of Open Access Journals (Sweden)

    NOZEMTСEV Alexandr Sergeevich

    2013-02-01

    Full Text Available The paper presents the results of research aimed at development of nanomodified high-strength lightweight concrete for construction. The developed concretes are of low average density and high ultimate compressive strength. It is shown that to produce this type of concrete one need to use hollow glass and aluminosilicate microspheres. To increase the durability of adhesion between cement stone and fine filler the authors offer to use complex nanodimensinal modifier based on iron hydroxide sol and silica sol as a surface nanomodifier for hollow microspheres. It is hypothesized that the proposed modifier has complex effect on the activity of the cement hydration and, at the same time increases bond strength between filler and cement-mineral matrix. The compositions for energy-efficient nanomodified high-strength lightweight concrete which density is 1300…1500 kg/m³ and compressive strength is 40…65 MPa have been developed. The approaches to the design of high-strength lightweight concrete with density of less than 2000 kg/m³ are formulated. It is noted that the proposed concretes possess dense homogeneous structure and moderate mobility. Thus, they allow processing by vibration during production. The economic and practical implications for realization of high-strength lightweight concrete in industrial production have been justified.

  15. Strength properties of fly ash based controlled low strength materials.

    Science.gov (United States)

    Türkel, S

    2007-08-25

    Controlled low strength material (CLSM) is a flowable mixture that can be used as a backfill material in place of compacted soils. Flowable fill requires no tamping or compaction to achieve its strength and typically has a load carrying capacity much higher than compacted soils, but it can still be excavated easily. The selection of CLSM type should be based on technical and economical considerations for specific applications. In this study, a mixture of high volume fly ash (FA), crushed limestone powder (filler) and a low percentage of pozzolana cement have been tried in different compositions. The amount of pozzolana cement was kept constant for all mixes as, 5% of fly ash weight. The amount of mixing water was chosen in order to provide optimum pumpability by determining the spreading ratio of CLSM mixtures using flow table method. The shear strength of the material is a measure of the materials ability to support imposed stresses on the material. The shear strength properties of CLSM mixtures have been investigated by a series of laboratory tests. The direct shear test procedure was applied for determining the strength parameters Phi (angle of shearing resistance) and C(h) (cohesion intercept) of the material. The test results indicated that CLSM mixtures have superior shear strength properties compared to compacted soils. Shear strength, cohesion intercept and angle of shearing resistance values of CLSM mixtures exceeded conventional soil materials' similar properties at 7 days. These parameters proved that CLSM mixtures are suitable materials for backfill applications.

  16. Performance of new polymeric materials with high radiation resistance

    Energy Technology Data Exchange (ETDEWEB)

    Hill, D.J.T.; O`Donnell, J.H.; Pomery, P.J. [Univ. of Queensland, Brisbane (Australia)

    1994-12-31

    The resistance to radiation of polymeric materials with high modulus and strength, high service temperatures, high resistance to thermal oxidation, and high chemical resistance is evaluated. Different methods of assessment are considered, which require radiation doses from 0.01 to 10 MGy.

  17. ON SPACELIKE BIHARMONIC SLANT HELICES ACCORDING TO BISHOP FRAME IN THE LORENTZIAN GROUP OF RIGID MOTIONS E(1,1

    Directory of Open Access Journals (Sweden)

    Talat Körpınar

    2012-01-01

    Full Text Available In this paper, we study spacelike biharmonic slant helices according to Bishop frame in the Lorentzian group of rigid motions E(1,1. We characterize the spacelike biharmonic slant helices in terms of their curvatures in the Lorentzian group of rigid motions E(1,1. Finally, we obtain parametric equations of spacelike biharmonic slant helices according to Bishop frame in the Lorentzian group of rigid motions E(1,1.

  18. E1 density transitions from the low-energy deuteron photodisintegration

    Energy Technology Data Exchange (ETDEWEB)

    Lipparini, E.; Orlandini, G. (Trento Univ. (Italy). Dipartimento di Fisica)

    1982-01-18

    The dynamical dipole polarizability and transition density for the deuteron are studied in the Bethe-Peierls model for deuteron photodisintegration. In two limiting values of the frequency of the oscillating field, the transition density is shown to have simple forms corresponding to pure surface and a mixing of surface and volume deformations respectively. Predictions for the low-sub(q) behaviour of the E1 form factor are given. A unitary transformation for the evaluation of the static polarizability in heavier nuclei is suggested.

  19. Alternative forms of lethality in mitomycin C-induced bacteria carrying ColE1 plasmids

    OpenAIRE

    Suit, Joan L.; Fan, M.-L. Judy; Sabik, Joseph F.; Labarre, Robert; Luria, S. E.

    1983-01-01

    We have studied the physiological effects of mitomycin C induction on cells carrying ColE1 plasmids with differing configurations of three genes: the structural gene coding for colicin (cea), a gene responsible for mitomycin C lethality (kil) that we located as part of an operon with cea, and the immunity (imm) gene, which lies near cea but is not in the same operon. kil is close to or overlaps imm. When cea+ plasmids are present mitomycin C induction results in 100-fold or greater increases ...

  20. Occupational Survey Report. Ground Radio Communications, AFSC 2E1X3

    Science.gov (United States)

    2003-10-01

    analyzed the data, and wrote the final report. Mr. Tyrone Hill provided computer-programming support, and Ms. Dolores Navarro and Ms. Sherry Evans...AFSC 2E1X3 members selected military-related education and training opportunities and medical/ dental care for AD members as their second and third...TRAINING OPPORTUNITIES 52 2.52 55 2.49 50 2.34 MEDICAL/ DENTAL CARE FOR AD MEMBER 60 2.57 55 2.56 53 2.48 MEDICAL/ DENTAL CARE FOR FAMILY MEMBERS 48

  1. Effect of piperine on CYP2E1 enzyme activity of chlorzoxazone in healthy volunteers.

    Science.gov (United States)

    Bedada, Satish Kumar; Boga, Praveen Kumar

    2017-12-01

    1. The purpose of the present study was to investigate the effect of piperine (PIP) on CYP2E1 enzyme activity and pharmacokinetics of chlorzoxazone (CHZ) in healthy volunteers. 2. An open-label, two period, sequential study was conducted in 12 healthy volunteers. A single dose of PIP 20 mg was administered daily for 10 days during treatment phase. A single dose of CHZ 250 mg was administered during control and after treatment phases under fasting conditions. The blood samples were collected at predetermined time intervals after CHZ dosing and analyzed by HPLC. 3. Treatment with PIP significantly enhanced maximum plasma concentration (Cmax) (3.14-4.96 μg/mL), area under the curve (AUC) (10.46-17.78 μg h/mL), half life (T1/2) (1.26-1.82 h) and significantly decreased elimination rate constant (Kel) (0.57-0.41 h (-) (1)), apparent oral clearance (CL/F) (24.76-13.65 L/h) of CHZ when compared to control. In addition, treatment with PIP significantly decreased Cmax (0.22-0.15 μg/mL), AUC (0.94-0.68 μg h/mL), T1/2 (2.54-1.68 h) and significantly increased Kel (0.32-0.43 h (-) (1)) of 6-hydroxychlorzoxazone (6-OHCHZ) as compared to control. Furthermore, treatment with PIP significantly decreased metabolite to parent (6-OHCHZ/CHZ) ratios of Cmax, AUC, T1/2 and significantly increased Kel ratio of 6-OHCHZ/CHZ, which indicate the decreased formation of CHZ to 6-OHCHZ. 4. The results suggest that altered pharmacokinetics of CHZ might be attributed to PIP mediated inhibition of CYP2E1 enzyme, which indicate significant pharmacokinetic interaction present between PIP and CHZ. The inhibition of CYP2E1 by PIP may represent a novel therapeutic benefit for minimizing ethanol induced CYP2E1 enzyme activity and results in reduced hepatotoxicity of ethanol.

  2. Ethanol Induction of CYP2A5: Role of CYP2E1-ROS-Nrf2 Pathway

    Science.gov (United States)

    Lu, Yongke; Zhang, Xu Hannah

    2012-01-01

    Chronic ethanol consumption was previously shown to induce CYP2A5 in mice, and this induction of CYP2A5 by ethanol was CYP2E1 dependent. In this study, the mechanisms of CYP2E1-dependent ethanol induction of CYP2A5 were investigated. CYP2E1 was induced by chronic ethanol consumption to the same degree in wild-type (WT) mice and CYP2A5 knockout (Cyp2a5 –/–) mice, suggesting that unlike the CYP2E1-dependent ethanol induction of CYP2A5, ethanol induction of CYP2E1 is not CYP2A5 dependent. Microsomal ethanol oxidation was about 25% lower in Cyp2a5 –/– mice compared with that in WT mice, suggesting that CYP2A5 can oxidize ethanol although to a lesser extent than CYP2E1 does. CYP2A5 was induced by short-term ethanol consumption in human CYP2E1 transgenic knockin (Cyp2e1 –/– KI) mice but not in CYP2E1 knockout (Cyp2e1 –/–) mice. The redox-sensitive transcription factor nuclear factor-erythroid 2-related factor 2 (Nrf2) was also induced by acute ethanol in Cyp2e1 –/– KI mice but not in Cyp2e1 –/– mice. Ethanol induction of CYP2A5 in Nrf2 knockout (Nrf2 –/–) mice was lower compared with that in WT mice, whereas CYP2E1 induction by ethanol was comparable in WT and Nrf2 –/– mice. Antioxidants (N-acetyl-cysteine and vitamin C), which blocked oxidative stress induced by chronic ethanol in WT mice and acute ethanol in Cyp2e1 –/– KI mice, also blunted the induction of CYP2A5 and Nrf2 by ethanol but not the induction of CYP2E1 by ethanol. These results suggest that oxidative stress induced by ethanol via induction of CYP2E1 upregulates Nrf2 activity, which in turn regulates ethanol induction of CYP2A5. Results obtained from primary hepatocytes, mice gavaged with binge ethanol or fed chronic ethanol, show that Nrf2-regulated ethanol induction of CYP2A5 protects against ethanol-induced steatosis. PMID:22552773

  3. Characterization of papillomavirus E1 helicase mutants defective for interaction with the SUMO-conjugating enzyme Ubc9.

    Science.gov (United States)

    Fradet-Turcotte, Amélie; Brault, Karine; Titolo, Steve; Howley, Peter M; Archambault, Jacques

    2009-12-20

    The E1 helicase from BPV and HPV16 interacts with Ubc9 to facilitate viral genome replication. We report that HPV11 E1 also interacts with Ubc9 in vitro and in the yeast two-hybrid system. Residues in E1 involved in oligomerization (353-435) were sufficient for binding to Ubc9 in vitro, but the origin-binding and ATPase domains were additionally required in yeast. Nuclear accumulation of BPV E1 was shown previously to depend on its interaction with Ubc9 and sumoylation on lysine 514. In contrast, HPV11 and HPV16 E1 mutants defective for Ubc9 binding remained nuclear even when the SUMO pathway was inhibited. Furthermore, we found that K514 in BPV E1 and the analogous K559 in HPV11 E1 are not essential for nuclear accumulation of E1. These results suggest that the interaction of E1 with Ubc9 is not essential for its nuclear accumulation but, rather, depends on its oligomerization and binding to DNA and ATP.

  4. Space Radiation

    Energy Technology Data Exchange (ETDEWEB)

    Corliss, William R.

    1968-01-01

    This booklet discusses three kinds of space radiation, cosmic rays, Van Allen Belts, and solar plasma. Cosmic rays are penetrating particles that we cannot see, hear or feel, which come from distant stars. Van Allen Belts, named after their discoverer are great belts of protons and electrons that the earth has captured in its magnetic trap. Solar plasma is a gaseous, electrically neutral mixture of positive and negative ions that the sun spews out from convulsed regions on its surface.

  5. Radiation Engineering for Designers

    Science.gov (United States)

    Pellish, Jonathan A.

    2015-01-01

    This tutorial provides an overview of the natural space radiation environment, an introduction to radiation effect types, an overview of EEE parts selection, scrubbing, and radiation mitigation, and an introduction to radiation testing.

  6. Risk Factors: Radiation

    Science.gov (United States)

    Radiation of certain wavelengths, called ionizing radiation, has enough energy to damage DNA and cause cancer. Ionizing radiation includes radon, x-rays, gamma rays, and other forms of high-energy radiation.

  7. Acute Radiation Syndrome

    Science.gov (United States)

    ... Matters Information on Specific Types of Emergencies Acute Radiation Syndrome (ARS): A Fact Sheet for the Public ... is called the radiation dose. People exposed to radiation will get ARS only if: The radiation dose ...

  8. Chest radiation - discharge

    Science.gov (United States)

    Radiation - chest - discharge; Cancer - chest radiation; Lymphoma - chest radiation ... When you have radiation treatment for cancer, your body goes through changes. About 2 weeks after your first treatment: It may be hard ...

  9. Developing a Radiation Protection Hub

    Energy Technology Data Exchange (ETDEWEB)

    Hertel, Nolan E [ORNL

    2017-01-01

    The WARP report issued by the NCRP study committee estimates that in ten years there will be a human capital crisis across the radiation safety community. The ability to respond to this shortage will be amplified by the fact that many radiation protection (health physics) academic programs will find it difficult to justify their continued existence since they are low volume programs, both in terms of enrollment and research funding, compared to the research funding return and visibility of more highly subscribed and highly funded academic disciplines. In addition, across the national laboratory complex, radiation protection research groups have been disbanded or dramatically reduced in size. The loss of both of these national resources is being accelerated by low and uncertain government funding priorities. The most effective solution to this problem would be to form a consortium that would bring together the radiation protection research, academic and training communities. The goal of such a consortium would be to engage in research, education and training of the next generation of radiation protection professionals. Furthermore the consortium could bring together the strengths of different universities, national laboratory programs and other entities in a strategic manner to accomplish a multifaceted research, educational and training agenda. This vision would forge a working and funded relationship between major research universities, national labs, four-year degree institutes, technical colleges and other partners.

  10. Laser radiation bracket debonding

    Science.gov (United States)

    Dostálová, Tat'jana; Jelínková, Helena; Šulc, Jan; Koranda, Petr; Nemec, Michal; Racek, Jaroslav; Miyagi, Mitsunobu

    2008-02-01

    Ceramic brackets are an aesthetic substitute for conventional stainless steel brackets in orthodontic patients. However, ceramic brackets are more brittle and have higher bond strengths, which can lead to bracket breakage and enamel damage during classical type of debonding. This study examined the possibility of laser radiation ceramic brackets removing as well as the possible damage of a surface structure of hard dental tissue after this procedure. Two types of lasers were used for the experiments - a laser diode LIMO HLU20F400 generating a wavelength of 808 nm with the maximum output power 20W at the end of the fiber (core diameter 400 μm, numerical aperture 0.22). As a second source, a diode-pumped Tm:YAP laser system generating a wavelength of 1.9 μm, with up to 3.8 W maximum output power was chosen. For the investigation, extracted incisors with ceramic brackets were used. In both cases, laser radiation was applied for 0.5 minute at a maximum power of 1 W. Temperature changes of the irradiated tissue was registered by camera Electrophysics PV320. After the interaction experiment, the photo-documentation was prepared by the stereomicroscope Nikon SMZ 2T, Japan. The surface tissue analysis was processed in "low vacuum" (30 Pa) regime without desiccation. This technique was used to record back-scattered electron images. Selecting the appropriate laser, resin, and bracket combination can minimize risks of enamel degradation and make debonding more safe.

  11. Effects of different strength training frequencies on maximum strength, body composition and functional capacity in healthy older individuals.

    Science.gov (United States)

    Turpela, Mari; Häkkinen, Keijo; Haff, Guy Gregory; Walker, Simon

    2017-11-01

    There is controversy in the literature regarding the dose-response relationship of strength training in healthy older participants. The present study determined training frequency effects on maximum strength, muscle mass and functional capacity over 6months following an initial 3-month preparatory strength training period. One-hundred and six 64-75year old volunteers were randomly assigned to one of four groups; performing strength training one (EX1), two (EX2), or three (EX3) times per week and a non-training control (CON) group. Whole-body strength training was performed using 2-5 sets and 4-12 repetitions per exercise and 7-9 exercises per session. Before and after the intervention, maximum dynamic leg press (1-RM) and isometric knee extensor and plantarflexor strength, body composition and quadriceps cross-sectional area, as well as functional capacity (maximum 7.5m forward and backward walking speed, timed-up-and-go test, loaded 10-stair climb test) were measured. All experimental groups increased leg press 1-RM more than CON (EX1: 3±8%, EX2: 6±6%, EX3: 10±8%, CON: -3±6%, Ptraining frequency would induce greater benefit to maximum walking speed (i.e. functional capacity) despite a clear dose-response in dynamic 1-RM strength, at least when predominantly using machine weight-training. It appears that beneficial functional capacity improvements can be achieved through low frequency training (i.e. 1-2 times per week) in previously untrained healthy older participants. Copyright © 2017 Elsevier Inc. All rights reserved.

  12. Unusual dielectric strength of Debye relaxation in monohydroxy alcohols upon mixing.

    Science.gov (United States)

    Gong, Hongxiang; Chen, Zeming; Bi, Dongyang; Sun, Mingdao; Tian, Yongjun; Wang, Li-Min

    2012-09-20

    The dielectric strength of the Debye relaxation in the binary mixtures of two isomeric monohydroxy alcohols, 2-ethyl-1-butanol (2E1B) and 4-methyl-2-pentanol (4M2P), is studied at low temperature near glass transition. Enhanced dielectric strength is exhibited in the mixtures, remarkably different from the mixing behaviors of the structural (α-) relaxation of generic liquids. A similar result is observed when analyzing the dielectric data of the binary mixtures of 2-ethyl-1-hexanol and 2-methyl-1-butanol reported in an early study. The unusual behavior of the dielectric strength in the mixtures reveals a new feature of the Debye relaxation in monohydroxy alcohols. Yet, the calorimetric measurements of the glass transition temperature in 2E1B-4M2P mixtures show a distinct negative deviation from the ideal mixing law. The explanation of the Debye relaxation is discussed with the results.

  13. Sirtuin1 promotes osteogenic differentiation through downregulation of peroxisome proliferator-activated receptor γ in MC3T3-E1 cells

    Energy Technology Data Exchange (ETDEWEB)

    Qu, Bo [Department of Orthopaedics, Chengdu Military General Hospital, Chengdu 610083 (China); Ma, Yuan [Department of Neurosurgery, Chengdu Military General Hospital, Chengdu 610083 (China); Yan, Ming [Department of Orthopaedics, Xijing Hospital of The Fourth Military Medical University, Xi’an 710032 (China); Gong, Kai; Liang, Feng; Deng, Shaolin; Jiang, Kai; Ma, Zehui [Department of Orthopaedics, Chengdu Military General Hospital, Chengdu 610083 (China); Pan, Xianming, E-mail: xianmingpanxj@163.com [Department of Orthopaedics, Chengdu Military General Hospital, Chengdu 610083 (China)

    2016-09-09

    Osteoporosis is a skeletal disorder characterized by bone loss, resulting in architectural deterioration of the skeleton, decreased bone strength and an increased risk of fragility fractures. Strengthening osteogenesis is an effective way to relieve osteoporosis. Sirtuin1 (Sirt1) is a nicotinamide adenine dinucleotide (NAD{sup +})-dependent deacetylase, which is reported to be involved in improving osteogenesis. Sirt1 targets peroxisome proliferator-activated receptor γ (PPARγ) in the regulation of adipose tissues; however, the molecular mechanism of Sirt1 in osteogenic differentiation is still unknown. PPARγ tends to induce more adipogenic differentiation rather than osteogenic differentiation. Hence, we hypothesized that Sirt1 facilitates osteogenic differentiation through downregulation of PPARγ signaling. Mouse pre-osteoblastic MC3T3-E1 cells were cultured under osteogenic medium. Sirt1 was overexpressed through plasmid transfection. The results showed that high expression of Sirt1 was associated with increased osteogenic differentiation, as indicated by quantitative PCR and Western blot analysis of osteogenic markers, and Von Kossa staining. Sirt1 overexpression also directly and negatively regulated the expression of PPARγ and its downstream molecules. Use of the PPARγ agonist Rosiglitazone, reversed the effects of Sirt1 on osteogenic differentiation. Using constructed luciferase plasmids, we demonstrated a role of Sirt1 in inhibiting PPARγ–induced activity and expression of adipocyte–specific genes, including acetyl-coenzyme A carboxylase (Acc) and fatty acid binding protein 4 (Fabp4). The interaction between Sirt1 and PPARγ was further confirmed using co-immunoprecipitation analysis. Together, these results reveal a novel mechanism for Sirt1 in osteogenic differentiation through downregulation of PPARγ activity. These findings suggest that the Sirt1–PPARγ pathway may represent a potential target for enhancement of osteogenesis and treatment

  14. Electromagnetic radiation by quark-gluon plasma in magnetic field

    OpenAIRE

    Tuchin, Kirill

    2012-01-01

    The electromagnetic radiation by quark-gluon plasma in strong magnetic field is calculated. The contributing processes are synchrotron radiation and one--photon annihilation. It is shown that in relativistic heavy--ion collisions at RHIC and LHC synchrotron radiation dominates over the annihilation. Moreover, it constitutes a significant part of all photons produced by the plasma at low transverse momenta; its magnitude depends on the plasma temperature and the magnetic field strength. Electr...

  15. A cascading activity-based probe sequentially targets E1-E2-E3 ubiquitin enzymes.

    Science.gov (United States)

    Mulder, Monique P C; Witting, Katharina; Berlin, Ilana; Pruneda, Jonathan N; Wu, Kuen-Phon; Chang, Jer-Gung; Merkx, Remco; Bialas, Johanna; Groettrup, Marcus; Vertegaal, Alfred C O; Schulman, Brenda A; Komander, David; Neefjes, Jacques; El Oualid, Farid; Ovaa, Huib

    2016-07-01

    Post-translational modifications of proteins with ubiquitin (Ub) and ubiquitin-like modifiers (Ubls), orchestrated by a cascade of specialized E1, E2 and E3 enzymes, control a wide range of cellular processes. To monitor catalysis along these complex reaction pathways, we developed a cascading activity-based probe, UbDha. Similarly to the native Ub, upon ATP-dependent activation by the E1, UbDha can travel downstream to the E2 (and subsequently E3) enzymes through sequential trans-thioesterifications. Unlike the native Ub, at each step along the cascade, UbDha has the option to react irreversibly with active site cysteine residues of target enzymes, thus enabling their detection. We show that our cascading probe 'hops' and 'traps' catalytically active Ub-modifying enzymes (but not their substrates) by a mechanism diversifiable to Ubls. Our founder methodology, amenable to structural studies, proteome-wide profiling and monitoring of enzymatic activity in living cells, presents novel and versatile tools to interrogate Ub and Ubl cascades.

  16. Molecular epidemiology of Chikungunya virus: mutation in E1 gene region.

    Science.gov (United States)

    Singh, Rishi K; Tiwari, Sarika; Mishra, Virendra K; Tiwari, Ruchi; Dhole, Tapan N

    2012-11-01

    Chikungunya virus is a mosquito-transmitted RNA virus and emerging as a pathogen that has a major public health impact because of the high morbidity including high fever, headache, rash, nausea, vomiting, myalgia, arthralgia with or without neurological manifestation or fulminant hepatitis. One hundred fifty-one patient samples were analyzed during the years 2006-2008, and compared conventional tests and CCRT-PCR (cell culture RT PCR). The conventional tests included ELISA, inoculation into C6/36 cell line and CPE were examined by PCR after RNA extraction. A total of 20/151 (13.2%), 8/151 (5.29%) and 7/151 (4.6%) samples were found to be positive by ELISA, cell culture and PCR, respectively. While 7/20 (35%) of the samples were positive by CCRT_PCR when ELISA 20 positive samples were detected. A total of 5/7 positive strains were sequenced in the E1 gene region. Remarkable changes (M269V, D284E, P294L, S295F, A316V, V322A, and C328W) were observed in the membrane fusion glycoprotein E1. These unique molecular features of the isolates with the continuing epidemic demonstrated high evolutionary potential and thereby indicating higher virulence. Copyright © 2012 Elsevier B.V. All rights reserved.

  17. [Genetic polymorphism of cytochrome P450 2E1 and the risk of nasopharyngeal carcinoma].

    Science.gov (United States)

    Ben Chaaben, Arij; Abaza, Hajer; Douik, Hayet; Chaouch, Leila; Ayari, Fayza; Ouni, Nesrine; Mamoghli, Tasnim; Ben Guezella, Dorra; Mejri, Rachida; Harzallah, Latifa; Guemira, Fethi

    2015-12-01

    Cytochrome P450 2E1 (CYP2E1) is a detoxifying enzyme that belongs to the phase I metabolism of xenobiotics. This enzyme is encoded by a highly polymorphic gene whose common polymorphism corresponds to the substitution of cytosine (C) and thymine (T) at position -1019 (rs2031920). This polymorphism has been identified in several cancers including nasopharyngeal cancer (NPC). The study involved 124 patients with nasopharyngeal carcinoma, compared with 166 healthy controls. The presence or absence of the polymorphism is determined by PCR-RFLP. The frequency comparison between the two groups is determined by the χ(2) test. The analysis of our results showed a significant difference between the two groups regarding the mutant genotype (C2/C2) (5% vs. 0.5%, P=0.04) and has a risk factor for NPC in Tunisia (OR=8.39; CI 95% [0.99-388.1]). Also, the C2 allele was significantly associated with the group of patients than the control group (6% vs. 2%, P=0.016) and increased three times the risk of NPC in Tunisia (OR=2.99, CI 95% [1.12-8.79]). Our results confirm the results reported in other populations and emphasize the importance of the involvement of this gene in the development of detoxification of the NPC, which seems more and more strongly associated with environmental factors. Copyright © 2015 Société Française du Cancer. Published by Elsevier Masson SAS. All rights reserved.

  18. Crystal structure of hyperthermophilic esterase EstE1 and the relationship between its dimerization and thermostability properties

    Directory of Open Access Journals (Sweden)

    Koh Eunhee

    2007-07-01

    Full Text Available Abstract Background EstE1 is a hyperthermophilic esterase belonging to the hormone-sensitive lipase family and was originally isolated by functional screening of a metagenomic library constructed from a thermal environmental sample. Dimers and oligomers may have been evolutionally selected in thermophiles because intersubunit interactions can confer thermostability on the proteins. The molecular mechanisms of thermostabilization of this extremely thermostable esterase are not well understood due to the lack of structural information. Results Here we report for the first time the 2.1-Å resolution crystal structure of EstE1. The three-dimensional structure of EstE1 exhibits a classic α/β hydrolase fold with a central parallel-stranded beta sheet surrounded by alpha helices on both sides. The residues Ser154, Asp251, and His281 form the catalytic triad motif commonly found in other α/β hydrolases. EstE1 exists as a dimer that is formed by hydrophobic interactions and salt bridges. Circular dichroism spectroscopy and heat inactivation kinetic analysis of EstE1 mutants, which were generated by structure-based site-directed mutagenesis of amino acid residues participating in EstE1 dimerization, revealed that hydrophobic interactions through Val274 and Phe276 on the β8 strand of each monomer play a major role in the dimerization of EstE1. In contrast, the intermolecular salt bridges contribute less significantly to the dimerization and thermostability of EstE1. Conclusion Our results suggest that intermolecular hydrophobic interactions are essential for the hyperthermostability of EstE1. The molecular mechanism that allows EstE1 to endure high temperature will provide guideline for rational design of a thermostable esterase/lipase using the lipolytic enzymes showing structural similarity to EstE1.

  19. SPAK and OSR1 Sensitive Cell Membrane Protein Abundance and Activity of KCNQ1/E1 K+ Channels

    Directory of Open Access Journals (Sweden)

    Bernat Elvira

    2015-11-01

    Full Text Available Background/Aims: KCNQ1/E1 channels are expressed in diverse tissues and serve a variety of functions including endolymph secretion in the inner ear, cardiac repolarization, epithelial transport and cell volume regulation. Kinases involved in regulation of epithelial transport and cell volume include SPAK (SPS1-related proline/alanine-rich kinase and OSR1 (oxidative stress-responsive kinase 1, which are under control of WNK (with-no-K[Lys] kinases. The present study explored whether KCNQ1/E1 channels are regulated by SPAK and/or OSR1. Methods: cRNA encoding KCNQ1/E1 was injected into Xenopus oocytes with or without additional injection of cRNA encoding wild-type SPAK, constitutively active T233ESPAK, WNK insensitive T233ASPAK, catalytically inactive D212ASPAK, wild-type OSR1, constitutively active T185EOSR1, WNK insensitive T185AOSR1 and catalytically inactive D164AOSR1. Voltage gated K+ channel activity was quantified utilizing dual electrode voltage clamp and KCNQ1/E1 channel protein abundance in the cell membrane utilizing chemiluminescence of KCNQ1/E1 containing an extracellular Flag tag epitope (KCNQ1-Flag/E1. Results: KCNQ1/E1 activity and KCNQ1-Flag/E1 protein abundance were significantly enhanced by wild-type SPAK and T233ESPAK, but not by T233ASPAK and D212ASPAK. Similarly, KCNQ1/E1 activity and KCNQ1-Flag/E1 protein abundance were significantly increased by wild-type OSR1 and T185EOSR1, but not by T185AOSR1 and D164AOSR1. Conclusions: SPAK and OSR1 participate in the regulation of KCNQ1/E1 protein abundance and activity.

  20. SPAK and OSR1 Sensitive Cell Membrane Protein Abundance and Activity of KCNQ1/E1 K+ Channels.

    Science.gov (United States)

    Elvira, Bernat; Warsi, Jamshed; Fezai, Myriam; Munoz, Carlos; Lang, Florian

    2015-01-01

    KCNQ1/E1 channels are expressed in diverse tissues and serve a variety of functions including endolymph secretion in the inner ear, cardiac repolarization, epithelial transport and cell volume regulation. Kinases involved in regulation of epithelial transport and cell volume include SPAK (SPS1-related proline/alanine-rich kinase) and OSR1 (oxidative stress-responsive kinase 1), which are under control of WNK (with-no-K[Lys]) kinases. The present study explored whether KCNQ1/E1 channels are regulated by SPAK and/or OSR1. cRNA encoding KCNQ1/E1 was injected into Xenopus oocytes with or without additional injection of cRNA encoding wild-type SPAK, constitutively active T233ESPAK, WNK insensitive T233ASPAK, catalytically inactive D212ASPAK, wild-type OSR1, constitutively active T185EOSR1, WNK insensitive T185AOSR1 and catalytically inactive D164AOSR1. Voltage gated K+ channel activity was quantified utilizing dual electrode voltage clamp and KCNQ1/E1 channel protein abundance in the cell membrane utilizing chemiluminescence of KCNQ1/E1 containing an extracellular Flag tag epitope (KCNQ1-Flag/E1). KCNQ1/E1 activity and KCNQ1-Flag/E1 protein abundance were significantly enhanced by wild-type SPAK and T233ESPAK, but not by T233ASPAK and D212ASPAK. Similarly, KCNQ1/E1 activity and KCNQ1-Flag/E1 protein abundance were significantly increased by wild-type OSR1 and T185EOSR1, but not by T185AOSR1 and D164AOSR1. SPAK and OSR1 participate in the regulation of KCNQ1/E1 protein abundance and activity. © 2015 S. Karger AG, Basel.

  1. Prediction of Torsional Strength for Very High Early Strength Geopolymer

    Directory of Open Access Journals (Sweden)

    Woraphot PRACHASAREE

    2017-11-01

    Full Text Available Very early high strength geopolymers are gaining acceptance as alternative repair materials for highways and other infrastructure. In this study, a very rapid geopolymer binder based on Metakaolin (MK and Parawood ash (PWA, developed by the authors, was experimentally tested and a prediction model for its torsional strength is proposed. The geopolymer samples were subjected to uniaxial compression, flexural beam, and torsion tests. The modulus of rupture and torsional strength in terms of compression strength were found to be well approximated by 0.7(f’c1/2 and 1/7(x2y (f’c1/2, respectively. Also an interaction relation to describe combined bending and torsion was developed in this study. In addition, the effects of aspect ratio (y/x were studied on both torsional strength and combined bending and torsion. It was found that an aspect ratio of y/x = 3 significantly reduced the torsional resistance, to about 50 % of the torsional strength of a square section.DOI: http://dx.doi.org/10.5755/j01.ms.23.4.17280

  2. Energy levels and radiative rates for Ne-like ions from Cu to Ga

    Indian Academy of Sciences (India)

    Similar calculations have also been performed using the fully relativistic flexible atomic code (FAC). Transition wavelength, oscillator strength, transition probabilities and line strength are reported for electric dipole (E1), electric quadrupole (E2), magnetic dipole (M1) and magnetic quadrupole (M2) transitions from the ...

  3. 26 CFR 1.1033(e)-1 - Sale or exchange of livestock solely on account of drought.

    Science.gov (United States)

    2010-04-01

    ... of drought. 1.1033(e)-1 Section 1.1033(e)-1 Internal Revenue INTERNAL REVENUE SERVICE, DEPARTMENT OF... Sale or exchange of livestock solely on account of drought. (a) The sale or exchange of livestock... if the sale or exchange of such livestock by the taxpayer is solely on account of drought. Section...

  4. Functional analysis of the C-terminal region of human adenovirus E1A reveals a misidentified nuclear localization signal

    Energy Technology Data Exchange (ETDEWEB)

    Cohen, Michael J.; King, Cason R.; Dikeakos, Jimmy D. [Department of Microbiology and Immunology, The University of Western Ontario, A4-833 London Regional Cancer Centre, 800 Commissioners Road E., London, Ontario, N6A 4L6 Canada (Canada); Mymryk, Joe S., E-mail: jmymryk@uwo.ca [Department of Microbiology and Immunology, The University of Western Ontario, A4-833 London Regional Cancer Centre, 800 Commissioners Road E., London, Ontario, N6A 4L6 Canada (Canada); Department of Oncology, The University of Western Ontario, London Regional Cancer Centre, Ontario (Canada)

    2014-11-15

    The immortalizing function of the human adenovirus 5 E1A oncoprotein requires efficient localization to the nucleus. In 1987, a consensus monopartite nuclear localization sequence (NLS) was identified at the C-terminus of E1A. Since that time, various experiments have suggested that other regions of E1A influence nuclear import. In addition, a novel bipartite NLS was recently predicted at the C-terminal region of E1A in silico. In this study, we used immunofluorescence microscopy and co-immunoprecipitation analysis with importin-α to verify that full nuclear localization of E1A requires the well characterized NLS spanning residues 285–289, as well as a second basic patch situated between residues 258 and 263 ({sup 258}RVGGRRQAVECIEDLLNEPGQPLDLSCKRPRP{sup 289}). Thus, the originally described NLS located at the C-terminus of E1A is actually a bipartite signal, which had been misidentified in the existing literature as a monopartite signal, altering our understanding of one of the oldest documented NLSs. - Highlights: • Human adenovirus E1A is localized to the nucleus. • The C-terminus of E1A contains a bipartite nuclear localization signal (NLS). • This signal was previously misidentified to be a monopartite NLS. • Key basic amino acid residues within this sequence are highly conserved.

  5. Hepatitis C Virus E1 and E2 Proteins Used as Separate Immunogens Induce Neutralizing Antibodies with Additive Properties.

    Directory of Open Access Journals (Sweden)

    Elodie Beaumont

    Full Text Available Various strategies involving the use of hepatitis C virus (HCV E1 and E2 envelope glycoproteins as immunogens have been developed for prophylactic vaccination against HCV. However, the ideal mode of processing and presenting these immunogens for effective vaccination has yet to be determined. We used our recently described vaccine candidate based on full-length HCV E1 or E2 glycoproteins fused to the heterologous hepatitis B virus S envelope protein to compare the use of the E1 and E2 proteins as separate immunogens with their use as the E1E2 heterodimer, in terms of immunogenetic potential and the capacity to induce neutralizing antibodies. The specific anti-E1 and anti-E2 antibody responses induced in animals immunized with vaccine particles harboring the heterodimer were profoundly impaired with respect to those in animals immunized with particles harboring E1 and E2 separately. Moreover, the anti-E1 and anti-E2 antibodies had additive neutralizing properties that increase the cross-neutralization of heterologous strains of various HCV genotypes, highlighting the importance of including both E1 and E2 in the vaccine for an effective vaccination strategy. Our study has important implications for the optimization of HCV vaccination strategies based on HCV envelope proteins, regardless of the platform used to present these proteins to the immune system.

  6. mUBC9, a novel adenovirus E1A-interacting protein that complements a yeast cell cycle defect

    NARCIS (Netherlands)

    Hateboer, G.; Hijmans, E. M.; Nooij, J. B. D.; Schlenker, S.; Jentsch, S.; Bernards, R.A.

    1996-01-01

    Adenovirus E1A encodes two nuclear phosphoproteins that can transform primary rodent fibroblasts in culture. Transformation by E1A is mediated at least in part through binding to several cellular proteins, including the three members of the retinoblastoma family of growth inhibitory proteins. We

  7. Strength training and shoulder proprioception

    National Research Council Canada - National Science Library

    Salles, José Inácio; Velasques, Bruna; Cossich, Victor; Nicoliche, Eduardo; Ribeiro, Pedro; Amaral, Marcus Vinicius; Motta, Geraldo

    2015-01-01

    .... To evaluate the result of an 8-week strength-training program on shoulder JPS and to verify whether using training intensities that are the same or divergent for the shoulder's dynamic-stabilizer...

  8. Muscle Strength and Poststroke Hemiplegia

    DEFF Research Database (Denmark)

    Kristensen, Otto H; Stenager, Egon; Dalgas, Ulrik

    2017-01-01

    OBJECTIVES: To systematically review (1) psychometric properties of criterion isokinetic dynamometry testing of muscle strength in persons with poststroke hemiplegia (PPSH); and (2) literature that compares muscle strength in patients poststroke with that in healthy controls assessed by criterion...... isokinetic dynamometry. DATA SOURCES: A systematic literature search of 7 databases was performed. STUDY SELECTION: Included studies (1) enrolled participants with definite poststroke hemiplegia according to defined criteria; (2) assessed muscle strength or power by criterion isokinetic dynamometry; (3) had...... undergone peer review; and (4) were available in English or Danish. DATA EXTRACTION: The psychometric properties of isokinetic dynamometry were reviewed with respect to reliability, validity, and responsiveness. Furthermore, comparisons of strength between paretic, nonparetic, and comparable healthy muscles...

  9. Strengths, weaknesses, opportunities and threats

    DEFF Research Database (Denmark)

    Bull, Joseph William; Jobstvogt, N.; Böhnke-Henrichs, A.

    2016-01-01

    The ecosystem services concept (ES) is becoming a cornerstone of contemporary sustainability thought. Challenges with this concept and its applications are well documented, but have not yet been systematically assessed alongside strengths and external factors that influence uptake. Such an assess......The ecosystem services concept (ES) is becoming a cornerstone of contemporary sustainability thought. Challenges with this concept and its applications are well documented, but have not yet been systematically assessed alongside strengths and external factors that influence uptake....... Such an assessment could form the basis for improving ES thinking, further embedding it into environmental decisions and management.The Young Ecosystem Services Specialists (YESS) completed a Strengths-Weaknesses-Opportunities-Threats (SWOT) analysis of ES through YESS member surveys. Strengths include the approach...

  10. Particle Strength of Bayer Hydrate

    Science.gov (United States)

    Anjier, J. L.; Marten, D. F. G.

    Because of the proposed use of fluid bed calciners at the Kaiser Aluminum Baton Rouge Works, studies into the strength of alumina and alumina trihydrate from eight different alumina plants were initiated. It was found in the course of these studies that the particle strength of Bayer hydrate depended on the precipitation process conditions under which it was produced. A series of laboratory precipitation tests was conducted to determine the effect on particle strength of process variables such as seed charge, temperature, caustic concentration and seed recycle. It is concluded from these studies that relative particle strength of alumina trihydrate, as measured by a modified Forsythe-Hertwig Apparatus, can be predicted from a knowledge of the precipitation process conditions.

  11. Relationship between the edgewise compression strength of ...

    African Journals Online (AJOL)

    The compression strength of a corrugated board box is a direct measure of its stacking strength. The edgewise compression strength of corrugated board is the major contributor to the box stacking strength. This relation can be further extended to the critical strength properties of paper substrates. It was, therefore, the aim of ...

  12. Crystal structure of (E-1-(4-chlorophenylethanone O-dehydroabietyloxime

    Directory of Open Access Journals (Sweden)

    Jian-Qiang Zheng

    2014-09-01

    Full Text Available The title compound, C28H34ClNO2 {systematic name: (E-1-(4-chlorophenylethanone O-[(1R,4aS,10aR-7-isopropyl-1,4a-dimethyl-1,2,3,4,4a,9,10,10a-octahydrophenanthrene-1-carbonyl]oxime}, was synthesized from dehydroabietic acid. In the dehydroabietyl moiety, the central and terminal cyclohexane rings display chair and half-chair conformations, respectively, and a trans-ring junction. The C=N bond is in an E conformation and the C—O—N=C torsion angle is 148.1 (5°. No directional interactions except van der Waals contacts occur in the crystal structure.

  13. Health sector response to security threats during the civil war in E1 Salvador.

    Science.gov (United States)

    Brentlinger, P. E.

    1996-01-01

    During the recent civil war in E1 Salvador, as in other modern wars, human rights abuses adversely affected health workers, patients, and medical facilities. The abuses themselves have been described in reports of human rights advocacy organisations but health sector adaptations to a hostile wartime environment have not. Agencies engaged in health work during the civil war adapted parties such as training of community based lay health workers, use of simple technology, concealment of patients and medical supplies, denunciation of human rights abuses, and multilevel negotiations in order to continue providing services. The Salvadorean experience may serve as a helpful case study for medical personnel working in wars elsewhere. Images p1471-a p1472-a p1473-a PMID:8973238

  14. Current status of the verification and processing system GALILÉE-1 for evaluated data

    Science.gov (United States)

    Coste-Delclaux, Mireille; Jouanne, Cédric; Moreau, Frédéric; Mounier, Claude; Visonneau, Thierry; Dolci, Florence

    2017-09-01

    This paper describes the current status of GALILÉE-1 that is the new verification and processing system for evaluated data, developed at CEA. It consists of various components respectively dedicated to read/write the evaluated data whatever the format is, to diagnose inconsistencies in the evaluated data and to provide continuous-energy and multigroup data as well as probability tables for transport and depletion codes. All these components are written in C+ + language and share the same objects. Cross-comparisons with other processing systems (NJOY, CALENDF or PREPRO) are systematically carried out at each step in order to fully master possible discrepancies. Some results of such comparisons are provided.

  15. Joint Tracking of Chang'E-1 with VLBI and USB

    Science.gov (United States)

    Hu, Xiaogong

    Chinese lunar exploration mission Chang'E-I made use of a Chinese Unified S-Band (USB) system and a network of four Very Long Baseline Interferometry (VLBI) antennas to meet the orbit determination/predication requirements of spacecraft tracking and scientific data analysis, which for the first time handled telemetry and control for a spacecraft at a distance of about 380,000 km. Chang'E-1 provided a perfect chance to quantify the contributions of VLBI to orbit determination/predication, and to test and evaluate the performance of the USB-VLBI joint system. We investigate in this paper the quality of the data and analyze the precision of orbit determination with different data arcs and data combinations during the 2-week journey from Earth to Chang'E-1's lunar mission orbit, using GEODYN II orbit determination software. The residuals of VLBI delay is about 3 ns (RMS, root-mean-squares), the residuals of VLBI delay-rate is about 0.6 ps/s, the residuals of ranging is about 1 2 m and Doppler is about 1 cm/s. Three flight phases are invistigated, namely 3 phasing orbits near Earth, the translunar trajectory and the lunar catputed orbits. We found including of VLBI data substantially improved orbit precision for short data arcs, therefore VLBI played an important role in assessing spacecraft manuvore performance. Given the differential nature of VLBI observables and their errors mostly from BBC's nonlinear phase-frequency responses, it appears for longer data arcs the VLBI contribution is relatively minor. We conclude that for Chang'E-I, the inclusion of VLBI data improved substantially the performance of orbit determination and prediction, even though the VLBI data acquisition and correlation imposes a major burden on data processing.

  16. Attenuation of prostaglandin E1‑induced osteoprotegerin synthesis in osteoblasts by normoxic HIF inducers.

    Science.gov (United States)

    Kuroyanagi, Gen; Tokuda, Haruhiko; Yamamoto, Naohiro; Kainuma, Shingo; Fujita, Kazuhiko; Ohguchi, Reou; Matsushima-Nishiwaki, Rie; Kozawa, Osamu; Otsuka, Takanobu

    2017-04-01

    Mimosine, which is a natural plant amino acid present in the Leucaena genus, is able to induce hypoxia‑inducible factors (HIFs). Previous evidence has indicated that HIF regulates angiogenesis‑osteogenesis coupling in bone metabolism, and it has previously been reported that mimosine inhibits prostaglandin (PG)F2α‑induced osteoprotegerin (OPG) synthesis without affecting interleukin‑6 (IL‑6) production in osteoblast‑like MC3T3‑E1 cells. In addition, PGE1 has been demonstrated to induce OPG synthesis via activation of p38 mitogen‑activated protein (MAP) kinase and stress‑activated protein kinase/c‑Jun N‑terminal kinase (SAPK/JNK) in these cells, and PGE1 stimulates IL‑6 production via the activation of protein kinase A. In the present study, the effects of mimosine on the PGE1‑stimulated synthesis of OPG and IL‑6 were investigated in osteoblast‑like MC3T3‑E1 cells. The concentrations of OPG and IL‑6 were measured using relevant ELISA kits. OPG mRNA was measured by semi‑quantitative reverse transcription polymerase chain reaction. The phosphorylation of p38 MAP kinase and SAPK/JNK was analyzed by western blotting. Mimosine significantly reduced PGE1‑induced release of OPG and OPG mRNA expression levels without affecting the release of IL‑6. In addition, deferoxamine, which is also a normoxic HIF inducer, significantly inhibited PGE1‑induced OPG release and OPG mRNA expression levels; however, it had little effect on IL‑6 release. Furthermore, mimosine and deferoxamine failed to affect PGE1‑stimulated phosphorylation of p38 MAP kinase or SAPK/JNK. These results strongly suggest that normoxic HIF inducers attenuate PGE1‑stimulated OPG synthesis without affecting IL‑6 production in osteoblasts.

  17. Radiation degradation of silk protein

    Energy Technology Data Exchange (ETDEWEB)

    Pewlong, W.; Sudatis, B. [Office of Atomic Energy for Peace, Bangkok (Thailand); Takeshita, Hidefumi; Yoshii, Fumio; Kume, Tamikazu [Japan Atomic Energy Research Inst., Takasaki, Gunma (Japan). Takasaki Radiation Chemistry Research Establishment

    2000-03-01

    Silk fibroin fiber from the domesticated silkworm Bombyx mori was irradiated using an electron beam accelerator to investigate the application of the radiation degradation technique as a means to solubilize fibroin. The irradiation caused a significant degradation of the fiber. The tensile strength of fibroin fiber irradiated up to 2500 kGy decreased rapidly with increasing dose. The presence of oxygen in the irradiation atmosphere enhanced degradation of the tensile strength. The solubilization of irradiated fibroin fiber was evaluated using the following three kinds of solutions: a calcium chloride solution(CaCl{sub 2}/C{sub 2}H{sub 5}OH/H{sub 2}O=1:2:8 in mole ratio), a hydrochloric acid (0.5 N) and a distilled water. Dissolution of fibroin fiber into these solutions was significantly enhanced by irradiation. Especially, an appreciable amount of water soluble proteins was extracted by a distilled water. (author)

  18. Molecular basis of maple syrup urine disease: Novel mutations at the E1[alpha] locus that impair E1([alpha][sub 2][beta][sub 2]) assembly or decrease steady-state E1[alpha] mRNA levels of branched-chain [alpha]-keto acid dehydrogenase complex

    Energy Technology Data Exchange (ETDEWEB)

    Chuang, J.L.; Fisher, C.R.; Chuang, D.T.; Cox, R.P. (Univ. of Texas Southwestern Medical Center, Dallas, TX (United States))

    1994-08-01

    The authors report the occurrence of three novel mutations in the E1[alpha] (BCKDHA) locus of the branched-chain [alpha]-keto acid dehydrogenase (BCKAD) complex that cause maple syrup urine disease (MSUD). An 8-bp deletion in exon 7 is present in one allele of a compound-heterozygous patient (GM-649). A single C nucleotide insertion in exon 2 occurs in one allele of an intermediate-MSUD patient (Lo). The second allele of patient Lo carries an A-to-G transition in exon 9 of the E1[alpha] gene. This missense mutation changes Tyr-368 to Cys (Y368C) in the E1[alpha] subunit. Both the 8-bp deletion and the single C insertion generate a downstream nonsense codon. Both mutations appear to be associated with a low abundance of the mutant E1[alpha] mRNA, as determined by allele-specific oligonucleotide probing. Transfection studies strongly suggest that the Y368C substitution in the E1[alpha] subunit impairs its proper assembly with the normal E1[beta]. Unassembled as well as misassembled E1[alpha] and E1[beta] subunits are degraded in the cell. 32 refs., 8 figs.

  19. The molecular mechanism regulating 24-hour rhythm of CYP2E1 expression in the mouse liver.

    Science.gov (United States)

    Matsunaga, Naoya; Ikeda, Misaki; Takiguchi, Takako; Koyanagi, Satoru; Ohdo, Shigehiro

    2008-07-01

    Cytochrome P450 2E1 (CYP2E1) is clinically and toxicologically important and exhibits 24-hour periodicity in its activity. In the present study, we investigated whether hepatic nuclear factor-1alpha (HNF-1alpha) and clock genes with a striking 24-hour rhythm in mouse liver contributed to the 24-hour regulation of CYP2E1 expression. The results demonstrated that the expression of CYP2E1 messenger RNA (mRNA) in the liver was affected by HNF-1alpha and the circadian organization of molecular clocks. The mRNA levels of CYP2E1 in the liver increased from the late light phase to the early dark phase. Luciferase reporter gene analysis revealed that HNF-1alpha activated CYP2E1 promoter activity, which was restricted by CRY1, a member of the circadian organization of molecular clocks. Repressor activity of CRY1 was observed on the HNF-1alpha binding site of the CYP2E1 promoter region with mutated E-box. Serum shock induced approximately 24-hour oscillation in CYP2E1 mRNA in HepG2. Transfection of HNF-1alpha and CRY1 small interfering RNA dampened the oscillation of CYP2E1 mRNA in HepG2. Chromatin immunoprecipitation assay in the CYP2E1 promoter indicated that HNF-1alpha binding to the CYP2E1 promoter increased from the late light phase to the early dark phase. Using the chromatin immunoprecipitation reimmunoprecipitation assay, time-dependent differences were demonstrated for CRY1 protein interaction with HNF-1alpha transcriptional complexes, including coactivator p300 on the HNF-1alpha binding site in the CYP2E1 promoter. Our results suggest that the transcription activator of HNF-1alpha acts periodically and the negative limbs of molecular clocks periodically inhibit CYP2E1 transcription, resulting in the 24-hour rhythm of its mRNA expression.

  20. HBx inhibits CYP2E1 gene expression via downregulating HNF4α in human hepatoma cells.

    Directory of Open Access Journals (Sweden)

    Hongming Liu

    Full Text Available CYP2E1, one of the cytochrome P450 mixed-function oxidases located predominantly in liver, plays a key role in metabolism of xenobiotics including ethanol and procarcinogens. Recently, down-expression of CYP2E1 was found in hepatocellular carcinoma (HCC with the majority to be chronic hepatitis B virus (HBV carriers. In this study, we tested a hypothesis that HBx may inhibit CYP2E1 gene expression via hepatocyte nuclear factor 4α (HNF4α. By enforced HBx gene expression in cultured HepG2 cells, we determined the effect of HBx on CYP2E1 mRNA and protein expression. With a bioinformatics analysis, we found a consensus HNF-4α binding sequence located on -318 to -294 bp upstream of human CYP2E1 promoter. Using reporter gene assay and site-directed mutagenesis, we have shown that mutation of this site dramatically decreased CYP2E1 promoter activity. By silencing endogenous HNF-4α, we have further validated knockdown of HNF-4α significantly decreased CYP2E1 expression. Ectopic overexpression of HBx in HepG2 cells inhibits HNF-4α expression, and HNF-4α levels were inversely correlated with viral proteins both in HBV-infected HepG2215 cells and as well as HBV positive HCC liver tissues. Moreover, the HBx-induced CYP2E1 reduction could be rescued by ectopic supplement of HNF4α protein expression. Furthermore, human hepatoma cells C34, which do not express CYP2E1, shows enhanced cell growth rate compared to E47, which constitutively expresses CYP2E1. In addition, the significantly altered liver proteins in CYP2E1 knockout mice were detected with proteomics analysis. Together, HBx inhibits human CYP2E1 gene expression via downregulating HNF4α which contributes to promotion of human hepatoma cell growth. The elucidation of a HBx-HNF4α-CYP2E1 pathway provides novel insight into the molecular mechanism underlining chronic HBV infection associated hepatocarcinogenesis.

  1. Lifting strength in two-person teamwork.

    Science.gov (United States)

    Lee, Tzu-Hsien

    2016-01-01

    This study examined the effects of lifting range, hand-to-toe distance, and lifting direction on single-person lifting strengths and two-person teamwork lifting strengths. Six healthy males and seven healthy females participated in this study. Two-person teamwork lifting strengths were examined in both strength-matched and strength-unmatched groups. Our results showed that lifting strength significantly decreased with increasing lifting range or hand-to-toe distance. However, lifting strengths were not affected by lifting direction. Teamwork lifting strength did not conform to the law of additivity for both strength-matched and strength-unmatched groups. In general, teamwork lifting strength was dictated by the weaker of the two members, implying that weaker members might be exposed to a higher potential danger in teamwork exertions. To avoid such overexertion in teamwork, members with significantly different strength ability should not be assigned to the same team.

  2. E1^E4-mediated keratin phosphorylation and ubiquitylation: a mechanism for keratin depletion in HPV16-infected epithelium

    Science.gov (United States)

    McIntosh, Pauline B.; Laskey, Peter; Sullivan, Kate; Davy, Clare; Wang, Qian; Jackson, Deborah J.; Griffin, Heather M.; Doorbar, John

    2010-01-01

    The keratin IF network of epidermal keratinocytes provides a protective barrier against mechanical insult, it is also a major player in absorbing stress in these cells. The human papilloma virus (HPV) type 16 E1^E4 protein accumulates in the upper layers of HPV16-infected epithelium and is known to associate with and reorganise the keratin IF network in cells in culture. Here, we show that this function is conserved amongst a number of HPV alpha-group E1^E4 proteins and that the differentiation-dependent keratins are also targeted. Using time-lapse microscopy, HPV16 E1^E4 was found to effect a dramatic cessation of keratin IF network dynamics by associating with both soluble and insoluble keratin. Network disruption was accompanied by keratin hyperphosphorylation at several sites, including K8 S73, which is typically phosphorylated in response to stress stimuli. Keratin immunoprecipitated from E1^E4-expressing cells was also found to be ubiquitylated, indicating that it is targeted for proteasomal degradation. Interestingly, the accumulation of hyperphosphorylated, ubiquitylated E1^E4-keratin structures was found to result in an impairment of proteasomal function. These observations shed new light on the mechanism of keratin IF network reorganisation mediated by HPV16 E1^E4 and provide an insight into the depletion of keratin co-incident with E1^E4 accumulation observed in HPV-infected epithelium. PMID:20663917

  3. Inherited susceptibility and radiation exposure

    Energy Technology Data Exchange (ETDEWEB)

    Little, J.B. [Harvard School of Public Health, Boston, MA (United States)

    1997-03-01

    There is continuing concern that some people in the general population may have genetic makeups that place them at particularly high risk for radiation-induced cancer. The existence of such a susceptible subpopulation would have obvious implications for the estimation of risks of radiation exposure. Although it has been long known that familial aggregations of cancer do sometimes occur, recent evidence suggests that a general genetic predisposition to cancer does not exist; most cancers occur sporadically. On the other hand, nearly 10% of the known Mendelian genetic disorders are associated with cancer. A number of these involve a familial predisposition to cancer, and some are characterized by an enhanced susceptibility to the induction of cancer by various physical and chemical carcinogens, including ionizing radiation. Such increased susceptibility will depend on several factors including the frequency of the susceptibility gene in the population and its penetrance, the strength of the predisposition, and the degree to which the cancer incidence in susceptible individuals may be increased by the carcinogen. It is now known that these cancer-predisposing genes may be responsible not only for rare familial cancer syndromes, but also for a proportion of the common cancers. Although the currently known disorders can account for only a small fraction of all cancers, they serve as models for genetic predisposition to carcinogen-induced cancer in the general population. In the present report, the author describes current knowledge of those specific disorders that are associated with an enhanced predisposition to radiation-induced cancer, and discusses how this knowledge may bear on the susceptibility to radiation-induced cancer in the general population and estimates of the risk of radiation exposure.

  4. Protective Effects of Cerium Oxide Nanoparticles on MC3T3-E1 Osteoblastic Cells Exposed to X-Ray Irradiation

    Directory of Open Access Journals (Sweden)

    Cuifen Wang

    2016-04-01

    Full Text Available Background/Aims: Exposure to ionizing radiation can result in bone damage, including decreased osteocyte number and suppressed osteoblastic activity. However, molecular mechanisms remain to be elucidated, and effective prevention strategies are still limited. This study was to investigate whether cerium oxide nanoparticles (CeO2 NP can protect MC3T3-E1 osteoblast-like cells from damaging effects of X-ray irradiation, and to study the underpinning mechanism(s. Methods: MC3T3-E1, a osteoblast-like cell line, was exposed to X-ray irradiation and treated with different concentration of CeO2 nanoparticles. The micronucleus frequency was counted under a fluorescence microscope. Cell viability was evaluated using MTT assay. The effects of irradiation and CeO2 nanoparticles on alkaline phosphatase activity and MC3T3-E1 mineralization were further assayed. Results: We found that the ratio of micronuclei to binuclei was dose-dependently increased with X-ray irradiation (from 2 to 6 Gy, but diminished with the increased concentration of CeO2 NP treatment (from 50 to 100 nM. Exposure to X-rays (6 Gy decreased cell viability, differentiation and the mineralization, but CeO2 NP treatment (100 nM attenuated the deteriorative effects of irradiation. Both intracellular reactive oxygen species (ROS production and extracellular H2O2 concentration were increased after X-ray irradiation, but reduced following CeO2 NP treatment. Similar to irradiation, exposure to H2O2 (10 µM elevated the frequency of micronuclei and diminished cell viability and mineralization, while these changes were ameliorated following CeO2 NP treatment. Conclusions: Taken together, our findings suggest that CeO2 nanoparticles exhibit astonishing protective effects on irradiation-induced osteoradionecrosis in MC3T3-E1 cells, and the protective effects appear to be mediated, at least partially, by reducing oxidative stress.

  5. RADIATION COUNTER

    Science.gov (United States)

    Goldsworthy, W.W.

    1958-02-01

    This patent relates to a radiation counter, and more particularly, to a scintillation counter having high uniform sensitivity over a wide area and capable of measuring alpha, beta, and gamma contamination over wide energy ranges, for use in quickly checking the contami-nation of personnel. Several photomultiplier tubes are disposed in parallel relationship with a light tight housing behind a wall of scintillation material. Mounted within the housing with the photomultipliers are circuit means for producing an audible sound for each pulse detected, and a range selector developing a voltage proportional to the repetition rate of the detected pulses and automatically altering its time constant when the voltage reaches a predetermined value, so that manual range adjustment of associated metering means is not required.

  6. Radiation pneumonitis

    Energy Technology Data Exchange (ETDEWEB)

    Amla, T.R.; Chakravarti, R.N.; Lal, K.

    1975-07-01

    Adult healthy rhesus monkeys were exposed to a course of roentgen irradiation over the chest and back to produce pulmonary changes simulating human radiation pneumonitis. Macroscopic and morphologic changes included dense adhesions, pleural thickening and increased consistency of the lungs. Microscopically the early reaction was characterized by dilatation of pulmonary vessels, microhaemorrhages, collapse of alveoli, permeation of the interstitial tissue with a fibrinous fluid and cells. In the late stage the fibrinous interstitial matrix was replaced by hyaline eosinophilic mass, fragmentation and dissolution of the elastic tissue and thickening of the alveolar walls. The cell population in the interstitial tissue showed decline and at places radiolytic effect. There was peribronchial and perivascular fibrosis and hyalinization and pulmonary arteries revealed marked degree of arteriosclerosis. The present study opens a new field for experimental research on the development of pulmonary hypertension as a post-irradiation complication.

  7. RADIATION DOSIMETER

    Science.gov (United States)

    Balkwell, W.R. Jr.; Adams, G.D. Jr.

    1960-05-10

    An improvement was made in the determination of amounts of ionizing radiation, particularly low-energy beta particles of less than 1000 rad total dose by means of fluid-phase dosimeter employing a stabilized-- sensitized ferrous-ferric colorimetric system in a sulphuric acid medium. The improvement in the dosimeter consists of adding to the ferrous-ferric system in concentrations of 10/sub -2/ to 10/sup -4/M an organic compound having one or more carboxylic or equivalent groups, such compounds being capable of chelating or complexing the iron ions in the solution. Suitable sensitizing and stabilizing agents are benzoic, phthalic, salicylic, malonic, lactic, maleic, oxalic, citric, succinic, phenolic tartaric, acetic, and adipic acid, as well as other compounds which are added to the solution alone or in certain combinations. As in conventional fluid-phase dosimeters, the absorbed dosage is correlated with a corresponding change in optical density at particular wavelengths of the solution.

  8. Adenovirus E1A targets the DREF nuclear factor to regulate virus gene expression, DNA replication, and growth.

    Science.gov (United States)

    Radko, Sandi; Koleva, Maria; James, Kris M D; Jung, Richard; Mymryk, Joe S; Pelka, Peter

    2014-11-01

    The adenovirus E1A gene is the first gene expressed upon viral infection. E1A remodels the cellular environment to maximize permissivity for viral replication. E1A is also the major transactivator of viral early gene expression and a coregulator of a large number of cellular genes. E1A carries out its functions predominantly by binding to cellular regulatory proteins and altering their activities. The unstructured nature of E1A enables it to bind to a large variety of cellular proteins and form new molecular complexes with novel functions. The C terminus of E1A is the least-characterized region of the protein, with few known binding partners. Here we report the identification of cellular factor DREF (ZBED1) as a novel and direct binding partner of E1A. Our studies identify a dual role for DREF in the viral life cycle. DREF contributes to activation of gene expression from all viral promoters early in infection. Unexpectedly, it also functions as a growth restriction factor for adenovirus as knockdown of DREF enhances virus growth and increases viral genome copy number late in the infection. We also identify DREF as a component of viral replication centers. E1A affects the subcellular distribution of DREF within PML bodies and enhances DREF SUMOylation. Our findings identify DREF as a novel E1A C terminus binding partner and provide evidence supporting a role for DREF in viral replication. This work identifies the putative transcription factor DREF as a new target of the E1A oncoproteins of human adenovirus. DREF was found to primarily localize with PML nuclear bodies in uninfected cells and to relocalize into virus replication centers during infection. DREF was also found to be SUMOylated, and this was enhanced in the presence of E1A. Knockdown of DREF reduced the levels of viral transcripts detected at 20 h, but not at 40 h, postinfection, increased overall virus yield, and enhanced viral DNA replication. DREF was also found to localize to viral promoters during

  9. Targeting CCl4 -induced liver fibrosis by RNA interference-mediated inhibition of cyclin E1 in mice.

    Science.gov (United States)

    Bangen, Jörg-Martin; Hammerich, Linda; Sonntag, Roland; Baues, Maike; Haas, Ute; Lambertz, Daniela; Longerich, Thomas; Lammers, Twan; Tacke, Frank; Trautwein, Christian; Liedtke, Christian

    2017-10-01

    Initiation and progression of liver fibrosis requires proliferation and activation of resting hepatic stellate cells (HSCs). Cyclin E1 (CcnE1) is the regulatory subunit of the cyclin-dependent kinase 2 (Cdk2) and controls cell cycle re-entry. We have recently shown that genetic inactivation of CcnE1 prevents activation, proliferation, and survival of HSCs and protects from liver fibrogenesis. The aim of the present study was to translate these findings into preclinical applications using an RNA interference (RNAi)-based approach. CcnE1-siRNA (small interfering RNA) efficiently inhibited CcnE1 gene expression in murine and human HSC cell lines and in primary HSCs, resulting in diminished proliferation and increased cell death. In C57BL/6 wild-type (WT) mice, delivery of stabilized siRNA using a liposome-based carrier targeted approximately 95% of HSCs, 70% of hepatocytes, and 40% of CD45+ cells after single injection. Acute CCl4 -mediated liver injury in WT mice induced endogenous CcnE1 expression and proliferation of surviving hepatocytes and nonparenchymal cells, including CD45+ leukocytes. Pretreatment with CcnE1-siRNA reverted CcnE1 induction to baseline levels of healthy mice, which was associated with reduced liver injury, diminished proliferation of hepatocytes and leukocytes, and attenuated overall inflammatory response. For induction of liver fibrosis, WT mice were challenged with CCl4 for 4-6 weeks. Co-treatment with CcnE1-siRNA once a week was sufficient to continuously block CcnE1 expression and cell-cycle activity of hepatocytes and nonparenchymal cells, resulting in significantly ameliorated liver fibrosis and inflammation. Importantly, CcnE1-siRNA also prevented progression of liver fibrosis if applied after onset of chronic liver injury. Therapeutic targeting of CcnE1 in vivo using RNAi is feasible and has high antifibrotic activity. (Hepatology 2017;66:1242-1257). © 2017 by the American Association for the Study of Liver Diseases.

  10. Crystal strength by direct computation

    Science.gov (United States)

    Bulatov, Vasily

    2007-03-01

    The art of making materials stronger goes back to medieval and even ancient times. Swords forged from Damascus steels more than 10 centuries ago possessed a unique combination of hardness and flexibility, two qualities that are difficult to attain simultaneously. The skills of metalworking were based on empirical knowledge and were passed from the master smith to his pupils. The science of physical metallurgy came about only in the XX century bringing with it new methods for finding out why some materials are strong while others are not. Soon it was realized that, when it comes to metal strength, it is all about crystal defects -- impurities, dislocations, grain boundaries, etc. - and how they are organized into crystal microstructure. This understanding has since resulted in new effective methods of material processing aiming to modify crystal microstructure in order to affect material's properties, e.g. strength and/or hardness. Remarkably and disappointingly, general understanding that microstructure defines material's response to external loads has not yet resulted in a workable physical theory of metal strength accounting for the realistic complexity of material microstructure. In this presentation I would like to discuss a few tidbits from computational and experimental research in our group at LLNL on crystal defects and their contributions to material strength. My selection of the examples aims to illustrate the major premise of our work that the mechanisms by which the microstructure affects crystal strength are multiple and complex but that there is hope to bring some order to this complexity.

  11. Influence of microwave irradiation of cement mixtures on the strength of cement stone and concrete

    Science.gov (United States)

    Dmitriev, M. S.; Dyakonov, M. V.; Krasnokutskiy, R. A.; Kolyaskin, A. D.; Dmitriev, S. A.

    2017-12-01

    The influence of microwave irradiation of mixtures on the strength of cement stone and concrete was studied. Created at NRNU MEPHI experimental installation for the investigation of microwave effects on imperfect dielectrics and semiconductor materials was the source of radiation. It is shown that on the twenty-eighth day after mixing, the strength of the cement stone increases by 1.2 times, and that of concrete by 2.2 times.

  12. Spontaneous Radiation Background Calculation for LCLS

    CERN Document Server

    Reiche, Sven

    2004-01-01

    The intensity of undulator radiation, not amplified by the FEL interaction, can be larger than the maximum FEL signal in the case of an X-ray FEL. In the commissioning of a SASE FEL it is essential to extract an amplified signal early to diagnose eventual misalignment of undulator modules or errors in the undulator field strength. We developed a numerical code to calculate the radiation pattern at any position behind a multi-segmented undulator with arbitrary spacing and field profiles. The output can be run through numerical spatial and frequency filters to model the radiation beam transport and diagnostic. In this presentation we estimate the expected background signal for the FEL diagnostic and at what point along the undulator the FEL signal can be separated from the background. We also discusses how much information on the undulator field and alignment can be obtained from the incoherent radiation signal itself.

  13. Muscle Strength and Poststroke Hemiplegia: A Systematic Review of Muscle Strength Assessment and Muscle Strength Impairment.

    Science.gov (United States)

    Kristensen, Otto H; Stenager, Egon; Dalgas, Ulrik

    2017-02-01

    To systematically review (1) psychometric properties of criterion isokinetic dynamometry testing of muscle strength in persons with poststroke hemiplegia (PPSH); and (2) literature that compares muscle strength in patients poststroke with that in healthy controls assessed by criterion isokinetic dynamometry. A systematic literature search of 7 databases was performed. Included studies (1) enrolled participants with definite poststroke hemiplegia according to defined criteria; (2) assessed muscle strength or power by criterion isokinetic dynamometry; (3) had undergone peer review; and (4) were available in English or Danish. The psychometric properties of isokinetic dynamometry were reviewed with respect to reliability, validity, and responsiveness. Furthermore, comparisons of strength between paretic, nonparetic, and comparable healthy muscles were reviewed. Twenty studies covering 316 PPSH were included. High intraclass correlation coefficient (ICC) inter- and intrasession reliability was reported for isokinetic dynamometry, which was independent of the tested muscle group, contraction mode, and contraction velocity. Slightly higher ICC values were found for the nonparetic extremity. Standard error of the mean (SEM) values showed that a change of 7% to 20% was required for a real group change to take place for most muscle groups, with the knee extensors showing the smallest SEM% values. The muscle strength of paretic muscles showed deficits when compared with both healthy and nonparetic muscles, independent of muscle group, contraction mode, and contraction velocity. Nonparetic muscles only showed minor strength impairments when compared with healthy muscles. Criterion isokinetic dynamometry is a reliable test in persons with stroke, generally showing marked reductions in muscle strength of paretic and, to a lesser degree, nonparetic muscles when compared with healthy controls, independent of muscle group, contraction mode, and contraction velocity. Copyright

  14. Muscle strength in myasthenia gravis

    DEFF Research Database (Denmark)

    Cejvanovic, S; Vissing, J

    2014-01-01

    is related to disease duration or gender. The aim of this study was to quantify the strength of patients with MG and investigate whether it is related to disease duration. METHODS: Eight muscle groups were tested by manual muscle testing and with a hand-held dynamometer in 38 patients with generalized MG...... and 37 healthy age- and gender-matched controls. The disease duration was recorded and compared with strength measures. RESULTS: On average, muscle strength was decreased by 28% compared with controls (Pstrength measures in individual patients did not differ, suggesting that the muscle...... force reported was not subject to fatigue, but reflected fixed weakness. The male patients showed a greater reduction in muscle force in all eight muscle groups than women with MG (60% vs 77% of normal, Pstrength in shoulder abductors was most affected (51% vs 62...

  15. Withdrawal Strength and Bending Yield Strength of Stainless Steel Nails

    Science.gov (United States)

    Douglas R. Rammer; Samuel L. Zelinka

    2015-01-01

    It has been well established that stainless steel nails have superior corrosion performance compared to carbon steel or galvanized nails in treated wood; however, their mechanical fastening behavior is unknown. In this paper, the performance of stainless steel nails is examined with respect to two important properties used in wood connection design: withdrawal strength...

  16. MC3T3-E1 Cells on Titanium Surfaces with Nanometer Smoothness and Fibronectin Immobilization

    Directory of Open Access Journals (Sweden)

    Tohru Hayakawa

    2012-01-01

    Full Text Available The present study was aimed to evaluate the viability and total protein contents of osteoblast-like cells on the titanium surface with different surface mechanical treatment, namely, nanometer smoothing (Ra: approximately 2.0 nm and sandblasting (Ra: approximately 1.0 μm, and biochemical treatment, namely, with or without fibronectin immobilization. Fibronectin could be easily immobilized by tresyl chloride-activation technique. MC3T3-E1 cells were seeded on the different titanium surfaces. Cell viability was determined by MTT assay. At 1 day of cell culture, there were no significant differences in cell viability among four different titanium surfaces. At 11 days, sandblasted titanium surface with fibronectin immobilization showed the significantly highest cell viability than other titanium surface. No significant differences existed for total protein contents among four different titanium surfaces at 11 days of cell culture. Scanning electron microscopy observation revealed that smoothness of titanium surface produced more spread cell morphologies, but that fibronectin immobilization did not cause any changes of the morphologies of attached cells. Fibronectin immobilization provided greater amount of the number of attached cells and better arrangement of attached cells. In conclusion, the combination of sandblasting and fibronectin immobilization enhanced the cell viability and fibronectin immobilization providing better arrangements of attached cells.

  17. Impaired phagocytosis in localized aggressive periodontitis: rescue by Resolvin E1.

    Directory of Open Access Journals (Sweden)

    Gabrielle Fredman

    Full Text Available Resolution of inflammation is an active temporally orchestrated process demonstrated by the biosynthesis of novel proresolving mediators. Dysregulation of resolution pathways may underlie prevalent human inflammatory diseases such as cardiovascular diseases and periodontitis. Localized Aggressive Periodontitis (LAP is an early onset, rapidly progressing form of inflammatory periodontal disease. Here, we report increased surface P-selectin on circulating LAP platelets, and elevated integrin (CD18 surface expression on neutrophils and monocytes compared to healthy, asymptomatic controls. Significantly more platelet-neutrophil and platelet-monocyte aggregates were identified in circulating whole blood of LAP patients compared with asymptomatic controls. LAP whole blood generates increased pro-inflammatory LTB4 with addition of divalent cation ionophore A23187 (5 µM and significantly less, 15-HETE, 12-HETE, 14-HDHA, and lipoxin A(4. Macrophages from LAP subjects exhibit reduced phagocytosis. The pro-resolving lipid mediator, Resolvin E1 (0.1-100 nM, rescues the impaired phagocytic activity in LAP macrophages. These abnormalities suggest compromised resolution pathways, which may contribute to persistent inflammation resulting in establishment of a chronic inflammatory lesion and periodontal disease progression.

  18. Alteration of therapeutic efficacy of lipid microspheres incorporating prostaglandin E1 by mixing with aqueous solution.

    Science.gov (United States)

    Komori, Yukiko; Aiba, Tetsuya; Kushima, Miki; Kawasaki, Hiromu; Kurosaki, Yuji

    2007-04-01

    To clarify whether the therapeutic efficacy of lipid microspheres incorporating prostaglandin E(1) (lipo-PGE(1)) is altered when mixed and coinfused with clinical solutions, the original lipo-PGE(1) solution (20 microg/mL) was mixed with three clinical infusion solutions: 0.9% sodium chloride solution, Hartmann's solution, and fat emulsion for parenteral nutrition. These diluted lipo-PGE(1) (2 microg/mL) solutions were administered to rats, and their hemodynamic and antiplatelet effects were examined. Peripheral blood flow was increased by 76 +/- 4% from the control level when the lipo-PGE(1) solution diluted with the fat emulsion was administered, while it was increased by 43 +/- 6% and 36 +/- 7%, respectively, when the lipo-PGE(1) solutions diluted with 0.9% sodium chloride and Hartmann's solution were administered. As for the antiplatelet effects of the lipo-PGE(1) solutions, the progression of digit gangrene in thromboangiitis obliterans (TAO) rats was significantly suppressed by the administration of lipo-PGE(1) solution diluted with the fat emulsion, but it was not suppressed by lipo-PGE(1) solution diluted with 0.9% sodium chloride. These findings indicate that the therapeutic efficacy of lipo-PGE(1) is decreased when it is mixed with an aqueous solution such as 0.9% sodium chloride. (c) 2007 Wiley-Liss, Inc.

  19. EVALUATION OF RATIONAL FUNCTION MODEL FOR GEOMETRIC MODELING OF CHANG'E-1 CCD IMAGES

    Directory of Open Access Journals (Sweden)

    Y. Liu

    2012-08-01

    Full Text Available Rational Function Model (RFM is a generic geometric model that has been widely used in geometric processing of high-resolution earth-observation satellite images, due to its generality and excellent capability of fitting complex rigorous sensor models. In this paper, the feasibility and precision of RFM for geometric modeling of China's Chang'E-1 (CE-1 lunar orbiter images is presented. The RFM parameters of forward-, nadir- and backward-looking CE-1 images are generated though least squares solution using virtual control points derived from the rigorous sensor model. The precision of the RFM is evaluated by comparing with the rigorous sensor model in both image space and object space. Experimental results using nine images from three orbits show that RFM can precisely fit the rigorous sensor model of CE-1 CCD images with a RMS residual error of 1/100 pixel level in image space and less than 5 meters in object space. This indicates that it is feasible to use RFM to describe the imaging geometry of CE-1 CCD images and spacecraft position and orientation. RFM will enable planetary data centers to have an option to supply RFM parameters of orbital images while keeping the original orbit trajectory data confidential.

  20. Prostaglandin E1 inhibits endocytosis in the β-cell endocytosis.

    Science.gov (United States)

    Zhao, Ying; Fang, Qinghua; Straub, Susanne G; Lindau, Manfred; Sharp, Geoffrey W G

    2016-06-01

    Prostaglandins inhibit insulin secretion in a manner similar to that of norepinephrine (NE) and somatostatin. As NE inhibits endocytosis as well as exocytosis, we have now examined the modulation of endocytosis by prostaglandin E1 (PGE1). Endocytosis following exocytosis was recorded by whole-cell patch clamp capacitance measurements in INS-832/13 cells. Prolonged depolarizing pulses producing a high level of Ca(2+) influx were used to stimulate maximal exocytosis and to deplete the readily releasable pool (RRP) of granules. This high Ca(2+) influx eliminates the inhibitory effect of PGE1 on exocytosis and allows specific characterization of the inhibitory effect of PGE1 on the subsequent compensatory endocytosis. After stimulating exocytosis, endocytosis was apparent under control conditions but was inhibited by PGE1 in a Pertussis toxin-sensitive (PTX)-insensitive manner. Dialyzing a synthetic peptide mimicking the C-terminus of the α-subunit of the heterotrimeric G-protein Gz into the cells blocked the inhibition of endocytosis by PGE1, whereas a control-randomized peptide was without effect. These results demonstrate that PGE1 inhibits endocytosis and Gz mediates the inhibition. © 2016 Society for Endocrinology.

  1. Development, Optimization, and Characterization of PEGylated Nanoemulsion of Prostaglandin E1 for Long Circulation.

    Science.gov (United States)

    Cheng, Ying; Liu, Miao; Hu, Huijing; Liu, Daozhou; Zhou, Siyuan

    2016-04-01

    Lipo-PGE1 is the most widely used formulation of PGE1 in clinic. However, PGE1 is easier to leak out from lipo-PGE1 and this will lead to the phlebophlogosis when intravenous injection. The stability of lipo-PGE1 in storage and in vivo is also discounted. The aim of this study is to develop a long-circulating prostaglandin E1-loaded nanoemulsion modified with 1,2-distearoyl-sn-glycero-3-phosphoethanolamine-N-[methoxy(polyethylene glycol)-2000] (DSPE-PEG) to improve the stability and pharmacokinetics profiles of lipo-PGE1. PEGylated PGE1 nanoemulsion was prepared using a dispersing-homogenized method. The stability of nanoemulsion in 1 month was investigated. Pharmacokinetic studies were employed to evaluate the in vivo profile of the optimized nanoemulsion. The optimized nanoemulsion PGE1-PEG2000(1%)-NE showed an oil droplet size nanoemulsion. The particle size, zeta potential, and drug loading of PGE1-PEG2000(1%)-NE were stable in 1 month. After PGE1-PEG2000(1%)-NE was intravenously administered to rats, the area under curve (AUC) and half-life of PGE1 were, respectively, 1.47-fold and 5.98-fold higher than those of lipo-PGE1 (commercial formulation). PGE1-PEG2000(1%)-NE was an ideal formulation for prolonging the elimination time of PGE1. This novel parenteral colloidal delivery system of PGE1 has a promising potential in clinic use.

  2. Modulation of Osteogenesis in MC3T3-E1 Cells by Different Frequency Electrical Stimulation.

    Directory of Open Access Journals (Sweden)

    Yu Wang

    Full Text Available Electrical stimulation (ES is therapeutic to many bone diseases, from promoting fracture regeneration to orthopedic intervention. The application of ES offers substantial therapeutic potential, while optimal ES parameters and the underlying mechanisms responsible for the positive clinical impact are poorly understood. In this study, we assembled an ES cell culture and monitoring device. Mc-3T3-E1 cells were subjected to different frequency to investigate the effect of osteogenesis. Cell proliferation, DNA synthesis, the mRNA levels of osteosis-related genes, the activity of alkaline phosphatase (ALP, and intracellular concentration of Ca2+ were thoroughly evaluated. We found that 100 Hz could up-regulate the mRNA levels of collagen I, collagen II and Runx2. On the contrary, ES could down-regulate the mRNA levels of osteopontin (OPN. ALP activity assay and Fast Blue RR salt stain showed that 100 Hz could accelerate cells differentiation. Compared to the control group, 100 Hz could promote cell proliferation. Furthermore, 1 Hz to 10 Hz could improve calcium deposition in the intracellular matrix. Overall, these results indicate that 100Hz ES exhibits superior potentialities in osteogenesis, which should be beneficial for the clinical applications of ES for the treatment of bone diseases.

  3. Radiation chemistry comes before radiation biology.

    Science.gov (United States)

    O'Neill, Peter; Wardman, Peter

    2009-01-01

    This article seeks to illustrate some contributions of radiation chemistry to radiobiology and related science, and to draw attention to examples where radiation chemistry is central to our knowledge of specific aspects. Radiation chemistry is a mature branch of radiation science which is continually evolving and finding wider applications. This is particularly apparent in the study of the roles of free radicals in biology generally, and radiation biology specifically. The chemical viewpoint helps unite the spatial and temporal insight coming from radiation physics with the diversity of biological responses. While historically, the main application of radiation chemistry of relevance to radiation biology has been investigations of the free-radical processes leading to radiation-induced DNA damage and its chemical characterization, two features of radiation chemistry point to its wider importance. First, its emphasis on quantification and characterization at the molecular level helps provide links between DNA damage, biochemical repair processes, and mutagenicity and radiosensitivity. Second, its central pillar of chemical kinetics aids understanding of the roles of 'reactive oxygen species' in cell signalling and diverse biological effects more generally, and application of radiation chemistry in the development of drugs to enhance radiotherapy and as hypoxia-specific cytotoxins or diagnostic agents. The illustrations of the broader applications of radiation chemistry in this article focus on their relevance to radiation biology and demonstrate the importance of synergy in the radiation sciences. The past contributions of radiation chemistry to radiation biology are evident, but there remains considerable potential to help advance future biological understanding using the knowledge and techniques of radiation chemistry.

  4. Topological strength of magnetic skyrmions

    Energy Technology Data Exchange (ETDEWEB)

    Bazeia, D.; Ramos, J.G.G.S.; Rodrigues, E.I.B.

    2017-02-01

    This work deals with magnetic structures that attain integer and half-integer skyrmion numbers. We model and solve the problem analytically, and show how the solutions appear in materials that engender distinct, very specific physical properties, and use them to describe their topological features. In particular, we found a way to model skyrmion with a large transition region correlated with the presence of a two-peak skyrmion number density. Moreover, we run into the issue concerning the topological strength of a vortex-like structure and suggest an experimental realization, important to decide how to modify and measure the topological strength of the magnetic structure.

  5. Oscillator strengths for Be I

    Energy Technology Data Exchange (ETDEWEB)

    Ates, Sule, E-mail: suleates@selcuk.edu.tr; Oezarslan, Selma; Celik, Gueltekin; Taser, Mehmet

    2012-07-15

    The electric dipole oscillator strengths for lines between some singlet and triplet levels have been calculated using the weakest bound electron potential model theory and the quantum defect orbital theory for Be I. In the calculations both multiplet and fine structure transitions are studied. We employed both the numerical Coulomb approximation method and numerical non-relativistic Hartree-Fock wavefunctions for expectation values of radii. The necessary energy values have been taken from experimental energy data in the literature. The calculated oscillator strengths have been compared with available theoretical results. A good agreement with the results in the literature has been obtained.

  6. The molecular mechanism regulating 24-hour rhythm of CYP2E1 expression in the mouse liver

    National Research Council Canada - National Science Library

    Matsunaga, Naoya; Ikeda, Misaki; Takiguchi, Takako; Koyanagi, Satoru; Ohdo, Shigehiro

    2008-01-01

    .... In the present study, we investigated whether hepatic nuclear factor-1alpha (HNF-1alpha) and clock genes with a striking 24-hour rhythm in mouse liver contributed to the 24-hour regulation of CYP2E1 expression...

  7. CYP2E1 epigenetic regulation in chronic, low-level toluene exposure: Relationship with oxidative stress and smoking habit

    Energy Technology Data Exchange (ETDEWEB)

    Jiménez-Garza, Octavio, E-mail: ojimenezgarza@ugto.mx [Health Sciences Division, University of Guanajuato Campus León, Blvd. Puente del Milenio 1001, Fracción del Predio San Carlos, C.P. 37670 León, Guanajuato (Mexico); Baccarelli, Andrea A.; Byun, Hyang-Min [Laboratory of Environmental Epigenetics, Department of Environmental Health, Harvard T.H. Chan School of Public Health, 677 Huntington Avenue, Boston, MA 02115 (United States); Márquez-Gamiño, Sergio [Health Sciences Division, University of Guanajuato Campus León, Blvd. Puente del Milenio 1001, Fracción del Predio San Carlos, C.P. 37670 León, Guanajuato (Mexico); Barrón-Vivanco, Briscia Socorro [Environmental Toxicology and Pollution Laboratory, Nayarit Autonomous University, Av. Ciudad de la Cultura s/n, “Amado Nervo”, Tepic, Nayarit C.P. 63155 (Mexico); Albores, Arnulfo [Department of Toxicology, CINVESTAV, Av. Instituto Politécnico Nacional 2508, Col. San Pedro Zacatenco, 07360 Mexico DF (Mexico)

    2015-08-01

    Background: CYP2E1 is a versatile phase I drug-metabolizing enzyme responsible for the biotransformation of most volatile organic compounds, including toluene. Human toluene exposure increases CYP2E1 mRNA and modifies its activity in leucocytes; however, epigenetic implications of this interaction have not been investigated. Goal: To determine promoter methylation of CYP2E1 and other genes known to be affected by toluene exposure. Methods: We obtained venous blood from 24 tannery workers exposed to toluene (mean levels: 10.86 +/− 7 mg/m{sup 3}) and 24 administrative workers (reference group, mean levels 0.21 +/− 0.02 mg/m{sup 3}) all of them from the city of León, Guanajuato, México. After DNA extraction and bisulfite treatment, we performed PCR-pyrosequencing in order to measure methylation levels at promoter region of 13 genes. Results: In exposed group we found significant correlations between toluene airborne levels and CYP2E1 promoter methylation (r = − .36, p < 0.05), as well as for IL6 promoter methylation levels (r = .44, p < 0.05). Moreover, CYP2E1 promoter methylation levels where higher in toluene-exposed smokers compared to nonsmokers (p = 0.009). We also observed significant correlations for CYP2E1 promoter methylation with GSTP1 and SOD1 promoter methylation levels (r = − .37, p < 0.05 and r = − .34, p < 0.05 respectively). Conclusion: These results highlight the importance of considering CYP2E1 epigenetic modifications, as well as its interactions with other genes, as key factors for unraveling the sub cellular mechanisms of toxicity exerted by oxidative stress, which can initiate disease process in chronic, low-level toluene exposure. People co-exposed to toluene and tobacco smoke are in higher risk due to a possible CYP2E1 repression. - Highlights: • We investigated gene-specific methylation in persons chronically exposed to toluene. • In a previous study, a reduced CYP2E1 activity was observed in these participants. • CYP2E1

  8. CYP2E1PstI/RsaI polymorphism and interaction with tobacco, alcohol and GSTs in gastric cancer susceptibility: A meta-analysis of the literature.

    NARCIS (Netherlands)

    S. Boccia (Stefania); S. de Lauretis (Angelo); F. Gianfagna (Francesco); C.M. van Duijn (Cornelia); G. Ricciardi (Gualtiero)

    2007-01-01

    textabstractStudies investigating the association between cytochrome P450 2E1 (CYP2E1) 5'-flanking region (PstI/RsaI) polymorphism and gastric cancer risk report conflicting results. The rationale for this meta-analysis was to determine whether CYP2E1*2 (c2) variant allele of CYP2E1 increases

  9. The human papillomavirus DNA helicase E1 binds, stimulates, and confers processivity to cellular DNA polymerase epsilon

    Science.gov (United States)

    Chojnacki, Michaelle

    2018-01-01

    Abstract The papillomavirus (PV) helicase protein E1 recruits components of the cellular DNA replication machinery to the PV replication fork, such as Replication Protein A (RPA), DNA polymerase α-primase (pol α) and topoisomerase I (topo I). Here we show that E1 binds to DNA polymerase ϵ (pol ϵ) and dramatically stimulates the DNA synthesis activity of pol ϵ. This stimulation of pol ϵ by E1 is highly specific and occurs even in the absence of the known pol ϵ cofactors Replication Factor C (RFC), Proliferating Cell Nuclear Antigen (PCNA) and RPA. This stimulation is due to an increase in the processivity of pol ϵ and occurs independently of pol ϵ’s replication cofactors. This increase in processivity is dependent on the ability of the E1 helicase to hydrolyze ATP, suggesting it is dependent on E1’s helicase action. In addition, RPA, thought to be vital for processive DNA synthesis by both pol ϵ and pol δ, was found to be dispensable for processive synthesis by pol ϵ in the presence of E1. Overall, E1 appears to be conferring processivity to pol ϵ by directly tethering pol ϵ to the DNA parental strand and towing ϵ behind the E1 helicase as the replication fork progresses; and thereby apparently obviating the need for RPA for leading strand synthesis. Thus far only pol α and pol δ have been implicated in the DNA replication of mammalian viruses; this is the first reported example of a virus recruiting pol ϵ. Furthermore, this demonstrates a unique capacity of a viral helicase having evolved to stimulate a cellular replicative DNA polymerase. PMID:29155954

  10. E1A Interacts with Two Opposing Transcriptional Pathways To Induce Quiescent Cells into S Phase ▿

    Science.gov (United States)

    Sha, Jingfeng; Ghosh, Mrinal K.; Zhang, Keman; Harter, Marian L.

    2010-01-01

    Despite data suggesting that the adenovirus E1A protein of 243 amino acids creates an S-phase environment in quiescent cells by overcoming the nucleosomal repression of E2F-regulated genes, the precise mechanisms underlying E1A's ability in this process have not yet been defined at the biochemical level. In this study, we show by kinetic analysis that E1A, as opposed to an E1A mutant failing to bind p130, can temporally eliminate corepressor complexes consisting of p130-E2F4 and HDAC1/2-mSin3B from the promoters of E2F-regulated genes in quiescent cells. Once the complexes are removed, the di-methylation of H3K9 at these promoters becomes dramatically diminished, and this in turn allows for the acetylation of H3K9/14 and the recruitment of activating E2F family members, which is then followed by the transcriptional activity of the E2F-regulated genes. Remarkably, although an E1A mutant that can no longer bind to a histone acetyltransferase (PCAF) is as capable as wild-type E1A in eliminating corepressor complexes and methyl groups from the promoters of these genes, it cannot mediate the acetylation of H3K9/14 or induce their transcription. These findings suggest that corepressors as well as coactivators are acted upon by E1A to derepress E2F-regulated genes in quiescent cells. Thus, our results highlight for the first time a functional relationship between E1A and two transcriptional pathways of differing functions for transitioning cells out of quiescence and into S phase. PMID:20089639

  11. Strengths and Weaknesses of Synthetic Mammography in Screening.

    Science.gov (United States)

    Ratanaprasatporn, Linda; Chikarmane, Sona A; Giess, Catherine S

    2017-01-01

    Synthetic mammography (SM) consists of two-dimensional images reconstructed from digital breast tomosynthesis (DBT) data. Unlike standard full-field digital mammography (FFDM), SM does not require additional radiation exposure. SM is being introduced in breast imaging centers because early clinical data demonstrate that synthetic images are comparable to FFDM in cancer detection, positive predictive values, and recall rates. SM has completely replaced FFDM in some practices. Thus, an understanding of SM and its strengths and weaknesses compared with those of FFDM is essential. The artifacts of SM include blurring subcutaneous tissue, loss of resolution in the axilla on mediolateral oblique views, pseudocalcifications, and decreased resolution near foreign bodies (eg, biopsy markers). SM's strengths include a reduced radiation dose, shorter acquisition time compared with a combined FFDM/DBT screening examination (with potentially less motion artifact), and increased conspicuity of calcifications, spiculated margins, and architectural distortion. The weaknesses of SM include the potential for false positives due to pseudocalcifications and the difficulty in assessing for motion artifact. This article reviews SM and its role in screening and presents clinical cases to highlight SM's strengths, weaknesses, and artifacts. © RSNA, 2017.

  12. Black-Body Radiation

    Indian Academy of Sciences (India)

    Keywords. Black-body radiation; thermal radiation; heat; electromagnetic radiation; Stefan's Law; Stefan–Boltzmann Law; Wien's Law; Rayleigh–Jeans Law; black-body spectrum; ultraviolet catastrophe; zero point energy; photon.

  13. Radiation Therapy for Cancer

    Science.gov (United States)

    ... is exposed to radiation. Whether IMRT leads to improved control of tumor growth and better survival compared ... treatments. Some patients may receive radiation therapy and chemotherapy at the same time. The timing of radiation ...

  14. Radiation Exposure and Pregnancy

    Science.gov (United States)

    ... Updated: June 2017 Health Physics Society Specialists in Radiation Safety Radiation Exposure and Pregnancy The birth of a child ... experience. It is In addition to unavoidable background radiation, one hard to prepare yourself for the joys— ...

  15. [Cloning and functional analysis of cysI gene involved in siderophores biosynthesis in Pseudomonas mosselii E1].

    Science.gov (United States)

    Huang, Wei-Hong; Ding, Yan-Qin; Yao, Liang-Tong; Du, Zhi-Bing; Du, Bing-Hai

    2007-10-01

    A siderophores-producing strain E1 was isolated from the rhizosphere of cotton. Its 16S rDNA is identical to that of Pseudomonas mosselii sp. nov. at 100% level. The suicide plasmid pRL1063a carrying Tn5-1063 was introduced into E1 by triparental mating and 1000 transposon insertion mutants were subsequently screened using CAS assay. One mutant deficiency in siderophores production was obtained, namely, E1-185. DNA sequences flanking Tn5-1063 of E1-185 was amplified by TAIL-PCR. According to the DNA sequencing results, it is found that Tn5-1063 was inserted into cysI gene. The cysI of E1 is identical to that of Pseudomonas entomophila. L48 at 96% level, and similarity of amino acid sequences of their CysI is 97% . The cysI gene is required for the synthesis of cysteine. However, The ability in siderophores production of E1-185 on the plate of CAS with cysteine was recovered. It is indicated that cysI play an important role during the synthesis of siderophores. It was supposed that cysI is involved in the synthesis of acyl-S-PCPs, which is the key protein in the synthesis pathway of siderophores.

  16. Rhes, a Physiologic Regulator of Sumoylation, Enhances Cross-sumoylation between the Basic Sumoylation Enzymes E1 and Ubc9*

    Science.gov (United States)

    Subramaniam, Srinivasa; Mealer, Robert G.; Sixt, Katherine M.; Barrow, Roxanne K.; Usiello, Alessandro; Snyder, Solomon H.

    2010-01-01

    We recently reported that the small G-protein Rhes has the properties of a SUMO-E3 ligase and mediates mutant huntingtin (mHtt) cytotoxicity. We now demonstrate that Rhes is a physiologic regulator of sumoylation, which is markedly reduced in the corpus striatum of Rhes-deleted mice. Sumoylation involves activation and transfer of small ubiquitin-like modifier (SUMO) from the thioester of E1 to the thioester of Ubc9 (E2) and final transfer to lysines on target proteins, which is enhanced by E3s. We show that E1 transfers SUMO from its thioester directly to lysine residues on Ubc9, forming isopeptide linkages. Conversely, sumoylation on E1 requires transfer of SUMO from the thioester of Ubc9. Thus, the process regarded as “autosumoylation” reflects intermolecular transfer between E1 and Ubc9, which we designate “cross-sumoylation.” Rhes binds directly to both E1 and Ubc9, enhancing cross-sumoylation as well as thioester transfer from E1 to Ubc9. PMID:20424159

  17. Rhes, a physiologic regulator of sumoylation, enhances cross-sumoylation between the basic sumoylation enzymes E1 and Ubc9.

    Science.gov (United States)

    Subramaniam, Srinivasa; Mealer, Robert G; Sixt, Katherine M; Barrow, Roxanne K; Usiello, Alessandro; Snyder, Solomon H

    2010-07-02

    We recently reported that the small G-protein Rhes has the properties of a SUMO-E3 ligase and mediates mutant huntingtin (mHtt) cytotoxicity. We now demonstrate that Rhes is a physiologic regulator of sumoylation, which is markedly reduced in the corpus striatum of Rhes-deleted mice. Sumoylation involves activation and transfer of small ubiquitin-like modifier (SUMO) from the thioester of E1 to the thioester of Ubc9 (E2) and final transfer to lysines on target proteins, which is enhanced by E3s. We show that E1 transfers SUMO from its thioester directly to lysine residues on Ubc9, forming isopeptide linkages. Conversely, sumoylation on E1 requires transfer of SUMO from the thioester of Ubc9. Thus, the process regarded as "autosumoylation" reflects intermolecular transfer between E1 and Ubc9, which we designate "cross-sumoylation." Rhes binds directly to both E1 and Ubc9, enhancing cross-sumoylation as well as thioester transfer from E1 to Ubc9.

  18. CYP2E1 epigenetic regulation in chronic, low-level toluene exposure: Relationship with oxidative stress and smoking habit.

    Science.gov (United States)

    Jiménez-Garza, Octavio; Baccarelli, Andrea A; Byun, Hyang-Min; Márquez-Gamiño, Sergio; Barrón-Vivanco, Briscia Socorro; Albores, Arnulfo

    2015-08-01

    CYP2E1 is a versatile phase I drug-metabolizing enzyme responsible for the biotransformation of most volatile organic compounds, including toluene. Human toluene exposure increases CYP2E1 mRNA and modifies its activity in leucocytes; however, epigenetic implications of this interaction have not been investigated. To determine promoter methylation of CYP2E1 and other genes known to be affected by toluene exposure. We obtained venous blood from 24 tannery workers exposed to toluene (mean levels: 10.86+/-7mg/m(3)) and 24 administrative workers (reference group, mean levels 0.21+/-0.02mg/m(3)) all of them from the city of León, Guanajuato, México. After DNA extraction and bisulfite treatment, we performed PCR-pyrosequencing in order to measure methylation levels at promoter region of 13 genes. In exposed group we found significant correlations between toluene airborne levels and CYP2E1 promoter methylation (r=-.36, ptoluene-exposed smokers compared to nonsmokers (p=0.009). We also observed significant correlations for CYP2E1 promoter methylation with GSTP1 and SOD1 promoter methylation levels (r=-.37, ptoluene exposure. People co-exposed to toluene and tobacco smoke are in higher risk due to a possible CYP2E1 repression. Copyright © 2015 Elsevier Inc. All rights reserved.

  19. Thermal radiation heat transfer

    CERN Document Server

    Howell, John R; Siegel, Robert

    2016-01-01

    Further expanding on the changes made to the fifth edition, Thermal Radiation Heat Transfer, 6th Edition continues to highlight the relevance of thermal radiative transfer and focus on concepts that develop the radiative transfer equation (RTE). The book explains the fundamentals of radiative transfer, introduces the energy and radiative transfer equations, covers a variety of approaches used to gauge radiative heat exchange between different surfaces and structures, and provides solution techniques for solving the RTE.

  20. Modeling of Sylgard Adhesive Strength

    Energy Technology Data Exchange (ETDEWEB)

    Stevens, Ralph Robert [Los Alamos National Lab. (LANL), Los Alamos, NM (United States)

    2015-02-03

    Sylgard is the name of a silicone elastomeric potting material manufactured by Dow Corning Corporation.1 Although the manufacturer cites its low adhesive strength as a feature of this product, thin layers of Sylgard do in fact have a non-negligible strength, which has been measured in recent tensile and shear debonding tests. The adhesive strength of thin layers of Sylgard potting material can be important in applications in which components having signi cantly di erent thermal expansion properties are potted together, and the potted assembly is subjected to temperature changes. The tensile and shear tractions developed on the potted surfaces of the components can cause signi cant internal stresses, particularly for components made of low-strength materials with a high area-to-volume ratio. This report is organized as follows: recent Sylgard debonding tests are rst brie y summarized, with particular attention to the adhesion between Sylgard and PBX 9501, and also between Sylgard and aluminum. Next, the type of numerical model that will be used to simulate the debonding behavior exhibited in these tests is described. Then the calibration of the debonding model will be illustrated. Finally, the method by which the model parameters are adjusted (scaled) to be applicable to other, non- tested bond thicknesses is summarized, and all parameters of the model (scaled and unscaled) are presented so that other investigators can reproduce all of the simulations described in this report as well as simulations of the application of interest.

  1. Strengths, Weaknesses, Opportunities and Threats

    NARCIS (Netherlands)

    Bull, J.W.; Jobstvogt, N.; Böhnke-Henrichs, A.; Mascarenhas, A.; Sitas, N.; Baulcomb, C.; Lambini, C.K.; Rawlins, M.; Baral, H.; Zähringer, J.; Carter-Silk, E.; Balzan, M.V.; Kenter, J.O.; Häyhä, T.; Petz, K.; Koss, R.

    2016-01-01

    The ecosystem services concept (ES) is becoming a cornerstone of contemporary sustainability thought. Challenges with this concept and its applications are well documented, but have not yet been systematically assessed alongside strengths and external factors that influence uptake. Such an

  2. The Strengths of Black Families.

    Science.gov (United States)

    Hill, Robert B.

    This report identifies and analyzes five strengths of black families: adaptability roles, strong kinship bonds, strong work orientation, strong religious orientation, and achievement orientation. These five characteristics have been functional for the survival, advancement, and stability of black families. Most discussions of black families tend…

  3. Electronic Correlation Strength of Pu

    DEFF Research Database (Denmark)

    Svane, A.; C. Albers, R.; E. Christensen, N.

    2013-01-01

    A new electronic quantity, the correlation strength, is defined as a necessary step for understanding the properties and trends in strongly correlated electronic materials. As a test case, this is applied to the different phases of elemental Pu. Within the GW approximation we have surprisingly...

  4. Effect of Water on Coal Strength

    African Journals Online (AJOL)

    Bheema

    engineering design it is essential to establish the wet strength and ideally the water sensitivity of the rock, in order to assess their potential change in strength and deformability. It has been observed that there is a significant reduction in strength when water is absorbed by coal. It has also been observed that the strength is ...

  5. Response of MC3T3-E1cells on microroughen bioactive glass coated zirconia

    Directory of Open Access Journals (Sweden)

    Sapna Laxmi Tuladhar

    2017-10-01

    Full Text Available Background & Objectives:The objective of this study was to determine the cellular response of micro-roughened bioactive glass coated zirconia substrate (ZBR and non roughen bioactive glass coated zirconia substrate (ZB, and compare them with uncoated zirconia substrate (Z.  Materials & Methods:Surface micro-roughening was obtained using an Al2O3 sandblasting method. Abrasive blasting of zirconia coated bioactive glass produced an irregular finish with surface roughness average Ra 0.85 µm as determined by profilometer and scan electron microscope. Surface roughness of the samples in ascending order was ZBR>ZB>Z. Murine derived preosteoblast (MC3T3-E1 cells were seeded on the samples, and the cell morphology, growth, differentiation, were observed. Cell morphology was evaluated by means of scanning electron microscope (SEM, while cell proliferation and differentiation using MTT (3-(4,5-Dimethylthiazol-2-yl-2,5-diphenyltetrazolium bromide test and alkaline phosphates activity respectively. Results:The cell growth on all the samples continual increase with culturing up to 5days, showing good cell viability. However, there was no significant difference (p>0.05 with respect to the Z, ZB, and ZBR at day 5 at MTT assay. In particular, the alkaline phosphatase (ALP activity of the cells was significantly higher on the ZB and ZBR than Z samples at both 7 and 14 days.   Conclusion:Our findings demonstrate that bioactive glass coated surface was found to have better surface conditions to regulate bone cell differentiation 

  6. Effect of acetaminophen on osteoblastic differentiation and migration of MC3T3-E1 cells.

    Science.gov (United States)

    Nakatsu, Yoshihiro; Nakagawa, Fumio; Higashi, Sen; Ohsumi, Tomoko; Shiiba, Shunji; Watanabe, Seiji; Takeuchi, Hiroshi

    2017-07-15

    N-acetyl-p-aminophenol (APAP, acetaminophen, paracetamol) is a widely used analgesic/antipyretic with weak inhibitory effects on cyclooxygenase (COX) compared to non-steroidal anti-inflammatory drugs (NSAIDs). The mechanism of action of APAP is mediated by its metabolite that activates transient receptor potential channels, including transient receptor potential vanilloid 1 (TRPV1) and TRP ankyrin 1 (TRPA1) or the cannabinoid receptor type 1 (CB1). However, the exact molecular mechanism and target underlying the cellular actions of APAP remain unclear. Therefore, we investigated the effect of APAP on osteoblastic differentiation and cell migration, with a particular focus on TRP channels and CB1. Effects of APAP on osteoblastic differentiation and cell migration of MC3T3-E1, a mouse pre-osteoblast cell line, were assessed by the increase in alkaline phosphatase (ALP) activity, and both wound-healing and transwell-migration assays, respectively. APAP dose-dependently inhibited osteoblastic differentiation, which was well correlated with the effects on COX activity compared with other NSAIDs. In contrast, cell migration was promoted by APAP, and this effect was not correlated with COX inhibition. None of the agonists or antagonists of TRP channels and the CB receptor affected the APAP-induced cell migration, while the effect of APAP on cell migration was abolished by down-regulating TRPV4 gene expression. APAP inhibited osteoblastic differentiation via COX inactivation while it promoted cell migration independently of previously known targets such as COX, TRPV1, TRPA1 channels, and CB receptors, but through the mechanism involving TRPV4. APAP may have still unidentified molecular targets that modify cellular functions. Copyright © 2017 Institute of Pharmacology, Polish Academy of Sciences. Published by Elsevier Urban & Partner Sp. z o.o. All rights reserved.

  7. Lanreotide inhibits human jejunal secretion induced by prostaglandin E1 in healthy volunteers.

    Science.gov (United States)

    Sobhani, I; René, E; Ramdani, A; Bayod, F; Sabbagh, L C; Thomas, F; Mignon, M

    1996-02-01

    1. Somatostatin inhibits hormonal secretions in the gastrointestinal tract. Somatostatin analogues are used in the treatment of VIPome-related watery diarrhoea. In addition, more than 10% of patients with AIDS suffer from diarrhoea likely due to the increased intestinal secretion of water and ions. However, the direct effect of somatostatin on the flux of water and ions in the intestine has not been, so far, analyzed in vivo. The aim of the present study was to evaluate the effect of lanreotide, a somatostatin analogue, on the movements of water and ions in the jejunum in man. 2. Accordingly, 10 healthy volunteers (age 18-35 years, mean 27) and two patients with AIDS (26 and 33 years) suffering from water diarrhoea (> 800 ml day-1) underwent intestinal perfusion using a four lumen tube with proximal occluding balloon. The segment tested was 25 cm long. The jejunum was infused by an isotonic control saline solution containing polyethylene glycol (PEG) as nonabsorbable marker. Basal jejunal secretions were measured in all subjects. Prostaglandin E1 (PGE1) was administered intraluminally to stimulate jejunal secretion in healthy volunteers. The effect of intravenous lanreotide on the jejunal PGE1-induced secretions of water and electrolytes was analysed in healthy subjects and on the basal secretions in AIDS patients. Each period was analyzed on the basis of three (10 min) successive intestinal juice collections after 20-30 min equilibration time. The antisecretory effect of lanreotide was evaluated in each subject as the difference between fluxes compared to the control period. 3. In healthy volunteers, PGE1 induced secretion of H2O, Na+, K+ and Cl- in the jejunum and lanreotide reduced significantly PGE1-induced response. In both AIDS patients basal fluxes of water and ions were reduced by lanreotide in a dose-dependent manner. 4. Somatostatin can reduce stimulated-jejunal secretion of ions and water in normal subjects and may improve water diarrhoea in AIDS

  8. The human orphan nuclear receptor tailless (TLX, NR2E1 is druggable.

    Directory of Open Access Journals (Sweden)

    Cindy Benod

    Full Text Available Nuclear receptors (NRs are an important group of ligand-dependent transcriptional factors. Presently, no natural or synthetic ligand has been identified for a large group of orphan NRs. Small molecules to target these orphan NRs will provide unique resources for uncovering regulatory systems that impact human health and to modulate these pathways with drugs. The orphan NR tailless (TLX, NR2E1, a transcriptional repressor, is a major player in neurogenesis and Neural Stem Cell (NSC derived brain tumors. No chemical probes that modulate TLX activity are available, and it is not clear whether TLX is druggable. To assess TLX ligand binding capacity, we created homology models of the TLX ligand binding domain (LBD. Results suggest that TLX belongs to an emerging class of NRs that lack LBD helices α1 and α2 and that it has potential to form a large open ligand binding pocket (LBP. Using a medium throughput screening strategy, we investigated direct binding of 20,000 compounds to purified human TLX protein and verified interactions with a secondary (orthogonal assay. We then assessed effects of verified binders on TLX activity using luciferase assays. As a result, we report identification of three compounds (ccrp1, ccrp2 and ccrp3 that bind to recombinant TLX protein with affinities in the high nanomolar to low micromolar range and enhance TLX transcriptional repressive activity. We conclude that TLX is druggable and propose that our lead compounds could serve as scaffolds to derive more potent ligands. While our ligands potentiate TLX repressive activity, the question of whether it is possible to develop ligands to de-repress TLX activity remains open.

  9. The human orphan nuclear receptor tailless (TLX, NR2E1) is druggable.

    Science.gov (United States)

    Benod, Cindy; Villagomez, Rosa; Filgueira, Carly S; Hwang, Peter K; Leonard, Paul G; Poncet-Montange, Guillaume; Rajagopalan, Senapathy; Fletterick, Robert J; Gustafsson, Jan-Åke; Webb, Paul

    2014-01-01

    Nuclear receptors (NRs) are an important group of ligand-dependent transcriptional factors. Presently, no natural or synthetic ligand has been identified for a large group of orphan NRs. Small molecules to target these orphan NRs will provide unique resources for uncovering regulatory systems that impact human health and to modulate these pathways with drugs. The orphan NR tailless (TLX, NR2E1), a transcriptional repressor, is a major player in neurogenesis and Neural Stem Cell (NSC) derived brain tumors. No chemical probes that modulate TLX activity are available, and it is not clear whether TLX is druggable. To assess TLX ligand binding capacity, we created homology models of the TLX ligand binding domain (LBD). Results suggest that TLX belongs to an emerging class of NRs that lack LBD helices α1 and α2 and that it has potential to form a large open ligand binding pocket (LBP). Using a medium throughput screening strategy, we investigated direct binding of 20,000 compounds to purified human TLX protein and verified interactions with a secondary (orthogonal) assay. We then assessed effects of verified binders on TLX activity using luciferase assays. As a result, we report identification of three compounds (ccrp1, ccrp2 and ccrp3) that bind to recombinant TLX protein with affinities in the high nanomolar to low micromolar range and enhance TLX transcriptional repressive activity. We conclude that TLX is druggable and propose that our lead compounds could serve as scaffolds to derive more potent ligands. While our ligands potentiate TLX repressive activity, the question of whether it is possible to develop ligands to de-repress TLX activity remains open.

  10. Scattering by an electromagnetic radiation field

    Science.gov (United States)

    Bini, D.; Geralico, A.

    2012-02-01

    Motion of test particles in the gravitational field associated with an electromagnetic plane wave is investigated. The interaction with the radiation field is modeled by a force term à la Poynting-Robertson entering the equations of motion given by the 4-momentum density of radiation observed in the particle’s rest frame with a multiplicative constant factor expressing the strength of the interaction itself. Explicit analytical solutions are obtained. Scattering of fields by the electromagnetic wave, i.e., scalar (spin 0), massless spin (1)/(2) and electromagnetic (spin 1) fields, is studied too.

  11. Ethanol metabolism by alcohol dehydrogenase or cytochrome P4502E1 differentially impairs hepatic protein trafficking and growth hormone signaling.

    Science.gov (United States)

    Doody, Erin E; Groebner, Jennifer L; Walker, Jetta R; Frizol, Brittnee M; Tuma, Dean J; Fernandez, David J; Tuma, Pamela L

    2017-12-01

    The liver metabolizes alcohol using alcohol dehydrogenase (ADH) and cytochrome P 450 2E1 (CYP2E1). Both enzymes metabolize ethanol into acetaldehyde, but CYP2E1 activity also results in the production of reactive oxygen species (ROS) that promote oxidative stress. We have previously shown that microtubules are hyperacetylated in ethanol-treated polarized, hepatic WIF-B cells and livers from ethanol-fed rats. We have also shown that enhanced protein acetylation correlates with impaired clathrin-mediated endocytosis, constitutive secretion, and nuclear translocation and that the defects are likely mediated by acetaldehyde. However, the roles of CYP2E1-generated metabolites and ROS in microtubule acetylation and these alcohol-induced impairments have not been examined. To determine if CYP2E1-mediated alcohol metabolism is required for enhanced acetylation and the trafficking defects, we coincubated cells with ethanol and diallyl sulfide (DAS; a CYP2E1 inhibitor) or N -acetyl cysteine (NAC; an antioxidant). Both agents failed to prevent microtubule hyperacetylation in ethanol-treated cells and also failed to prevent impaired secretion or clathrin-mediated endocytosis. Somewhat surprisingly, both DAS and NAC prevented impaired STAT5B nuclear translocation. Further examination of microtubule-independent steps of the pathway revealed that Jak2/STAT5B activation by growth hormone was prevented by DAS and NAC. These results were confirmed in ethanol-exposed HepG2 cells expressing only ADH or CYP2E1. Using quantitative RT-PCR, we further determined that ethanol exposure led to blunted growth hormone-mediated gene expression. In conclusion, we determined that alcohol-induced microtubule acetylation and associated defects in microtubule-dependent trafficking are mediated by ADH metabolism whereas impaired microtubule-independent Jak2/STAT5B activation is mediated by CYP2E1 activity. NEW & NOTEWORTHY Impaired growth hormone-mediated signaling is observed in ethanol

  12. Mechanism-based inactivation of cytochromes P450 2E1 and 2E1 T303A by tert-butyl acetylenes: characterization of reactive intermediate adducts to the heme and apoprotein.

    Science.gov (United States)

    Blobaum, Anna L; Kent, Ute M; Alworth, William L; Hollenberg, Paul F

    2002-12-01

    The kinetics for the inactivation of cytochrome P450 2E1 and the mutant P450 2E1 T303A by tert-butyl acetylene (tBA) and tert-butyl 1-methyl-2-propynyl ether (tBMP) were investigated. The two acetylenes inactivated the 7-ethoxy-4-(trifluoromethyl)coumarin (7-EFC) O-deethylation activity of purified rabbit P450s 2E1 and 2E1 T303A in a reconstituted system in a time-, concentration-, and NADPH-dependent manner. The K(I) values for the inactivation of P450s 2E1 and 2E1 T303A by tBA were 1.0 and 2.0 mM, the k(inact) values were 0.20 and 0.38 min(-)(1), and the t(1/2) values were 3.5 and 1.8 min, respectively. The K(I) values for the tBMP-inactivated P450s were 0.1 and 1.0 mM, the k(inact) values were 0.12 and 0.07 min(-)(1), and the t(1/)(2) values were 5.9 and 10.2 min, respectively. Losses in enzyme activity occurred with concurrent losses in the P450 CO spectrum and P450 heme, which were accompanied by the appearance of two different tBA- or tBMP-modified heme products in each inactivated sample. LC-MS analysis of the adducts showed masses of 661 or 705 Da, consistent with the mass of an iron-depleted heme plus the masses of a tBA or tBMP reactive intermediate and one oxygen atom, respectively. Only the tBA-inactivated P450 2E1 revealed a tBA-adducted apoprotein with an increase in mass of 99 Da, corresponding to the mass of tBA plus one oxygen atom. Surprisingly, the inactivation, CO spectral and heme loss, and heme adduct formation of the tBA-inactivated T303A mutant were completely reversible after dialysis. In addition, metabolism of para-nitrophenol was not compromised by the tBA-inactivated T303A mutant. Therefore, our studies on the inactivation of P450s 2E1 and 2E1 T303A by tBA and tBMP suggest the existence of three distinct mechanisms for inactivation, among which includes a novel, reversible heme alkylation that has not been previously described with P450 enzymes.

  13. Radiation Detection Computational Benchmark Scenarios

    Energy Technology Data Exchange (ETDEWEB)

    Shaver, Mark W.; Casella, Andrew M.; Wittman, Richard S.; McDonald, Ben S.

    2013-09-24

    Modeling forms an important component of radiation detection development, allowing for testing of new detector designs, evaluation of existing equipment against a wide variety of potential threat sources, and assessing operation performance of radiation detection systems. This can, however, result in large and complex scenarios which are time consuming to model. A variety of approaches to radiation transport modeling exist with complementary strengths and weaknesses for different problems. This variety of approaches, and the development of promising new tools (such as ORNL’s ADVANTG) which combine benefits of multiple approaches, illustrates the need for a means of evaluating or comparing different techniques for radiation detection problems. This report presents a set of 9 benchmark problems for comparing different types of radiation transport calculations, identifying appropriate tools for classes of problems, and testing and guiding the development of new methods. The benchmarks were drawn primarily from existing or previous calculations with a preference for scenarios which include experimental data, or otherwise have results with a high level of confidence, are non-sensitive, and represent problem sets of interest to NA-22. From a technical perspective, the benchmarks were chosen to span a range of difficulty and to include gamma transport, neutron transport, or both and represent different important physical processes and a range of sensitivity to angular or energy fidelity. Following benchmark identification, existing information about geometry, measurements, and previous calculations were assembled. Monte Carlo results (MCNP decks) were reviewed or created and re-run in order to attain accurate computational times and to verify agreement with experimental data, when present. Benchmark information was then conveyed to ORNL in order to guide testing and development of hybrid calculations. The results of those ADVANTG calculations were then sent to PNNL for

  14. Prediction of potential compressive strength of Portland clinker from its mineralogy

    DEFF Research Database (Denmark)

    Svinning, K.; Høskuldsson, Agnar; Justnes, H.

    2010-01-01

    Based on a statistical model first applied for prediction of compressive strength up to 28 d from the microstructure of Portland cement, potential compressive strength of clinker has been predicted from its mineralogy. The prediction model was evaluated by partial least squares regression....... The mineralogy was described by patterns from X-ray diffraction analysis in the 20-regions 29.88-30.70 degrees and 32.90-34.10 degrees (using CuK alpha-radiation). It has been shown that prediction of potential compressive strength of clinker up to 28 d from the observed variation in the mineralogy gave...... a significant variation of the strength at both 1 and 28 d. Sensitivity analysis based on simulation, optimisation and prediction made it possible to study the influence of the mineralogy on the strength in more detail....

  15. Immunological characterization of a modified vaccinia virus Ankara vector expressing the human papillomavirus 16 E1 protein.

    Science.gov (United States)

    Remy-Ziller, Christelle; Germain, Claire; Spindler, Anita; Hoffmann, Chantal; Silvestre, Nathalie; Rooke, Ronald; Bonnefoy, Jean-Yves; Préville, Xavier

    2014-02-01

    Women showing normal cytology but diagnosed with a persistent high-risk human papillomavirus (HR-HPV) infection have a higher risk of developing high-grade cervical intraepithelial neoplasia and cervical cancer than noninfected women. As no therapeutic management other than surveillance is offered to these women, there is a major challenge to develop novel targeted therapies dedicated to the treatment of these patients. As such, E1 and E2 antigens, expressed early in the HPV life cycle, represent very interesting candidates. Both proteins are necessary for maintaining coordinated viral replication and gene synthesis during the differentiation process of the epithelium and are essential for the virus to complete its normal and propagative replication cycle. In the present study, we evaluated a new active targeted immunotherapeutic, a modified vaccinia virus Ankara (MVA) vector containing the E1 sequence of HPV16, aimed at inducing cellular immune responses with the potential to help and clear persistent HPV16-related infection. We carried out an extensive comparative time course analysis of the cellular immune responses induced by different schedules of immunization in C57BL/6 mice. We showed that multiple injections of MVA-E1 allowed sustained HPV16 E1-specific cellular immune responses in vaccinated mice and had no impact on the exhaustion phenotype of the generated HPV16 E1-specific CD8⁺ T cells, but they led to the differentiation of multifunctional effector T cells with high cytotoxic capacity. This study provides proof of concept that an MVA expressing HPV16 E1 can induce robust and long-lasting E1-specific responses and warrants further development of this candidate.

  16. Oncolytic E1B 55KDa-deleted adenovirus replication is independent of p53 levels in cancer cells.

    Science.gov (United States)

    Abbas, B M; El-Mogy, M A; Haj-Ahmad, Y

    2017-08-15

    Oncolytic adenoviruses represent a new approach for cancer therapy due to its tumor specificity. E1B 55kDa-deleted adenovirus type 5 (Ad5dlE1B 55kDa) is a promising therapeutic agent that can selectively replicate in and lyse p53 defective cancer cells. However, the overall efficacy has shown varying degrees of success with raised doubts about the correlation between p53 status and E1B-deleted adenovirus replication ability. In this study, we investigated the relationship between the efficiency of Ad5dlE1B 55kDa replication and p53 levels in cancer cells. Five transient p53 expression vectors were engineered to expresses different p53 levels in transfected cells. Then, the effect of the variable p53 levels and cellular backgrounds on the replication efficiency of oncolytic Ad5dlE1B 55kDa was evaluated in H1299 and HeLa cell lines. We found that the replication efficiency of these oncolytic viruses is dependent on the status, but not the expression levels, of p53. Ad5dlE1B 55kDa was shown to have selective replication activity in H1299 cells (p53-null) and decreased viral replication in HeLa cells (p53-positive), relative to the wild-type adenovirus in both cell lines. Our findings suggest that there is a relation between the E1B-deleted adenovirus replication and the presence as well as the activity of p53, independent of its quantity.

  17. Differential polarization of immune responses by plant 2S seed albumins, Ber e 1, and SFA8.

    Science.gov (United States)

    Kean, Dorothy E; Goodridge, Helen S; McGuinness, Stephen; Harnett, Margaret M; Alcocer, Marcos J C; Harnett, William

    2006-08-01

    The plant 2S seed albumins Ber e 1 and SFA8, although structurally very similar, vary with respect to their allergenic properties. Whereas the former represents a major allergen, the latter appears to promote only weak allergenic responses. The aim of this investigation was to determine whether the allergenic properties of Ber e 1 and SFA8 reflected differential polarization of dendritic cell (DC) and Th cell responses. We thus investigated the effect of recombinant forms of both allergens on DC and Th cell responses as indicated by cell surface phenotype and cytokine production. Exposure of murine DCs to SFA8, but not Ber e 1, resulted in production of the cytokines IL-12 p40 and TNF-alpha by a mechanism independent of recognition by TLRs. Furthermore, depending on the mouse strain used, increased expression of MHC class II and costimulatory molecules such as CD40, CD80, and CD86 was associated with exposure to SFA8, but not Ber e 1. In coculture experiments using the DO11.10 transgenic T cell that recognizes OVA peptide, DCs exposed to both allergens induced T cells to produce IFN-gamma, but only Ber e 1 could induce significant production of IL-4 and IL-5. Likewise, analysis of transcription factors shows increased T-bet with respect to both allergens, but also GATA-3 with respect to Ber e 1. Overall, our data are consistent with the idea that the ability of Ber e 1, but not SFA8, to act as a potent allergen may reflect differences in their ability to induce IL-12 production.

  18. Solution structure, copper binding and backbone dynamics of recombinant Ber e 1-the major allergen from Brazil nut.

    Science.gov (United States)

    Rundqvist, Louise; Tengel, Tobias; Zdunek, Janusz; Björn, Erik; Schleucher, Jürgen; Alcocer, Marcos J C; Larsson, Göran

    2012-01-01

    The 2S albumin Ber e 1 is the major allergen in Brazil nuts. Previous findings indicated that the protein alone does not cause an allergenic response in mice, but the addition of components from a Brazil nut lipid fraction were required. Structural details of Ber e 1 may contribute to the understanding of the allergenic properties of the protein and its potential interaction partners. The solution structure of recombinant Ber e 1 was solved using NMR spectroscopy and measurements of the protein back bone dynamics at a residue-specific level were extracted using (15)N-spin relaxation. A hydrophobic cavity was identified in the structure of Ber e 1. Using the paramagnetic relaxation enhancement property of Cu(2+) in conjunction with NMR, it was shown that Ber e 1 is able to specifically interact with the divalent copper ion and the binding site was modeled into the structure. The IgE binding region as well as the copper binding site show increased dynamics on both fast ps-ns timescale as well as slower µs-ms timescale. The overall fold of Ber e 1 is similar to other 2S albumins, but the hydrophobic cavity resembles that of a homologous non-specific lipid transfer protein. Ber e 1 is the first 2S albumin shown to interact with Cu(2+) ions. This Cu(2+) binding has minimal effect on the electrostatic potential on the surface of the protein, but the charge distribution within the hydrophobic cavity is significantly altered. As the hydrophobic cavity is likely to be involved in a putative lipid interaction the Cu(2+) can in turn affect the interaction that is essential to provoke an allergenic response.

  19. Solution Structure, Copper Binding and Backbone Dynamics of Recombinant Ber e 1–The Major Allergen from Brazil Nut

    Science.gov (United States)

    Rundqvist, Louise; Tengel, Tobias; Zdunek, Janusz; Björn, Erik; Schleucher, Jürgen; Alcocer, Marcos J. C.; Larsson, Göran

    2012-01-01

    Background The 2S albumin Ber e 1 is the major allergen in Brazil nuts. Previous findings indicated that the protein alone does not cause an allergenic response in mice, but the addition of components from a Brazil nut lipid fraction were required. Structural details of Ber e 1 may contribute to the understanding of the allergenic properties of the protein and its potential interaction partners. Methodology/Principal Findings The solution structure of recombinant Ber e 1 was solved using NMR spectroscopy and measurements of the protein back bone dynamics at a residue-specific level were extracted using 15N-spin relaxation. A hydrophobic cavity was identified in the structure of Ber e 1. Using the paramagnetic relaxation enhancement property of Cu2+ in conjunction with NMR, it was shown that Ber e 1 is able to specifically interact with the divalent copper ion and the binding site was modeled into the structure. The IgE binding region as well as the copper binding site show increased dynamics on both fast ps-ns timescale as well as slower µs-ms timescale. Conclusions/Significance The overall fold of Ber e 1 is similar to other 2S albumins, but the hydrophobic cavity resembles that of a homologous non-specific lipid transfer protein. Ber e 1 is the first 2S albumin shown to interact with Cu2+ ions. This Cu2+ binding has minimal effect on the electrostatic potential on the surface of the protein, but the charge distribution within the hydrophobic cavity is significantly altered. As the hydrophobic cavity is likely to be involved in a putative lipid interaction the Cu2+ can in turn affect the interaction that is essential to provoke an allergenic response. PMID:23056307

  20. Structural Dissection of a Gating Mechanism Preventing Misactivation of Ubiquitin by NEDD8’s E1

    Energy Technology Data Exchange (ETDEWEB)

    Souphron,J.; Waddell, M.; Paydar, A.; Tokgöz-Gromley, Z.; Roussel, M.; Schulman, B.

    2008-01-01

    Post-translational covalent modification by ubiquitin and ubiquitin-like proteins (UBLs) is a major eukaryotic mechanism for regulating protein function. In general, each UBL has its own E1 that serves as the entry point for a cascade. The E1 first binds the UBL and catalyzes adenylation of the UBL's C-terminus, prior to promoting UBL transfer to a downstream E2. Ubiquitin's Arg 72, which corresponds to Ala72 in the UBL NEDD8, is a key E1 selectivity determinant: swapping ubiquitin and NEDD8 residue 72 identity was shown previously to swap their E1 specificity. Correspondingly, Arg190 in the UBA3 subunit of NEDD8's heterodimeric E1 (the APPBP1-UBA3 complex), which corresponds to a Gln in ubiquitin's E1 UBA1, is a key UBL selectivity determinant. Here, we dissect this specificity with biochemical and X-ray crystallographic analysis of APPBP1-UBA3-NEDD8 complexes in which NEDD8's residue 72 and UBA3's residue 190 are substituted with different combinations of Ala, Arg, or Gln. APPBP1-UBA3's preference for NEDD8's Ala72 appears to be indirect, due to proper positioning of UBA3's Arg190. By contrast, our data are consistent with direct positive interactions between ubiquitin's Arg72 and an E1's Gln. However, APPBP1-UBA3's failure to interact with a UBL having Arg72 is not due to a lack of this favorable interaction, but rather arises from UBA3's Arg190 acting as a negative gate. Thus, parallel residues from different UBL pathways can utilize distinct mechanisms to dictate interaction selectivity, and specificity can be amplified by barriers that prevent binding to components of different conjugation cascades.

  1. Integrating Wireless Networking for Radiation Detection

    Science.gov (United States)

    Board, Jeremy; Barzilov, Alexander; Womble, Phillip; Paschal, Jon

    2006-10-01

    As wireless networking becomes more available, new applications are being developed for this technology. Our group has been studying the advantages of wireless networks of radiation detectors. With the prevalence of the IEEE 802.11 standard (``WiFi''), we have developed a wireless detector unit which is comprised of a 5 cm x 5 cm NaI(Tl) detector, amplifier and data acquisition electronics, and a WiFi transceiver. A server may communicate with the detector unit using a TCP/IP network connected to a WiFi access point. Special software on the server will perform radioactive isotope determination and estimate dose-rates. We are developing an enhanced version of the software which utilizes the receiver signal strength index (RSSI) to estimate source strengths and to create maps of radiation intensity.

  2. Polyphosphates inhibit extracellular matrix mineralization in MC3T3-E1 osteoblast cultures.

    Science.gov (United States)

    Hoac, Betty; Kiffer-Moreira, Tina; Millán, José Luis; McKee, Marc D

    2013-04-01

    Studies on various compounds of inorganic phosphate, as well as on organic phosphate added by post-translational phosphorylation of proteins, all demonstrate a central role for phosphate in biomineralization processes. Inorganic polyphosphates are chains of orthophosphates linked by phosphoanhydride bonds that can be up to hundreds of orthophosphates in length. The role of polyphosphates in mammalian systems, where they are ubiquitous in cells, tissues and bodily fluids, and are at particularly high levels in osteoblasts, is not well understood. In cell-free systems, polyphosphates inhibit hydroxyapatite nucleation, crystal formation and growth, and solubility. In animal studies, polyphosphate injections inhibit induced ectopic calcification. While recent work has proposed an integrated view of polyphosphate function in bone, little experimental data for bone are available. Here we demonstrate in osteoblast cultures producing an abundant collagenous matrix that normally show robust mineralization, that two polyphosphates (PolyP5 and PolyP65, polyphosphates of 5 and 65 phosphate residues in length) are potent mineralization inhibitors. Twelve-day MC3T3-E1 osteoblast cultures with added ascorbic acid (for collagen matrix assembly) and β-glycerophosphate (a source of phosphate for mineralization) were treated with either PolyP5 or PolyP65. Von Kossa staining and calcium quantification revealed that mineralization was inhibited in a dose-dependent manner by both polyphosphates, with complete mineralization inhibition at 10μM. Cell proliferation and collagen assembly were unaffected by polyphosphate treatment, indicating that polyphosphate inhibition of mineralization results not from cell and matrix effects but from direct inhibition of mineralization. This was confirmed by showing that PolyP5 and PolyP65 bound to synthetic hydroxyapatite in a concentration-dependent manner. Tissue-nonspecific alkaline phosphatase (TNAP, ALPL) efficiently hydrolyzed the two PolyPs as

  3. Mapping Lunar global chemical composition from Chang'E-1 IIM data

    Science.gov (United States)

    Yan, Bokun; Xiong, Sheng Qing; Wu, Yunzhao; Wang, Zhenchao; Dong, Lina; Gan, Fuping; Yang, Suming; Wang, Runsheng

    2012-07-01

    The global distribution of the chemical composition of the lunar surface is an important factor helping us to understand the formation and evolution of the Moon. In this paper, formulas were established for deriving FeO, TiO2, Al2O3 and MnO abundances from Chang'E-1 (CE-1) Interference Imaging Spectrometer (IIM) data on the basis of the method "color ratio of UV/VIS and NIR/VIS versus VIS reflectance diagram" which was put forward by Lucey and Blewett. Global high-resolution maps (200 m/pixel) of FeO, TiO2, Al2O3 and MnO were produced, and then compared qualitatively with results from Clementine UVVIS, Lunar Prospector (LP) Gamma-Ray Spectrometer (GRS) and Neutron Prospector (NS) data. The abundance ranges of the above four elements are 0-21.0 wt%, 0-9.5 wt%, 5.4-32.1 wt%, and 0.015-0.28 wt% respectively. The abundance range of FeO is consistent with the results from LP-GRS data reported by Gillis et al. (2004), and the abundance range of TiO2 is consistent with the results from LP-NS data reported by Elphic et al. (2002). Relative abundance distributions of FeO and TiO2 from Clementine and IIM data are slightly different from those from LP-GRS and LP-NS data. In map from the LP-GRS data, FeO abundances are the highest at Oceanus Procellarum and Mare Imbrium. However, in the map from CE-1 IIM data they are the highest at Oceanus Procellarum and Mare Tranquillitatis. Although the spatial resolution of these maps is high, caution must be taken when the maps in this paper are used at the crater scale because they suffer from errors owing to topographically induced shading. In future work, a high-accuracy DEM from Lunar Reconnaissance Orbiter Mission Laser Altimeter (LOLA) data coupled with a photometric model can probably be used to resolve this problem.

  4. Roles of cytochrome P4502E1 gene polymorphisms and the risks of alcoholic liver disease: a meta-analysis.

    Directory of Open Access Journals (Sweden)

    Tao Zeng

    Full Text Available BACKGROUND: Previous studies investigating the association between cytochrome P4502E1 (CYP2E1 polymorphisms and the risk of alcoholic liver diseases (ALD have yielded conflicting results. Thus, a meta-analysis was performed to clarify the association between CYP2E1 polymorphisms and the risks of ALD. METHODS: A comprehensive literature search was conducted to identify the relevant studies. The fixed or random effect model was selected based on the heterogeneity test among studies. Publication bias was estimated using Begg's funnel plots and Egger's regression test. RESULTS: A total of 27 and 9 studies were finally included for the association between the CYP2E1 Pst I/Rsa I or Dra I polymorphisms and the risks of ALD, respectively. Overall, the combined results showed that homozygous genotype c2c2 was significantly associated with increase risk of ALD in worldwide populations (c2c2 vs. c1c1: OR = 3.12, 95%CI 1.91-5.11 when ALD patients were compared with alcoholics without ALD. Significant associations between CYP2E1 Pst I/Rsa I polymorphism and ALD risk were also observed in Asians (c2c2 vs. c1c1: OR = 4.11, 95%CI 2.32-7.29 and in Caucasians (c2c2/c1c2 vs. c1c1: OR = 1.58, 95%CI 1.04-2.42 when ALD patients were compared with alcoholics without ALD. However, subgroup analysis stratified by ALD types showed that CYP2E1 Pst I/Rsa I polymorphism was not significantly associated with the risks of alcoholic cirrhosis (ALC. No significant association was observed between CYP2E1 Dra I polymorphism and ALD risks. CONCLUSION: This meta-analysis suggested that CYP2E1 Pst I/Rsa I polymorphism might be not significantly associated with advanced form of ALD (ALC, but might be significantly associated with other form of ALD such as steatosis, hepatisis, fibrosis. Furthermore, CYP2E1 Dra I polymorphism might be not significantly associated with the ALD risks. Since potential confounders could not be ruled out completely, further studies were needed to confirm

  5. Proliferation and osteogenic response of MC3T3-E1 pre-osteoblastic cells on porous zirconia ceramics stabilized with magnesia or yttria.

    Science.gov (United States)

    Hadjicharalambous, Chrystalleni; Mygdali, Evdokia; Prymak, Oleg; Buyakov, Ales; Kulkov, Sergei; Chatzinikolaidou, Maria

    2015-11-01

    Dense zirconia ceramics are used in bone applications due to their mechanical strength and biocompatibility, but lack osseointegration. A porous interface in contact with bone tissue may lead to better bone bonding but the biological properties of porous zirconia are not widely explored. The present study focuses on the manufacturing of an yttria- (YSZ) and a magnesia-stabilized (MgSZ) porous zirconia, and on their in vitro biological investigation. The sintered ceramics had similar characteristics of porosity, pore size and interconnectivity. Their elastic moduli and compressive strength values were within the range of the values of human cortical bone. MC3T3-E1 pre-osteoblasts were used to investigate the proliferation, alkaline phosphatase (ALP) activity, collagen deposition and expression profile of four genes involved in bone metabolism of cells on porous ceramics. Scanning electron and fluorescence microscopy were employed to visualize cell morphology and growth. Pre-osteoblasts adhered well on both ceramics but cell numbers on YSZ were higher. Cells exhibited an increase in ALP activity and collagen deposition after 14 days on both MgSZ and YSZ, with higher levels on YSZ. Real-time quantitative polymerase chain reaction (qPCR) showed that the expression of bone sialoprotein (Bsp) and collagen type I (col1aI) were significantly higher on YSZ. No significant differences were found in their ability to regulate the early gene expression of Runx2 and Alp. Nevertheless, the biomineralized calcium content was similar on both ceramics after 21 days, indicating that despite chemical differences, both scaffolds direct the pre-osteoblasts toward a mature state capable of mineralizing the extracellular matrix. © 2015 Wiley Periodicals, Inc.

  6. Early-Onset Diabetic E1-DN Mice Develop Albuminuria and Glomerular Injury Typical of Diabetic Nephropathy

    Directory of Open Access Journals (Sweden)

    Mervi E. Hyvönen

    2015-01-01

    Full Text Available The transgenic E1-DN mice express a kinase-negative epidermal growth factor receptor in their pancreatic islets and are diabetic from two weeks of age due to impaired postnatal growth of β-cell mass. Here, we characterize the development of hyperglycaemia-induced renal injury in the E1-DN mice. Homozygous mice showed increased albumin excretion rate (AER at the age of 10 weeks; the albuminuria increased over time and correlated with blood glucose. Morphometric analysis of PAS-stained histological sections and electron microscopy images revealed mesangial expansion in homozygous E1-DN mice, and glomerular sclerosis was observed in the most hyperglycaemic mice. The albuminuric homozygous mice developed also other structural changes in the glomeruli, including thickening of the glomerular basement membrane and widening of podocyte foot processes that are typical for diabetic nephropathy. Increased apoptosis of podocytes was identified as one mechanism contributing to glomerular injury. In addition, nephrin expression was reduced in the podocytes of albuminuric homozygous E1-DN mice. Tubular changes included altered epithelial cell morphology and increased proliferation. In conclusion, hyperglycaemic E1-DN mice develop albuminuria and glomerular and tubular injury typical of human diabetic nephropathy and can serve as a new model to study the mechanisms leading to the development of diabetic nephropathy.

  7. The adenovirus oncoprotein E1a stimulates binding of transcription factor ETF to transcriptionally activate the p53 gene.

    Science.gov (United States)

    Hale, T K; Braithwaite, A W

    1999-08-20

    Expression of the tumor suppressor protein p53 plays an important role in regulating the cellular response to DNA damage. During adenovirus infection, levels of p53 protein also increase. It has been shown that this increase is due not only to increased stability of the p53 protein but to the transcriptional activation of the p53 gene during infection. We demonstrate here that the E1a proteins of adenovirus are responsible for activating the mouse p53 gene and that both major E1a proteins, 243R and 289R, are required for complete activation. E1a brings about the binding of two cellular transcription factors to the mouse p53 promoter. One of these, ETF, binds to three upstream sites in the p53 promoter and one downstream site, whereas E2F binds to one upstream site in the presence of E1a. Our studies indicate that E2F binding is not essential for activation of the p53 promoter but that ETF is. Our data indicate the ETF site located downstream of the start site of transcription is the key site in conferring E1a responsiveness on the p53 promoter.

  8. Acetato?(N-[(E)-1-(6-methyl-2-pyrid?yl)methyl?idene]-2-{2-[(E)-1-(6-methyl-2-pyrid?yl)methyl?idene?amino]?pheneth?yl}aniline)nickel(II) perchlorate

    OpenAIRE

    Sarkar, Shuranjan; Lee, Hajin; Lee, Hong-In

    2010-01-01

    In the title complex, [Ni(CH3COO)(C28H26N4)]ClO4, the NiII atom is coordinated by two imine N atoms and two pyridine N atoms of the N-[(E)-1-(6-methyl-2-pyridyl)methylidene]-2-(2-[(E)-1-(6-methyl-2-pyridyl)methylideneamino]phenethyl)aniline donor ligand and two O atoms of the acetate ion in a distorted octahedral coordination. The average Ni—N and Ni—O bond lengths are 2.131 (13) and 2.098 (11) Å, respectively. An intramolecular N&...

  9. Photon Strength Functions for ^156, 157, 159Gd

    Science.gov (United States)

    Baramsai, Bayarbadrakh; Mitchell, G. E.; Chyzh, A.; Dashdorj, D.; Walker, C.; Bredeweg, T. A.; Couture, A.; Haight, R. C.; Jandel, M.; Keksis, A. L.; O'Donnell, J. M.; Rundberg, R. S.; Wouters, J. M.; Ullmann, J. L.; Vieira, D. J.; Agvaanluvsan, U.; Becvar, F.; Krticka, M.

    2010-11-01

    In recent years the low energy behavior of the Photon Strength Function (PSF) has attracted much attention. A completely consistent description of this behavior is not available. The neutron capture γ-ray spectra measured by the DANCE detector array located at the Los Alamos Neutron Science Center has been used for the study of the PSF below the neutron separation energy. The radiative decay of the compound nuclei ^156, 157, 159Gd has been measured. The spectra were simulated with the DICEBOX code. A variety of phenomenological models of the PSF were considered in the simulations. Comparison of the experimental and simulated spectra will be presented.

  10. Tensile strength and the mining of black holes.

    Science.gov (United States)

    Brown, Adam R

    2013-11-22

    There are a number of important thought experiments that involve raising and lowering boxes full of radiation in the vicinity of black hole horizons. This Letter looks at the limitations placed on these thought experiments by the null energy condition, which imposes a fundamental bound on the tensile-strength-to-weight ratio of the materials involved, makes it impossible to build a box near the horizon that is wider than a single wavelength of the Hawking quanta, and puts a severe constraint on the operation of "space elevators" near black holes. In particular, it is shown that proposals for mining black holes by lowering boxes near the horizon, collecting some Hawking radiation, and dragging it out to infinity cannot proceed nearly as rapidly as has previously been claimed. As a consequence of this limitation, the boxes and all the moving parts are superfluous and black holes can be destroyed equally rapidly by threading the horizon with strings.

  11. Gravitation radiation observations

    OpenAIRE

    Glass, E. N.

    2017-01-01

    The notion of gravitational radiation begins with electromagnetic radiation. In 1887 Heinrich Hertz, working in one room, generated and received electromagnetic radiation. Maxwell's equations describe the electromagnetic field. The quanta of electromagnetic radiation are spin 1 photons. They are fundamental to atomic physics and quantum electrodynamics.

  12. Detection of Terahertz Radiation

    DEFF Research Database (Denmark)

    2015-01-01

    The present invention relates to a system for detecting terahertz radiation, a camera device, and a method for detecting terahertz radiation.......The present invention relates to a system for detecting terahertz radiation, a camera device, and a method for detecting terahertz radiation....

  13. Strength Properties of Aalborg Clay

    DEFF Research Database (Denmark)

    Iversen, Kirsten Malte; Nielsen, Benjaminn Nordahl; Augustesen, Anders Hust

    In the northern part of Vendsyssel, Denmark, the deposits made in the late glacial time are formed by the sea. The deposits are named after two mussels: Yoldia clay and Saxicava sand. However, in the southern part of Vendsyssel and in the area of Aalborg the clay and sand deposits from the late...... glacial time are characterised by the absence of this mussel. These deposits are named Aalborg Clay and Aalborg Sand. In the city of Aalborg, a fill layer superposes Aalborg Clay. This layer is at some places found to be 6m thick. This fill layer does not provide sufficient bearing capacity, which has...... resulted in many damaged buildings in Aalborg. To provide sufficient bearing capacity it is therefore necessary either to remove the fill or to construct the building on piles. Both methods imply that the strength of Aalborg Clay is important for the construction. This paper evaluates the strength...

  14. Strength training and shoulder proprioception.

    Science.gov (United States)

    Salles, José Inácio; Velasques, Bruna; Cossich, Victor; Nicoliche, Eduardo; Ribeiro, Pedro; Amaral, Marcus Vinicius; Motta, Geraldo

    2015-03-01

    Proprioception is essential to motor control and joint stability during daily and sport activities. Recent studies demonstrated that athletes have better joint position sense (JPS) when compared with controls matched for age, suggesting that physical training could have an effect on proprioception. To evaluate the result of an 8-week strength-training program on shoulder JPS and to verify whether using training intensities that are the same or divergent for the shoulder's dynamic-stabilizer muscles promote different effects on JPS. Randomized controlled clinical trial. We evaluated JPS in a research laboratory and conducted training in a gymnasium. A total of 90 men, right handed and asymptomatic, with no history of any type of injury or shoulder instability. For 8 weeks, the participants performed the strength-training program 3 sessions per week. We used 4 exercises (bench press, lat pull down, shoulder press, and seated row), with 2 sets each. We measured shoulder JPS acuity by calculating the absolute error. We found an interaction between group and time. To examine the interaction, we conducted two 1-way analyses of variance comparing groups at each time. The groups did not differ at pretraining; however, a difference among groups was noted posttraining. Strength training using exercises at the same intensity produced an improvement in JPS compared with exercises of varying intensity, suggesting that the former resulted in improvements in the sensitivity of muscle spindles and, hence, better neuromuscular control in the shoulder.

  15. Strength Variation of Parachute Joints

    Science.gov (United States)

    Mollmann, Catherine

    2017-01-01

    A parachute joint is defined as a location where a component is sewn or connected to another component. During the design and developmental phase of a parachute system, the joints for each structural component are isolated and tested through a process called seam and joint testing. The objective of seam and joint testing is to determine the degradation on a single component due to interaction with other components; this data is then used when calculating the margin of safety for that component. During the engineering developmental phase of CPAS (Capsule Parachute Assembly System), the parachute system for the NASA Orion Crew Module, testing was completed for every joint of the six subsystems: the four parachutes (main, drogue, pilot, and FBCP [forward bay cover parachute]), the retention release bridle, and the retention panels. The number of joint tests for these subsystems totaled 92, which provides a plethora of data and results for further analysis. In this paper, the data and results of these seam and joint tests are examined to determine the effects, if any, of different operators and sewing machines on the strength of parachute joints. Other variables are also studied to determine their effect on joint strength, such as joint complexity, joint strength magnitude, material type, and material construction. Findings reveal that an optimally-run seam and joint test program could result in an increased understanding of the structure of the parachute; this should lead to a parachute built with optimal components, potentially saving system weight and volume.

  16. Thermal radiation heat transfer.

    Science.gov (United States)

    Siegel, R.; Howell, J. R.

    1972-01-01

    A comprehensive discussion of heat transfer by thermal radiation is presented, including the radiative behavior of materials, radiation between surfaces, and gas radiation. Among the topics considered are property prediction by electromagnetic theory, the observed properties of solid materials, radiation in the presence of other modes of energy transfer, the equations of transfer for an absorbing-emitting gas, and radiative transfer in scattering and absorbing media. Also considered are radiation exchange between black isothermal surfaces, radiation exchange in enclosures composed of diffuse gray surfaces and in enclosures having some specularly reflecting surfaces, and radiation exchange between nondiffuse nongray surfaces. The use of the Monte Carlo technique in solving radiant-exchange problems and problems of radiative transfer through absorbing-emitting media is explained.

  17. Oscillator strength, transition rates and lifetimes for n=3 states in Al-like ions

    CERN Document Server

    Safronova, U I; Safronova, M S; Sataka, M

    2002-01-01

    Transition rates, oscillator strengths, and line strengths are calculated for the 3220 possible electric-dipole (E1) transitions between the 73 even-parity 3s3p sup 2 , 3s sup 2 3d, 3p sup 2 3d, 3d sup 2 3s and 3d sup 3 states and the 75 odd-parity 3s sup 2 3p, 3p sup 3 , 3s3p3d, and 3d sup 2 3p states in Al-like ions with the nuclear charges ranging from Z=15 to 100. Relativistic many-body perturbation theory (MBPT), including the Breit interaction, is used to evaluate retarded E1 matrix elements in length and velocity forms. The calculations start from a 1s sup 2 2s sup 2 2p sup 6 Dirac-Fock potential. First-order MBPT is used to obtain intermediate coupling coefficients and second-order MBPT is used to calculate transition matrix elements. Contributions from negative-energy states are included in the second order E1 matrix elements to ensure gauge-independence of transition amplitudes. The transition energies used in the calculation of oscillator strengths and transition rates are from second-order MBPT. T...

  18. Effects of two different programs of modern sports dancing on motor coordination, strength, and speed.

    Science.gov (United States)

    Uzunovic, Slavoljub; Kostic, Radmila; Zivkovic, Dobrica

    2010-09-01

    This study aimed to determine the effects of two different programs of modern sports dancing on coordination, strength, and speed in 60 beginner-level female dancers, aged 13 and 14 yrs. The subjects were divided into two experimental groups (E1 and E2), each numbering 30 subjects, drawn from local dance clubs. In order to determine motor coordination, strength, and speed, we used 15 measurements. The groups were tested before and after the experimental programs. Both experimental programs lasted for 18 wks, with training sessions twice a week for 60 minutes. The subjects from the E1 group trained according to a new experimental program of disco dance (DD) modern sports dance, and the E2 group trained according to the classic DD program of the same kind for beginner selections. The obtained results were assessed by statistical analysis: a paired-samples t-test and MANCOVA/ANCOVA. The results indicated that following the experimental programs, both groups showed a statistically significant improvement in the evaluated skills, but the changes among the E1 group subjects were more pronounced. The basic assumption of this research was confirmed, that the new experimental DD program has a significant influence on coordination, strength, and speed. In relation to these changes, the application of the new DD program was recommended for beginner dancers.

  19. Cytochrome P450 2E1 potentiates ethanol induction of hypoxia and HIF-1α in vivo.

    Science.gov (United States)

    Wang, Xiaodong; Wu, Defeng; Yang, Lili; Gan, Lixia; Cederbaum, Arthur I

    2013-10-01

    Ethanol induces hypoxia and elevates HIF-1α in the liver. CYP2E1 plays a role in the mechanisms by which ethanol generates oxidative stress, fatty liver, and liver injury. This study evaluated whether CYP2E1 contributes to ethanol-induced hypoxia and activation of HIF-1α in vivo and whether HIF-1α protects against or promotes CYP2E1-dependent toxicity in vitro. Wild-type (WT), CYP2E1-knock-in (KI), and CYP2E1 knockout (KO) mice were fed ethanol chronically; pair-fed controls received isocaloric dextrose. Ethanol produced liver injury in the KI mice to a much greater extent than in the WT and KO mice. Protein levels of HIF-1α and downstream targets of HIF-1α activation were elevated in the ethanol-fed KI mice compared to the WT and KO mice. Levels of HIF prolyl hydroxylase 2, which promotes HIF-1α degradation, were decreased in the ethanol-fed KI mice in association with the increases in HIF-1α. Hypoxia occurred in the ethanol-fed CYP2E1 KI mice as shown by an increased area of staining using the hypoxia-specific marker pimonidazole. Hypoxia was lower in the ethanol-fed WT mice and lowest in the ethanol-fed KO mice and all the dextrose-fed mice. In situ double staining showed that pimonidazole and CYP2E1 were colocalized to the same area of injury in the hepatic centrilobule. Increased protein levels of HIF-1α were also found after acute ethanol treatment of KI mice. Treatment of HepG2 E47 cells, which express CYP2E1, with ethanol plus arachidonic acid (AA) or ethanol plus buthionine sulfoximine (BSO), which depletes glutathione, caused loss of cell viability to a greater extent than in HepG2 C34 cells, which do not express CYP2E1. These treatments elevated protein levels of HIF-1α to a greater extent in E47 cells than in C34 cells. 2-Methoxyestradiol, an inhibitor of HIF-1α, blunted the toxic effects of ethanol plus AA and ethanol plus BSO in the E47 cells in association with inhibition of HIF-1α. The HIF-1α inhibitor also blocked the elevated oxidative

  20. Evaluation of bond strength of a conventional adhesive system in irradiated teeth

    Directory of Open Access Journals (Sweden)

    Emanuel Jordan de CARVALHO

    Full Text Available Abstract Introduction One of the most common treatments of head and neck cancer patients is radiotherapy, a treatment method which uses ionizing radiation beam and destroys tumor cells, minimizing damage to neighbor cells. Purpose To evaluate the bond strength of a conventional adhesive system in irradiated teeth. Method 24 third human molars, 12 of which were randomly exposed to radiation and prepared from the removal of occlusal enamel, then exposed to a flat dentine surface. The adhesive system Stae was applied according to the manufacturer’s instructions. Next, two 2 mm increments of resin were implemented. The samples were hemi sectioned specimens, originating shapped toothpick. To evaluate the bond strength, a micro tensile test was done with 500N load and speed of 0.5 mm/minute. Result There was no statistically significant difference between the bond strength of teeth which were or were not exposed to radiation and which used a conventional adhesive system. Conclusion Although the radiation doses applied may cause some alterations in microscopic range in dental tissues, it can be concluded that these alterations do not influence in the bond strength in dentin of irradiated teeth.

  1. Genotype and allelic frequencies of CYP2E1*5B polymorphism in the southwest population of Iran

    Directory of Open Access Journals (Sweden)

    Fatemeh Zanganeh

    2014-10-01

    Full Text Available Background: Cytochrome P450 2E1 (CYP2E1 is a main enzyme which plays a major role in activating and detoxifying many xenobiotics, carcinogens and drugs. Available studies suggest that CYP2E1 single nucleotide polymorphisms (SNPs are involved in the risk of developing certain cancers after exposure to carcinogens. The purpose of the present study was to assess genotype and allele frequencies of polymorphic CYP2E1*5B in the Iranian population. Material and Methods: This study was performed on 200 healthy individuals (female: 100, male: 100 in medical laboratories of Ahvaz during 2011. The CYP2E1 *5B (rs3813867 G-1293C assessment was carried out using PCR-RFLP method. The data were analyzed with ĸ2 and hardy-Weinberg Equation statistically methods. Results: The frequency of *1A/*1A (c1/c1, *1A/*5B (c1/c2 and *5B/*5B (c2/c2 genotypes was computed 97, 3 and 0 percent, respectively. The frequency of *1A (c1 and *5B (c2 alleles was computed 98.5 and 1.5 percent, respectively. No statistically significant difference was between two genders (p>0.05. Conclusion: The genotype distribution and allele frequencies of CYP2E1*5B polymorphism were similar to Turkish and some of the European populations. However, there are significant interethnic differences when the Iranian population is compared with the Eastern Asian, American and some of the European populations. The allelic distribution of this polymorphism did not vary with gender.

  2. Occupational Toluene Exposure Induces Cytochrome P450 2E1 mRNA Expression in Peripheral Lymphocytes

    Science.gov (United States)

    Mendoza-Cantú, Ania; Castorena-Torres, Fabiola; de León, Mario Bermúdez; Cisneros, Bulmaro; López-Carrillo, Lizbeth; Rojas-García, Aurora E.; Aguilar-Salinas, Alberto; Manno, Maurizio; Albores, Arnulfo

    2006-01-01

    Print workers are exposed to organic solvents, of which the systemic toxicant toluene is a main component. Toluene induces expression of cytochrome P450 2E1 (CYP2E1), an enzyme involved in its own metabolism and that of other protoxicants, including some procarcinogens. Therefore, we investigated the association between toluene exposure and the CYP2E1 response, as assessed by mRNA content in peripheral lymphocytes or the 6-hydroxychlorzoxazone (6OH-CHZ)/chlorzoxazone (CHZ) quotient (known as CHZ metabolic ratio) in plasma, and the role of genotype (5′-flanking region RsaI/PstI polymorphic sites) in 97 male print workers. The geometric mean (GM) of toluene concentration in the air was 52.80 ppm (10–760 ppm); 54% of the study participants were exposed to toluene concentrations that exceeded the maximum permissible exposure level (MPEL). The GM of urinary hippuric acid at the end of a work shift (0.041 g/g creatinine) was elevated relative to that before the shift (0.027 g/g creatinine; p < 0.05). The GM of the CHZ metabolic ratio was 0.33 (0–9.3), with 40% of the subjects having ratios below the GM. However, the average CYP2E1 mRNA level in peripheral lymphocytes was 1.07 (0.30–3.08), and CYP2E1 mRNA levels within subjects correlated with the toluene exposure ratio (environmental toluene concentration:urinary hippuric acid concentration) (p = 0.014). Genotype did not alter the association between the toluene exposure ratio and mRNA content. In summary, with further validation, CYP2E1 mRNA content in peripheral lymphocytes could be a sensitive and noninvasive biomarker for the continuous monitoring of toluene effects in exposed persons. PMID:16581535

  3. Influence of plant lipids on immune responses in mice to the major Brazil nut allergen Ber e 1.

    Science.gov (United States)

    Dearman, R J; Alcocer, M J C; Kimber, I

    2007-04-01

    Lipids, particularly bacterial lipopolysaccharide, can impact on immune responses to proteins, with low doses enhancing type 2 responses. We have examined the influence of natural plant lipid extracts on antibody responses provoked in mice by recombinant Ber e 1, the major allergen in Brazil nuts. BALB/c strain mice were immunized (by intraperitoneal injection) with natural or recombinant Ber e l produced in Pichia pastoris and admixed with various lipid fractions isolated from Brazil nuts. Serum samples were analysed for specific IgE antibody by homologous passive cutaneous anaphylaxis assay and for IgG by enzyme-linked immunosorbant assay. Exposure to recombinant (lipid-free) Ber e 1 alone failed to induce detectable IgG or IgE antibody. Co-administration of the total lipid fraction (with reduced triglyceride levels), sterol-rich, or polar lipid fractions, resulted in marked adjuvant effects on IgG and IgE. However, the beta-sitosterol and glycolipid-rich fractions were associated with only low-level IgG antibody, and had little impact on IgE antibody production. Natural Ber e 1 containing endogenous lipids also provoked IgG and IgE antibody responses. Identical IgE and IgG antibody responses were detected regardless of whether natural or recombinant Ber e 1 was used as substrates for analyses. Endogenous Brazil nut lipids are required for the induction of optimal antibody responses to Ber e 1 in the BALB/c strain mouse. Appropriate antibody binding sites are present on both natural and recombinant forms of Ber e 1, suggesting that the impact of lipid is at the induction phase, rather than antibody recognition, and is possibly required for efficient antigen presentation.

  4. The sea anemone toxin AdE-1 modifies both sodium and potassium currents of rat cardiomyocytes.

    Science.gov (United States)

    Nesher, Nir; Zlotkin, Eliahu; Hochner, Binyamin

    2014-07-01

    AdE-1, a cardiotonic peptide recently isolated from the sea anemone Aiptasia diaphana, contains 44 amino acids and has a molecular mass of 4907 Da. It was previously found to resemble other sea anemone type 1 and 2 Na+ channel toxins, enhancing contractions of rat cardiomyocytes and slowing their twitch relaxation; however, it did not induce spontaneous twitches. AdE-1 increased the duration of the cardiomyocyte action potential and decreased its amplitude and its time-to-peak in a concentration-dependent manner, without affecting its threshold and cell resting potential. Nor did it generate the early and delayed after-depolarizations characteristic of sea anemone Na+ channel toxins. To further understand its mechanism of action we investigated the effect of AdE-1 on the major ion currents of rat cardiomyocytes. In the present study we show that AdE-1 markedly slowed inactivation of the Na+ current, enhancing and prolonging the current influx with no effect on current activation, possibly through direct interaction with the site 3 receptor of the Na+ channel. No significant effect of AdE-1 on the Ca2+ current was observed, but, unexpectedly, AdE-1 significantly increased the amplitude of the transient component of the K+ current, shifting the current threshold to more negative membrane potentials. This effect on the K+ current has not been found in any other sea anemone toxin and may explain the exclusive reduction in action potential amplitude and the absence of the action potential disorders found with other toxins, such as early and delayed after-depolarizations.

  5. Interaction of E1 and E3 components with the core proteins of the human pyruvate dehydrogenase complex.

    Science.gov (United States)

    Patel, Mulchand S; Korotchkina, Lioubov G; Sidhu, Sukhdeep

    2009-11-01

    The human (h) pyruvate dehydrogenase complex (hPDC) consists of multiple copies of several components: pyruvate dehydrogenase (E1), dihydrolipoamide acetyltransferase (E2), dihydrolipoamide dehydrogenase (E3), E3-binding protein (BP), and specific kinases and phosphatases. Mammalian PDC has a well organized structure with an icosahedral symmetry of the central E2/BP core to which the other component proteins bind non-covalently. Both hE2 and hBP consist of three well defined domains, namely the lipoyl domain, the subunit-binding domain and the inner domain, connected with flexible linkers. hE1 (alpha(2)beta(2)) binds to the subunit-binding domain of hE2; whereas hE3 binds to the E3-binding domain of hBP. Among several residues of the C-terminal surface of the hE1beta E1betaD289 was found to interact with hE2K276. The C-terminal residue I329 of the hE1beta did not participate in binding to hE2. This latter finding shows specificity in the interaction between E1beta and E2 in hPDC. The selective binding between hE3 and the E3-binding domain of hBP was investigated using specific mutants. E3R460G and E3340K showed significant reductions in affinity for hBP as determined by surface plasmon resonance. Both residues are involved in the structural organization of the binding site on hE3. Substitution of I157, N137 and R155 of hBP resulted in variable increases in the K(D) for binding with wild-type hE3, suggesting that the binding results from several weak electrostatic bonds and hydrophobic interactions among residues of hBP with residues at the interface of dimeric hE3. These results provide insight in the mono-specificity of binding of E1 to E2 and E3 to BP in hPDC and showed the differences in the binding of peripheral components (E1 and E3) in human and bacterial PDCs.

  6. CYP2A6 and CYP2E1 polymorphisms in a Brazilian population living in Rio de Janeiro

    Directory of Open Access Journals (Sweden)

    Rossini A.

    2006-01-01

    Full Text Available Cytochrome P450 (CYP is a superfamily of enzymes involved in the metabolism of endogenous compounds and xenobiotics. CYP2A6 catalyzes the oxidation of nicotine and the activation of carcinogens such as aflatoxin B1 and nitrosamines. CYP2E1 metabolizes ethanol and other low-molecular weight compounds and can also activate nitrosamines. The CYP2A6 and CYP2E1 genes are polymorphic, altering their catalytic activities and susceptibility to cancer and other diseases. A number of polymorphisms described are ethnic-dependent. In the present study, we determined the genotype and allele frequencies of the main CYP2A6 and CYP2E1 polymorphisms in a group of 289 volunteers recruited at the Central Laboratory of Hospital Universitário Pedro Ernesto. They had been residing in the city of Rio de Janeiro for at least 6 months and were divided into two groups according to skin color (white and non-white. The alleles were determined by allele specific PCR (CYP2A6 or by PCR-RFLP (CYP2E1. The frequencies of the CYP2A6*1B and CYP2A6*2 alleles were 0.29 and 0.02 for white individuals and 0.24 and 0.01 for non-white individuals, respectively. The CYP2A6*5 allele was not found in the population studied. Regarding the CYP2E1*5B allele, we found a frequency of 0.07 in white individuals, which was statistically different (P < 0.05 from that present in non-white individuals (0.03. CYP2E1*6 allele frequency was the same (0.08 in both groups. The frequencies of CYP2A6*1B, CYP2A6*2 and CYP2E1*6 alleles in Brazilians are similar to those found in Caucasians and African-Americans, but the frequency of the CYP2E1*5B allele is higher in Brazilians.

  7. E1^E4-mediated keratin phosphorylation and ubiquitylation: a mechanism for keratin depletion in HPV16-infected epithelium

    OpenAIRE

    McIntosh, Pauline B.; Laskey, Peter; Sullivan, Kate; Davy, Clare; Wang, Qian; Jackson, Deborah J.; Griffin, Heather M.; Doorbar, John

    2010-01-01

    The keratin IF network of epidermal keratinocytes provides a protective barrier against mechanical insult, it is also a major player in absorbing stress in these cells. The human papilloma virus (HPV) type 16 E1^E4 protein accumulates in the upper layers of HPV16-infected epithelium and is known to associate with and reorganise the keratin IF network in cells in culture. Here, we show that this function is conserved amongst a number of HPV alpha-group E1^E4 proteins and that the differentiati...

  8. CYP2A6 and CYP2E1 polymorphisms in a Brazilian population living in Rio de Janeiro

    Directory of Open Access Journals (Sweden)

    A. Rossini

    2006-02-01

    Full Text Available Cytochrome P450 (CYP is a superfamily of enzymes involved in the metabolism of endogenous compounds and xenobiotics. CYP2A6 catalyzes the oxidation of nicotine and the activation of carcinogens such as aflatoxin B1 and nitrosamines. CYP2E1 metabolizes ethanol and other low-molecular weight compounds and can also activate nitrosamines. The CYP2A6 and CYP2E1 genes are polymorphic, altering their catalytic activities and susceptibility to cancer and other diseases. A number of polymorphisms described are ethnic-dependent. In the present study, we determined the genotype and allele frequencies of the main CYP2A6 and CYP2E1 polymorphisms in a group of 289 volunteers recruited at the Central Laboratory of Hospital Universitário Pedro Ernesto. They had been residing in the city of Rio de Janeiro for at least 6 months and were divided into two groups according to skin color (white and non-white. The alleles were determined by allele specific PCR (CYP2A6 or by PCR-RFLP (CYP2E1. The frequencies of the CYP2A6*1B and CYP2A6*2 alleles were 0.29 and 0.02 for white individuals and 0.24 and 0.01 for non-white individuals, respectively. The CYP2A6*5 allele was not found in the population studied. Regarding the CYP2E1*5B allele, we found a frequency of 0.07 in white individuals, which was statistically different (P < 0.05 from that present in non-white individuals (0.03. CYP2E1*6 allele frequency was the same (0.08 in both groups. The frequencies of CYP2A6*1B, CYP2A6*2 and CYP2E1*6 alleles in Brazilians are similar to those found in Caucasians and African-Americans, but the frequency of the CYP2E1*5B allele is higher in Brazilians.

  9. Synthesis, spectroscopic (FT-IR, FT-Raman, NMR, UV-Visible), first order hyperpolarizability, NBO and molecular docking study of (E)-1-(4-bromobenzylidene)semicarbazide

    Science.gov (United States)

    Raja, M.; Muhamed, R. Raj; Muthu, S.; Suresh, M.

    2017-01-01

    The compound (E)-1-(4-bromobenzylidene)semicarbazide(4BSC) was synthesized and characterized by FT-IR, FT-Raman, UV-Visible, 1HNMR and 13CNMR spectra. The optimized molecular geometry(bond length, bond angle), the complete vibrational frequency, the infrared intensities and the Raman scattering activities were calculated by using density functional theory(DFT) B3LYP method with the help of 6-311++G(d,p) basis set. From the recorded UV-Visible spectrum, the electronic properties such as excitation energies, wavelength, band gap and oscillator strength are evaluated by TD-DFT in DMSO solution and gas phase methods using 6-311++G(d,p) basis set. The calculated HOMO - LUMO band gap energies confirm that charge transfer occurs within the molecule. The 1H and 13C nuclear magnetic resonance (NMR) chemical shifts of the molecule are calculated by the gauge-independent atomic orbital (GIAO) method and compared with experimental results. The hyperconjugative interaction energy E(2) and electron densities of donor (i) and acceptor (j) bonds were calculated using NBO analysis. Besides NLO and MEP were also calculated and interpreted. To study the biological activity of the investigation molecule, molecular docking was done to identify the hydrogen bond lengths and binding energy with different antimicrobial protein. Thermodynamic properties of the title compound at different temperatures have been calculated, revealing the correlations the heat capacity (C), entropy (S) and enthalpy changes (H) and temperatures.

  10. Forearm Torque and Lifting Strength: Normative Data.

    Science.gov (United States)

    Axelsson, Peter; Fredrikson, Per; Nilsson, Anders; Andersson, Jonny K; Kärrholm, Johan

    2018-02-10

    To establish reference values for new methods designed to quantitatively measure forearm torque and lifting strength and to compare these values with grip strength. A total of 499 volunteers, 262 males and 237 females, aged 15 to 85 (mean, 44) years, were tested for lifting strength and forearm torque with the Kern and Baseline dynamometers. These individuals were also tested for grip strength with a Jamar dynamometer. Standardized procedures were used and information about sex, height, weight, hand dominance, and whether their work involved high or low manual strain was collected. Men had approximately 70% higher forearm torque and lifting strength compared with females. Male subjects aged 26 to 35 years and female subjects aged 36 to 45 years showed highest strength values. In patients with dominant right side, 61% to 78% had a higher or equal strength on this side in the different tests performed. In patients with dominant left side, the corresponding proportions varied between 41% and 65%. There was a high correlation between grip strength and forearm torque and lifting strength. Sex, body height, body weight, and age showed a significant correlation to the strength measurements. In a multiple regression model sex, age (entered as linear and squared) could explain 51% to 63% of the total variances of forearm torque strength and 30% to 36% of lifting strength. Reference values for lifting strength and forearm torque to be used in clinical practice were acquired. Grip strength has a high correlation to forearm torque and lifting strength. Sex, age, and height can be used to predict forearm torque and lifting strength. Prediction equations using these variables were generated. Normative data of forearm torque and lifting strength might improve the quality of assessment of wrist and forearm disorders as well as their treatments. Copyright © 2018 American Society for Surgery of the Hand. Published by Elsevier Inc. All rights reserved.

  11. Management information system on radiation protection

    Energy Technology Data Exchange (ETDEWEB)

    Grossi, Pablo Andrade; Souza, Leonardo Soares de; Figueiredo, Geraldo Magela, E-mail: pabloag@cdtn.b, E-mail: lss@cdtn.b, E-mail: gmf@cdtn.b [Centro de Desenvolvimento da Tecnologia Nuclear (CDTN/CNEN-MG), Belo Horizonte, MG (Brazil)

    2011-07-01

    Considering the flux complexity and the multi source information of all radiation protection activities on nuclear organizations, an effective management information system based on technology, information and people is necessary to improve the safety on all processes and operations subjected to radiation risks. An effective management information system is an essential tool to highlight the strengths and weaknesses and identify behaviors and trends on the activities requiring radiation protection programs. Such kind of distinct knowledge is useful to reach an effective management and support the human decision-making on nuclear organization. This paper presents a management information system based on Brazilian directives and regulations on radiation protection. Due to its generic characteristics, this radiation protection control system can be implemented on any nuclear organization by reediting the non restricted parameters which could differ considering all facilities and laboratories expected on-site with diverse technologies applications. This system can be considered as a powerful tool applied on the continuous management of radiation protection activities on nuclear organizations and research institutes as well as for long term planning, not only indicating how the safety activities are going, but why they are not going as well as planned where that is the case. (author)

  12. Ab Initio Modeling of Molecular Radiation

    Science.gov (United States)

    Jaffe, Richard; Schwenke, David

    2014-01-01

    Radiative emission from excited states of atoms and molecules can comprise a significant fraction of the total heat flux experienced by spacecraft during atmospheric entry at hypersonic speeds. For spacecraft with ablating heat shields, some of this radiative flux can be absorbed by molecular constituents in the boundary layer that are formed by the ablation process. Ab initio quantum mechanical calculations are carried out to predict the strengths of these emission and absorption processes. This talk will describe the methods used in these calculations using, as examples, the 4th positive emission bands of CO and the 1g+ 1u+ absorption in C3. The results of these calculations are being used as input to NASA radiation modeling codes like NeqAir, HARA and HyperRad.

  13. Estimation of strength of source in a 2D participating media using the differential evolution algorithm

    Science.gov (United States)

    Parwani, Ajit K.; Talukdar, Prabal; Subbarao, P. M. V.

    2012-06-01

    A numerical model is developed to estimate the time varying strength of a heat source without prior information about the unknown function. The medium is considered to be gray, absorbing and emitting and the heat transfer is assumed to take place by both radiation and conduction. All the boundaries of the 2-D enclosure are considered to be black with known temperature. The finite-volume method is used for discretization of the energy as well as the radiative transfer equation. This inverse radiation-conduction problem is solved with the minimization of a performance function, which is expressed by the sum of square residuals between calculated and observed temperature, utilizing the differential evolution algorithm. The prediction of the strength of the source by the present algorithm is found to be quite reasonable.

  14. Recommendations for Improving Consistency in the Radiation Fields Used During Testing of Radiation Detection Instruments for Homeland Security Applications

    OpenAIRE

    Pibida, L.; Mille, M; Norman, B.

    2013-01-01

    Several measurements and calculations were performed to illustrate the differences that can be observed in the determination of exposure rate or ambient dose equivalent rate used for testing radiation detection systems against consensus standards. The large variations observed support our recommendation that better consistency in the test radiation fields can be achieved by specifying the source activity and testing distance instead of the field strength.

  15. Recommendations for Improving Consistency in the Radiation Fields Used During Testing of Radiation Detection Instruments for Homeland Security Applications.

    Science.gov (United States)

    Pibida, L; Mille, M; Norman, B

    2013-01-01

    Several measurements and calculations were performed to illustrate the differences that can be observed in the determination of exposure rate or ambient dose equivalent rate used for testing radiation detection systems against consensus standards. The large variations observed support our recommendation that better consistency in the test radiation fields can be achieved by specifying the source activity and testing distance instead of the field strength.

  16. Strength training: importance of genetic factors

    National Research Council Canada - National Science Library

    Thomis, M A; Beunen, G P; Maes, H H; Blimkie, C J; Van Leemputte, M; Claessens, A L; Marchal, G; Willems, E; Vlietinck, R F

    1998-01-01

    This study focuses on the quantification of genetic and environmental factors in arm strength after high-resistance strength training. Male monozygotic (MZ, N = 25) and dizygotic (DZ, N = 16) twins (22.4 +/- 3.7 yr...

  17. ABRASION RESISTANCE ESTIMATION OF HIGH STRENGTH CONCRETE

    Directory of Open Access Journals (Sweden)

    Şemsi YAZICI

    2007-01-01

    Full Text Available This study gives the results of a laboratory investigation undertaken to determine the relationship between mechanical properties (compressive and flexural strengths and abrasion resistance of 65-85 MPa high strength concretes incorporating silica fume, fly ash and silica fume-fly ash mixtures as supplementary cementing materials. A series of six different concrete mixtures including a control high strength concrete mixture (C1, and five high strength concrete mixtures (C2, C3, C4, C5, C6 incorporating supplementary cementing materials, were manufactured. The compressive strength, flexural strength, and abrasion resistance were determined for each mixture at 28-days. Mathematical expressions were suggested to estimate the abrasion resistance of concrete regarding their compressive strength and flexural strength.

  18. Intra-arterial infusion of prostaglandin E1 in normal subjects and patients with peripheral arterial disease

    DEFF Research Database (Denmark)

    Nielsen, P E; Nielsen, S L; Holstein, P

    1976-01-01

    Acute vasodilatation was produced by infusion of prostaglandin E1 (PGE1) in the femoral artery in 6 patients with occlusive arterial disease of the legs and in 3 normal subjects. The effect on blood flow and on blood pressure was measured at different segments of the leg with the strain gauge...

  19. ILS Element E1 Maintenance Planning: Distribution Program and User’s Manual. Version 1.0

    Science.gov (United States)

    1991-04-01

    For a single digit , enter a blank space or zero to the left of the digit . The program accepts only actual dates. If an incorrect date is entered...Documentation for Comoleteness and Firmaness E1.2-1 What stage of develooment- are you in?: "o Concept Exploration "o Development and Validation "o Full Scale

  20. Mobilization properties of small ColE1-like plasmids carrying kanamycin resistance gene isolated from Salmonella enterica serotypes

    Science.gov (United States)

    Background: Previously we isolated and characterized various groups of small kanamycin resistance (KanR) ColE1-like plasmids from different serotypes of Salmonella enterica isolates. These plasmids all carried the aph(3)-I gene encoding the aminoglycoside phosphotransferase responsible for the kanam...

  1. The making of S{u00E1mi ethnography : contested authorities and negotiated representations / Kristin Kuutma

    Index Scriptorium Estoniae

    Kuutma, Kristin, 1959-

    2008-01-01

    Vaadeldakse saami autori Johan Turi raamatut Muitalus s{u00E1miid birra (1910) ja selle tõlget taani keelede Emilie Demant Hatti poolt ning uuritakse, millist autoritaarsust ja kultuurilist poeetikat see peegeldab ja millist sotsiaalset ja kultuurilist kriitikat ta edasi arendab

  2. Hepatitis C virus (HCV) E1 and E2 protein regions that specifically bind to HepG2 cells.

    Science.gov (United States)

    Garcia, Javier Eduardo; Puentes, Alvaro; Súarez, Jorge; López, Ramses; Vera, Ricardo; Rodríguez, Luis Eduardo; Ocampo, Marisol; Curtidor, Hernando; Guzman, Fanny; Urquiza, Mauricio; Patarroyo, Manuel Elkin

    2002-02-01

    Identify hepatitis C virus (HCV) sequences in E1 and E2 protein binding to HepG2. Synthetic 20-mer long, ten-residue overlapped peptides, from E1 and E2 proteins, were tested in HepG2 or Raji cell-binding assays. Affinity constants, binding site number per cell and Hill coefficients were determined by saturation assay for high activity binding peptides (HABPs). Receptors for HepG2 cell were determined by cross-linking and sodium dodecyl sulfate-polyacrylamide gel electrophoresis analysis. Twelve HABPs were found in HCV genotype 1a, allowing six hepatocyte-binding sequences (HBSs) to be defined: two peptide-binding regions in E1 HABPs 4913 (YQVRNSTGLYHVTNDCPNSS) and 4918 (MTPTVATRDGKLPATQLRRHY). Four hepatocyte-binding regions were defined in E2: region-I, peptide 4931 (ETHVTGGSAGHTVSGFVSLLY); region-II, 4937-4939 (HHKFNSSGCPERLASCRPLTDFDQGWGPISYANGSGPDQR); region-III, 4943-4945 (PVYCFTPSPVVVGTTDRSGAPTYSWGENDTDVFVLNNTR) and region-IV, 4949-4952 (CGAPPCVIGGAGNNTLHCPTDCFRKHPDATYSRCGSGPWITPRCLVDYPY). The underlined sequences are most relevant in the binding process. HABPs 4913 and 4938 also bind to CD81 positive Raji cells. Region-II 4938 HABPs bind to 50 and 60kDa HepG2 cell membrane surface proteins. Six HVRs to the HepG2 were identified. Some HABPs have been previously found to be antigenic and immunogenic. HABPs, 4918 (from E1), 4938, 4949, 4950, 4951 and 4952 (from E2) have not been previously recognised. These HABPs could be relevant to HCV invasion of hepatocytes.

  3. Solution structure, copper binding and backbone dynamics of recombinant Ber e 1-the major allergen from Brazil nut

    National Research Council Canada - National Science Library

    Rundqvist, Louise; Tengel, Tobias; Zdunek, Janusz; Björn, Erik; Schleucher, Jürgen; Alcocer, Marcos J C; Larsson, Göran

    2012-01-01

    The 2S albumin Ber e 1 is the major allergen in Brazil nuts. Previous findings indicated that the protein alone does not cause an allergenic response in mice, but the addition of components from a Brazil nut lipid fraction were required...

  4. Structural and Dynamic Characterization of the Molecular Hub Early Region 1A (E1A) from Human Adenovirus.

    Science.gov (United States)

    Hošek, Tomáš; Calçada, Eduardo O; Nogueira, Marcela Oliveira; Salvi, Michele; Pagani, Talita Duarte; Felli, Isabella C; Pierattelli, Roberta

    2016-09-05

    The small-DNA human adenovirus encodes one of the most versatile molecular hubs, the E1A protein. This protein is essential for productive viral infection in human cells and a vast amount of biologically relevant data are available on its interactions with host proteins. Up to now, however, no high-resolution structural and dynamic information on E1A is available despite its important biological role. Among the different spliced variants of E1A, two are expressed at high level in the early stage of infection. These are 243 and 289 residues isoforms. Herein, we present their NMR characterization, showing that they are both highly disordered, but also demonstrate a certain heterogeneous behavior in terms of structural and dynamic properties. Furthermore, we present the characterization of the isolated domain of the longer variant, known as CR3. This study opens the way to understanding at the molecular level how E1A functions. © 2016 WILEY-VCH Verlag GmbH & Co. KGaA, Weinheim.

  5. Prostaglandin E1 treatment in ductus dependent congenital cardiac malformation. A review of the treatment of 34 neonates

    DEFF Research Database (Denmark)

    Høst, A; Halken, S; Kamper, J

    1988-01-01

    Thirty-four sick neonates with major duct dependent cardiac defects were given short term (1 h-408 h) intravenous infusions of prostaglandin E1 (alprostadil) in doses varying between 0.1 micrograms/kg/min (starting dose) and 0.01 micrograms/kg/min. The aim of the study was to establish an effecti...

  6. 26 CFR 301.6503(e)-1 - Suspension of running of period of limitation; certain powers of appointment.

    Science.gov (United States)

    2010-04-01

    ... 26 Internal Revenue 18 2010-04-01 2010-04-01 false Suspension of running of period of limitation... Limitations Limitations on Assessment and Collection § 301.6503(e)-1 Suspension of running of period of... complied with, the running of the period of limitation for assessment or collection of any estate tax...

  7. Combined administration of resolvin E1 and lipoxin A4 resolves inflammation in a murine model of Alzheimer's disease.

    Science.gov (United States)

    Kantarci, Alpdogan; Aytan, Nurgul; Palaska, Iro; Stephens, Danielle; Crabtree, Leah; Benincasa, Claudia; Jenkins, Bruce G; Carreras, Isabel; Dedeoglu, Alpaslan

    2017-11-07

    Dysfunction in the resolution of inflammation may play a key role in Alzheimer's disease (AD). In this study, we found that the levels of specialized pro-resolving lipid mediators (SPMs) in the hippocampus of 5xFAD mice are significantly lower than in non-transgenic littermates. We, therefore, tested the hypothesis that treatment with resolvin E1 (RvE1) and lipoxin A4 (LXA4) alone or in combination will reverse the neuroinflammatory process and decrease Aβ pathology. 5xFAD mice were treated intraperitoneally starting at 1month of age with RvE1 or LXA4 alone or in combination at a dose of 1.5 μg/kg, 3 times a week until 3months of age. We found that treatment with RvE1 or LXA4 alone or in combination increased the concentration of RvE1, LXA4, and RvD2 in the hippocampus as measured by ELISA. Combination treatment of RvE1 and LXA4 had a more potent effect on the activation of microglia and astrocytes than either treatment alone, measured by immunohistochemistry with Iba1 and GFAP antibodies, respectively. The concentrations of Aβ40 and Aβ42 were measured by ELISA and the percentage of Aβ plaques were analyzed by immunohistochemistry. All treatments single and in combination, decreased the measures of Aβ pathology and restored the homeostasis reversing the inflammatory process for inflammatory cytokines and chemokines (GM-CSF, IFN-γ, IL-1β, IL-6, IL-10, TNF-α, MCP-1, MIP-1α, MIP-1β, and RANTES) as measured by multiplex immunoassay. Overall, the study showed that the levels of SPMs in the hippocampus of 5xFAD mice were significantly lower than in wild-type mice; that treatment with RvE1 and LXA4 restored the level of these compounds, reversed the inflammatory process, and decreased the neuroinflammation associated with Aβ pathology in 5xFAD mice. Copyright © 2017. Published by Elsevier Inc.

  8. Ethanol-induced oxidative stress via the CYP2E1 pathway disrupts adiponectin secretion from adipocytes.

    Science.gov (United States)

    Tang, Hui; Sebastian, Becky M; Axhemi, Armend; Chen, Xiaocong; Hillian, Antoinette D; Jacobsen, Donald W; Nagy, Laura E

    2012-02-01

    Adipose tissue is an important target for ethanol action. One important effect of ethanol is to reduce the secretion of adiponectin from adipocytes; this decrease is associated with lowered circulating adiponectin in rodent models of chronic ethanol feeding. Adiponectin is an insulin-sensitizing, anti-inflammatory adipokine; decreased adiponectin activity may contribute to tissue injury in response to chronic ethanol. Here, we investigated the role of cytochrome P450 2E1 (CYP2E1) and oxidative stress in the mechanism for impaired adiponectin secretion from adipocytes in response to ethanol. Male Wistar rats were fed a liquid diet containing ethanol as 36% of calories or pair-fed a control diet for 4 weeks. 3T3-L1 adipocyte cultures, expressing CYP2E1 or not, were exposed to ethanol or 4-hydroxynonenal (4-HNE). Chronic ethanol feeding to rats suppressed the secretion of adiponectin from isolated epididymal adipocytes. Ethanol feeding induced the expression of CYP2E1 in adipocytes and increased markers of oxidative stress, including 4-HNE and protein carbonyls. Because adiponectin is posttranslationally processed in the endoplasmic reticulum and Golgi, we investigated the impact of ethanol on the redox status of high-density microsomes. Chronic ethanol decreased the ratio of reduced glutathione to oxidized glutathione (4.6:1, pair-fed; 2.9:1, ethanol-fed) in high-density microsomes isolated from rat epididymal adipose tissue. We next utilized the 3T3-L1 adipocyte-like cell model to interrogate the mechanisms for impaired adiponectin secretion. Culture of 3T3-L1 adipocytes overexpressing exogenous CYP2E1, but not those overexpressing antisense CYP2E1, with ethanol increased oxidative stress and impaired adiponectin secretion from intracellular pools. Consistent with a role of oxidative stress in impaired adiponectin secretion, challenge of 3T3-L1 adipocytes with 4-HNE also reduced adiponectin mRNA expression and secretion, without affecting intracellular adiponectin

  9. Ghrelin inhibits the apoptosis of MC3T3-E1 cells through ERK and AKT signaling pathway

    Energy Technology Data Exchange (ETDEWEB)

    Liang, Qiu-Hua; Liu, Yuan; Wu, Shan-Shan; Cui, Rong-Rong; Yuan, Ling-Qing, E-mail: allenylq@hotmail.com; Liao, Er-Yuan, E-mail: eyliao@21cn.com

    2013-11-01

    Ghrelin is a 28-amino-acid peptide that acts as a natural endogenous ligand of the growth hormone secretagogue receptor (GHSR) and strongly stimulates the release of growth hormone from the hypothalamus–pituitary axis. Previous studies have identified the important physiological effects of ghrelin on bone metabolism, such as regulating proliferation and differentiation of osteoblasts, independent of GH/IGF-1 axis. However, research on effects and mechanisms of ghrelin on osteoblast apoptosis is still rare. In this study, we identified expression of GHSR in MC3T3-E1 cells and determined the effects of ghrelin on the apoptosis of osteoblastic MC3T3-E1 cells and the mechanism involved. Our data demonstrated that ghrelin inhibited the apoptosis of osteoblastic MC3T3-E1 cells induced by serum deprivation, as determined by terminal deoxynucleotidyl transferase-mediated deoxyribonucleotide triphosphate nick end-labeling (TUNEL) and ELISA assays. Moreover, ghrelin upregulated Bcl-2 expression and downregulated Bax expression in a dose-dependent manner. Our study also showed decreased activated caspase-3 activity under the treatment of ghrelin. Further study suggested that ghrelin stimulated the phosphorylation of ERK and AKT. Pretreatment of cells with the ERK inhibitor PD98059, PI3K inhibitor LY294002, and GHSR-siRNA blocked the ghrelin-induced activation of ERK and AKT, respectively; however, ghrelin did not stimulate the phosphorylation of p38 or JNK. PD90859, LY294002 and GHSR-siRNA attenuated the anti-apoptosis effect of ghrelin in MC3T3-E1 cells. In conclusion, ghrelin inhibits the apoptosis of osteoblastic MC3T3-E1 cells induced by serum deprivation, which may be mediated by activating the GHSR/ERK and GHSR/PI3K/AKT signaling pathways. - Highlights: • We explored the effects of ghrelin on serum deprivation-induced MC3T3-E1 cells apoptosis. • Both ELISA and TUNEL were used to detect the apoptosis. • The receptor of ghrelin, GHSR, was expressed in MC3T3-E1

  10. Plutonium radiation surrogate

    Science.gov (United States)

    Frank, Michael I [Dublin, CA

    2010-02-02

    A self-contained source of gamma-ray and neutron radiation suitable for use as a radiation surrogate for weapons-grade plutonium is described. The source generates a radiation spectrum similar to that of weapons-grade plutonium at 5% energy resolution between 59 and 2614 keV, but contains no special nuclear material and emits little .alpha.-particle radiation. The weapons-grade plutonium radiation surrogate also emits neutrons having fluxes commensurate with the gamma-radiation intensities employed.

  11. Muscle strength in patients with chronic pain

    NARCIS (Netherlands)

    van Wilgen, C.P.; Akkerman, L.; Wieringa, J.; Dijkstra, P.U.

    2003-01-01

    Objective: To analyse the influence of chronic pain on muscle strength. Design: Muscle strength of patients with unilateral nonspecific chronic pain, in an upper or lower limb, were measured according to a standardized protocol using a hand-held dynamometer. Before and after muscle strength

  12. Improving the toughness of ultrahigh strength steel

    Energy Technology Data Exchange (ETDEWEB)

    Soto, Koji [Univ. of California, Berkeley, CA (United States)

    2002-01-01

    The ideal structural steel combines high strength with high fracture toughness. This dissertation discusses the toughening mechanism of the Fe/Co/Ni/Cr/Mo/C steel, AerMet 100, which has the highest toughness/strength combination among all commercial ultrahigh strength steels. The possibility of improving the toughness of this steel was examined by considering several relevant factors.

  13. Unexpectedly low tensile strength in concrete structures

    NARCIS (Netherlands)

    Siemes, A.J.M.; Han, N.; Visser, J.H.M.

    2002-01-01

    During an extensive investigation of some 25 concrete bridges and other structures suffering from alkali-silica reaction it has been found that the uniaxial tensile strength of the concrete was extremely low in relation to both the compressive strength and the splitting tensile strength. It is known

  14. Sulforaphane Induces Nrf2 and Protects Against CYP2E1-dependent Binge Alcohol –induced Liver Steatosis

    Science.gov (United States)

    Zhou, Richard; Lin, Jianjun; Wu, Defeng

    2013-01-01

    Background The mechanism(s) by which alcohol causes cell injury are still not clear but a major mechanism appears to be the role of lipid peroxidation and oxidative stress in alcohol toxicity. CYP2E1-generated ROS contributes to the ethanol-induced oxidant stress and inhibition of CYP2E1 activity decreases ethanol-induced fatty liver. The transcription factor Nrf2 regulates the expression of many cytoprotective enzymes which results in cellular protection against a variety of toxins. Method The current study was designed to evaluate the ability of sulforaphane, an activator of Nrf2, to blunt CYP2E1-dependent, ethanol-induced steatosis in vivo and in vitro. Results The sulforaphane treatment activated Nrf2, increased levels of the Nrf2 target heme oxygenase -1 and subsequently lowered oxidant stress as shown by the decline in lipid peroxidation and 3-Nitrotyrosine protein adducts and an increase in GSH levels after the acute ethanol treatment. It decreased ethanol-elevated liver levels of triglycerides and cholesterol and Oil Red O staining. Similar results were found in vitro as addition of sulforaphane to HepG2 E47 cells, which express CYP2E1, elevated Nrf2 levels and decreased the accumulation of lipid in cells cultured with ethanol. Sulforaphane treatment had no effect on levels of or activity of CYP2E1. Conclusions Sulforaphane proved to be an effective in vivo inhibitor of acute ethanol–induced fatty liver in mice. General significance The possible amelioration of liver injury which occurs under these conditions by chemical activators of Nrf2 is of clinical relevance and worthy of further study. PMID:24060752

  15. Sulforaphane induces Nrf2 and protects against CYP2E1-dependent binge alcohol-induced liver steatosis.

    Science.gov (United States)

    Zhou, Richard; Lin, Jianjun; Wu, Defeng

    2014-01-01

    The mechanism(s) by which alcohol causes cell injury are still not clear but a major mechanism appears to be the role of lipid peroxidation and oxidative stress in alcohol toxicity. CYP2E1-generated ROS contributes to the ethanol-induced oxidant stress and inhibition of CYP2E1 activity decreases ethanol-induced fatty liver. The transcription factor Nrf2 regulates the expression of many cytoprotective enzymes which results in cellular protection against a variety of toxins. The current study was designed to evaluate the ability of sulforaphane, an activator of Nrf2, to blunt CYP2E1-dependent, ethanol-induced steatosis in vivo and in vitro. The sulforaphane treatment activated Nrf2, increased levels of the Nrf2 target heme oxygenase-1 and subsequently lowered oxidant stress as shown by the decline in lipid peroxidation and 3-nitrotyrosine protein adducts and an increase in GSH levels after the acute ethanol treatment. It decreased ethanol-elevated liver levels of triglycerides and cholesterol and Oil Red O staining. Similar results were found in vitro as addition of sulforaphane to HepG2 E47 cells, which express CYP2E1, elevated Nrf2 levels and decreased the accumulation of lipid in cells cultured with ethanol. Sulforaphane treatment had no effect on levels of or activity of CYP2E1. Sulforaphane proved to be an effective in vivo inhibitor of acute ethanol-induced fatty liver in mice. The possible amelioration of liver injury which occurs under these conditions by chemical activators of Nrf2 is of clinical relevance and worthy of further study. © 2013.

  16. Crystal Structure of UBA2ufd-Ubc9: Insights into E1-E2 Interactions in Sumo Pathways

    Science.gov (United States)

    Hunt, Harold W.; Seyedin, Steven N.; Miller, David W.; Miller, Darcie J.; Huang, Danny T.; Schulman, Brenda A.

    2010-01-01

    Canonical ubiquitin-like proteins (UBLs) such as ubiquitin, Sumo, NEDD8, and ISG15 are ligated to targets by E1-E2-E3 multienzyme cascades. The Sumo cascade, conserved among all eukaryotes, regulates numerous biological processes including protein localization, transcription, DNA replication, and mitosis. Sumo conjugation is initiated by the heterodimeric Aos1-Uba2 E1 enzyme (in humans called Sae1-Uba2), which activates Sumo's C-terminus, binds the dedicated E2 enzyme Ubc9, and promotes Sumo C-terminal transfer between the Uba2 and Ubc9 catalytic cysteines. To gain insights into details of E1-E2 interactions in the Sumo pathway, we determined crystal structures of the C-terminal ubiquitin fold domain (ufd) from yeast Uba2 (Uba2ufd), alone and in complex with Ubc9. The overall structures of both yeast Uba2ufd and Ubc9 superimpose well on their individual human counterparts, suggesting conservation of fundamental features of Sumo conjugation. Docking the Uba2ufd-Ubc9 and prior full-length human Uba2 structures allows generation of models for steps in Sumo transfer from Uba2 to Ubc9, and supports the notion that Uba2 undergoes remarkable conformational changes during the reaction. Comparisons to previous structures from the NEDD8 cascade demonstrate that UBL cascades generally utilize some parallel E1-E2 interaction surfaces. In addition, the structure of the Uba2ufd-Ubc9 complex reveals interactions unique to Sumo E1 and E2. Comparison with a previous Ubc9-E3 complex structure demonstrates overlap between Uba2 and E3 binding sites on Ubc9, indicating that loading with Sumo and E3-catalyzed transfer to substrates are strictly separate steps. The results suggest mechanisms establishing specificity and order in Sumo conjugation cascades. PMID:21209884

  17. Crystal Structure of UBA2[superscript ufd]-Ubc9: Insights into E1-E2 Interactions in Sumo Pathways

    Energy Technology Data Exchange (ETDEWEB)

    Wang, Jing; Taherbhoy, Asad M.; Hunt, Harold W.; Seyedin, Steven N.; Miller, David W.; Miller, Darcie J.; Huang, Danny T.; Schulman, Brenda A. (SJCH)

    2012-04-30

    Canonical ubiquitin-like proteins (UBLs) such as ubiquitin, Sumo, NEDD8, and ISG15 are ligated to targets by E1-E2-E3 multienzyme cascades. The Sumo cascade, conserved among all eukaryotes, regulates numerous biological processes including protein localization, transcription, DNA replication, and mitosis. Sumo conjugation is initiated by the heterodimeric Aos1-Uba2 E1 enzyme (in humans called Sae1-Uba2), which activates Sumo's C-terminus, binds the dedicated E2 enzyme Ubc9, and promotes Sumo C-terminal transfer between the Uba2 and Ubc9 catalytic cysteines. To gain insights into details of E1-E2 interactions in the Sumo pathway, we determined crystal structures of the C-terminal ubiquitin fold domain (ufd) from yeast Uba2 (Uba2{sup ufd}), alone and in complex with Ubc9. The overall structures of both yeast Uba2{sup ufd} and Ubc9 superimpose well on their individual human counterparts, suggesting conservation of fundamental features of Sumo conjugation. Docking the Uba2{sup ufd}-Ubc9 and prior full-length human Uba2 structures allows generation of models for steps in Sumo transfer from Uba2 to Ubc9, and supports the notion that Uba2 undergoes remarkable conformational changes during the reaction. Comparisons to previous structures from the NEDD8 cascade demonstrate that UBL cascades generally utilize some parallel E1-E2 interaction surfaces. In addition, the structure of the Uba2{sup ufd}-Ubc9 complex reveals interactions unique to Sumo E1 and E2. Comparison with a previous Ubc9-E3 complex structure demonstrates overlap between Uba2 and E3 binding sites on Ubc9, indicating that loading with Sumo and E3-catalyzed transfer to substrates are strictly separate steps. The results suggest mechanisms establishing specificity and order in Sumo conjugation cascades.

  18. Crystal structure of UBA2(ufd)-Ubc9: insights into E1-E2 interactions in Sumo pathways.

    Science.gov (United States)

    Wang, Jing; Taherbhoy, Asad M; Hunt, Harold W; Seyedin, Steven N; Miller, David W; Miller, Darcie J; Huang, Danny T; Schulman, Brenda A

    2010-12-30

    Canonical ubiquitin-like proteins (UBLs) such as ubiquitin, Sumo, NEDD8, and ISG15 are ligated to targets by E1-E2-E3 multienzyme cascades. The Sumo cascade, conserved among all eukaryotes, regulates numerous biological processes including protein localization, transcription, DNA replication, and mitosis. Sumo conjugation is initiated by the heterodimeric Aos1-Uba2 E1 enzyme (in humans called Sae1-Uba2), which activates Sumo's C-terminus, binds the dedicated E2 enzyme Ubc9, and promotes Sumo C-terminal transfer between the Uba2 and Ubc9 catalytic cysteines. To gain insights into details of E1-E2 interactions in the Sumo pathway, we determined crystal structures of the C-terminal ubiquitin fold domain (ufd) from yeast Uba2 (Uba2(ufd)), alone and in complex with Ubc9. The overall structures of both yeast Uba2(ufd) and Ubc9 superimpose well on their individual human counterparts, suggesting conservation of fundamental features of Sumo conjugation. Docking the Uba2(ufd)-Ubc9 and prior full-length human Uba2 structures allows generation of models for steps in Sumo transfer from Uba2 to Ubc9, and supports the notion that Uba2 undergoes remarkable conformational changes during the reaction. Comparisons to previous structures from the NEDD8 cascade demonstrate that UBL cascades generally utilize some parallel E1-E2 interaction surfaces. In addition, the structure of the Uba2(ufd)-Ubc9 complex reveals interactions unique to Sumo E1 and E2. Comparison with a previous Ubc9-E3 complex structure demonstrates overlap between Uba2 and E3 binding sites on Ubc9, indicating that loading with Sumo and E3-catalyzed transfer to substrates are strictly separate steps. The results suggest mechanisms establishing specificity and order in Sumo conjugation cascades.

  19. Crystal structure of UBA2(ufd-Ubc9: insights into E1-E2 interactions in Sumo pathways.

    Directory of Open Access Journals (Sweden)

    Jing Wang

    2010-12-01

    Full Text Available Canonical ubiquitin-like proteins (UBLs such as ubiquitin, Sumo, NEDD8, and ISG15 are ligated to targets by E1-E2-E3 multienzyme cascades. The Sumo cascade, conserved among all eukaryotes, regulates numerous biological processes including protein localization, transcription, DNA replication, and mitosis. Sumo conjugation is initiated by the heterodimeric Aos1-Uba2 E1 enzyme (in humans called Sae1-Uba2, which activates Sumo's C-terminus, binds the dedicated E2 enzyme Ubc9, and promotes Sumo C-terminal transfer between the Uba2 and Ubc9 catalytic cysteines. To gain insights into details of E1-E2 interactions in the Sumo pathway, we determined crystal structures of the C-terminal ubiquitin fold domain (ufd from yeast Uba2 (Uba2(ufd, alone and in complex with Ubc9. The overall structures of both yeast Uba2(ufd and Ubc9 superimpose well on their individual human counterparts, suggesting conservation of fundamental features of Sumo conjugation. Docking the Uba2(ufd-Ubc9 and prior full-length human Uba2 structures allows generation of models for steps in Sumo transfer from Uba2 to Ubc9, and supports the notion that Uba2 undergoes remarkable conformational changes during the reaction. Comparisons to previous structures from the NEDD8 cascade demonstrate that UBL cascades generally utilize some parallel E1-E2 interaction surfaces. In addition, the structure of the Uba2(ufd-Ubc9 complex reveals interactions unique to Sumo E1 and E2. Comparison with a previous Ubc9-E3 complex structure demonstrates overlap between Uba2 and E3 binding sites on Ubc9, indicating that loading with Sumo and E3-catalyzed transfer to substrates are strictly separate steps. The results suggest mechanisms establishing specificity and order in Sumo conjugation cascades.

  20. Gene order for rubella virus structural proteins is NH/sub 2/-C-E2-E1-COOH

    Energy Technology Data Exchange (ETDEWEB)

    Oker-Blom, C.

    1984-08-01

    The order of translation in vivo of the genes coding for rubella virus structural proteins was studied in infected B-Vero cells. The proteins were sequentially pulse-chase labeled with (/sup 35/S)methionine after synchronization of translation initiation with hypertonic salt treatment. A sequential labeling procedure (window-labeling) to specifically label defined segments of the structural proteins was also used. The labeled proteins were identified by sodium dodecyl sulfate-gel electrophoresis after immunoprecipitation with specific antisera directed against the two virion glycoproteins (E1 and E2a/E2b) and the nucleocapsid (C) protein. The order of translation was found to be NH/sub 2/-C-E2-E1-COOH. We have previously shown that the structural proteins are synthesized in vitro from a cytoplasmic 24S subgenomic mRNA as a 110,000-dalton (p110) precursor. Here, it is shown that p110 is precipitated with anti-C, anti-E2, and anti-E1 sera, indicating that p110 is the precursor of all three structural proteins. Two major in vitro translation products (M/sub r/s, 66,000 and 62,000) that could represent preterminated polypeptide chains or proteolytic cleavage products were precipitated with anti-C and anti-Es sera, but not with anti-E1 serum, indicating, in conformity with the in vivo results, that the genes for the C and E2 proteins are adjacent to each other. Using these specific antisera, we have also confirmed the identity of the unglycosylated forms of E1 (M/sub r/, 53,000) and E2 (M/sub r/ 30,000) immunoprecipitated from tunicamycin-treated infected cells. 18 references, 6 figures.

  1. A negative cooperativity mechanism of human CYP2E1 inferred from molecular dynamics simulations and free energy calculations.

    Science.gov (United States)

    Li, Jue; Wei, Dong-Qing; Wang, Jing-Fang; Li, Yi-Xue

    2011-12-27

    Human cytochrome P450 2E1 (CYP2E1) participates in the metabolism of over 2% of all the oral drugs. A hallmark peculiar feature of this enzyme is that it exhibits a pronounced negative cooperativity in substrate binding. However the mechanism by which the negative cooperativity occurs is unclear. Here, we performed molecular dynamics simulations and free energy calculations on human CYP2E1 to examine the structural differences between the substrate-free and the enzymes with one and two aniline molecules bound. Our results indicate that although the effector substrate does not bind in the active site cavity, it still can directly interact with the active site residues of human CYP2E1. The interaction of the effector substrate with the active site leads to a reorientation of active site residues, which thereby weakens the interactions of the active substrate with this site. We also identify a conserved residue T303 that plays a crucial role in the negative cooperative binding on the short-range effects. This residue is a key factor in the positioning of substrates and in proton delivery to the active site. Additionally, a long-range effect of the effector substrate is identified in which F478 is proposed to play a key role. As located in the interface between the active and effector sites, this residue structurally links the active and effector sites and is found to play a significant role in affecting substrate access and ligand positioning within the active site. In the negative cooperative binding, this residue can decrease the interactions of the active substrate with the active site by π-π stacking which then lowers the hydroxylation activity for the active substrate. These findings are in agreement with previous experimental observations and thus provide detailed atomistic insight into the poorly understood mechanism of the negative cooperativity in human CYP2E1.

  2. The effect of lycopene on the total cytochrome P450, CYP1A2 and CYP2E1

    Directory of Open Access Journals (Sweden)

    Melva Louisa

    2009-12-01

    Full Text Available Aim: Some carotenoids such as canthaxantin, astaxanthin and beta apo-8’-carotenal were reported to have modulatoryeffect on the cytochrome P450. The present study was conducted to investigate the effects of lycopene, a nonprovitamin A carotenoid, on microsomal cytochrome P450, CYP1A2 and CYP2E1.Methods: Total cytochrome P450 levels, CYP1A2 and CYP2E1-catalyzed reactions (acetanilide 4-hydroxylation and p-nitrophenol hydroxylation were studied in the liver microsomes of male Sprague Dawley rats. Microsomes were prepared using differential centrifugation combined with calcium aggregation method. Lycopene was orally administered in the dosages of 0, 25, 50 or 100 mg/kgBW/day for 14 days in a repeated fashion. Data were analyzed using ANOVA test.Results: Total cytochrome P450 level and acetanilide 4-hydroxylase activity were unaffected by any of the treatments. The CYP2E1 probe enzyme (p-nitrophenol hydroxylase was significantly reduced by repeated administration of 100mg/ kgBW/day lycopene (7.88 + 2.04 vs 12.26 + 2.77 n mol/min/mg prot.Conclusion: The present results suggest that lycopene does not affect the total cytochrome P450 or CYP1A2 activity but it inhibits the activity of CYP2E1 (p-nitrophenol hydroxylase in the rat. (Med J Indones 2009; 18: 233-8Keywords: lycopene, cytochrome P450, CYP1A2, CYP2E1

  3. Bovine collagen peptides compounds promote the proliferation and differentiation of MC3T3-E1 pre-osteoblasts.

    Directory of Open Access Journals (Sweden)

    JunLi Liu

    Full Text Available OBJECTIVE: Collagen peptides (CP compounds, as bone health supplements, are known to play a role in the treatment of osteoporosis. However, the molecular mechanisms of this process remain unclear. This study aimed to investigate the effects of bovine CP compounds on the proliferation and differentiation of MC3T3-E1 cells. METHODS: Mouse pre-osteoblast cell line MC3T3-E1 subclone 4 cells were treated with bovine CP compounds. Cell proliferation was analyzed by MTT assays and the cell cycle was evaluated by flow cytometry scanning. Furthermore, MC3T3-E1 cell differentiation was analyzed at the RNA level by real-time PCR and at the protein level by western blot analysis for runt-related transcription factor 2 (Runx2, a colorimetric p-nitrophenyl phosphate assay for alkaline phosphatase (ALP, and ELISA for osteocalcin (OC. Finally, alizarin red staining for mineralization was measured using Image Software Pro Plus 6.0. RESULTS: Cell proliferation was very efficient after treatment with different concentrations of bovine CP compounds, and the best concentration was 3 mg/mL. Bovine CP compounds significantly increased the percentage of MC3T3-E1 cells in G2/S phase. Runx2 expression, ALP activity, and OC production were significantly increased after treatment with bovine CP compounds for 7 or 14 days. Quantitative analyses with alizarin red staining showed significantly increased mineralization of MC3T3-E1 cells after treatment with bovine CP compounds for 14 or 21 days. CONCLUSIONS: Bovine CP compounds increased osteoblast proliferation, and played positive roles in osteoblast differentiation and mineralized bone matrix formation. Taking all the experiments together, our study indicates a molecular mechanism for the potential treatment of osteoarthritis and osteoporosis.

  4. Atmospheric volatilization and distribution of (Z)- and (E)-1,3-dichloropropene in field beds with and without plastic covers.

    Science.gov (United States)

    Thomas, John E; Allen, L Hartwell; McCormack, Leslie A; Vu, Joseph C; Dickson, Donald W; Ou, Li-Tse

    2004-01-01

    The fumigant 1,3-dichloropropene (1,3-D) is considered to be a potential replacement for methyl bromide when methyl bromide is phased out in 2005. This study on surface emissions and subsurface diffusion of 1,3-D in a Florida sandy soil was conducted in field beds with or without plastic covers. After injection of the commercial fumigant Telone II by conventional chisels to field beds at 30cm depth which were covered with polyethylene film (PE), virtually impermeable film, or no cover (bare), (Z)- and (E)-1,3-D rapidly diffused upward. Twenty hours after injection, majority of (Z)- and (E)-1,3-D had moved upward from 30 cm depth to the layer of 5-20 cm depth. Downward movement of the two isomers in the beds with or without a plastic cover was not significant. (Z)-1,3-D diffused more rapidly than (E)-1,3-D. Virtually impermeable films (VIF) had a good capacity to retain (Z)- and (E)-1,3-D in soil pore air space. Vapor concentrations of the two isomers in the shallow subsurface of the field bed covered with VIF were greater than that in the two beds covered with polyethylene film (PE) or no cover (bare). In addition, VIF cover provided more uniform distribution of (Z)- and (E)-1,3-D in shallow subsurface than PE cover or no cover. Virtually impermeable film also had a better capability to retard surface emissions of the two isomers from soil in field beds than PE cover or no cover.

  5. Gamma radiation effects in packaging for sterilization of health products and their constituents paper and plastic film

    Science.gov (United States)

    B. G. Porto, Karina Meschini; Napolitano, Celia Marina; Borrely, Sueli Ivone

    2018-01-01

    The integrity of materials containing packaging (natural or synthetic polymers) is essential to keep the aseptic condition of commercialized products (health care products, food and pharmaceuticals). The objective of this paper was to study gamma radiation effects (25 kGy, 40 kGy and 50 kGy) on the main properties of paper and multilayer films (polyester and polyethylene). Paper and multilayer films are components of packaging (pouches) for radiation sterilization containing medical equipment or products. Paper was the more radiation sensitive among the studied materials and radiation effects were more pronounced at brightness, pH, tearing resistance, bursting strength and tensile strength. Concerning plastic film, no pinholes were induced by radiation and the effects on the tensile strength were not significant. Although the seal strength packaging (pouches) decreased according to increasing dose, the sealing integrity was preserved.

  6. Radiation Safety Awareness among Radiation Workers and ...

    African Journals Online (AJOL)

    Background: All x-ray utilization in human medicine leads to exposure of the patient and personnel to radiation. Although the quantity is low in diagnostic examinations, special attention should be given to this fact in order to minimize unnecessary exposure for both groups. Exposure to ionizing radiation cannot be avoided ...

  7. Asteroid airburst altitude vs. strength

    Science.gov (United States)

    Robertson, D. K.; Wheeler, L.; Mathias, D.

    2016-12-01

    The entry and break-up of small asteroids were simulated with a hydrocode to examine the effect of strength, size, composition, entry angle, and speed on the resulting airburst. A strong asteroid, such as a monolithic boulder, structurally fail and deposit most of their energy around the altitude at which dynamic ram pressure exceeds the cohesive strength of the asteroid. A weaker asteroid, such as a loose rubble pile, will structurally fail at high altitude, but continue to fly through the atmosphere as a single unit until reaching lower altitudes where the increased aerodynamic pressure is sufficient to disrupt and disperse the rubble resulting in a flare. Airburst from weak asteroids consequently have a peak energy deposition at similar altitudes.This study focuses on small NEO asteroids which are likely to airburst rather than impact the ground where the damage created on the ground depends strongly on the altitude at which most of the energy is deposited in the atmosphere. The ability to accurately predict ground damage is useful in determining appropriate evacuation or shelter plans and emergency management. Airbursting asteroids are not a threat on a national level but can still cause a significant amount of local damage as demonstrated by the Chelyabinsk event where there was over $33 million worth of damage (1 billion roubles) and 1500 were injured by flying glass.

  8. Movement velocity vs. strength training

    Directory of Open Access Journals (Sweden)

    Mário C. Marques

    2017-06-01

    Full Text Available Intensity during strength training has been commonly identified with relative load (percentage of one-repetition maximum, 1RM or with performing a given maximal number of repetitions in each set (XRM: 5RM, 10RM, 15 RM, etc.. Yet, none of these methods can be appropriate for precisely monitoring the real training effort in each training session. The first approach requires coaches to individually assess the 1RM value for each athlete. We may agree that expressing intensity as a percentage of the maximum repetition has the advantage that it can be used to program strength training for multiple athletes simultaneously, the loads being later transformed in absolute values (kg for each individual. Further, another advantage is that this expression of the intensity can clearly reflect the dynamics of the evolution of the training load if we understand the percentage of 1RM as an effort, and not as a simple arithmetic calculus. Nevertheless, direct assessment of 1RM has some possible disadvantages worth noting. It may be associated with risk of injury when performed incorrectly or by novice athlete’s and it is time-consuming and impractical for large groups. Moreover, the actual RM can change quite rapidly after only a few training sessions and often the obtained value is not the subject’s true maximum. The classic way to prescribe loading intensity is to determine, through trial and error, the maximum number of repetitions that one can be performed with a given submaximal weight. For example, 5RM refers to a weight that can only be lifted five times. Some studies identified the relationship between selected percentages of 1RM and the number of repetitions to failure, establishing a repetition maximum continuum. It is believed that certain performance characteristics are best trained using specific RM load ranges. This method eliminates the need for a direct 1RM test, but it is not without drawbacks either. Using exhaustive efforts is common

  9. Evaluation of radiation damage using nonlinear ultrasound

    Science.gov (United States)

    Matlack, K. H.; Wall, J. J.; Kim, J.-Y.; Qu, J.; Jacobs, L. J.; Viehrig, H.-W.

    2012-03-01

    Nonlinear ultrasound was used to monitor radiation damage in two reactor pressure vessel (RPV) steels. The microstructural changes associated with radiation damage include changes in dislocation density and the formation of precipitates, and nonlinear ultrasonic waves are known to be sensitive to such changes. Six samples each of two different RPV steels were previously irradiated in the Rheinsberg power reactor to two fluence levels, up to 1020 n/cm2 (E > 1 MeV). Longitudinal waves were used to measure the acoustic nonlinearity in these samples, and the results show a clear increase in the measured acoustic nonlinearity from the unirradiated state to the medium dose, and then a decrease from medium dose to high dose.

  10. Radiation degradation of silk protein

    Energy Technology Data Exchange (ETDEWEB)

    Wachiraporn Pewlong; Boonya Sudatis [Office of Atomic Energy for Peace, Bangkok (Thailand); Takeshita, Hidefumi; Yoshii, Fumio; Kume, Tamikazu [Japan Atomic Energy Research Inst., Takasaki, Gunma (Japan). Takasaki Radiation Chemistry Research Establishment

    2000-09-01

    Silk fibroin fiber from the domesticated silkworm Bombyx mori was irradiated in the dose range up to 2500 kGy using an electron beam accelerator to apply the radiation degradation technique as a means to solubilize fibroin. The tensile strength of irradiated fibroin fiber decreased with increasing dose and the presence of oxygen in the irradiation atmosphere enhanced the degradation. The solubilization of irradiated fibroin fiber was evaluated using the following three kinds of solutions: calcium chloride solution (CaCl{sub 2}/C{sub 2}H{sub 5}OH/H{sub 2}O = 1 : 2 : 8 in mole ratio), hydrochloric acid (0.5N) and distilled water. Dissolution of fibroin fiber into these solutions was significantly enhanced by irradiation. Especially, an appreciable amount of water-soluble protein was extracted by distilled water. (author)

  11. Hendee's radiation therapy physics

    CERN Document Server

    Pawlicki, Todd; Starkschall, George

    2016-01-01

    The publication of this fourth edition, more than ten years on from the publication of Radiation Therapy Physics third edition, provides a comprehensive and valuable update to the educational offerings in this field. Led by a new team of highly esteemed authors, building on Dr Hendee’s tradition, Hendee’s Radiation Therapy Physics offers a succinctly written, fully modernised update. Radiation physics has undergone many changes in the past ten years: intensity-modulated radiation therapy (IMRT) has become a routine method of radiation treatment delivery, digital imaging has replaced film-screen imaging for localization and verification, image-guided radiation therapy (IGRT) is frequently used, in many centers proton therapy has become a viable mode of radiation therapy, new approaches have been introduced to radiation therapy quality assurance and safety that focus more on process analysis rather than specific performance testing, and the explosion in patient-and machine-related data has necessitated an ...

  12. Fluorescent radiation converter

    Science.gov (United States)

    Viehmann, W. (Inventor)

    1981-01-01

    A fluorescence radiation converter is described which includes a substantially undoped optically transparent substrate and a waveshifter coating deposited on at least one portion of the substrate for absorption of radiation and conversion of fluorescent radiation. The coating is formed to substantially 1000 g/liter of a solvent, 70 to 200 g/liter of an organic polymer, and 0.2 to 25 g/liter of at least one organic fluorescent dye. The incoming incident radiation impinges on the coating. Radiation is absorbed by the fluorescent dye and is re-emitted as a longer wavelength radiation. Radiation is trapped within the substrate and is totally internally reflected by the boundary surface. Emitted radiation leaves the substrate ends to be detected.

  13. Cell Radiation Experiment System

    Science.gov (United States)

    Morrison, Dennis R.

    2010-01-01

    The cell radiation experiment system (CRES) is a perfused-cell culture apparatus, within which cells from humans or other animals can (1) be maintained in homeostasis while (2) being exposed to ionizing radiation during controlled intervals and (3) being monitored to determine the effects of radiation and the repair of radiation damage. The CRES can be used, for example, to determine effects of drug, radiation, and combined drug and radiation treatments on both normal and tumor cells. The CRES can also be used to analyze the effects of radiosensitive or radioprotectant drugs on cells subjected to radiation. The knowledge gained by use of the CRES is expected to contribute to the development of better cancer treatments and of better protection for astronauts, medical-equipment operators, and nuclear-power-plant workers, and others exposed frequently to ionizing radiation.

  14. Environmental Radiation Data

    Data.gov (United States)

    U.S. Environmental Protection Agency — Environmental Radiation Data (ERD) is an electronic and print journal compiled and distributed quarterly by the Office of Radiation and Indoor Air's National Air and...

  15. Radiation processing in Japan

    Energy Technology Data Exchange (ETDEWEB)

    Makuuchi, Keizo [Japan Atomic Energy Research Inst., Takasaki, Gunma (Japan). Takasaki Radiation Chemistry Research Establishment

    2001-03-01

    Economic scale of radiation application in the field of industry, agriculture and medicine in Japan in 1997 was investigated to compare its economic impacts with that of nuclear energy industry. Total production value of radiation application accounted for 54% of nuclear industry including nuclear energy industry and radiation applications in three fields above. Industrial radiation applications were further divided into five groups, namely nondestructive test, RI instruments, radiation facilities, radiation processing and ion beam processing. More than 70% of the total production value was brought about by ion beam processing for use with IC and semiconductors. Future economic prospect of radiation processing of polymers, for example cross-linking, EB curing, graft polymerization and degradation, is reviewed. Particular attention was paid to radiation vulcanization of natural rubber latex and also to degradation of natural polymers. (S. Ohno)

  16. Radiation Protection Handbook

    Science.gov (United States)

    1972-01-01

    A handbook which sets forth the Kennedy Space Center radiation protection policy is presented. The book also covers administrative direction and guidance on organizational and procedural requirements of the program. Only ionizing radiation is covered.

  17. Breast radiation - discharge

    Science.gov (United States)

    Radiation - breast - discharge ... You may notice changes in the way your breast looks or feels (if you are getting radiation ... after treatment is over. The skin on your breast may become more sensitive or numb. Skin and ...

  18. ERLN Radiation Focus Area

    Science.gov (United States)

    As part of the Environmental Response Laboratory Network, the National Air and Radiation Environmental Laboratory (NAREL) here provides your laboratory with access to radiation-specific laboratory guidance documents and training courses.

  19. Radiation and Pregnancy

    Science.gov (United States)

    ... Global Map Premature Birth Report Cards Careers Archives Pregnancy Before or between pregnancies Nutrition, weight & fitness Prenatal ... Is it safe? > Radiation and pregnancy Radiation and pregnancy E-mail to a friend Please fill in ...

  20. Radiation therapy -- skin care

    Science.gov (United States)

    ... this page: //medlineplus.gov/ency/patientinstructions/000735.htm Radiation therapy - skin care To use the sharing features ... this page, please enable JavaScript. When you have radiation treatment for cancer, you may have some changes ...

  1. Radiation effects in semiconductors

    CERN Document Server

    2011-01-01

    There is a need to understand and combat potential radiation damage problems in semiconductor devices and circuits. Written by international experts, this book explains the effects of radiation on semiconductor devices, radiation detectors, and electronic devices and components. These contributors explore emerging applications, detector technologies, circuit design techniques, new materials, and innovative system approaches. The text focuses on how the technology is being used rather than the mathematical foundations behind it. It covers CMOS radiation-tolerant circuit implementations, CMOS pr

  2. Heart and radiation

    Directory of Open Access Journals (Sweden)

    Lauro Martins Júnior

    2011-12-01

    Full Text Available ABSTRATC The heart exposition to ionizing radiation may produce lesions in cardiac structures, acute (in most of cases benign and reversible, or months and even years later. There is a direct relationship of severity of lesions with radiation doses. The clinical picture receives a new denomination: radiation induced cardiopathy. The more frequent use of radiation in diagnosis and therapeutics increases the importance of their knowledge and especially their prevention.

  3. External radiation surveillance

    Energy Technology Data Exchange (ETDEWEB)

    Antonio, E.J.

    1995-06-01

    This section of the 1994 Hanford Site Environmental Report describes how external radiation was measured, how surveys were performed, and the results of these measurements and surveys. External radiation exposure rates were measured at locations on and off the Hanford Site using thermoluminescent dosimeters (TLD). External radiation and contamination surveys were also performed with portable radiation survey instruments at locations on and around the Hanford Site.

  4. Synchrotron radiation facilities

    CERN Multimedia

    1972-01-01

    Particularly in the past few years, interest in using the synchrotron radiation emanating from high energy, circular electron machines has grown considerably. In our February issue we included an article on the synchrotron radiation facility at Frascati. This month we are spreading the net wider — saying something about the properties of the radiation, listing the centres where synchrotron radiation facilities exist, adding a brief description of three of them and mentioning areas of physics in which the facilities are used.

  5. Xanthates As Useful Probes for Testing the Active Sites of Cytochromes P450 4A11 and 2E1

    Directory of Open Access Journals (Sweden)

    Tsveta Stoyanova

    2017-09-01

    Full Text Available Xanthates (alkyl or aryl derivatives of dithiocarbonic acid have been shown to be selective mechanism-based inactivators of cytochromes P450 2B1/2B6 and 2E1 due to covalent binding of a reactive intermediate to apoprotein after double hydrogen abstraction at α-carbon atom, suggesting interaction of the xanthate dithiocarbonic head with the enzyme heme. The structures of xanthates with a long alkyl chain are similar to the fatty acids. Saturated fatty acids (FA such as lauric acid (LA, are metabolized by different cytochrome P450 isoforms to ω- and (ω-1-hydroxy products, in humans done by CYP4A11 and CYP2E1, respectively. In the present study we aimed at elucidating the possible interactions of xanthates with two cytochrome P450 isoforms CYP4A11 and CYP2E1 involved in the metabolism of the FA. Our experiments showed that LA-ω-hydroxylation by CYP4A11 is inhibited in a competitive manner by xanthates with long alkyl chain (C12-xanthate being the most potent inhibitor. On the other hand LA-(ω-1-hydroxylation reaction by purified CYP2E1 is inactivated by a mechanism-based type. The suggested differences in the interactions of C12-xanthate with the two cytochrome P450 isoforms were investigated by molecular modeling using docking approach. The results suggested that in CYP2E1 active site C12-xanthate coordinates to the heme with its most vulnerable dithiocarbonic head leading to a mechanism-based inactivation. In CYP4A11 xanthate alkyl chain is exposed to the heme, thus, a potenial ω-hydroxylated xanthate product could be formed, which could inhibit in a competitive manner the hydroxylation of LA. The observed differences of xanthates interactions with the active sites of the two similar cytochrome P450 isoforms (CYP4A11 and CYP2E1 involved in the metabolism of FA, which lead to different changes in the enzyme activity, suggest that xanthates can be used as probing tools for analyzing enzyme active sites when exploring useful and selective

  6. Reference Values of Grip Strength, Prevalence of Low Grip Strength, and Factors Affecting Grip Strength Values in Chinese Adults.

    Science.gov (United States)

    Yu, Ruby; Ong, Sherlin; Cheung, Osbert; Leung, Jason; Woo, Jean

    2017-06-01

    The objectives of this study were to update the reference values of grip strength, to estimate the prevalence of low grip strength, and to examine the impact of different aspects of measurement protocol on grip strength values in Chinese adults. A cross-sectional survey of Chinese men (n = 714) and women (n = 4014) aged 18-102 years was undertaken in different community settings in Hong Kong. Grip strength was measured with a digital dynamometer (TKK 5401 Grip-D; Takei, Niigata, Japan). Low grip strength was defined as grip strength 2 standard deviations or more below the mean for young adults. The effects of measurement protocol on grip strength values were examined in a subsample of 45 men and women with repeated measures of grip strength taken with a hydraulic dynamometer (Baseline; Fabrication Enterprises Inc, Irvington, NY), using pair t-tests, intraclass correlation coefficient, and Bland and Altman plots. Grip strength was greater among men than among women (P values than the Baseline hydraulic dynamometer (P values were also observed when the measurement was performed with the elbow extended in a standing position, compared with that with the elbow flexed at 90° in a sitting position, using the same dynamometer (P values of grip strength and estimated the prevalence of low grip strength among Chinese adults spanning a wide age range. These findings might be useful for risk estimation and evaluation of interventions. However, grip strength measurements should be interpreted with caution, as grip strength values can be affected by type of dynamometer used, assessment posture, and elbow position. Copyright © 2017 AMDA – The Society for Post-Acute and Long-Term Care Medicine. Published by Elsevier Inc. All rights reserved.

  7. Radiation bioengineering; Bioinzynieria radiacyjna

    Energy Technology Data Exchange (ETDEWEB)

    Rosiak, J.M. [Politechnika Lodzka, Lodz (Poland). Inst. Techniki Radiacynej

    1997-10-01

    Radiation processing for modification of different properties of materials being designed for medical use have been described. Especially the polymers as very often used for medical equipment production have been modified by radiation. The different medical applications of biomaterials based on radiation modified polymers have been presented. 13 refs.

  8. Ultraviolet radiation and immunosuppression.

    LENUS (Irish Health Repository)

    Murphy, G M

    2009-11-01

    Ultraviolet (UV) radiation is a complete carcinogen. The effects of UV radiation are mediated via direct damage to cellular DNA in the skin and suppression of image surveillance mechanisms. In the context of organ transplantation, addiction of drugs which suppress the immune system add greatly to the carcinogenicity of UV radiation. This review considers the mechanisms of such effects.

  9. (Mis)Understanding Radiation

    Energy Technology Data Exchange (ETDEWEB)

    Schreiber, Stephen Bruce [Los Alamos National Lab. (LANL), Los Alamos, NM (United States)

    2016-02-10

    This set of slides discusses radiation and fears concerning it at a non-technical level. Included are some misconceptions and practical consequences resulting from these. The concept of radiation hormesis is explained. The author concludes that a number of significant societal benefits are being foregone because of overly cautious concerns about low-level radiation.

  10. RADIATION AND SURGERY

    African Journals Online (AJOL)

    Dr. S.A. Adewuyi

    Introduction. Radiation therapy is devoted to management of patients with cancers and occasionally benign conditions by ionizing radiations. It can be used alone or in combination with other treatment modalities like surgery, chemotherapy, hormonal therapy and immunotherapy . Ionizing radiations were discovered.

  11. Calculation of surface impedance effects on transient antenna radiation

    Science.gov (United States)

    Booker, S. M.; Lambert, A. P.; Smith, P. D.

    1996-11-01

    A numerical time domain approach to radiation and scattering problems is introduced for surfaces of arbitrary conductivity. This approach is based upon a method of moments solution of the electric field integral equation. The problem is posed as a second-kind integral equation in discrete time for those regions of the surface with finite conductivity; it is shown that this formulation possesses desirable stability properties. The numerical method introduced is used to determine the far field radiation of both directive and nondirective transient antennas excited by temporally compact, ultrawideband pulses when the antenna surfaces are subject to a Wu-King surface impedance profile. Such loads are shown to suppress the "late time ringing" resulting from reflected surface currents without significantly affecting the initial radiated waveform. In the case of nondirective transient radiators, such as the bicone or bow tie antenna, the presence of a surface loading has no effect on the peak radiated field strength. In the case of a directive transient radiator, such as a transverse electromagnetic horn, the introduction of a surface impedance reduces the radiated field strength somewhat. The difference in the physical behavior of these two classes of antenna is accounted for.

  12. Pelvic (between the hips) radiation - discharge

    Science.gov (United States)

    ... radiation treatment area on your body is large. Alternative Names Radiation of the pelvis - discharge; Cancer treatment - pelvic radiation; Prostate cancer - pelvic radiation; Ovarian cancer - pelvic radiation; Cervical ...

  13. Thermal Balance in Dense Molecular Clouds: Radiative Cooling Rates and Emission-Line Luminosities

    Science.gov (United States)

    Neufeld, David A.; Lepp, Stephen; Melnick, Gary J.

    1995-01-01

    We consider the radiative cooling of fully shielded molecular astrophysical gas over a wide range of temperatures ( 10 K line strengths that contribute to the total radiative cooling rate, and we have obtained example spectra for the submillimeter emission expected from molecular cloud cores. Many of the important cooling lines will be detectable using the Infrared Space Observatory and the Submillimeter Wave Astronomy Satellite.

  14. Evaluation of plastic packaging materials used in radiation sterilized medical products and food

    Science.gov (United States)

    Fengmei, L. L.; Ying, W. W.; Xiaoguang, L. L.; Baoyu, Y. Y.

    2000-03-01

    This paper studied the results of evaluation on resistance to radiation, moisture permeability, bacteria permeability, tensile strength, elongation at break and sealing ability for several plastic films available on the market. The result shows that nylon, sarin, and polyethylene complex films, high and low density polyethylene films are applicable for packing of radiation sterilized products.

  15. Swimbladder on Fish Target Strength

    Directory of Open Access Journals (Sweden)

    Sunardi

    2008-08-01

    Full Text Available This paper discusses of target strength (TS for the Selar boops (Oxeye scad and Megalaspis cordyla (Torpedo scad, the most commercially fish in Malaysia. TS can be determined from in situ measurements and acoustic calculation of fish model. TS value, depth, and position (x-y-z of targeted fish can be viewed from echogram using FQ-80 Analyzer by in situ measurement. X-ray imaged can be deployed to develop the acoustic fish model. The percentage of length and upper surface area for swimbladder to body fish of Selar boops more than Megalaspis cordyla can be measured after X-ray process. The percentage of width and volume of swimbladders to its each body are no significantly difference for both fish. These data of swimbladder physic support the result of in situ measurement which TS of Megalaspis cordyla stronger Selar boops.

  16. Wheat Germ Oil Attenuates Gamma Radiation-Induced Skeletal ...

    African Journals Online (AJOL)

    Muscular strength is important in sport as well as in daily activities. Exposure to ionizing radiation is thought to increase oxidative stress and damage muscle tissue. Wheat germ oil is a natural unrefined vegetable oil. It is an excellent source of vitamin E, octacosanol, linoleic and linolenic essential fatty acids, which may be ...

  17. Impact of UV radiation on the physical properties of polypropylene ...

    African Journals Online (AJOL)

    Textiles, used as agrotextiles require suitable tensile strength and good permeability characteristics with no significant deterioration under the influence of weather changes and UV radiation. Properties of agrotextiles depend on the fibres made of and on the type and conditions of production. The purpose of this study was ...

  18. Pressure-induced magnetic collapse and metallization of TlF e1.6S e2

    Science.gov (United States)

    Naumov, P. G.; Filsinger, K.; Shylin, S. I.; Barkalov, O. I.; Ksenofontov, V.; Qi, Y.; Palasyuk, T.; Schnelle, W.; Medvedev, S. A.; Greenblatt, M.; Felser, C.

    2017-08-01

    The crystal structure, magnetic ordering, and electrical resistivity of TlF e1.6S e2 were studied at high pressures. Below ˜7 GPa , TlF e1.6S e2 is an antiferromagnetically ordered semiconductor with a ThC r2S i2 -type structure. The insulator-to-metal transformation observed at a pressure of ˜7 GPa is accompanied by a loss of magnetic ordering and an isostructural phase transition. In the pressure range ˜7.5 -11 GPa a remarkable downturn in resistivity, which resembles a superconducting transition, is observed below 15 K. We discuss this feature as the possible onset of superconductivity originating from a phase separation in a small fraction of the sample in the vicinity of the magnetic transition.

  19. Topics in radiation dosimetry radiation dosimetry

    CERN Document Server

    1972-01-01

    Radiation Dosimetry, Supplement 1: Topics in Radiation Dosimetry covers instruments and techniques in dealing with special dosimetry problems. The book discusses thermoluminescence dosimetry in archeological dating; dosimetric applications of track etching; vacuum chambers of radiation measurement. The text also describes wall-less detectors in microdosimetry; dosimetry of low-energy X-rays; and the theory and general applicability of the gamma-ray theory of track effects to various systems. Dose equivalent determinations in neutron fields by means of moderator techniques; as well as developm

  20. Radiative Corrections to Bremsstrahlung in Radiative Return

    CERN Document Server

    Yost, S A; Ward, B F L; Yost, Scott A.

    2005-01-01

    Radiating a photon from the initial state provides a useful tool for studying a range of low energy physics using a high-energy e+ e- accelerator. Accurate results require careful calculation of the first order virtual photon corrections. We compare exact results for initial state radiative corrections, finding agreement to an order of 10^{-5} or better as a fraction of the Born cross-section for most of the range of photon energies, at CMS energies relevant in both high-energy collision and radiative return experiments.

  1. Synthesis, Physical Characterization, Antibacterial and Antifungal activities of a novel bis(3-((E-1-(2-hydroxyphenylethylideneaminophenylmethanone

    Directory of Open Access Journals (Sweden)

    S. Rezaei

    2006-06-01

    Full Text Available Bis (3-((E-1-(2-hydroxyphenyl ethylideneamino phenyl methanone has been synthesized in this paper and its structure was confirmed by 1H-NMR, 13C-NMR, IR and Mass spectra. Its AM1 and B3LYP/6-31G* calculations to characterize the physical properties of this molecule has been also presented. Finally, the antifungal and antibacterial activities of this derivative have been evaluated.

  2. [3H]-thymidine labelling of DNA triggers apoptosis potentiated by E1A-adenoviral protein.

    Science.gov (United States)

    Orlov, S N; Pchejetski, D V; Sarkissian, S D; Adarichev, V; Taurin, S; Pshezhetsky, A V; Tremblay, J; Maximov, G V; deBlois, D; Bennett, M R; Hamet, P

    2003-03-01

    [(3)H]-thymidine is commonly used to analyze the accumulation of [(3)H]-labeled chromatin fragments in cells undergoing apoptosis. This study shows that [(3)H]-thymidine incorporation within DNA is sufficient per se to inhibit growth and to induce apoptosis in canine kidney epithelial cells and porcine aorta endothelial cells. Despite high-level [(3)H]-thymidine-DNA labeling, rat vascular smooth muscle cells (VSMC) showed only modest inhibition of growth and induction of apoptosis compared to other cell types. Similarly to serum deprivation, apoptosis triggered by [(3)H]-thymidine labeling was sharply potentiated by VSMC transfection with a functional analogue of c-myc, E1A-adenoviral protein (VSMC-E1A), and was suppressed by stimulation of cAMP signaling with forskolin as well as by and Na/K pump inhibition with ouabain. Both apoptosis induction and growth suppression seen in [(3)H]-thymidine-treated VSMC-E1A were reduced by the pan-caspase inhibitor z-VAD.fmk. Thus, our results show that the differential efficiency of the apoptotic machinery determines cell type-specific attenuation of growth in cells with [(3)H]-thymidine-labeled DNA. They also demonstrate that [(3)H]-thymidine-treated and serum-deprived VSMC employ common intermediates of the apoptotic machinery, including steps that are potentiated by E1A-adenoviral protein and inhibited by activation of cAMP signaling as well as by inversion of the intracellular [Na(+)](i)/[K(+)](i) ratio.

  3. Lokal østrogen-fobehandling reducerer aborttiden ven prostaglandin E1 analog-induceret abort i 2. trimester

    DEFF Research Database (Denmark)

    Petersen, Lone Kjeld; Uldbjerg, N; Allen, J G

    1991-01-01

    Twenty-eight patients (median gestational age 17 weeks) referred for induction of second trimester abortion, were randomized to intracervical preliminary treatment by either 50 mg 17 beta-oestradiol or placebo. Abortion was then induced by 1 mg prostaglandin E1 vagitories. The preliminary treatment...... caused a significant rise in cervical score and a significant reduction in induction-abortion time especially by reducing the number of patients with prolonged induction-abortion time. Udgivelsesdato: 1991-May-20...

  4. Functional expression of 5-HT{sub 2A} receptor in osteoblastic MC3T3-E1 cells

    Energy Technology Data Exchange (ETDEWEB)

    Hirai, Takao; Kaneshige, Kota; Kurosaki, Teruko [Department of Molecular Pharmacology, Faculty of Pharmacy and Pharmaceutical Sciences, Fukuyama University, 1 Gakuen-cho, Fukuyama, Hiroshima 729-0292 (Japan); Nishio, Hiroaki, E-mail: nishio@fupharm.fukuyama-u.ac.jp [Department of Molecular Pharmacology, Faculty of Pharmacy and Pharmaceutical Sciences, Fukuyama University, 1 Gakuen-cho, Fukuyama, Hiroshima 729-0292 (Japan)

    2010-05-28

    In the previous study, we reported the gene expression for proteins related to the function of 5-hydroxytryptamine (5-HT, serotonin) and elucidated the expression patterns of 5-HT{sub 2} receptor subtypes in mouse osteoblasts. In the present study, we evaluated the possible involvement of 5-HT receptor subtypes and its inactivation system in MC3T3-E1 cells, an osteoblast cell line. DOI, a 5-HT{sub 2A} and 5-HT{sub 2C} receptor selective agonist, as well as 5-HT concentration-dependently increased proliferative activities of MC3T3-E1 cells in their premature period. This effect of 5-HT on cell proliferation were inhibited by ketanserin, a 5-HT{sub 2A} receptor specific antagonist. Moreover, both DOI-induced cell proliferation and phosphorylation of ERK1 and 2 proteins were inhibited by PD98059 and U0126, selective inhibitors of MEK in a concentration-dependent manner. Furthermore, treatment with fluoxetine, a 5-HT specific re-uptake inhibitor which inactivate the function of extracellular 5-HT, significantly increased the proliferative activities of MC3T3-E1 cells in a concentration-dependent manner. Our data indicate that 5-HT fill the role for proliferation of osteoblast cells in their premature period. Notably, 5-HT{sub 2A} receptor may be functionally expressed to regulate mechanisms underlying osteoblast cell proliferation, at least in part, through activation of ERK/MAPK pathways in MC3T3-E1 cells.

  5. Management of newborns with duct-dependent congenital heart disease with prostaglandin E1 – Slovenian guidelines

    OpenAIRE

    Mojca Grošelj Grenc; Maja Pavčnik Arnol; Gorazd Kalan; Tomaž Podnar; Ivan Vidmar

    2012-01-01

    Background: Early recognition of duct-dependent congenital heart disease in newborns with duct-dependent pulmonary or systemic blood flow or transposition of the great arteries is critical for early introduction of prostaglandin E1 (PGE1), which allows stabilization of the newborn till cardiac catheterization or surgical intervention. Indications for PGE1, management of newborns with duct-dependent congenital heart disease and interventions in case of side effects of PGE1 are reviewed. Con...

  6. Association between Rare Variants in AP4E1, a Component of Intracellular Trafficking, and Persistent Stuttering.

    Science.gov (United States)

    Raza, M Hashim; Mattera, Rafael; Morell, Robert; Sainz, Eduardo; Rahn, Rachel; Gutierrez, Joanne; Paris, Emily; Root, Jessica; Solomon, Beth; Brewer, Carmen; Basra, M Asim Raza; Khan, Shaheen; Riazuddin, Sheikh; Braun, Allen; Bonifacino, Juan S; Drayna, Dennis

    2015-11-05

    Stuttering is a common, highly heritable neurodevelopmental disorder characterized by deficits in the volitional control of speech. Whole-exome sequencing identified two heterozygous AP4E1 coding variants, c.1549G>A (p.Val517Ile) and c.2401G>A (p.Glu801Lys), that co-segregate with persistent developmental stuttering in a large Cameroonian family, and we observed the same two variants in unrelated Cameroonians with persistent stuttering. We found 23 other rare variants, including predicted loss-of-function variants, in AP4E1 in unrelated stuttering individuals in Cameroon, Pakistan, and North America. The rate of rare variants in AP4E1 was significantly higher in unrelated Pakistani and Cameroonian stuttering individuals than in population-matched control individuals, and coding variants in this gene are exceptionally rare in the general sub-Saharan West African, South Asian, and North American populations. Clinical examination of the Cameroonian family members failed to identify any symptoms previously reported in rare individuals carrying homozygous loss-of-function mutations in this gene. AP4E1 encodes the ε subunit of the heterotetrameric (ε-β4-μ4-σ4) AP-4 complex, involved in protein sorting at the trans-Golgi network. We found that the μ4 subunit of AP-4 interacts with NAGPA, an enzyme involved in the synthesis of the mannose 6-phosphate signal that targets acid hydrolases to the lysosome and the product of a gene previously associated with stuttering. These findings implicate deficits in intracellular trafficking in persistent stuttering. Copyright © 2015 The American Society of Human Genetics. Published by Elsevier Inc. All rights reserved.

  7. DNA Damage Reduces the Quality, but Not the Quantity of Human Papillomavirus 16 E1 and E2 DNA Replication

    Directory of Open Access Journals (Sweden)

    Molly L. Bristol

    2016-06-01

    Full Text Available Human papillomaviruses (HPVs are causative agents in almost all cervical carcinomas. HPVs are also causative agents in head and neck cancer, the cases of which are increasing rapidly. Viral replication activates the DNA damage response (DDR pathway; associated proteins are recruited to replication foci, and this pathway may serve to allow for viral genome amplification. Likewise, HPV genome double-strand breaks (DSBs could be produced during replication and could lead to linearization and viral integration. Many studies have shown that viral integration into the host genome results in unregulated expression of the viral oncogenes, E6 and E7, promoting HPV-induced carcinogenesis. Previously, we have demonstrated that DNA-damaging agents, such as etoposide, or knocking down viral replication partner proteins, such as topoisomerase II β binding protein I (TopBP1, does not reduce the level of DNA replication. Here, we investigated whether these treatments alter the quality of DNA replication by HPV16 E1 and E2. We confirm that knockdown of TopBP1 or treatment with etoposide does not reduce total levels of E1/E2-mediated DNA replication; however, the quality of replication is significantly reduced. The results demonstrate that E1 and E2 continue to replicate under genomically-stressed conditions and that this replication is mutagenic. This mutagenesis would promote the formation of substrates for integration of the viral genome into that of the host, a hallmark of cervical cancer.

  8. 2-aminopurine enhances the oncolytic activity of an E1b-deleted adenovirus in hepatocellular carcinoma cells.

    Science.gov (United States)

    Sharon, David; Schümann, Michael; MacLeod, Sheena; McPherson, Robyn; Chaurasiya, Shyambabu; Shaw, Andrew; Hitt, Mary M

    2013-01-01

    Adenoviruses with deletions of viral genes have been extensively studied as potential cancer therapeutics. Although a high degree of cancer selectivity has been demonstrated with these conditionally replicating adenoviruses, low levels of virus replication can be detected in normal cells. Furthermore, these mutations were also found to reduce the activity of the replicating viruses in certain cancer cells. Recent studies have shown that co-administration of chemotherapeutic drugs may increase the activity of these viruses without affecting their specificity. We constructed an adenovirus with deletions of both the E1b and the VA-RNA genes and found that replication of this virus was selective for human hepatocellular carcinoma (HCC) cell lines when compared to normal cell lines. Furthermore, we show that 2-aminopurine (2'AP) treatment selectively enhanced virus replication and virus-mediated death of HCC cells. 2'AP did not compensate for the loss of VA-RNA activities, but rather the loss of an E1b-55K activity, such as the DNA damage response, suggesting that co-administration of 2'AP derivatives that block host DNA damage response, may increase the oncolytic activity of AdΔE1bΔVA without reducing its selectivity for HCC cells.

  9. 2-aminopurine enhances the oncolytic activity of an E1b-deleted adenovirus in hepatocellular carcinoma cells.

    Directory of Open Access Journals (Sweden)

    David Sharon

    Full Text Available Adenoviruses with deletions of viral genes have been extensively studied as potential cancer therapeutics. Although a high degree of cancer selectivity has been demonstrated with these conditionally replicating adenoviruses, low levels of virus replication can be detected in normal cells. Furthermore, these mutations were also found to reduce the activity of the replicating viruses in certain cancer cells. Recent studies have shown that co-administration of chemotherapeutic drugs may increase the activity of these viruses without affecting their specificity. We constructed an adenovirus with deletions of both the E1b and the VA-RNA genes and found that replication of this virus was selective for human hepatocellular carcinoma (HCC cell lines when compared to normal cell lines. Furthermore, we show that 2-aminopurine (2'AP treatment selectively enhanced virus replication and virus-mediated death of HCC cells. 2'AP did not compensate for the loss of VA-RNA activities, but rather the loss of an E1b-55K activity, such as the DNA damage response, suggesting that co-administration of 2'AP derivatives that block host DNA damage response, may increase the oncolytic activity of AdΔE1bΔVA without reducing its selectivity for HCC cells.

  10. The Effect of Smoking on Necrosis Rate in Digital Replantation and Revascularization with Prostaglandin E1 Therapy: A Retrospective Study.

    Science.gov (United States)

    Nishijima, Akio; Yamamoto, Naoto; Yanagibayashi, Satoshi; Yoshida, Ryuichi; Takikawa, Megumi; Kouno, Rie; Gosho, Masahiko

    2016-10-01

    Most microsurgeons believe that smoking and severity of injury adversely affect the outcome of digital replantation surgery. As countermeasures, several pharmacologic agents have been used for the perioperative period. The purpose of this retrospective study was to examine whether the rate of necrosis is appreciably different across smokers versus nonsmokers with prostaglandin E1 therapy. The authors' study subjects included 144 patients (184 digits) who underwent replantation or revascularization between August of 2013 and August of 2015.The primary outcome was the incidence of total necrosis after replantation surgery, and the secondary outcomes were the rate of overall necrosis, proportion of total necrosis to overall necrosis, and total success. Intravenous administration of prostaglandin E1 was performed at the rate of 120 μg/day for 7 days after surgery in all patients. These outcomes of each injury type were compared between smoking and nonsmoking groups. Among the 184 injured digits, the incidence of total necrosis in smokers (23 percent) was higher than that in nonsmokers (17 percent), although no significant difference was shown (p = 0.36). The adjusted odds ratio was 1.17 (95 percent CI, 0.51 to 2.69). Similarly, there was no significant difference in the secondary outcomes between the two groups. The authors' retrospective study found no significant difference in the formation or extent of necrosis after replantation or revascularization between smoking and nonsmoking groups when all patients were treated with prostaglandin E1. Risk, II.

  11. STABILITAS EPIGALOKATEKIN GALAT DALAM KRIM EKSTRAK TEH HIJAU DENGAN VARIASI KONSENTRASI ANTIOKSIDAN VITAMIN C 1% DAN VITAMIN E 1%

    Directory of Open Access Journals (Sweden)

    Nining Sugihartini

    2016-11-01

    Full Text Available Epigallocatechingallate (EGCG in green tea extract has activity as an anti-inflammatory agent. On the other hand the stability of EGCG is poor because of the oxidation. The aim of this study was to determine the influence of Vitamine C and Vitamine E in formulation of green tea extract cream to the stabiliy of EGCG. The green tea extract was obtained from the extraction process by infundation followed by fractination with ethyl acetate as the solvent. The three formulas were compiled in similar composition with the concentration of vitamine C 1% (FI, Vitamine E 1% (FII and there was no Vitamine C and Vitamine E (FIII as a control. The EGCG level was determinated by TLC-densitometry methode. The stability parameter was determinated by calculated of the Q10 of each formula. The result of this study showed that the parameter of t90 of EGCG with Vitamine C 1%, Vitamine E 1% and control addition were 0.0108 hours, 0.0087 hours, 0.0084 hours, respectively. Stability of EGCG in green tea leaf extract cream with addition of the vitamin C 1% was higher than it stability with the addition of vitamin E 1%. The concentration of Vitamin C 1% was the optimum concentration as antioxidant in formulation of green tea extract cream.

  12. DNA Damage Reduces the Quality, but Not the Quantity of Human Papillomavirus 16 E1 and E2 DNA Replication.

    Science.gov (United States)

    Bristol, Molly L; Wang, Xu; Smith, Nathan W; Son, Minkyeong P; Evans, Michael R; Morgan, Iain M

    2016-06-22

    Human papillomaviruses (HPVs) are causative agents in almost all cervical carcinomas. HPVs are also causative agents in head and neck cancer, the cases of which are increasing rapidly. Viral replication activates the DNA damage response (DDR) pathway; associated proteins are recruited to replication foci, and this pathway may serve to allow for viral genome amplification. Likewise, HPV genome double-strand breaks (DSBs) could be produced during replication and could lead to linearization and viral integration. Many studies have shown that viral integration into the host genome results in unregulated expression of the viral oncogenes, E6 and E7, promoting HPV-induced carcinogenesis. Previously, we have demonstrated that DNA-damaging agents, such as etoposide, or knocking down viral replication partner proteins, such as topoisomerase II β binding protein I (TopBP1), does not reduce the level of DNA replication. Here, we investigated whether these treatments alter the quality of DNA replication by HPV16 E1 and E2. We confirm that knockdown of TopBP1 or treatment with etoposide does not reduce total levels of E1/E2-mediated DNA replication; however, the quality of replication is significantly reduced. The results demonstrate that E1 and E2 continue to replicate under genomically-stressed conditions and that this replication is mutagenic. This mutagenesis would promote the formation of substrates for integration of the viral genome into that of the host, a hallmark of cervical cancer.

  13. Collagen-derived dipeptide prolyl-hydroxyproline promotes differentiation of MC3T3-E1 osteoblastic cells

    Energy Technology Data Exchange (ETDEWEB)

    Kimira, Yoshifumi, E-mail: kimira@josai.ac.jp [Faculty of Pharmaceutical Sciences, Josai University, 1-1 Keyakidai, Sakado, Saitama 350-0295 (Japan); Ogura, Kana; Taniuchi, Yuri [Faculty of Pharmaceutical Sciences, Josai University, 1-1 Keyakidai, Sakado, Saitama 350-0295 (Japan); Kataoka, Aya; Inoue, Naoki; Sugihara, Fumihito [Nitta Gelatin Inc., Peptide Division, 2-22 Futamata, Yao, Osaka 581-0024 (Japan); Nakatani, Sachie; Shimizu, Jun; Wada, Masahiro; Mano, Hiroshi [Faculty of Pharmaceutical Sciences, Josai University, 1-1 Keyakidai, Sakado, Saitama 350-0295 (Japan)

    2014-10-24

    Highlights: • Pro-Hyp did not affect MC3T3-E1 cell proliferation and matrix mineralization. • Pro-Hyp significantly increased alkaline phosphatase activity. • Pro-Hyp significantly upregulated gene expression of Runx2, Osterix, and Col1α1. - Abstract: Prolyl-hydroxyproline (Pro-Hyp) is one of the major constituents of collagen-derived dipeptides. The objective of this study was to investigate the effects of Pro-Hyp on the proliferation and differentiation of MC3T3-E1 osteoblastic cells. Addition of Pro-Hyp did not affect MC3T3-E1 cell proliferation and matrix mineralization but alkaline phosphatase activity was significantly increased. Furthermore, cells treated with Pro-Hyp significantly upregulated gene expression of Runx2, Osterix, and Col1α1. These results indicate that Pro-Hyp promotes osteoblast differentiation. This study demonstrates for the first time that Pro-Hyp has a positive effect on osteoblast differentiation with upregulation of Runx2, Osterix, and Collα1 gene expression.

  14. Monitoring of radiation exposure

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    2000-02-01

    The guide specifies the requirements for the monitoring of radiation exposure in instances where radiation is used. In addition to workers, the guide covers students, apprentices and visitors. The guide shall also apply to exposure from natural radiation. However, the monitoring of radiation exposure in nuclear power plants is dealt with in YVL Guide 7.10 and 7.11. The guide defines the concepts relevant to the monitoring of radiation exposure and provides guidelines for determining the necessity of monitoring and subsequently arranging such in different operations. In addition, the guide specifies the criteria for the approval and regulatory control of the dosimetric service.

  15. COHERENCE PROPERTIES OF ELECTROMAGNETIC RADIATION,

    Science.gov (United States)

    ELECTROMAGNETIC RADIATION , COHERENT SCATTERING), (*COHERENT SCATTERING, ELECTROMAGNETIC RADIATION ), LIGHT, INTERFERENCE, INTENSITY, STATISTICAL FUNCTIONS, QUANTUM THEORY, BOSONS, INTERFEROMETERS, CHINA

  16. Biological improvement of radiation resistance

    Energy Technology Data Exchange (ETDEWEB)

    Chun, K. J.; Lee, Y. K.; Kim, J. S.; Kim, J. K.; Lee, S. J

    2000-08-01

    To investigate the mechanisms of gene action related to the radiation resistance in microorganisms could be essentially helpful for the development of radiation protectants and hormeric effects of low dose radiation. This book described isolation of radiation-resistant microorganisms, induction of radiation-resistant and functionally improved mutants by gamma-ray radiation, cloning and analysis of the radiation resistance related genes and analysis of the expressed proteins of the radiation resistant related genes.

  17. Sulfonate groups grafted on Ti6Al4V favor MC3T3-E1 cell performance in serum free medium conditions.

    Science.gov (United States)

    Felgueiras, Helena; Migonney, Véronique

    2014-06-01

    Ten years ago, we synthesized "bioactive model polymers" bearing sulfonate groups and proposed a mechanism of their modulation effect at different steps of the cell response. Then, we set up the grafting of polymers bearing sulfonate on Ti6Al4V surfaces by a grafting "from" technique making sure of the creation of covalent bonds between the grafted polymer and the Ti6Al4V surface. We have checked and confirmed the positive effect of grafted sulfonate groups on the osteoblastic cell response in vivo and in vitro but we did not elucidate the mechanism. The aim of this basic work consists first in investigating the role of sulfonate groups in the presence and in the absence of proteins at early stages of the osteointegration process on poly(sodium styrene sulfonate) poly(NaSS) grafted and ungrafted Ti6Al4V surfaces, in vitro. To understand the role of poly(NaSS) grafted chains on osteoblast-like cell response and to confirm/elucidate the importance of fetal bovine serum (FBS) proteins in the culture medium, MC3T3-E1 cells were seeded onto poly(NaSS) grafted and non-grafted Ti6Al4V surfaces. Cultures were carried out in a complete (10% FBS) and in a non-complete medium (without FBS). Cell viability assay, cell attachment number and cell adhesion strength were followed up to 3days of culture. The presence of proteins enhanced cell growth and development whatever the surface and the presence of sulfonate groups enhanced the cell attachment even in the absence of proteins, which suggests and confirms that the sulfonate groups can modify the activity of cells such as the secretion of binding proteins. Statistical differences were found in the attachment strength tests on poly(NaSS) grafted and ungrafted surfaces and showed that the sulfonate groups play an important role in the cell resistance to shear stress. Copyright © 2014 Elsevier B.V. All rights reserved.

  18. Radiation protection and instrumentation

    Science.gov (United States)

    Bailey, J. V.

    1975-01-01

    Radiation was found not to be an operational problem during the Apollo program. Doses received by the crewmen of Apollo missions 7 through 17 were small because no major solar-particle events occurred during those missions. One small event was detected by a radiation sensor outside the Apollo 12 spacecraft, but no increase in radiation dose to the crewmen inside the spacecraft was detected. Radiation protection for the Apollo program was focused on both the peculiarities of the natural space radiation environment and the increased prevalence of manmade radiation sources on the ground and onboard the spacecraft. Radiation-exposure risks to crewmen were assessed and balanced against mission gain to determine mission constraints. Operational radiation evaluation required specially designed radiation detection systems onboard the spacecraft in addition to the use of satellite data, solar observatory support, and other liaison. Control and management of radioactive sources and radiation-generating equipment was important in minimizing radiation exposure of ground-support personnel, researchers, and the Apollo flight and backup crewmen.

  19. Modeling classical and quantum radiation from laser-plasma accelerators

    Directory of Open Access Journals (Sweden)

    M. Chen

    2013-03-01

    Full Text Available The development of models and the “Virtual Detector for Synchrotron Radiation” (vdsr code that accurately describe the production of synchrotron radiation are described. These models and code are valid in the classical and linear (single-scattering quantum regimes and are capable of describing radiation produced from laser-plasma accelerators (LPAs through a variety of mechanisms including betatron radiation, undulator radiation, and Thomson/Compton scattering. Previous models of classical synchrotron radiation, such as those typically used for undulator radiation, are inadequate in describing the radiation spectra from electrons undergoing small numbers of oscillations. This is due to an improper treatment of a mathematical evaluation at the end points of an integration that leads to an unphysical plateau in the radiation spectrum at high frequencies, the magnitude of which increases as the number of oscillation periods decreases. This is important for betatron radiation from LPAs, in which the betatron strength parameter is large but the number of betatron periods is small. The code vdsr allows the radiation to be calculated in this regime by full integration over each electron trajectory, including end-point effects, and this code is used to calculate betatron radiation for cases of experimental interest. Radiation from Thomson scattering and Compton scattering is also studied with vdsr. For Thomson scattering, radiation reaction is included by using the Sokolov method for the calculation of the electron dynamics. For Compton scattering, quantum recoil effects are considered in vdsr by using Monte Carlo methods. The quantum calculation has been benchmarked with the classical calculation in a classical regime.

  20. Thermal radiation heat transfer

    CERN Document Server

    Howell, John R; Mengüç, M Pinar

    2011-01-01

    Providing a comprehensive overview of the radiative behavior and properties of materials, the fifth edition of this classic textbook describes the physics of radiative heat transfer, development of relevant analysis methods, and associated mathematical and numerical techniques. Retaining the salient features and fundamental coverage that have made it popular, Thermal Radiation Heat Transfer, Fifth Edition has been carefully streamlined to omit superfluous material, yet enhanced to update information with extensive references. Includes four new chapters on Inverse Methods, Electromagnetic Theory, Scattering and Absorption by Particles, and Near-Field Radiative Transfer Keeping pace with significant developments, this book begins by addressing the radiative properties of blackbody and opaque materials, and how they are predicted using electromagnetic theory and obtained through measurements. It discusses radiative exchange in enclosures without any radiating medium between the surfaces-and where heat conduction...

  1. PPARγ inhibits inflammation and RANKL expression in epoxy resin-based sealer-induced osteoblast precursor cells E1 cells.

    Science.gov (United States)

    Kim, Tae-Gun; Lee, Young-Hee; Bhattari, Govinda; Lee, Nan-Hee; Lee, Kwang-Won; Yi, Ho-Keun; Yu, Mi-Kyung

    2013-01-01

    The AH26 of epoxy resin-based sealer is used widely owing to its excellent physical characteristics but it induces oxidative stress and cytotoxicity at the periapical tissues. AH26 exhibited cytotoxicity towards MC-3T3-E1 cells, which resulted in mitochondria-mediated apoptosis. Peroxisome proliferator-activated receptor (PPARγ) has an anti-inflammatory effect in several tissue and cells, but its action of AH26-related inflammation is not completely understood. The aim of this study is to investigate the anti-inflammatory and anti-osteoclastic mechanisms of PPARγ in AH26-induced MC-3T3 E1 cells. AH26 was prepared according to the manufacturer's instructions. The 1-day extraction sample, which was diluted by 30%, was tested in this experiment. Recombinant deficiency adenoviral PPARγ (Ad/PPARγ) was used to examine PPARγ over-expression in MC-3T3 E1 cells. AH26-induced reactive oxygen species (ROS) formation was analysed using 2',7'-dichlorodihydrofluorescein diacetate (DCFH-DA) with fluorescence-activated cell sorting (FACS), and the expression of receptor activator of nuclear factor-κB ligand (RANKL) and inflammatory molecules was determined by immunoblotting. The anti-inflammatory and anti-osteoclastic mechanisms of the PPARγ-involved signal pathway was examined by immunoblotting. The AH26 elutes induced inducible nitric oxide synthase (iNOS), cyclooxygenase-2 (COX-2), RANKL expression and ROS formation. In addition, the AH26 elutes suppressed the expression of PPARγ. However, the recovery of PPARγ expression with Ad/PPARγ resulted in the inhibition of iNOS, COX-2, RANKL and ROS formation despite the AH26 treatment in MC-3T3 E1 cells. The mechanism of PPARγ was confirmed by the blocking of nuclear factor kappa B (NF-κB) translocation to the nucleus after the suppression of ERK1/2, SAPK/JNK and AP-1 in AH26-induced MC-3T3 E1 cells. From this result, PPARγ acts to inhibit bone destruction in AH26-induced bone cells. Therefore, the anti-inflammatory and

  2. The utilize of gamma radiation on the examination of mechanical properties of polymeric materials

    Directory of Open Access Journals (Sweden)

    F. Greškovič

    2012-04-01

    Full Text Available The article deals about the application area of radiation crosslinking of plastics, which follows after the injection moulding. The main objective of the presented article is the research of influence irradiation dosage on mechanical properties of materials: PP filled by 15 % of mineral filler – talc. Mechanical properties - tensile strength and impact strength by Charpy were examined in dependence on absorbed dose of the gamma rays on various conditions and were compared with non-irradiated samples. Radiation processing involves mainly the use of either electron beams from electron accelerators or gamma radiation from Cobalt-60 sources.

  3. Radiation shield for operator under radiation circumference

    Energy Technology Data Exchange (ETDEWEB)

    Nemezawa, Isao; Kimura, Tadahiro [Hitachi Ltd., Tokyo (Japan); Omori, Tetsu; Mizuochi, Akira

    1997-11-18

    A radiation shield for an upper half of a man`s body comprises a synthetic resin clothing, a rubber plate or a composite member of them formed into a bag. The bag is formed three dimensionally in the form of an open in front vest. A radiation shielding bag for the lower half of a man`s body is formed into three dimensionally in the form of open in front half trousers. A water injection port for injecting water as shielding liquid and a gas exhaust port are formed to each of the bags. Upon operation under radiation circumstance, the water injection ports and the gas exhaustion ports are opened, and shielding liquid is injected from the water injection ports to the bag so that the shielding liquid shields radiation rays. After closing the water injection ports and the gas exhaustion ports, an operator wears and buttons up the radiation shield of the upper half and the lower half to protect radiation exposure from the front, back and the side of a man. (I.N.)

  4. Experimental and simulated strength of spot welds

    DEFF Research Database (Denmark)

    Nielsen, Chris Valentin; Bennedbæk, Rune A.K.; Larsen, Morten B.

    2014-01-01

    Weld strength testing of single spots in DP600 steel is presented for the three typical testing procedures, i.e. tensile-shear, cross-tension and peel testing. Spot welds are performed at two sets of welding parameters and strength testing under these conditions is presented by load......-elongation curves revealing the maximum load and the elongation at break. Welding and strength testing is simulated by SORPAS® 3D, which allows the two processes to be prepared in a combined simulation, such that the simulated welding properties are naturally applied to the simulation of strength testing. Besides...... the size and shape of the weld nugget, these properties include the new strength of the material in the weld and the heat affected zone based on the predicted hardness resulting from microstructural phase changes simulated during cooling of the weld before strength testing. Comparisons between overall...

  5. Experimental knee pain reduces muscle strength

    DEFF Research Database (Denmark)

    Henriksen, Marius; Mortensen, Sara Rosager; Aaboe, Jens

    2011-01-01

    Pain is the principal symptom in knee pathologies and reduced muscle strength is a common observation among knee patients. However, the relationship between knee joint pain and muscle strength remains to be clarified. This study aimed at investigating the changes in knee muscle strength following...... experimental knee pain in healthy volunteers, and if these changes were associated with the pain intensities. In a crossover study, 18 healthy subjects were tested on 2 different days. Using an isokinetic dynamometer, maximal muscle strength in knee extension and flexion was measured at angular velocities 0....... Knee pain reduced the muscle strength by 5 to 15% compared to the control conditions (P knee extension and flexion at all angular velocities. The reduction in muscle strength was positively correlated to the pain intensity. Experimental knee pain significantly reduced knee extension...

  6. Testing thin film adhesion strength acoustically

    Science.gov (United States)

    Madanshetty, Sameer I.; Wanklyn, Kevin M.; Ji, Hang

    2004-05-01

    A new method of measuring the adhesion strength of thin films to their substrates is reported. The method is based on an analogy with the common tensile test of materials. This is an acoustic method that uses acoustic microcavitation to bring about controlled erosion of the thin film. Based on the insonification pressure and the time to complete erosion, the adhesion strength is assessed. The measurements correctly rank order a set of thin film samples of known adhesion strengths.

  7. Pitch strength of normal and dysphonic voices

    OpenAIRE

    Shrivastav, Rahul; Eddins, David A.; Anand, Supraja

    2012-01-01

    Two sounds with the same pitch may vary from each other based on saliency of their pitch sensation. This perceptual attribute is called “pitch strength.” The study of voice pitch strength may be important in quantifying of normal and pathological qualities. The present study investigated how pitch strength varies across normal and dysphonic voices. A set of voices (vowel /a/) selected from the Kay Elemetrics Disordered Voice Database served as the stimuli. These stimuli demonstrated a wide ra...

  8. Strength and failure modes of ceramic multilayers

    DEFF Research Database (Denmark)

    Sørensen, Bent F.; Toftegaard, Helmuth Langmaack; Linderoth, Søren

    2012-01-01

    A model was developed for the prediction of the tensile strength of thin, symmetric 3-layer sandwich specimens. The model predictions rationalize the effect of heat-treatment temperature on the strength of sandwich specimens consisting of an YSZ (Yttria-Stabilized Zirconia) substrate coated...... and propagating into the substrate. These predictions are consistent with microstructural observations of the fracture surfaces. A good agreement was found between the measured strength values and model predictions. © 2012 Elsevier Ltd. All rights reserved....

  9. Correlated Strength in the Nuclear Spectral Function

    Energy Technology Data Exchange (ETDEWEB)

    D. Rohe; C. S. Armstrong; R. Asaturyan; O. K. Baker; S. Bueltmann; C. Carasco; D. Day; R. Ent; H. C. Fenker; K. Garrow; A. Gasparian; P. Gueye; M. Hauger; A. Honegger; J. Jourdan; C. E. Keppel; G. Kubon; R. Lindgren; A. Lung; D. J. Mack; J. H. Mitchell; H. Mkrtchyan; D. Mocelj; K. Normand; T. Petitjean; O. Rondon; E. Segbefia; I. Sick; S. Stepanyan; L. Tang; F. Tiefenbacher; W. F. Vulcan; G. Warren; S. A. Wood; L. Yuan; M. Zeier; H. Zhu; B. Zihlmann

    2004-10-01

    We have carried out an (e,ep) experiment at high momentum transfer and in parallel kinematics to measure the strength of the nuclear spectral function S(k,E) at high nucleon momenta k and large removal energies E. This strength is related to the presence of short-range and tensor correlations, and was known hitherto only indirectly and with considerable uncertainty from the lack of strength in the independent-particle region. This experiment locates by direct measurement the correlated strength predicted by theory.

  10. Strength of Ship Plates under Combined Loading

    DEFF Research Database (Denmark)

    Cui, W.; Wang, Y.; Pedersen, Preben Terndrup

    2002-01-01

    Strength of ship plates plays a significant role in the ultimate strength analysis of ship structures. In recent years several authors have proposed simplified analytical methods to calculate the ultimate strength of unstiffened plates. The majority of these investigations deal with plates....... The obtained results indicate that the simplified analytical method is able to determine the ultimate strength of unstiffened plates with imperfections in the form of welding-induced residual stresses and geometric deflections subjected to combined loads. Comparisons with experimental results show...

  11. Strength of ship plates under combined loading

    DEFF Research Database (Denmark)

    Cui, Weiching; Wang, Yongjun; Pedersen, Preben Terndrup

    2000-01-01

    Strength of ship plates plays a significant role for the ultimate strength analysis of ship structures. In recent years several authors have proposed simplified methods to calculate the ultimate strength of unstiffened plates. The majority of these investigations deal with plates subjected...... that the simplified method is able to determine the ultimate strength of unstiffened plates with imperfections in the form of welding induced residual stresses and geometric deflections subjected to combined loads. Comparisons with experimental results show that the procedure has sufficient accuracy for practical...

  12. Strength properties of separators in alkaline solutions

    Energy Technology Data Exchange (ETDEWEB)

    Danko, T. [Viskase Corp., Chicago, IL (United States)

    1996-11-01

    Battery separator non-wovens that were coated with regenerated cellulose via the viscose process were subjected to storage in 40% potassium hydroxide (KOH) over a two month period. Samples were periodically checked for wet MD tensile strength. The test showed that among the non-wovens, the polyamide retained about 93% of its initial tensile strength whereas polyvinyl alcohol and cellulosic non-wovens retained only 55% and 35%, respectively. Adding a viscose coating to the non-wovens improved tensile strength retention by 20--25% for the polyvinyl alcohol and cellulosic materials. The viscose-coated polyamide retained more than 98% of its initial tensile strength.

  13. Hydrogen Assisted Cracking of High Strength Alloys

    National Research Council Canada - National Science Library

    Gangloff, Richard P

    2003-01-01

    ... (Irwin and Wells, 1997; Paris, 1998). Second, materials scientists developed metals with outstanding balances of high tensile strength and high fracture toughness (Garrison, 1990; Wells, 1993; Boyer, 1993...

  14. Estimation of radiation hardening in ferritic steels using the cluster dynamics models

    Energy Technology Data Exchange (ETDEWEB)

    Kwon, Jun Hyun; Kim, Whung Whoe; Hong, Jun Hwa [Korea Atomic Energy Research Institute, Taejon (Korea, Republic of)

    2005-07-01

    Evolution of microstructure under irradiation brings about the mechanical property changes of materials, of which the major concern is radiation hardening in this work. Radiation hardening is generally expressed in terms of an increase in yield strength as a function of radiation dose and temperature. Cluster dynamics model for radiation hardening has been developed to describe the evolution of point defects clusters (PDCs) and copperrich precipitates (CRPs). While the mathematical models developed by Stoller focus on the evolution of PDCs in ferritic steels under neutron irradiation, we slightly modify the model by including the CRP growth and estimate the magnitude of hardening induced by PDC and CRP. The model is then used to calculate the changes in yield strength of RPV steels. The calculation results are compared to measured yield strength values, obtained from surveillance testing of PWR vessel steels in France.

  15. Establishing a link to given radiated emission limits during extending the frequency range above 1 GHz

    Directory of Open Access Journals (Sweden)

    H. Garbe

    2008-05-01

    Full Text Available Up to now most limits for radiated emission are given as values for the electrical field strength. Battermann, 2007 has shown that the frequency range extension for radiated emission measurements above 1 GHz generates a lot of problems while performing the test on a classical test site as depicted in Fig. 1. This paper will give a motivation to use an other measurand namely the total-radiated-power than electrical field strength by using alternative test sites like reverberation chambers, TEM-waveguides, Fully Anechoic Rooms (FAR etc. Nevertheless most of the existing standards still specify electrical field strength limits. This paper will show how to set the parameters in the given algorithm to establish a link between measured total radiated power and equivalent electrical field values.

  16. Experimental knee joint pain during strength training and muscle strength gain in healthy subjects

    DEFF Research Database (Denmark)

    Sørensen, T J; Langberg, Henning; Hodges, P W

    2012-01-01

    Knee joint pain and reduced quadriceps strength are cardinal symptoms in many knee pathologies. In people with painful knee pathologies, quadriceps exercise reduces pain, improves physical function, and increases muscle strength. A general assumption is that pain compromises muscle function and t...... and thus may prevent effective rehabilitation. This study evaluated the effects of experimental knee joint pain during quadriceps strength training on muscle strength gain in healthy individuals.......Knee joint pain and reduced quadriceps strength are cardinal symptoms in many knee pathologies. In people with painful knee pathologies, quadriceps exercise reduces pain, improves physical function, and increases muscle strength. A general assumption is that pain compromises muscle function...

  17. Oscillator Strength and Absorption Cross-section of Core-Shell Triangular Quantum Wire for Intersubband Transition

    Science.gov (United States)

    Deyasi, Arpan; Das, N. R.

    Oscillator strength and absorption cross-section of core-shell triangular quantum wire is computed for intersubband optical transition between ground state and first excited state. Kane type band nonparabolicity of first order is considered to study the shift of cross-section peak with incident radiation, and also of the oscillator strength with structural parameters. Results are compared with that obtained from parabolic overestimation. Results show that both oscillator strength and peak magnitude of absorption cross-section decreases with increasing dimension, and the rate is significant when nonparabolic dispersion relation is taken into account. Findings are important for designing optical emitter/detector using core-shell triangular quantum wire.

  18. Annealing mechanisms of self-interstitial related defect E1=E{sub c}-0.39 eV in irradiated silicon

    Energy Technology Data Exchange (ETDEWEB)

    Abdullin, Kh.A., E-mail: kh.a.abdullin@mail.ru [National Nanotechnology Open Laboratory, al-Farabi Kazakh National University, 71 al-Farabi Str., 050060 Almaty (Kazakhstan); Mukashev, B.N. [National Nanotechnology Open Laboratory, al-Farabi Kazakh National University, 71 al-Farabi Str., 050060 Almaty (Kazakhstan)

    2012-07-01

    DLTS and thermally stimulated capacitance (TSCap) studies of {alpha}-particle irradiated p-Si were undertaken to obtain additional information about the self-interstitial related defect E1=E{sub c}-0.39 eV. The E1 defect can be retained frozen up to room temperature without any minority carrier injection, but under injection conditions at 77-300 K the E1 becomes mobile. As a result of annealing of the E1 defect, the carbon interstitial concentration grows. The E1 defect production rate under reverse bias as well as thermal annealing behavior depends strongly on the temperature and impurity concentration. Numerical estimates of the E1 migration via a Bourgoin-Corbett mechanism are in good agreement with the experimental data obtained.

  19. Radiation physics, biophysics, and radiation biology

    Energy Technology Data Exchange (ETDEWEB)

    Hall, E.J.; Zaider, M.

    1993-05-01

    Research at the Center for Radiological Research is a multidisciplenary blend of physics, chemistry and biology aimed at understanding the mechanisms involved in the health problems resulting from human exposure to ionizing radiations. The focus is increased on biochemistry and the application of the techniques of molecular biology to the problems of radiation biology. Research highlights of the program from the past year are described. A mathematical model describing the production of single-strand and double-strand breaks in DNA as a function radiation quality has been completed. For the first time Monte Carlo techniques have been used to obtain directly the spatial distribution of DNA moieties altered by radiation. This information was obtained by including the transport codes a realistic description of the electronic structure of DNA. We have investigated structure activity relationships for the potential oncogenicity of a new generation of bioreductive drugs that function as hypoxic cytotoxins. Experimental and theoretical investigation of the inverse dose rate effect, whereby medium LET radiations actually produce an c effect when the dose is protracted, is now at a point where the basic mechanisms are reasonably understood and the complex interplay between dose, dose rate and radiation quality which is necessary for the effect to be present can now be predicted at least in vitro. In terms of early radiobiological damage, a quantitative link has been established between basic energy deposition and locally multiply damaged sites, the radiochemical precursor of DNA double strand breaks; specifically, the spatial and energy deposition requirements necessary to form LMDs have been evaluated. For the first time, a mechanically understood biological fingerprint'' of high-LET radiation has been established. Specifically measurement of the ratio of inter-to intra-chromosomal aberrations produces a unique signature from alpha-particles or neutrons.

  20. The acute effects intensity and volume of strength training on running performance.

    Science.gov (United States)

    Doma, Kenji; Deakin, Glen Bede

    2014-01-01

    Strength training has been shown to cause acute detrimental effects on running performance. However, there is limited investigation on the effect of various strength training variables, whilst controlling eccentric contraction velocity, on running performance. The present study examined the effects of intensity and volume (i.e. whole body vs. lower body only) of strength training with slow eccentric contractions on running economy (RE) [i.e. below anaerobic threshold (AT)] and time-to-exhaustion (TTE) (i.e. above AT) 6 hours post. Fifteen trained and moderately endurance trained male runners undertook high-intensity whole body (HW), high-intensity lower body only (HL) and low-intensity whole body (LW) strength training sessions with slow eccentric contractions (i.e. 1:4 second concentric-to-eccentric contraction) in random order. Six hours following each strength training session, a RE test with TTE was conducted. The results showed that HW, HL and LW sessions had no effect on RE and that LW session had no effect on TTE (P ≥ 0.05). However, HW and HL sessions significantly reduced TTE (P training performance below AT, although caution should be taken for endurance training sessions above AT amongst trained and moderately endurance trained runners.

  1. (E-1-Phenylethanone semicarbazone

    Directory of Open Access Journals (Sweden)

    Hoong-Kun Fun

    2009-08-01

    Full Text Available In the title compound, C9H11N3O, the benzene ring is disordered over two positions with refined occupancies of 0.922 (5 and 0.078 (5. The program PLATON [Spek (2009. Acta Cryst. D65, 148–155] recommends the solution in the space group C2/m with a = 7.3050 (3, b = 6.6745 (2, c = 18.3853 (6 Å and β = 96.986 (2°. However, the large number of non-extinct reflections needed to be ignored if C2/m is chosen suggested that the space group is incorrect, even though the R values are lower than that for P21/c. The semicarbazone group is essentially planar, with a maximum deviation of 0.046 (1 Å for one of the N atoms. The mean plane of the semicarbazone group forms dihedral angles of 33.61 (8 and 39.1 (9° with the benzene ring of the major and minor components, respectively. In the crystal structure, molecules are linked by intermolecular N—H...O hydrogen bonds into extended chains along the c axis. The crystal structure is further stabilized by weak intermolucular C—H...π interactions.

  2. High glucose impaired estrogen receptor alpha signaling via β-catenin in osteoblastic MC3T3-E1.

    Science.gov (United States)

    Wang, Rui; Gao, Dong; Zhou, Yin; Chen, Lu; Luo, Bin; Yu, Yanrong; Li, Hao; Hu, Jiawei; Huang, Qiren; He, Ming; Peng, Weijie; Luo, Dan

    2017-11-01

    Diabetic Mellitus is a risk factor for osteoporosis. It has been suggested that altered estrogen or estrogen receptor α/β (ERα/β) signaling may be involved in diabetic osteoporosis. The present study is to investigate the effects of high glucose on ERα/β signaling in osteoblastic MC3T3-E1 and how the altered signaling of ERα/β affect osteoblastic bone formation. ERα/β signaling was demonstrated as ERα/β protein expression (Western Blotting) and ER transcription activity (Luciferase Reporter assays). Proliferation (WSK-1 assaying), differentiation (ALP staining) and mineralization (Alizalard Red staining) of MC3T3-E1 were examined to evaluate bone formation function. It has been found that high glucose increased ERα/β expression dose-dependently and time-dependently, but high glucose (33mM) decreased ERα transcription activity. 17β-estradiol increased the ERα/β expression dose-dependently in normal medium, but decreased the ERα/β expression dose-dependently in medium with high glucose (33mM). High glucose decreased bone formation and also decreased the osteogenic effects of 17β-estradiol (10 -8 M). High glucose decreased β-catenin expression dose-dependently and time-dependently. LiCl, an inhibitor of β-catenin degradation, decreased ERα expression but increased ERα transcription activity. When compared with high glucose treatment, LiCl (5mM) increased ALP activity and calcified nodes. Besides, high glucose also decreased the protein expression PI-3K, pAKT/AKT, GSK-3β. In conclusion, the present study suggested that high glucose may impair ERα transcription activity by inhibiting β-catenin signaling in osteoblastic MC3T3-E1, leading decreased bone formation ligand-dependently or ligand-independently. Copyright © 2017 Elsevier Ltd. All rights reserved.

  3. The simulation of lunar gravity field recovery from D-VLBI of Chang’E-1 and SELENE lunar orbiters

    Science.gov (United States)

    Yan, Jianguo; Ping, Jingsong; Matsumoto, K.; Li, Fei

    2008-07-01

    The lunar gravity field is a foundation to study the lunar interior structure, and to recover the evolution history of the Moon. It is still an open and key topic for lunar science. For above mentioned reasons, it becomes one of the important scientific objectives of recent lunar missions, such as KAGUYA (SELENE) the Japanese lunar mission and Chang’E-1, the Chinese lunar mission. The Chang’E-1 and the SELENE were successfully launched in 2007. It is estimated that these two missions can fly around the Moon longer than 6 months simultaneously. In these two missions, the Chinese new VLBI (Very Long Baseline Interferometry) network will be applied for precise orbit determination (POD) by using a differential VLBI (D-VLBI) method during the mission period. The same-beam D-VLBI technique will contribute to recover the lunar gravity field together with other conventional observables, i.e. R&RR (Range and Range Rate) and multi-way Doppler. Taking VLBI tracking conditions into consideration and using the GEODYNII/SOVLE software of GSFC/NASA/USA [Rowlands, D.D., Marshall, J.A., Mccarthy, J., et al. GEODYN II System Description, vols. 1 5. Contractor Report, Hughes STX Corp. Greenbelt, MD, 1997; Ullman, R.E. SOLVE program: mathematical formulation and guide to user input, Hughes/STX Contractor Report, Contract NAS5-31760. NASA Goddard Space Flight Center, Greenbelt, Maryland, 1994], we simulated the lunar gravity field recovering ability with and without D-VLBI between the Chang’E-1 and SELENE main satellite. The cases of overlapped flying and tracking period of 30 days, 60 days and 90 days have been analyzed, respectively. The results show that D-VLBI tracking between two lunar satellites can improve the gravity field recovery remarkably. The results and methods introduced in this paper will benefit the actual missions.

  4. Attenuation of microRNA-16 derepresses the cyclins D1, D2 and E1 to provoke cardiomyocyte hypertrophy

    Science.gov (United States)

    Huang, Shuai; Zou, Xiao; Zhu, Jie-Ning; Fu, Yong-Heng; Lin, Qiu-Xiong; Liang, Ye-You; Deng, Chun-Yu; Kuang, Su-Juan; Zhang, Meng-Zhen; Liao, Yu-Lin; Zheng, Xi-Long; Yu, Xi-Yong; Shan, Zhi-Xin

    2015-01-01

    Cyclins/retinoblastoma protein (pRb) pathway participates in cardiomyocyte hypertrophy. MicroRNAs (miRNAs), the endogenous small non-coding RNAs, were recognized to play significant roles in cardiac hypertrophy. But, it remains unknown whether cyclin/Rb pathway is modulated by miRNAs during cardiac hypertrophy. This study investigates the potential role of microRNA-16 (miR-16) in modulating cyclin/Rb pathway during cardiomyocyte hypertrophy. An animal model of hypertrophy was established in a rat with abdominal aortic constriction (AAC), and in a mouse with transverse aortic constriction (TAC) and in a mouse with subcutaneous injection of phenylephrine (PE) respectively. In addition, a cell model of hypertrophy was also achieved based on PE-promoted neonatal rat ventricular cardiomyocyte and based on Ang-II-induced neonatal mouse ventricular cardiomyocyte respectively. We demonstrated that miR-16 expression was markedly decreased in hypertrophic myocardium and hypertrophic cardiomyocytes in rats and mice. Overexpression of miR-16 suppressed rat cardiac hypertrophy and hypertrophic phenotype of cultured cardiomyocytes, and inhibition of miR-16 induced a hypertrophic phenotype in cardiomyocytes. Expressions of cyclins D1, D2 and E1, and the phosphorylated pRb were increased in hypertrophic myocardium and hypertrophic cardiomyocytes, but could be reversed by enforced expression of miR-16. Cyclins D1, D2 and E1, not pRb, were further validated to be modulated post-transcriptionally by miR-16. In addition, the signal transducer and activator of transcription-3 and c-Myc were activated during myocardial hypertrophy, and inhibitions of them prevented miR-16 attenuation. Therefore, attenuation of miR-16 provoke cardiomyocyte hypertrophy via derepressing the cyclins D1, D2 and E1, and activating cyclin/Rb pathway, revealing that miR-16 might be a target to manage cardiac hypertrophy. PMID:25583328

  5. Sulfation of fulvestrant by human liver cytosols and recombinant SULT1A1 and SULT1E1

    Directory of Open Access Journals (Sweden)

    Edavana VK

    2011-11-01

    Full Text Available Vineetha Koroth Edavana1, Xinfeng Yu1, Ishwori B Dhakal1, Suzanne Williams1, Baitang Ning2, Ian T Cook3, David Caldwell1, Charles N Falany3, Susan Kadlubar11Division of Medical Genetics, College of Medicine, University of Arkansas for Medical Sciences, Little Rock, AR, USA; 2Division of Personalized Nutrition and Medicine, National Center for Toxicological Research, Food and Drug Administration, Jefferson, AR, USA; 3Department of Pharmacology, University of Alabama, Birmingham, AL, USAAbstract: Fulvestrant (Faslodex™ is a pure antiestrogen that is approved to treat hormone receptor-positive metastatic breast cancer in postmenopausal women. Previous studies have demonstrated that fulvestrant metabolism in humans involves cytochromes P450 and UDP-glucuronosyltransferases (UGTs. To date, fulvestrant sulfation has not been characterized. This study examined fulvestrant sulfation with nine recombinant sulfotransferases and found that only SULT1A1 and SULT1E1 displayed catalytic activity toward this substrate, with Km of 4.2 ± 0.99 and 0.2 ± 0.16 µM, respectively. In vitro assays of 104 human liver cytosols revealed marked individual variability that was highly correlated with β-naphthol sulfation (SULT1A1 diagnostic substrate; r = 0.98, P < 0.0001, but not with 17ß-estradiol sulfation (SULT1E1 diagnostic substrate; r = 0.16, P = 0.10. Fulvestrant sulfation was correlated with both SULT1A1*1/2 genotype (P value = 0.023 and copy number (P < 0.0001. These studies suggest that factors influencing SULT1A1/1E1 tissue expression and/or enzymatic activity could influence the efficacy of fulvestrant therapy.Keywords: fulvestrant, sulfotransferase, genotype, copy number

  6. Role of cleavage at the core-E1 junction of hepatitis C virus polyprotein in viral morphogenesis

    Science.gov (United States)

    Pène, Véronique; Lemasson, Matthieu; Harper, Francis; Pierron, Gérard; Rosenberg, Arielle R.

    2017-01-01

    In hepatitis C virus (HCV) polyprotein sequence, core protein terminates with E1 envelope signal peptide. Cleavage by signal peptidase (SP) separates E1 from the complete form of core protein, anchored in the endoplasmic reticulum (ER) membrane by the signal peptide. Subsequent cleavage of the signal peptide by signal-peptide peptidase (SPP) releases the mature form of core protein, which preferentially relocates to lipid droplets. Both of these cleavages are required for the HCV infectious cycle, supporting the idea that HCV assembly begins at the surface of lipid droplets, yet SPP-catalyzed cleavage is dispensable for initiation of budding in the ER. Here we have addressed at what step(s) of the HCV infectious cycle SP-catalyzed cleavage at the core-E1 junction is required. Taking advantage of the sole system that has allowed visualization of HCV budding events in the ER lumen of mammalian cells, we showed that, unexpectedly, mutations abolishing this cleavage did not prevent but instead tended to promote the initiation of viral budding. Moreover, even though no viral particles were released from Huh-7 cells transfected with a full-length HCV genome bearing these mutations, intracellular viral particles containing core protein protected by a membrane envelope were formed. These were visualized by electron microscopy as capsid-containing particles with a diameter of about 70 nm and 40 nm before and after delipidation, respectively, comparable to intracellular wild-type particle precursors except that they were non-infectious. Thus, our results show that SP-catalyzed cleavage is dispensable for HCV budding per se, but is required for the viral particles to acquire their infectivity and secretion. These data support the idea that HCV assembly occurs in concert with budding at the ER membrane. Furthermore, capsid-containing particles did not accumulate in the absence of SP-catalyzed cleavage, suggesting the quality of newly formed viral particles is controlled before

  7. GSTT1 and CYP2E1 polymorphisms and trihalomethanes in drinking water: effect on childhood leukemia.

    Science.gov (United States)

    Infante-Rivard, Claire; Amre, Devendra; Sinnett, Daniel

    2002-01-01

    The purpose of the study was to determine whether the risk of childhood acute lymphoblastic leukemia (ALL) associated with drinking water disinfection by-products was modified in the presence of variants in genes involved in the metabolism of trihalomethanes (THMs). We included a subset of cases from a population-based case-control study in a case-only study to estimate the interaction odds ratios (IORs) between prenatal and postnatal exposure to THMs and polymorphisms in the GSTT1 and CYP2E1 genes. We compared cases with and without a given variant regarding their exposure to THMs using unconditional logistic regression. The IOR for a postnatal average of total THM above the 95th percentile with GSTT1 null genotype was 9.1 [95% confidence interval (95% CI), 1.4-57.8]. With CYP2E1 (variant G-1259C, known as the allele CYP2E1*5), the effect of exposure during pregnancy for an average exposure to total THM at or above the 75th percentile was 9.7 (95% CI, 1.1-86.0). These results contrast strongly with those from our case-control analysis, in which we considered the exposure to THMs only in relation with ALL, and observed no increase in risk or very moderate ones. The present preliminary study shows suggestive but imprecise results. We found no similar results in the literature, underscoring the need for other studies as well as the potential usefulness of combining exposure and relevant genetic information in such studies. PMID:12055050

  8. 26 CFR 54.4980E-1 - Requirement of return and time for filing of the excise tax under section 4980E.

    Science.gov (United States)

    2010-04-01

    ... 26 Internal Revenue 17 2010-04-01 2010-04-01 false Requirement of return and time for filing of the excise tax under section 4980E. 54.4980E-1 Section 54.4980E-1 Internal Revenue INTERNAL REVENUE SERVICE, DEPARTMENT OF THE TREASURY (CONTINUED) MISCELLANEOUS EXCISE TAXES (CONTINUED) PENSION EXCISE TAXES § 54.4980E-1 Requirement of return and time...

  9. 26 CFR 1.404(e)-1A - Contributions on behalf of a self-employed individual to or under a qualified pension, annuity...

    Science.gov (United States)

    2010-04-01

    ... individual to or under a qualified pension, annuity, or profit-sharing plan. 1.404(e)-1A Section 1.404(e)-1A...) INCOME TAXES Pension, Profit-Sharing, Stock Bonus Plans, Etc. § 1.404(e)-1A Contributions on behalf of a self-employed individual to or under a qualified pension, annuity, or profit-sharing plan. (a) In...

  10. Radiation processes in astrophysics

    CERN Document Server

    Tucker, Wallace H

    1975-01-01

    The purpose of this book is twofold: to provide a brief, simple introduction to the theory of radiation and its application in astrophysics and to serve as a reference manual for researchers. The first part of the book consists of a discussion of the basic formulas and concepts that underlie the classical and quantum descriptions of radiation processes. The rest of the book is concerned with applications. The spirit of the discussion is to present simple derivations that will provide some insight into the basic physics involved and then to state the exact results in a form useful for applications. The reader is referred to the original literature and to reviews for rigorous derivations.The wide range of topics covered is illustrated by the following table of contents: Basic Formulas for Classical Radiation Processes; Basic Formulas for Quantum Radiation Processes; Cyclotron and Synchrotron Radiation; Electron Scattering; Bremsstrahlung and Collision Losses; Radiative Recombination; The Photoelectric Effect; a...

  11. Radiation and Thyroid Cancer

    Science.gov (United States)

    Albi, Elisabetta; Cataldi, Samuela; Lazzarini, Andrea; Codini, Michela; Beccari, Tommaso; Ambesi-Impiombato, Francesco Saverio; Curcio, Francesco

    2017-01-01

    Radiation-induced damage is a complex network of interlinked signaling pathways, which may result in apoptosis, cell cycle arrest, DNA repair, and cancer. The development of thyroid cancer in response to radiation, from nuclear catastrophes to chemotherapy, has long been an object of study. A basic overview of the ionizing and non-ionizing radiation effects of the sensitivity of the thyroid gland on radiation and cancer development has been provided. In this review, we focus our attention on experiments in cell cultures exposed to ionizing radiation, ultraviolet light, and proton beams. Studies on the involvement of specific genes, proteins, and lipids are also reported. This review also describes how lipids are regulated in response to the radiation-induced damage and how they are involved in thyroid cancer etiology, invasion, and migration and how they can be used as both diagnostic markers and drug targets. PMID:28445397

  12. Foundations of radiation hydrodynamics

    Science.gov (United States)

    Mihalas, D.; Mihalas, B. W.

    This book is the result of an attempt, over the past few years, to gather the basic tools required to do research on radiating flows in astrophysics. The microphysics of gases is discussed, taking into account the equation of state of a perfect gas, the first and second law of thermodynamics, the thermal properties of a perfect gas, the distribution function and Boltzmann's equation, the collision integral, the Maxwellian velocity distribution, Boltzmann's H-theorem, the time of relaxation, and aspects of classical statistical mechanics. Other subjects explored are related to the dynamics of ideal fluids, the dynamics of viscous and heat-conducting fluids, relativistic fluid flow, waves, shocks, winds, radiation and radiative transfer, the equations of radiation hydrodynamics, and radiating flows. Attention is given to small-amplitude disturbances, nonlinear flows, the interaction of radiation and matter, the solution of the transfer equation, acoustic waves, acoustic-gravity waves, basic concepts of special relativity, and equations of motion and energy.

  13. Radiation exposure and pregnancy.

    Science.gov (United States)

    Labant, Amy; Silva, Christina

    2014-01-01

    Radiological exposure from nuclear power reactor accidents, transportation of nuclear waste accidents, industrial accidents, or terrorist activity may be a remote possibility, but it could happen. Nurses must be prepared to evaluate and treat pregnant women and infants who have been exposed to radiation, and to have an understanding of the health consequences of a nuclear or radiological incident. Pregnant women and infants are a special group of patients who need consideration when exposed to radiation. Initial care requires thorough assessment and decisions regarding immediate care needs. Ongoing care is based on type and extent of radiation exposure. With accurate, comprehensive information and education, nurses will be better prepared to help mitigate the effects of radiation exposure to pregnant women and infants following a radiological incident. Information about radiation, health effects of prenatal radiation exposure, assessment, patient care, and treatment of pregnant women and infants are presented.

  14. Efficient synthesis of novel azo compounds based on pyrimido[4,5-e][1,3,4]thiadiazine

    Directory of Open Access Journals (Sweden)

    Mohsen Nikpour

    2012-12-01

    Full Text Available Some new 5-bromo-2,4-dichloro-6-alkylpyrimidines were prepared by sequential treatment of 6-alkyl-pyrimidin-2,4(1H,3H-diones with bromine and phosphoryl chloride. Condensation of the dithizone with 5-bromo-2,4-dichloro-6-alkylpyrimidines in alkaline acetonitrile achieved 5-alkyl-7-chloro-3-phenylazo-1-phenyl-1H-pyrimido[4,5-e][1,3,4] thiadiazines. 7-chlorine atom of these compounds was replaced by secondary amines in boiling ethanol to afford their 7-amino derivatives. DOI: http://dx.doi.org/10.4314/bcse.v26i1.12

  15. High-yield production of a chimeric glycoprotein based on permuted E1 and E2 HCV envelope ectodomains

    OpenAIRE

    Tello, Daniel; Rodríguez-Rodríguez, Mar; Yélamos, Belén; Gómez-Gutiérrez, Julián; Peterson, Darrell L.; Gavilanes, Francisco

    2015-01-01

    In this report it is described for the first time the expression and purification of large quantities of a oluble and correctly folded chimeric recombinant protein, E2661E1340, containing the permuted Hepatitis C virus (HCV) glycoprotein ectodomains E1 (amino acids 192-340) and E2 (amino acids 384-661). Using the baculovirus/insect cell expression system, 8mg of secreted protein were purified from 1L of culture media, a yield 4 times higher than the described for its counterpart E1341E2661. T...

  16. Hepatotoxicity and P-4502E1-dependent metabolic oxidation of N,N-dimethylformamide in rats and mice.

    Science.gov (United States)

    Chieli, E; Saviozzi, M; Menicagli, S; Branca, T; Gervasi, P G

    1995-01-01

    A comparative biochemical and histological study on the hepatotoxicity of a single dose of N,N-dimethylformamide (DMF) and N-methylformamide (NMF) in control and acetone-treated SD male rats and CD-1 male mice was performed. In control and acetone-pretreated rats, neither DMF nor NMF caused hepatic damage or elevation of plasma transaminases. In contrast, in acetonized but not in control mice, DMF administration yielded some evidence of liver necrosis and elevation of ALAT (alanine-amino transferase) activity. After a DMF dose of 1000 mg/kg, ALAT activity was found 1215 +/- 832 mU/ml and 47 +/- 18 mU/ml in acetonized and control mice, respectively. NMF treatment was hepatotoxic in control mice and lethal in acetonized mice. In control mice, an NMF dose of 600 mg/kg increased ALAT activity from a basal value of 35 +/- 5 to 2210 +/- 1898 mU/ml. When the oxidative metabolism of DMF was investigated, microsomes from both rats and mice preinduced by acetone increased the demethylation rate of DMF 7 to 10-fold compared to that (about 0.25 nmol/min per mg protein) of the corresponding control microsomes. The enzymatic affinities for DMF oxidation, however, were different: in mice the Km (0.05 mM) was one order of magnitude lower than that (0.56 mM) found in rats. The experiments performed with purified rat and mouse P-450 2E1 in a reconstituted system confirmed that the P-450 2E1 isoforms are very active catalysts towards DMF oxidation (the turnover was about 10 nmol/min per nmol P-450 for both enzymes) but with a strikingly different affinity. Whereas the Km for mouse P-450 2E1 was 0.08 +/- 0.03 mM, that for rat P-450 2E1 was 1.1 +/- 0.2 mM.(ABSTRACT TRUNCATED AT 250 WORDS)

  17. Intra-arterial infusion of prostaglandin E1 in normal subjects and patients with peripheral arterial disease

    DEFF Research Database (Denmark)

    Nielsen, P E; Nielsen, S L; Holstein, P

    1976-01-01

    Acute vasodilatation was produced by infusion of prostaglandin E1 (PGE1) in the femoral artery in 6 patients with occlusive arterial disease of the legs and in 3 normal subjects. The effect on blood flow and on blood pressure was measured at different segments of the leg with the strain gauge...... technique, isotope clearance technique, and photoelectric technique. Skin temperature was measured at different levels by using thermocouples. The blood pressure on the legs decreased at all segments during vasodilatation as well in patients as in controls. The blood flow increased in all segments in normal...

  18. Dosimetry for radiation processing

    DEFF Research Database (Denmark)

    Miller, Arne

    1986-01-01

    During the past few years significant advances have taken place in the different areas of dosimetry for radiation processing, mainly stimulated by the increased interest in radiation for food preservation, plastic processing and sterilization of medical products. Reference services both...... and sterilization dosimetry, optichromic dosimeters in the shape of small tubes for food processing, and ESR spectroscopy of alanine for reference dosimetry. In this paper the special features of radiation processing dosimetry are discussed, several commonly used dosimeters are reviewed, and factors leading...

  19. Galactic Radiation Belts.

    Science.gov (United States)

    1982-01-15

    was formulated by Ortwein et al. 13for analysis of the Jovian radio emission. These authors de- rived their results for an arbitrary dipole-axis...galactic radio sources with the Jovian radiation-belt source, 17suggests a=. intriguing similarity. The related questions of why galactic radiation belts...Space Sciences Laboratory: Atmospheric and ionospheric physics, radiation from the atmosphere, densfty and composition of the upper atmosphere, aurorae

  20. Radiation Physics, Biophysics and Radiation Biology

    Energy Technology Data Exchange (ETDEWEB)

    Rossi, H. H.; Hall, E. J.

    1978-02-01

    Research under Contract EY-76-C-02-3243 has been carried out in the area of Radiation Physics, Biophysics and Radiation Biology. During the period of this contract the major accomplishments include, in Physics, the refinement of tissue equivalent dosimetry, the formulation of the concepts of microdosimetry, the development of apparatus used in microdosimetry, and the development of ionization chambers with internal gas multiplication. Principal contributions in Radiobiology have included the determination of RBE and OER as a function·of neutron energy, the study of combined effects of radiation and a variety of other agents, and the investigation of the transformation of cells in tissue culture. Theoretical research centered around the development of the theoretical framework of microdosimetry and the establishment of the Theory of Dual Radiation Action. In a cooperative effort with Brookhaven National Laboratory, a major accelerator facility dedicated exclusively to Radiobiology and Radiation Physics, has been developed. Members of the laboratory have performed extensive. service to national and international organizations.