WorldWideScience

Sample records for e1 giant resonance

  1. Electric dipole strength distribution below the E1 giant resonance in N = 82 nuclei

    Science.gov (United States)

    Guliyev, Ekber; Kuliev, Ali; Guner, Mehmet

    2010-12-01

    In this study quasiparticle random-phase approximation with the translational invariant Hamiltonian using deformed mean field potential has been conducted to describe electric dipole excitations in 136Xe, 138Ba, 140Ce, 142Nd, 144Sm and 146Gd isotones. The distribution of the calculated E1 strength shows a resonance like structure at energies between 6-8 MeV exhausting up to 1% of the isovector electric dipole Energy Weighted Sum Rule and in some aspects nicely confirms the experimental data. It has been shown that the main part of E1 strength, observed below the threshold in these nuclei may be interpreted as main fragments of the Pygmy Dipole resonance. The agreement between calculated mean excitation energies as well as summed B(E1) value of the 1- excitations and the available experimental data is quite good. The calculations indicate the presence of a few prominent positive parity 1+ States in heavy N = 82 isotones in the energy interval 6-8 MeV which shows not all dipole excitations were of electric character in this energy range.

  2. Multiphonon giant resonances in nuclei

    Energy Technology Data Exchange (ETDEWEB)

    Aumann, T. [Mainz Univ. (Germany). Inst. fuer Kernchemie; Bortignon, P.F. [Milan Univ. (Italy). Dipt. di Fisica]|[Istituto Nazionale di Fisica Nucleare, Milan (Italy); Emling, H. [Gesellschaft fuer Schwerionenforschung mbH, Darmstadt (Germany)

    1998-07-01

    We review the present knowledge of multiphonon giant resonances in nuclei. Theoretical concepts approaching the intrinsic structure and excitation mechanisms of multi-phonon states are discussed. The available experimental results are summarized, including a brief description of applied techniques. This review emphasizes electromagnetic excitations of double dipole resonances. Open questions and possible routes toward a solution are addressed. (orig.)

  3. Deformation effects in Giant Monopole Resonance

    CERN Document Server

    Kvasil, J; Repko, A; Bozik, D; Kleinig, W; Reinhard, P -G

    2014-01-01

    The isoscalar giant monopole resonance (GMR) in Samarium isotopes (from spherical $^{144}$Sm to deformed $^{148-154}$Sm) is investigated within the Skyrme random-phase-approximation (RPA) for a variety of Skyrme forces. The exact RPA and its separable version (SRPA) are used for spherical and deformed nuclei, respectively. The quadrupole deformation is shown to yield two effects: the GMR broadens and attains a two-peak structure due to the coupling with the quadrupole giant resonance.

  4. Anharmonic effects and double giant dipole resonances

    CERN Document Server

    Voronov, V V

    2001-01-01

    A brief review of recent results of the microscopic calculations to describe characteristics of the double giant dipole resonances (DGDR) is presented. A special attention is paid to a microscopic study of the anharmonic properties of the DGDR. It is found that the deviation of the energy centroid of the DGDR from the harmonic limit follows A sup - sup 1 dependence

  5. Double giant dipole resonance in hot nuclei

    Energy Technology Data Exchange (ETDEWEB)

    Cinausero, M.; Rizzi, V.; Viesti, G.; Fabris, D.; Lunardon, M.; Moretto, S.; Nebbia, G.; Pesente, S.; Barbui, M.; Fioretto, E.; Prete, G.; Bracco, A.; Camera, F.; Million, B.; Leoni, S.; Wieland, O.; Benzoni, G.; Brambilla, S.; Airoldi, A.; Maj, A.; Kmiecik, M

    2004-02-09

    Signals from Double Dipole Giant Resonances (DGDR) in hot nuclei have been searched in a {gamma}-{gamma} coincidence experiment using the HECTOR array at the Laboratori Nazionali di Legnaro. The experimental single {gamma}-ray spectrum and the projection of the {gamma}-{gamma} matrix have been compared with a standard Monte Carlo Statistical Model code including only the single GDR excitation. These calculations have been used as background to determine the extra-yield associated with the DGDR de-excitation. Results have been compared with a previous experiment confirming the presence of the DGDR excitation in fusion-evaporation reactions.

  6. Giant dipole resonance studied with GASP

    Energy Technology Data Exchange (ETDEWEB)

    Cinausero, M. [Istituto Nazionale di Fisica Nucleare, Legnaro (Italy). Lab. Nazionali di Legnaro; Bazzacco, D. [Dipartimento di Fisica, I.N.F.N., Sezione di Padova, 35131, Padova (Italy); Bortignon, P.F. [Dipartimento di Fisica, I.N.F.N., Sezione di Milano, 20133, Milano (Italy); De Angelis, G. [Istituto Nazionale di Fisica Nucleare, Legnaro (Italy). Lab. Nazionali di Legnaro; Fabris, D. [Dipartimento di Fisica, I.N.F.N., Sezione di Padova, 35131, Padova (Italy); Fiore, E.M. [Dipartimento di Fisica, I.N.F.N., Sezione di Bari, 70126, Bari (Italy); Fiore, L. [Dipartimento di Fisica, I.N.F.N., Sezione di Bari, 70126, Bari (Italy); Fioretto, E. [Istituto Nazionale di Fisica Nucleare, Legnaro (Italy). Lab. Nazionali di Legnaro; Fornal, B. [Institute of Nuclear Physics, 31342, Cracow (Poland); Gelli, N. [Dipartimento di Fisica, I.N.F.N., Sezione di Firenze, 50125, Firenze (Italy); Lops, M. [Dipartimento di Fisica, I.N.F.N., Sezione di Padova, 35131, Padova (Italy); Lucarelli, F. [Dipartimento di Fisica, I.N.F.N., Sezione di Firenze, 50125, Firenze (Italy); Lunardi, S. [Dipartimento di Fisica, I.N.F.N., Sezione di Padova, 35131, Padova (Italy); Nebbia, G. [Dipartimento di Fisica, I.N.F.N., Sezione di Padova, 35131, Padova (Italy); Paticchio, V. [Dipartimento di Fisica, I.N.F.N., Sezione di Bari, 70126, Bari (Italy); Prete, G. [Istituto Nazionale di Fisica Nucleare, Legnaro (Italy). Lab. Nazionali di Legnaro; Rossi-Alvarez, C. [Dipartimento di Fisica, I.N.F.N., Sezione di Padova, 35131, Padova (Italy); Viesti, G. [Dipartimento di Fisica, I.N.F.N., Sezione di Padova, 35131, Padova (Italy)

    1996-03-18

    The giant dipole resonance (GDR) from the decay of excited {sup 156}Er nuclei populated in the reaction {sup 64}Ni+{sup 92}Zr at 241 MeV has been studied by using the GASP spectrometer. High-energy {gamma}-ray spectra have been obtained in coincidence with the 80 elements of the GASP inner ball and with discrete transitions in the residual nuclei {sup 155,154}Er. GDR parameters extracted from the high-energy {gamma}-ray spectra in coincidence with low-energy {gamma}-ray fold k>10 are in good agreement with systematics as well as with predictions from adiabatic calculations. No signature for entrance channel effects in the decay of {sup 156}Er was therefore observed from this lineshape analysis of the high-energy {gamma}-ray spectra in contrast with the case of the {sup 164}Yb nucleus. (orig.).

  7. Giant dipole resonance in hot rotating nuclei

    Energy Technology Data Exchange (ETDEWEB)

    Chakrabarty, D.R. [Bhabha Atomic Research Centre, Nuclear Physics Division, Mumbai (India); Dinh Dang, N. [RIKEN, Nishina Centre for Accelerator-based Science, Saitama (Japan); VINATOM, Institute of Nuclear Science and Technique, Hanoi (Viet Nam); Datar, V.M. [Tata Institute of Fundamental Research, INO Cell, Mumbai (India)

    2016-05-15

    Over the last several decades, extensive experimental and theoretical work has been done on the giant dipole resonance (GDR) in excited nuclei covering a wide range of temperature (T), angular momentum (J) and nuclear mass. A reasonable stability of the GDR centroid energy and an increase of the GDR width with T (in the range∝1-3 MeV) and J are the two well-established results. Some experiments have indicated the saturation of the GDR width at high T. The gradual disappearance of the GDR vibration at much higher T has been observed. Experiments on the Jacobi transition and the GDR built on superdeformed shapes at high rotational frequencies have been reported in a few cases. Theoretical calculations on the damping of the collective dipole vibration, characterised by the GDR width, have been carried out within various models such as the thermal shape fluctuation model and the phonon damping model. These models offer different interpretations of the variation of the GDR width with T and J and have met with varying degrees of success in explaining the experimental data. In this review, the present experimental and theoretical status in this field is discussed along with the future outlook. The interesting phenomenon of the pre-equilibrium GDR excitation in nuclear reactions is briefly addressed. (orig.)

  8. Average radiation widths and the giant dipole resonance width

    Energy Technology Data Exchange (ETDEWEB)

    Arnould, M.; Thielemann, F.K.

    1982-11-01

    The average E1 radiation width can be calculated in terms of the energy Esub(G) and width GAMMAsub(G) of the Giant Dipole Resonance (GDR). While various models can predict Esub(G) quite reliably, the theoretical situation regarding ..lambda..sub(G) is much less satisfactory. We propose a simple phenomenological model which is able to provide GAMMAsub(G) values in good agreement with experimental data for spherical or deformed intermediate and heavy nuclei. In particular, this model can account for shell effects in GAMMAsub(G), and can be used in conjunction with the droplet model. The GAMMAsub(G) values derived in such a way are used to compute average E1 radiation widths which are quite close to the experimental values. The method proposed for the calculation of GAMMAsub(G) also appears to be well suited when the GDR characteristics of extended sets of nuclei are required, as is namely the case in nuclear astrophysics.

  9. Temperature dependence of a spreading width of giant dipole resonance in neutron-rich nuclei

    Energy Technology Data Exchange (ETDEWEB)

    Vdovin, A.I.; Storozhenko, A.N

    2003-07-14

    A temperature dependence of the spreading width of a giant dipole resonance is studied in the framework of the Quasiparticle-Phonon Model extended to finite temperature using a formalism of the Thermo Field Dynamics. Numerical calculations are performed for {sup 120}Sn and the neutron-rich double-magic isotope {sup 132}Sn It is found that the dispersion of the E1 strength function {sigma} increases with temperature.

  10. Nonlinear dynamics of giant resonances in atomic nuclei

    CERN Document Server

    Vretenar, D; Ring, P; Lalazissis, G A

    1999-01-01

    The dynamics of monopole giant resonances in nuclei is analyzed in the time-dependent relativistic mean-field model. The phase spaces of isoscalar and isovector collective oscillations are reconstructed from the time-series of dynamical variables that characterize the proton and neutron density distributions. The analysis of the resulting recurrence plots and correlation dimensions indicate regular motion for the isoscalar mode, and chaotic dynamics for the isovector oscillations. Information-theoretic functionals identify and quantify the nonlinear dynamics of giant resonances in quantum systems that have spatial as well as temporal structure.

  11. Thermal pairing and giant dipole resonance in highly excited nuclei

    CERN Document Server

    Dang, Nguyen Dinh

    2014-01-01

    Recent results are reported showing the effects of thermal pairing in highly excited nuclei. It is demonstrated that thermal pairing included in the phonon damping model (PDM) is responsible for the nearly constant width of the giant dipole resonance (GDR) at low temperature $T $ 170 MeV.

  12. Temperature Dependence of Spreading Width of Giant Dipole Resonance

    CERN Document Server

    Storozhenko, A N; Ventura, A; Blokhin, A I

    2002-01-01

    The Quasiparticle-Phonon Nuclear Model extended to finite temperature within the framework of Thermo Field Dynamics is applied to calculate a temperature dependence of the spreading width Gamma^{\\downarrow} of a giant dipole resonance. Numerical calculations are made for ^{120}Sn and ^{208}Pb nuclei. It is found that Gamma^{\\downarrow} increases with T. The reason of this effect is discussed as well as a relation of the present approach to other ones, existing in the literature.

  13. Giant right atrial myxoma: characterization with cardiac magnetic resonance imaging.

    LENUS (Irish Health Repository)

    Ridge, Carole A

    2012-02-01

    A 53-year-old woman presented to the emergency department with a 2-week history of dyspnoea and chest pain. Computed tomography pulmonary angiography was performed to exclude acute pulmonary embolism (PE). This demonstrated a large right atrial mass and no evidence of PE. Transthoracic echocardiography followed by cardiac magnetic resonance imaging confirmed a mobile right atrial mass. Surgical resection was then performed confirming a giant right atrial myxoma. We describe the typical clinical, radiologic, and pathologic features of right atrial myxoma.

  14. Isobar giant resonance formation in self-conjugate nuclei

    Science.gov (United States)

    Townsend, L. W.; Deutchman, P. A.

    1981-03-01

    The production of isobars with concomitant giant resonance excitations due to peripheral collisions of relativistic heavy ions is investigated. The interaction is described by a modified form of the central term in the one-pion-exchange potential (OPEP) where the projectile ordinary spin operator is replaced by a transition spin operator which describes the creation of an isobar from a nucleon. The scattering is analyzed using time-dependent harmonic perturbation theory to determine the reaction total cross sections. The results obtained, which are valid for reactions involving self-conjugate nuclei, are applied to the specific collison of 2.1 {GeV}/{nucleon}16O projectiles with 12C targets at rest. Cross sections are investigated using two different models for the nuclear spin states. In the first model, the many-body nuclear spin state is reduced, in the spirit of a particle-hole state, to an equivalent two-body state called a particle-core state. In the second model, the many-body spin states are described by unsymmetrized products of individual particle spins. Properties of the spin giant resonance and isobar giant resonance states are investigated. Finally, isobar decay and isobar/pion absorption effects are discussed.

  15. Nuclear Structure aspects of gamma decay from giant resonances

    Directory of Open Access Journals (Sweden)

    Bracco A.

    2014-01-01

    Full Text Available The gamma decay of the giant dipole resonance (including its tail region is an important tool to probe the properties of these states, and thus to test the predictions of mean field theories. This paper focuses on two main aspects concerning the electric dipole excitation in nuclei. These are the study of the isospin character of the low energy tail of the Giant Dipole Resonance (GDR, the so-called Pygmy resonance, and the isospin mixing of nuclear systems at finite temperature. In the first case, the Pygmy resonance has been populated in the inelastic scattering reaction 17O+124Sn at 20 MeV/u. Its gamma decay has been measured using the AGATA Demonstrator and an array of 8 large volume LaBr3:Ce scintillators. In the second case, the gamma decay of the GDR in thermalized nuclear systems, formed in fusion evaporation reactions, has been used to investigate the isospin mixing in 80Zr. For this work the reactions 40Ca+40Ca at 3.4 MeV/u and 37Cl +44Ca at 2.6 MeV/u were used.

  16. Excitation-energy dependence of the giant dipole resonance width

    Science.gov (United States)

    Enders, G.; Berg, F. D.; Hagel, K.; Kühn, W.; Metag, V.; Novotny, R.; Pfeiffer, M.; Schwalb, O.; Charity, R. J.; Gobbi, A.; Freifelder, R.; Henning, W.; Hildenbrand, K. D.; Holzmann, R.; Mayer, R. S.; Simon, R. S.; Wessels, J. P.; Casini, G.; Olmi, A.; Stefanini, A. A.

    1992-07-01

    High-energy γ rays have been measured in coincidence with heavy fragents in deeply inelastic reactions of 136Xe+48Ti at 18.5 MeV/nucleon. The giant dipole resonance (GDR) strength function is deduced from an analysis of the photon spectra within the statistical model. The GDR width Γ is studied as a function of the fragment excitation energy E*. A saturation at about Γ=10 MeV is observed for E*/A>=1.0 MeV/nucleon.

  17. Excitation-energy dependence of the giant dipole resonance width

    Energy Technology Data Exchange (ETDEWEB)

    Enders, G.; Berg, F.D.; Hagel, K.; Kuehn, W.; Metag, V.; Novotny, R.; Pfeiffer, M.; Schwalb, O. (II. Physikalisches Institut, Universitaet, Giessen, Giessen (Germany)); Charity, R.J.; Gobbi, A.; Freifelder, R.; Henning, W.; Hildenbrand, K.D.; Holzmann, R.; Mayer, R.S.; Simon, R.S.; Wessels, J.P. (Gesellschaft fuer Schwerionenforschung Darmstadt, Darmstadt (Germany)); Casini, G.; Olmi, A.; Stefanini, A.A. (Istituto Nazionale di Fisica Nucleare and University of Florence, Florence (Italy))

    1992-07-13

    High-energy {gamma} rays have been measured in coincidence with heavy fragents in deeply inelastic reactions of {sup 136}Xe+{sup 48}Ti at 18.5 MeV/nucleon. The giant dipole resonance (GDR) strength function is deduced from an analysis of the photon spectra within the statistical model. The GDR width {Gamma} is studied as a function of the fragment excitation energy {ital E}{sup *}. A saturation at about {Gamma}=10 MeV is observed for {ital E}{sup *}/{ital A}{ge}1.0 MeV/nucleon.

  18. Continuum TDHF calculation of Isoscalar and Isovector Giant Monopole Resonances

    CERN Document Server

    Stevenson, P D

    2013-01-01

    We motivate and summarise some recent results in the application of formally exact boundary conditions in nuclear time-dependent Hartree-Fock calculations, making use of Laplace transformations to calculate the values of the wave functions at the boundaries. We have realised the method in the case of giant monopole resonances of spherically-symmetric nuclei, and present strength functions of O-16 and Ca-40 using a simplified version of the Skyrme force, showing that no artefacts from discretisation occur as contaminants

  19. Destruction and Resurrection of Atomic Giant resonances in Endohedral Atoms A@C60

    CERN Document Server

    Amusia, M Ya; Chernysheva, L V

    2007-01-01

    It is demonstrated that in photoabsorption by endohedral atoms some atomic Giant resonances are almost completely destroyed while the others are totally preserved due to different action on it of the fullerenes shell. As the first example we discuss the 4d10 Giant resonance in Xe@C60 whereas as the second serves the Giant autoionization resonance in Eu@C60. The qualitative difference comes from the fact that photoelectrons from the 4d Giant resonance has small energies (tens of eV) and are strongly reflected by the C60 fullerenes shell. As to the Eu@C60, Giant autoionization leads to fast photoelectrons (about hundred eV) that go out almost untouched by the C60 shell. As a result of the outgoing electrons energy difference the atomic Giant resonances will be largely destroyed in A@C60 while the Giant autoionization resonance will be almost completely preserved. Thus, on the way from Xe@C60 Giant resonance to Eu@C60 Giant autoionization resonance the oscillation structure should disappear. Similar will be the ...

  20. On direct proton decay of the Gamow-Teller giant resonance

    Directory of Open Access Journals (Sweden)

    Urin M.H.

    2012-12-01

    Full Text Available The semi-microscopic approach to the description of giant resonances in medium-heavy mass closed-shell nuclei is implemented to treat partial probabilities of direct-proton decay of the Gamow-Teller giant resonance (GTGR in 208Bi. The corresponding experimental data are reasonably explained.

  1. E1 resonances in neutron-rich nuclei within the phonon damping model

    Indian Academy of Sciences (India)

    Nguyen Dinh Dang; Voung Kim Au; Toshio Suzuki; Akito Arima

    2001-08-01

    The quasiparticle representation of the phonon damping model (PDM) is developed to include the superfluid pairing correlations microscopically. The formalism is applied to calculate the photoabsorption and the electromagnetic (EM) differential cross sections of E1 excitations in neutron-rich oxygen and calcium isotopes. The calculated photoabsorption cross sections agree reasonably well with the available data for 16,18O and 40,48Ca. The results of calculations show that the change of the fraction of the E1 integrated strength in the region of pygmy dipole resonance (PDR) as a function of mass number with increasing neutron number is in agreement with the recent experimental data, and does not follow the prediction by the simple cluster model. The EM differential cross sections obtained within PDM in this work show prominent PDR peaks below 15 MeV for 20,22O in agreement with the recent experimental observation. It is also shown that, using low-energy RI beams at around 50-60 MeV/nucleon, one can observe clean and even enhanced PDR peaks without the admixture with the GDR in the EM differential cross sections of neutron-rich nuclei.

  2. Structure and direct decay of Giant Monopole Resonances

    CERN Document Server

    Avez, Benoît

    2013-01-01

    We study structure and direct decay of the Giant Monopole Resonance (GMR) using the Time-Dependent Energy-Density-Functional method in the linear response regime in a few doubly-magic nuclei. In these calculations, a proper treatment of the continuum, through the use of large coordinate space, allows for a separation between the nucleus and its emitted nucleons. The microscopic structure of the GMR is investigated with the decomposition of the strength function into individual single-particles quantum numbers. A similar microscopic decomposition of the spectra of emitted nucleons by direct decay of the GMR is performed. Shifting every contribution by the initial sinle-particle energy allows to reconstruct the GMR strength function. The RPA residual interaction couples bound 1-particle 1-hole states to unbound ones, allowing for the total decay of the GMR.

  3. Driving Rabi oscillations at the giant dipole resonance in xenon

    CERN Document Server

    Pabst, Stefan; Santra, Robin

    2015-01-01

    Free-electron lasers (FELs) produce short and very intense light pulses in the XUV and x-ray regimes. We investigate the possibility to drive Rabi oscillations in xenon with an intense FEL pulse by using the unusually large dipole strength of the giant-dipole resonance (GDR). The GDR decays within less than 30 as due to its position, which is above the $4d$ ionization threshold. We find that intensities around 10$^{18}$ W/cm$^2$ are required to induce Rabi oscillations with a period comparable to the lifetime. The pulse duration should not exceed 100 as because xenon will be fully ionized within a few lifetimes. Rabi oscillations reveal themselves also in the photoelectron spectrum in form of Autler-Townes splittings extending over several tens of electronvolt.

  4. Measurement of isospin mixing at a finite temperature in 80Zr via giant dipole resonance decay

    Science.gov (United States)

    Corsi, A.; Wieland, O.; Barlini, S.; Bracco, A.; Camera, F.; Kravchuk, V. L.; Baiocco, G.; Bardelli, L.; Benzoni, G.; Bini, M.; Blasi, N.; Brambilla, S.; Bruno, M.; Casini, G.; Ciemala, M.; Cinausero, M.; Crespi, F. C. L.; D'Agostino, M.; Degerlier, M.; Giaz, A.; Gramegna, F.; Kmiecik, M.; Leoni, S.; Maj, A.; Marchi, T.; Mazurek, K.; Meczynski, W.; Million, B.; Montanari, D.; Morelli, L.; Myalski, S.; Nannini, A.; Nicolini, R.; Pasquali, G.; Poggi, G.; Vandone, V.; Vannini, G.

    2011-10-01

    Isospin mixing in the hot compound nucleus 80Zr was studied by measuring and comparing the γ-ray emission from the fusion reactions 40Ca+40Ca at Ebeam=200 MeV and 37Cl+44Ca at Ebeam=153 MeV. The γ yield associated with the giant dipole resonance is found to be different in the two reactions because, in self-conjugate nuclei, the E1 selection rules forbid the decay between states with isospin I=0. The degree of mixing is deduced from statistical-model analysis of the γ-ray spectrum emitted by the compound nucleus 80Zr with the standard parameters deduced from the γ decay of the nucleus 81Rb. The results are used to deduce the zero-temperature value, which is then compared with the latest predictions. The Coulomb spreading width is found to be independent of temperature.

  5. A Secular Resonance Between Iapetus and the Giant Planets

    Science.gov (United States)

    Cuk, Matija; Dones, Henry C. Luke; Nesvorny, David; Walsh, Kevin J.

    2017-06-01

    Iapetus is the outermost of the regular satellites of Saturn, and its origin and evolution present a number of unsolved problems. From the point of view of orbital dynamics, it is remarkable that Iapetus has a large inclination (8 degrees) and a significantly smaller eccentricity (0.03), contrary to the pattern expected if its orbit was excited by encounters between Saturn and other planets early in the Solar System's history (Nesvorny et al, 2014). Here we report our long-term numerical integrations of Iapetus's orbit that show multi-Myr oscillations of Iapetus's eccentricity with an amplitude on the order of 0.01. We find that the basic argument causing this behavior is the sum of the longitude of pericenter and the longitude of the node of Iapetus, with a 0.3 Myr period. This argument appears to be in resonance with the period of the g5 mode in the eccentricity and perihelion of Saturn. We find that our nominal solution, including Saturn's oblateness, Titan, Iapetus and all four giant planets, shows librations of the argument: ǎrpi_Iapetus - ǎrpi_g5 + \\Omega_Iapetus - \\Omega_SaturnEq, where ǎrpi and \\Omega are the longitudes of pericenters and nodes, respectively, and \\Omega_SaturnEq is Saturn's equinox. While planetary perturbations are crucial in generating the g5 mode and therefore maintaining this resonance, we find that Iapetus is affected by the planets only indirectly, with the Sun being the dominant direct perturber. The libration is stable for tens of Myr for the nominal rate of Saturn's pole precession (French et al, 2017), and appears stable indefinitely if we assume a secular resonance between Saturn's node and the secular mode g18 (Ward and Hamilton, 2004; Hamilton and Ward, 2004). We will present the implication of this resonance for the origin of Iapetus's orbit and the dynamical history of Saturn's system. This research is funded by NASA Outer Planets Research Program award NNX14AO38G. References: French, R. G., McGhee-French, C. A

  6. Structure and decay properties of spin-dipole giant resonances within a semimicroscopical approach

    NARCIS (Netherlands)

    Moukhai, EA; Rodin, VA; Urin, MH

    1999-01-01

    A semimicroscopical approach is applied to calculate: (i) strength functions for the charge-exchange spin-dipole giant resonances in the Pb-208 parent nucleus; (ii) partial and total branching ratios for the direct proton decay of the resonance in Bi-208. The approach is based on continuum-RPA calcu

  7. Attosecond delay of xenon $4d$ photoionization at the giant resonance and Cooper minimum

    CERN Document Server

    Magrakvelidze, Maia; Chakraborty, Himadri S

    2016-01-01

    A Kohn-Sham time-dependent local-density-functional scheme is utilized to predict attosecond time delays of xenon 4d photoionization that involves the 4d giant dipole resonance and Cooper minimum. The fundamental effect of electron correlations to uniquely determine the delay at both regions is demonstrated. In particular, for the giant dipole resonance, the delay underpins strong collective effect, emulating the recent prediction at C60 giant plasmon resonance [T. Barillot et al, Phys. Rev. A 91, 033413 (2015)]. For the Cooper minimum, a qualitative similarity with a photorecombination experiment near argon 3p minimum [S. B. Schoun et al, Phys. Rev. Lett. 112, 153001 (2014)] is found. The result should encourage attosecond measurements of Xe 4d photoemission.

  8. Proton decay from the isoscalar giant dipole resonance in Ni-58

    NARCIS (Netherlands)

    Hunyadi, M.; Hashimoto, H.; Li, T.; Akimune, H.; Fujimura, H.; Fujiwara, M.; Gacsi, Z.; Garg, U.; Hara, K.; Harakeh, M. N.; Hoffman, J.; Itoh, M.; Murakami, T.; Nakanishi, K.; Nayak, B. K.; Okumura, S.; Sakaguchi, H.; Terashima, S.; Uchida, M.; Yasuda, Y.; Yosoi, M.

    2009-01-01

    Proton decay from the 3 (h) over bar omega isoscalar giant dipole resonance (ISGDR) in Ni-58 has been measured using the (alpha, alpha' p) reaction at a bombarding energy of 386 MeV to investigate its decay properties. We have extracted the ISGDR strength under the coincidence condition between inel

  9. Proton decay from the isoscalar giant dipole resonance in 58Ni

    NARCIS (Netherlands)

    Hunyadi, M.; Hashimoto, H.; Li, T.; Akimune, H.; Fujimura, H.; Fujiwara, M.; Gacsi, Z.; Garg, U.; Hara, K.; Harakeh, M. N.; Hoffman, J.; Itoh, M.; Murakami, T.; Nakanishi, K.; Nayak, B. K.; Okumura, S.; Sakaguchi, H.; Terashima, S.; Uchida, M.; Yasuda, Y.; Yosoi, M.

    2009-01-01

    Proton decay from the 3 (h) over bar omega isoscalar giant dipole resonance (ISGDR) in Ni-58 has been measured using the (alpha, alpha' p) reaction at a bombarding energy of 386 MeV to investigate its decay properties. We have extracted the ISGDR strength under the coincidence condition between inel

  10. Electromagnetic transitions between giant resonances within a continuum-RPA approach

    NARCIS (Netherlands)

    Rodin, VA; Dieperink, AEL

    2002-01-01

    A general continuum-RPA approach is developed to describe electromagnetic transitions between giant resonances. Using a diagrammatic representation for the three-point Green's function, an expression for the transition amplitude is derived which allows one to incorporate effects of mixing of single

  11. Neutron-skin thickness from the study of the anti-analog giant dipole resonance

    NARCIS (Netherlands)

    Krasznahorkay, A.; Stuhl, L.; Csatlós, M.; Algora, A.; Gulyás, J.; Timár, J.; Paar, N.; Vretenar, D.; Boretzky, K.; Heil, M.; Litvinov, Yu A.; Rossi, D.; Scheidenberger, C.; Simon, H.; Weick, H.; Bracco, A.; Brambilla, S.; Blasi, N.; Camera, F.; Giaz, A.; Million, B.; Pellegri, L.; Riboldi, S.; Wieland, O.; Altstadt, S.; Fonseca, M.; Glorius, J.; Göbel, K.; Heftrich, T.; Koloczek, A.; Kräckmann, S.; Langer, C.; Plag, R.; Pohl, M.; Rastrepina, G.; Reifarth, R.; Schmidt, S.; Sonnabend, K.; Weigand, M.; Harakeh, M. N.; Kalantar-Nayestanaki, N.; Rigollet, C.; Bagchi, S.; Najafi, M. A.; Aumann, T.; Atar, L.; Heine, M.; Holl, M.; Movsesyan, A.; Schrock, P.; Volkov, V.; Wamers, F.; Fiori, E.; Löher, B.; Marganiec, J.; Savran, D.; Johansson, H. T.; Fernández, P. Diaz; Garg, U.; Balabanski, D. L.

    2012-01-01

    The gamma-decay of the anti-analog of the giant dipole resonance (AGDR) has been measured to the isobaric analog state excited in the p(124Sn,n) reaction at a beam energy of 600 MeV/nucleon. The energy of the transition was also calculated with state-of-the-art self-consistent random-phase approxima

  12. NATO Advanced Study Institute on Giant Resonances in Atoms, Molecules, and Solids

    CERN Document Server

    Esteva, J; Karnatak, R

    1987-01-01

    Often, a new area of science grows at the confines between recognised subject divisions, drawing upon techniques and intellectual perspectives from a diversity of fields. Such growth can remain unnoticed at first, until a characteristic fami ly of effects, described by appropriate key words, has developed, at which point a distinct subject is born. Such is very much the case with atomic 'giant resonances'. For a start, their name itself was borrowed from the field of nuclear collective resonances. The energy range in which they occur, at the juncture of the extreme UV and the soft X-rays, remains to this day a meeting point of two different experimental techniques: the grating and the crystal spectrometer. The impetus of synchrotron spectroscopy also played a large part in developing novel methods, described by many acronyms, which are used to study 'giant resonances' today. Finally, although we have described them as 'atomic' to differentiate them from their counterparts in Nuclear Physics, their occurrence ...

  13. Coupled-Channel Models of Direct-Semidirect Capture via Giant-Dipole Resonances

    Energy Technology Data Exchange (ETDEWEB)

    Thompson, I J [Lawrence Livermore National Laboratory (LLNL); Escher, Jutta E [ORNL; Arbanas, Goran [ORNL

    2013-01-01

    Semidirect capture, a two-step process that excites a giant-dipole resonance followed by its radiative de-excitation, is a dominant process near giant-dipole resonances, that is, for incoming neutron energies within 5 20 MeV. At lower energies such processes may affect neutron capture rates that are relevant to astrophysical nucleosynthesis models. We implement a semidirect capture model in the coupled-channel reaction code Fresco and validate it by comparing the cross section for direct-semidirect capture 208Pb(n,g)209Pb to experimental data. We also investigate the effect of low-energy electric dipole strength in the pygmy resonance. We use a conventional single-particle direct-semidirect capture code Cupido for comparison. Furthermore, we present and discuss our results for direct-semidirect capture reaction 130Sn(n,g)131Sn, the cross section of which is known to have a significant effect on nucleosynthesis models.

  14. Giant resonances in the {sup 26}Mg(e,e{sup {prime}}{alpha}{sub 0}){sup 22}Ne reaction

    Energy Technology Data Exchange (ETDEWEB)

    Terremoto, L.A.; Likhachev, V.P.; Martins, M.N.; Emrich, H.J.; Fricke, G.; Kroehl, T.; Neff, K.W. [Laboratorio do Acelerador Linear, Instituto de Fisica da Universidade de Sao Paulo, Caixa Postal 66318, 05315-970 Sao Paulo, SP (Brazil)

    1997-11-01

    The fivefold differential cross section of the reaction {sup 26}Mg(e,e{sup {prime}}c) was measured for transferred momenta of 0.35 and 0.54fm{sup {minus}1} and emitted particle angles from {minus}10{degree} to 270{degree} with respect to the transferred-momentum direction. Angular correlation functions for the emitted {alpha}{sub 0} were obtained from the data. A model-independent analysis allowed us to obtain the E0, E1, and E2 multipole components of the {sup 26}Mg(e,e{sup {prime}}{alpha}{sub 0}){sup 22}Ne cross section, between 14 and 26 MeV of excitation energy. The E1 component shows a bump around 16.5 MeV, associated with the T{sub {lt}} isospin component of the giant dipole resonance. The evaluated strengths associated with the {alpha}{sub 0} decay channel, presented in percentage of the respective energy-weighted sum rules are 0.45(7){percent} for E1, 1.4(3){percent} for E2, and 0.2(1){percent} for E0. {copyright} {ital 1997} {ital The American Physical Society}

  15. E1 strength in N = 82 nuclei

    Energy Technology Data Exchange (ETDEWEB)

    Hartmann, T.; Volz, S.; Babilon, M.; Mohr, P.; Vogt, K.; Zilges, A

    2003-05-19

    Recently the importance of small contributions of electric dipole strength near the particle threshold to the production rates of atomic nuclei has become evident. Prior estimates concentrated on the Giant Dipole Resonance (GDR) which dominates photoabsorption in all nuclei. Extrapolations to smaller excitation energies were assumed to be sufficiently reliable. However, new measurements reveal that collective E1 strength can be found in the threshold region.

  16. First principles description of the giant dipole resonance in 16O

    CERN Document Server

    Bacca, Sonia; Hagen, Gaute; Orlandini, Giuseppina; Papenbrock, Thomas

    2013-01-01

    We present an ab-initio calculation of the giant dipole resonance in 16O based on a nucleon-nucleon (NN) interaction from chiral effective field theory that reproduces NN scattering data with high accuracy. By merging the Lorentz integral transform and the coupled-cluster methods, we extend the previous theoretical limits for break-up observables in light nuclei with mass numbers (A<=7), and address the collective giant dipole resonance of 16O. We successfully benchmark the new approach against virtually exact results from the hyper-spherical harmonics method in 4He. Our results for 16O reproduce the position and the total strength (bremsstrahlung sum rule) of the dipole response very well. When compared to the cross section from photo-absorption experiments the theoretical curve exhibits a smeared form of the peak. The tail region between 40 and 100 MeV is reproduced within uncertainties.

  17. Inner-shell photodetachment from N i- : A giant Feshbach resonance

    Science.gov (United States)

    Dumitriu, I.; Bilodeau, R. C.; Gorczyca, T. W.; Walter, C. W.; Gibson, N. D.; Rolles, D.; Pešić, Z. D.; Aguilar, A.; Berrah, N.

    2017-08-01

    Inner-shell photodetachment from N i-([Ar ] 3 d94 s2) leading to N i+,N i2 + , and N i3 + ion production was studied near and above the 3 p excitation region, in the 60-90 eV photon energy range, using a merged ion-photon beam technique. The absolute photodetachment cross section of N i- leading to N i+ ion production was measured. The 3 p →3 d photoexcitation in N i- gives rise to a giant Feshbach resonance. In the near-threshold region, a Fano profile, modified by a Wigner s -wave (l =0 ) threshold law, accurately fits the N i- single-photodetachment cross section. A lower-order R -matrix calculation shows overall agreement with essential features of the experimental data, confirming the nature of the strong, asymmetric Fano profile of the giant 3 p →3 d photoexcitation-autodetachment resonance in N i- .

  18. Is the Double Giant Dipole Resonance Process Responsible for Alpha Emission in Ternary Fission?

    Science.gov (United States)

    Han, Hong-Yin; Wand, Yi-Hua; Mouze, G.

    2001-11-01

    The Monte Carlo program built on the double giant dipole resonance model proposed by Mouze et al. [Nuovo Cimento A 110(1997)1097] was employed to calculate the energy spectrum of alpha particles emitted in the spontaneous ternary fission of 252Cf. It has been found that in the case of the zero orbital angular momentum of alpha particles in the alpha decay of the fragments, the measured alpha spectrum can be reproduced approximately by the model without any adjustable parameter.

  19. Is the Double Giant Dipole Resonance Process Responsible for Alpha Emission in Ternary Fission?

    Institute of Scientific and Technical Information of China (English)

    HAN Hong-Yin(韩洪银); WAND Yi-Hua(王屹华); G.Mouze

    2001-01-01

    The Monte Carlo program built on the double giant dipole resonance model proposed by Mouze et al. [Nuovo Cimento A 110(1997)1097] was employed to calculate the energy spectrum of alpha particles emitted in the spontaneous ternary fission of 252Cf. It has been found that in the case of the zero orbital angular momentum of alpha particles in the alpha decay of the fragments, the measured alpha spectrum can be reproduced approximately by the model without any adjustable parameter.

  20. Damping Mechanism of the Giant Dipole Resonance in Hot Nuclei with A=130

    Science.gov (United States)

    Wieland, O.; Bracco, A.; Camera, F.; Benzoni, G.; Blasi, N.; Crespi, F. C. L.; Leoni, S.; Million, B.; Barlini, S.; Kravchuk, V. L.; Gramegna, F.; Lanchais, A.; Maj, A.; Kmiecik, M.; Casini, G.; Chiari, M.; Nannini, A.; Bruno, M.; Geraci, E.

    2007-04-01

    The gamma decay of the Giant Dipole Resonance (GDR) in 132Ce nuclei has been measured using the reactions 64Ni (Elab= 300, 400, 500 MeV) + 68Zn and 16O (Elab= 130,250 MeV) + 116Sn. The analysis of the data shows clearly that the GDR width increases steadily with temperature at least up to 4 MeV of the temperature. The data can be well interpreted within the thermal shape fluctuation model.

  1. Remarks to the problem of the isomeric state production in (gamma, gamma') reactions in the giant dipole resonance

    CERN Document Server

    Demekhina, N A; Karapetyan, G S

    2001-01-01

    The population of the isomeric states is considered in nuclei sup 1 sup 1 sup 5 In and sup 1 sup 8 sup 0 Hf in photonuclear (gamma, gamma') reactions at giant dipole resonance energies. The comparison with the earlier published experimental and theoretical data is made. The behavior of the excitation function gives an evidence for possible increase of the high-spin state population in the giant resonance range

  2. Excitation of Giant Monopole Resonance in $^{208}$Pb and $^{116}$Sn Using Inelastic Deuteron Scattering

    CERN Document Server

    Patel, D; Itoh, M; Akimune, H; Berg, G P A; Fujiwara, M; Harakeh, M N; Iwamoto, C; Kawabata, T; Kawase, K; Matta, J T; Murakami, T; Okamoto, A; Sako, T; Schlax, K W; Takahashi, K; White, M; Yosoi, M

    2014-01-01

    The excitation of the isoscalar giant monopole resonance (ISGMR) in $^{116}$Sn and $^{208}$Pb has been investigated using small-angle (including $0^\\circ$) inelastic scattering of 100 MeV/u deuteron and multipole-decomposition analysis (MDA). The extracted strength distributions agree well with those from inelastic scattering of 100 MeV/u $\\alpha$ particles. These measurements establish deuteron inelastic scattering at E$_d \\sim$ 100 MeV/u as a suitable probe for extraction of the ISGMR strength with MDA, making feasible the investigation of this resonance in radioactive isotopes in inverse kinematics.

  3. Microspherical photonics: Giant resonant light forces, spectrally resolved optical manipulation, and coupled modes of microcavity arrays

    CERN Document Server

    Li, Yangcheng

    2015-01-01

    In this dissertation novel resonant propulsion of dielectric microspheres is studied with the goal of sorting spheres with identical resonances, which are critical for developing microspherical photonics. First, evanescent field couplers were developed by fixing tapered microfibers in mechanically robust platforms. The tapers were obtained by chemical etching techniques. Using these platforms, WGMs modal numbers, coupling regimes and quality factors were determined for various spheres and compared with theory. Second, the spectroscopic properties of photonic molecules formed by spheres with better than 0.05% uniformity of WGM resonances were studied. It was shown that various spatial configurations of coupled-cavities present relatively stable mode splitting patterns in the fiber transmission spectra which can be used as spectral signatures to distinguish such photonic molecules. The third part is the study of giant resonant propulsion forces exerted on microspheres. This effect was observed in suspensions of...

  4. Giant second harmonic generation by engineering of double plasmonic resonances at nanoscale

    CERN Document Server

    Ren, Ming-Liang; Wang, Ben-Li; Chen, Bao-Qin; Li, Jiafang; Li, Zhi-Yuan

    2014-01-01

    We have investigated second harmonic generation (SHG) from Ag-coated LiNbO3 (LN) core-shell nanocuboids and found that giant SHG can occur via deliberately designed double plasmonic resonances. By controlling the aspect ratio, we can tune fundamental wave (FW) and SHG signal to match the longitudinal and transverse plasmonic modes simultaneously, and achieve giant enhancement of SHG by more than five orders of magnitude in comparison to a bare LN nanocuboid and by about one order of magnitude to the case adopting only single plasmonic resonance. The underlying key physics is that the double-resonance nanoparticle enables greatly enhanced trapping and harvesting of incident FW energy, efficient internal transfer of optical energy from FW to SHW, and much improved power to transport the SHG energy from the nanoparticle to the far-field region. The proposed double-resonance nanostructure can serve as an efficient subwavelength coherent light source through SHG and enable flexible engineering of light-matter inte...

  5. On the orbital evolution of a pair of giant planets in mean motion resonance

    Science.gov (United States)

    André, Q.; Papaloizou, J. C. B.

    2016-10-01

    Pairs of extrasolar giant planets in a mean motion commensurability are common with 2:1 resonance occurring most frequently. Disc-planet interaction provides a mechanism for their origin. However, the time-scale on which this could operate in particular cases is unclear. We perform 2D and 3D numerical simulations of pairs of giant planets in a protoplanetary disc as they form and maintain a mean motion commensurability. We consider systems with current parameters similar to those of HD 155358, 24 Sextantis and HD 60532, and disc models of varying mass, decreasing mass corresponding to increasing age. For the lowest mass discs, systems with planets in the Jovian mass range migrate inwards maintaining a 2:1 commensurability. Systems with the inner planet currently at around 1 au from the central star could have originated at a few au and migrated inwards on a time-scale comparable to protoplanetary disc lifetimes. Systems of larger mass planets such as HD 60532 attain 3:1 resonance as observed. For a given mass accretion rate, results are insensitive to the disc model for the range of viscosity prescriptions adopted, there being good agreement between 2D and 3D simulations. However, in a higher mass disc a pair of Jovian mass planets passes through 2:1 resonance before attaining a temporary phase lasting a few thousand orbits in an unstable 5:3 resonance prior to undergoing a scattering. Thus, finding systems in this commensurability is unlikely.

  6. Role of deformation on giant resonances within the QRPA approach and the Gogny force

    CERN Document Server

    Peru, S

    2008-01-01

    Fully consistent axially-symmetric-deformed Quasi-particle Random Phase Approximation (QRPA) calculations have been performed, in which the same Gogny D1S effective force has been used for both the Hartree-Fock-Bogolyubov mean field and the QRPA approaches. Giant resonances calculated in deformed $^{26-28}$Si and $^{22-24}$Mg nuclei as well as in the spherical $^{30}$Si and $^{28}$Mg isotopes are presented. Theoretical results for isovector-dipole and isoscalar monopole, quadrupole, and octupole responses are presented and the impact of the intrinsic nuclear deformation is discussed.

  7. Isoscalar Giant Resonances of 120Sn in the Quasiparticle Relativistic Random Phase Approximation

    Institute of Scientific and Technical Information of China (English)

    CAO Li-Gang; MA Zhong-Yu

    2004-01-01

    @@ The quasiparticle relativistic random phase approximation (QRRPA) is formulated based on the relativistic mean field ground state in the response function formalism. The pairing correlations are taken into account in the Bardeen-Cooper-Schrieffer approximation with a constant pairing gap. The numerical calculations are performed in the case of various isoscalar giant resonances of nucleus 120Sn with parameter set NL3. The calculated results show that the QRRPA approach could satisfactorily reproduce the experimental data of the energies of low-lying states.

  8. Giant field enhancement by funneling effect into sub-wavelength slit-box resonators

    CERN Document Server

    Chevalier, Paul; Haidar, Riad; Pardo, Fabrice

    2014-01-01

    Inspired by the acoustic Helmholtz resonator, we propose a slit-box electromagnetic nanoantenna able to concentrate the energy of an incident beam into surfaces a thousand times smaller than with a classical lens. This design gives birth to giant field intensity enhancement in hot volume, throughout the slit. It reaches $10^4$ in the visible up to $10^8$ in the THz range even with focused beams thanks to an omnidirectional reception. These properties could target applications requiring extreme light concentration, such as SEIRA, non-linear optics and biophotonics.

  9. Neutron-skin thickness from the study of the anti-analog giant dipole resonance

    OpenAIRE

    2012-01-01

    The gamma-decay of the anti-analog of the giant dipole resonance (AGDR) has been measured to the isobaric analog state excited in the p(124Sn,n) reaction at a beam energy of 600 MeV/nucleon. The energy of the transition was also calculated with state-of-the-art self-consistent random-phase approximation (RPA) and turned out to be very sensitive to the neutron-skin thickness (\\DeltaR_(pn)). By comparing the theoretical results with the measured one, the \\DeltaR_(pn) value for 124Sn was deduced...

  10. Giant resonances in exotic spherical nuclei within the RPA approach with the Gogny force

    CERN Document Server

    P'eru, S; Bortignon, P F

    2005-01-01

    Theoretical results for giant resonances in the three doubly magic exotic nuclei $^{78}$Ni, $^{100}$Sn and $^{132}$Sn are obtained from Hartree-Fock (HF) plus Random Phase Approximation (RPA) calculations using the D1S parametrization of the Gogny two-body effective interaction. Special attention is paid to full consistency between the HF field and the RPA particle-hole residual interaction. The results for the exotic nuclei, on average, appear similar to those of stable ones, especially for quadrupole and octupole states. More exotic systems have to be studied in order to confirm such a trend. The low energy of the monopole resonance in $^{78}$Ni suggests that the compression modulus in this neutron rich nucleus is lower than the one of stable ones.

  11. The Giant Dipole Resonance built on highly excited states — results of the MEDEA experiment

    Science.gov (United States)

    Suomijärvi, T.; Le Faou, J. H.; Blumenfeld, Y.; Piattelli, P.; Agodi, C.; Alamanos, N.; Alba, R.; Auger, F.; Bellia, G.; Chomaz, Ph.; Coniglione, R.; Del Zoppo, A.; Finocchiaro, P.; Frascaria, N.; Gaardhøje, J. J.; Garron, J. P.; Gillibert, A.; Lamehi-Rachti, M.; Liguori-Neto, R.; Maiolino, C.; Migneco, E.; Russo, G.; Roynette, J. C.; Santonocito, D.; Sapienza, P.; Scarpaci, J. A.; Smerzi, A.

    1994-03-01

    Gamma-rays, light charged particles and evaporation residues emitted from hot nuclei formed in the 36Ar + 90Zr reaction at 27 MeV/u have been measured with a nearly 4π barium fluoride multidetector. It is shown that hot Sn-like nuclei with a range of excitation energies between 300 and 600 MeV are produced. The γ-ray yield from the decay of the Giant Dipole Resonance in these nuclei is shown to remain constant over this excitation energy range. The measured γ-ray spectra are compared with statistical calculations encompassing several recent theoretical models for the quenching of gamma-ray emission from the dipole resonance at very high temperatures.

  12. On the orbital evolution of a pair of giant planets in mean motion resonance

    CERN Document Server

    André, Q

    2016-01-01

    Pairs of extrasolar giant planets in a mean motion commensurability are common with 2:1 resonance occurring most frequently. Disc-planet interaction provides a mechanism for their origin. However, the time scale on which this could operate in particular cases is unclear. We perform 2D and 3D numerical simulations of pairs of giant planets in a protoplanetary disc as they form and maintain a mean motion commensurability. We consider systems with current parameters similar to those of HD 155358, 24 Sextantis and HD 60532, and disc models of varying mass, decreasing mass corresponding to increasing age. For the lowest mass discs, systems with planets in the Jovian mass range migrate inwards maintaining a 2:1 commensurability. Systems with the inner planet currently at around 1 au from the central star could have originated at a few au and migrated inwards on a time scale comparable to protoplanetary disc lifetimes. Systems of larger mass planets such as HD 60532 attain 3:1 resonance as observed. For a given mass...

  13. Giant positive and negative Goos-Hänchen shift on dielectric gratings caused by guided mode resonance.

    Science.gov (United States)

    Yang, Rui; Zhu, Wenkan; Li, Jingjing

    2014-01-27

    Giant positive and negative Goos-Hänchen shift more than 5000 times of the operating wavelength is observed when a beam is totally reflected from a substrate decorated by a dielectric grating. Different to the former studies where Goos-Hänchen shift is related to metamaterials or plasmonic materials with ohmic loss, here the giant shift is realized with unity reflectance without the loss. This is extremely advantageous for sensor applications. The Goos-Hänchen shift exhibits a strong resonant feature at the frequency of guided mode resonance, and is associated to the energy flow carried by the guided mode.

  14. Formation and evolution of the two 4/3 resonant giants planets in HD 200946

    CERN Document Server

    Santos, M Tadeu dos; Michtchenko, T A; Ferraz-Mello, S

    2014-01-01

    It has been suggested that HD 200964 is the first exoplanetary system with two Jovian planets evolving in the 4/3 mean- motion resonance. Previous scenarios to simulate the formation of two giant planets in the stable 4/3 resonance configuration have failed. Moreover, the orbital parameters available in the literature point out an unstable configuration of the planetary pair. The purpose of this paper is i) to determine the orbits of the planets from the RV measurements and update the value of the stellar mass (1.57 M), ii) to analyse the stability of the planetary evolution in the vicinity and inside the 4/3 MMR, and iii) to elaborate a possible scenario for the formation of systems in the 4/3 MMR. The results of the formation simulations are able to very closely reproduce the 4/3 resonant dynamics of the best-fit config- uration obtained in this paper. Moreover, the confidence interval of the fit matches well with the very narrow stable region of the 4/3 mean-motion resonance. The formation process of the H...

  15. Resonant bonding driven giant phonon anharmonicity and low thermal conductivity of phosphorene

    Science.gov (United States)

    Qin, Guangzhao; Zhang, Xiaoliang; Yue, Sheng-Ying; Qin, Zhenzhen; Wang, Huimin; Han, Yang; Hu, Ming

    2016-10-01

    Two-dimensional (2D) phosphorene, which possesses fascinating physical and chemical properties distinctively different from other 2D materials, calls for a fundamental understanding of thermal transport properties for its rapidly growing applications in nano- and optoelectronics and thermoelectrics. However, even the basic phonon property, for example, the exact value of the lattice thermal conductivity (κ ) of phosphorene reported in the literature, can differ unacceptably by one order of magnitude. More importantly, the fundamental physics underlying its unique properties such as strong phonon anharmonicity and unusual anisotropy remains largely unknown. In this paper, based on the analysis of electronic structure and lattice dynamics from first principles, we report that the giant phonon anharmonicity in phosphorene is associated with the soft transverse optical (TO) phonon modes and arises from the long-range interactions driven by the orbital governed resonant bonding. We also provide a microscopic picture connecting the anisotropic and low κ of phosphorene to the giant directional phonon anharmonicity and long-range interactions, which are further traced back to the asymmetric resonant orbital occupations of electrons and characteristics of the hinge-like structure. The unambiguously low κ of phosphorene obtained consistently by three independent ab initio methods confirms the phonon anharmonicity to a large extent and is expected to end the confusing huge deviations in previous studies. This work further pinpoints the necessity of including van der Waals interactions to accurately describe the interatomic interactions in phosphorene. We propose in 2D material that resonant bonding leads to low thermal conductivity, despite that it is originally found in three-dimensional (3D) thermoelectric and phase-change materials. Our study offers insights into phonon transport from the view of orbital states, which would be of great significance to the design of

  16. Cardiac Sarcoidosis or Giant Cell Myocarditis? On Treatment Improvement of Fulminant Myocarditis as Demonstrated by Cardiovascular Magnetic Resonance Imaging

    Directory of Open Access Journals (Sweden)

    Hari Bogabathina

    2012-01-01

    Full Text Available Giant cell myocarditis, but not cardiac sarcoidosis, is known to cause fulminant myocarditis resulting in severe heart failure. However, giant cell myocarditis and cardiac sarcoidosis are pathologically similar, and attempts at pathological differentiation between the two remain difficult. We are presenting a case of fulminant myocarditis that has pathological features suggestive of cardiac sarcoidosis, but clinically mimicking giant cell myocarditis. This patient was treated with cyclosporine and prednisone and recovered well. This case we believe challenges our current understanding of these intertwined conditions. By obtaining a sense of severity of cardiac involvement via delayed hyperenhancement of cardiac magnetic resonance imaging, we were more inclined to treat this patient as giant cell myocarditis with cyclosporine. This resulted in excellent improvement of patient’s cardiac function as shown by delayed hyperenhancement images, early perfusion images, and SSFP videos.

  17. Pygmy and Giant Dipole Resonances by Coulomb Excitation using a Quantum Molecular Dynamics model

    CERN Document Server

    Tao, C; Zhang, G Q; Cao, X G; Wang, D Q Fang H W

    2012-01-01

    Pygmy and Giant Dipole Resonance (PDR and GDR) in Ni isotopes have been investigated by Coulomb excitation in the framework of the Isospin-dependent Quantum Molecular Dynamics model (IQMD). The spectra of $\\gamma$ rays are calculated and the peak energy, the strength and Full Width at Half Maximum (FWHM) of GDR and PDR have been extracted. Their sensitivities to nuclear equation of state, especially to its symmetry energy term are also explored. By a comparison with the other mean-field calculations, we obtain the reasonable values for symmetry energy and its slope parameter at saturation, which gives an important constrain for IQMD model. In addition, we also studied the neutron excess dependence of GDR and PDR parameters for Ni isotopes and found that the energy-weighted sum rule (EWSR) $PDR_{m_1}/GDR_{m_1}%$ increases linearly with the neutron excess.

  18. Nuclear Symmetry Energy: constraints from Giant Quadrupole Resonances and Parity Violating Electron Scattering

    CERN Document Server

    Roca-Maza, X; Bortignon, P F; Brenna, M; Cao, Li-Gang; Centelles, M; Colò, G; Paar, N; Viñas, X; Vretenar, D; Warda, M

    2013-01-01

    Experimental and theoretical efforts are being devoted to the study of observables that can shed light on the properties of the nuclear symmetry energy. We present our new results on the excitation energy [X. Roca-Maza et al., Phys. Rev. C 87, 034301 (2013)] and polarizability of the Isovector Giant Quadrupole Resonance (IVGQR), which has been the object of new experimental investigation [S. S. Henshaw et al., Phys. Rev. Lett. 107, 222501 (2011)]. We also present our theoretical analysis on the parity violating asymmetry at the kinematics of the Lead Radius Experiment [S. Abrahamyan et al. (PREx Collaboration), Phys. Rev. Lett. 108, 112502 (2012)] and highlight its relation with the density dependence of the symmetry energy [X. Roca-Maza et al., Phys. Rev. Lett. 106, 252501 (2011)].

  19. Finite amplitude method applied to giant dipole resonance in heavy rare-earth nuclei

    CERN Document Server

    Oishi, Tomohiro; Hinohara, Nobuo

    2016-01-01

    Background: The quasiparticle random phase approximation (QRPA), within the framework of the nuclear density functional theory (DFT), has been a standard tool to access the collective excitations of the atomic nuclei. Recently, finite amplitude method (FAM) has been developed, in order to perform the QRPA calculations efficiently without any truncation on the two-quasiparticle model space. Purpose: We discuss the nuclear giant dipole resonance (GDR) in heavy rare-earth isotopes, for which the conventional matrix diagonalization of the QRPA is numerically demanding. A role of the Thomas-Reiche-Kuhn (TRK) sum rule enhancement factor, connected to the isovector effective mass, is also investigated. Methods: The electric dipole photoabsorption cross section was calculated within a parallelized FAM-QRPA scheme. We employed the Skyrme energy density functional self-consistently in the DFT calculation for the ground states and FAM-QRPA calculation for the excitations. Results: The mean GDR frequency and width are mo...

  20. Multineutron photodisintegration of the {sup 197}Au nucleus behind the giant dipole resonance

    Energy Technology Data Exchange (ETDEWEB)

    Ermakov, A. N.; Ishkhanov, B. S.; Kapitonov, I. M.; Htun, Kyaw Kyaw; Makarenko, I. V.; Orlin, V. N.; Shvedunov, V. I. [Moscow State University, Institute of Nuclear Physics (Russian Federation)

    2008-03-15

    An experiment in which the gold isotope {sup 197}Au was irradiated with a beam of bremsstrahlung photons having an endpoint energy of E{sub {gamma}}{sup m} = 67.7 MeV and originating from the RTM-70 racetrack microtron of the Institute of Nuclear Physics at Moscow State University was performed. The gammaray spectra of the residual beta activity of an irradiated sample were measured. Multinucleon photonuclear reactions on {sup 197}Au nuclei were observed in the experiment. Photonuclear reactions on a {sup 197}Au nucleus that involve the emission of up to seven neutrons were recorded for the first time. The experimental results in question suggest the important role of the quasideuteron photodisintegration mechanism in the energy region behind the giant dipole resonance.

  1. Multineutron photodisintegration of the 197Au nucleus behind the giant dipole resonance

    Science.gov (United States)

    Ermakov, A. N.; Ishkhanov, B. S.; Kapitonov, I. M.; Htun, Kyaw Kyaw; Makarenko, I. V.; Orlin, V. N.; Shvedunov, V. I.

    2008-03-01

    An experiment in which the gold isotope 197Au was irradiated with a beam of bremsstrahlung photons having an endpoint energy of E {/γ m } = 67.7 MeV and originating from the RTM-70 racetrack microtron of the Institute of Nuclear Physics at Moscow State University was performed. The gammaray spectra of the residual beta activity of an irradiated sample were measured. Multinucleon photonuclear reactions on 197Au nuclei were observed in the experiment. Photonuclear reactions on a 197Au nucleus that involve the emission of up to seven neutrons were recorded for the first time. The experimental results in question suggest the important role of the quasideuteron photodisintegration mechanism in the energy region behind the giant dipole resonance.

  2. Giant Dipole Resonance as a Fingerprint of $\\alpha$ Clustering Configurations in $^{12}$C and $^{16}$O

    CERN Document Server

    He, W B; Cao, X G; Cai, X Z; Zhang, G Q

    2014-01-01

    It is studied how the $\\alpha$ cluster degrees of freedom, such as $\\alpha$ clustering configurations close to the $\\alpha$ decay threshold in $^{12}$C and $^{16}$O, including the linear chain, triangle, square, kite, and tetrahedron, affect nuclear collective vibrations with a microscopic dynamical approach, which can describe properties of nuclear ground states well across the nuclide chart and reproduce the standard giant dipole resonance (GDR) of $^{16}$O quite nicely. It is found that the GDR spectrum is highly fragmented into several apparent peaks due to the $\\alpha$ structure. The different $\\alpha$ cluster configurations in $^{12}$C and $^{16}$O have corresponding characteristic spectra of GDR. The number and centroid energies of peaks in the GDR spectra can be reasonably explained by the geometrical and dynamical symmetries of $\\alpha$ clustering configurations. Therefore, the GDR can be regarded as a very effective probe to diagnose the different $\\alpha$ cluster configurations in light nuclei.

  3. Origin of fine structure of the giant dipole resonance in sd-shell nuclei

    CERN Document Server

    Fearick, R W; Matsubara, H; von Neumann-Cosel, P; Richter, A; Roth, R; Tamii, A

    2014-01-01

    A set of high resolution zero-degree inelastic proton scattering data on 24Mg, 28Si, 32S, and 40Ca provides new insight into the long-standing puzzle of the origin of fragmentation of the Giant Dipole Resonance (GDR) in sd-shell nuclei. Understanding is provided by state-of-the-art theoretical Random Phase Approximation (RPA) calculatios for deformed nuclei using for the first time a realistic nucleon-nucleon interaction derived from the Argonne V18 potential with the unitary correlation operator method and supplemented by a phenomenological three-nucleon contact interaction. A wavelet analysis allows to extract significant scales both in the data and calculations characterizing the fine structure of the GDR. The fair agreement supports that the fine structure arises from ground-state deformation driven by alpha clustering.

  4. Neutron-skin thickness from the study of the anti-analog giant dipole resonance

    Science.gov (United States)

    Krasznahorkay, A.; Stuhl, L.; Csatlós, M.; Algora, A.; Gulyás, J.; Timár, J.; Paar, N.; Vretenar, D.; Harakeh, M. N.; Boretzky, K.; Heil, M.; Litvinov, Yu. A.; Rossi, D.; Scheidenberger, C.; Simon, H.; Weick, H.; Bracco, A.; Brambilla, S.; Blasi, N.; Camera, F.; Giaz, A.; Million, B.; Pellegri, L.; Riboldi, S.; Wieland, O.; Altstadt, S.; Fonseca, M.; Glorius, J.; Göbel, K.; Heftrich, T.; Koloczek, A.; Kräckmann, S.; Langer, C.; Plag, R.; Pohl, M.; Rastrepina, G.; Reifarth, R.; Schmidt, S.; Sonnabend, K.; Weigand, M.; Kalantar-Nayestanaki, N.; Rigollet, C.; Bagchi, S.; Najafi, M. A.; Aumann, T.; Atar, L.; Heine, M.; Holl, M.; Movsesyan, A.; Schrock, P.; Volkov, V.; Wamers, F.; Fiori, E.; Löher, B.; Marganiec, J.; Savran, D.; Johansson, H. T.; Fernández, P. Diaz; Garg, U.; Balabanski, D. L.

    2012-10-01

    The γ-decay of the anti-analog of the giant dipole resonance (AGDR) to the isobaric analog state has been measured following the p(124Sn,n) reaction at a beam energy of 600 MeV/nucleon. The energy of the transition was also calculated with state-of-the-art self-consistent relativistic random-phase approximation (RPA) and turned out to be very sensitive to the neutronskin thickness (ΔRpn). By comparing the theoretical results with the measured one, the ΔRpn value for 124Sn was deduced to be 0.21 ± 0.07 fm, which agrees well with the previous results. The present method offers new possibilities for measuring the neutron-skin thicknesses of very exotic isotopes.

  5. Effects of thermal shape fluctuations and pairing fluctuations on the giant dipole resonance in warm nuclei

    CERN Document Server

    Kumar, A K Rhine; Dang, N Dinh

    2015-01-01

    Apart from the higher limits of isospin and temperature, the properties of atomic nuclei are intriguing and less explored at the limits of lowest but finite temperatures. At very low temperatures there is a strong interplay between the shell (quantal fluctuations), statistical (thermal fluctuations), and residual pairing effects as evidenced from the studies on giant dipole resonance (GDR). In our recent work [Phys. Rev. C \\textbf{90}, 044308 (2014)], we have outlined some of our results from a theoretical approach for such warm nuclei where all these effects are incorporated along within the thermal shape fluctuation model (TSFM) extended to include the fluctuations in the pairing field. In this article, we present the complete formalism based on the microscopic-macroscopic approach for determining the deformation energies and a macroscopic approach which links the deformation to GDR observables. We discuss our results for the nuclei $^{97}$Tc, $^{120}$Sn, $^{179}$Au, and $^{208}$Pb, and corroborate with the...

  6. Monopole giant resonance in $^{100-132}$Sn, $^{144}$Sm and $^{208}$Pb

    CERN Document Server

    Kvasil, J; Repko, A; Reinhard, P -G; Nesterenko, V O; Kleinig, W

    2014-01-01

    The isoscalar giant monopole resonance (GMR) in spherical nuclei $^{100-132}$Sn, $^{144}$Sm, and $^{208}$Pb is investigated within the Skyrme random-phase-approximation (RPA) for a variety of Skyrme forces and different pairing options. The calculated GMR strength functions are directly compared to the available experimental distributions. It is shown that, in accordance to results of other groups, description of GMR in Sn and heavier Sm/Pb nuclei needs different values of the nuclear incompressibilty, $K \\approx$ 200 or 230 MeV, respectively. Thus none from the used Skyrme forces is able to describe GMR in these nuclei simultaneously. The GMR peak energy in open-shell $^{120}$Sn is found to depend on the isoscalar effective mass, which might be partly used for a solution of the above problem. Some important aspects of the problem (discrepancies of available experimental data, proper treatment of the volume and surface compression in finite nuclei, etc) are briefly discussed.

  7. Measurement of Giant Dipole Resonance width at low temperature: A new experimental perspective

    CERN Document Server

    Mukhopadhyay, S; Pal, Surajit; Bhattacharya, Srijit; De, A; Bhattacharya, S; Bhattacharya, C; Banerjee, K; Kundu, S; Rana, T K; Mukherjee, G; Pandey, R; Gohil, M; Pai, H; Meena, J K; Banerjee, S R

    2011-01-01

    The systematic evolution of the giant dipole resonance (GDR) width in the temperature region of 0.9 ~ 1.4 MeV has been measured experimentally for 119Sb using alpha induced fusion reaction and employing the LAMBDA high energy photon spectrometer. The temperatures have been precisely determined by simultaneously extracting the vital level density parameter from the neutron evaporation spectrum and the angular momentum from gamma multiplicity filter using a realistic approach. The systematic trend of the data seems to disagree with the thermal shape fluctuation model (TSFM). The model predicts the gradual increase of GDR width from its ground state value for T > 0 MeV whereas the measured GDR widths appear to remain constant at the ground state value till T ~ 1 MeV and increase thereafter indicating towards a failure of the adiabatic assumption of the model at low temperature.

  8. Extremely narrow resonances, giant sensitivity and field enhancement in low-loss waveguide sensors

    Science.gov (United States)

    Nesterenko, D. V.; Hayashi, S.; Sekkat, Z.

    2016-06-01

    Low-loss waveguides (WGs), which support excitation of waveguide modes (WMs), are based on a dielectric WG separated from an absorptive film by a low-index dielectric spacer layer. We perform numerical and analytical study of the impact of the losses imposed to the WG in a planar sensing structure in the Kretschmann configuration on the resonance properties of the excitation. We demonstrate that the loss degree of the WMs can be controlled by the thickness of the spacer layer for both s and p polarizations. Extremely narrow resonances are discovered in the reflectivity spectra due to excitation of the low-loss WMs, and the maximum of the estimated sensitivity by intensity is found to be of 105-fold higher as compared to the conventional surface plasmon and WG-coupled surface plasmon sensors. We reveal the giant field intensity enhancement of 107-fold on the surface of the sensing structure in aqueous sensing media that can provide stronger fluorescence intensity at lower sample volumes for fluorescent labeling sensing.

  9. Deformation-induced splitting of isoscalar E0 giant resonance: Skyrme random-phase-approximation analysis

    CERN Document Server

    Kvasil, J; Repko, A; Kleinig, W; Reinhard, P -G

    2016-01-01

    The deformation-induced splitting of isoscalar giant monopole resonance (ISGMR) is systematically analyzed in a wide range of masses covering medium, rare-earth, actinide, and superheavy axial deformed nuclei. The study is performed within the fully self-consistent quasiparticle random-phase-approximation (QRPA) method based on the Skyrme functional. Two Skyrme forces, one with a large (SV-bas) and one with a small (SkP) nuclear incompressibility, are considered. The calculations confirm earlier results that, due to the deformation-induced E0-E2 coupling, the isoscalar E0 resonance attains a double-peak structure and significant energy upshift. Our results are compared with available analytic estimations. Unlike earlier studies, we get a smaller energy difference between the lower and upper peaks and thus a stronger E0-E2 coupling. This in turn results in more pumping of E0 strength into the lower peak and more pronounced splitting of ISGMR. We also discuss widths of the peaks and their negligible correlation...

  10. Isoscalar Giant Resonance Strengths in $^{32}$S and possible excitations of superdeformed and $^{28}$Si + $\\alpha$ cluster bandheads

    CERN Document Server

    Itoh, M; Sakaguchi, H; Akimune, H; Fujiwara, M; Garg, U; Hara, K; Hashimoto, H; Hoffman, J; Kawabata, T; Kawase, K; Murakami, T; Nakanishi, K; Nayak, B K; Terashima, S; Uchida, M; Yasuda, Y; Yosoi, M

    2013-01-01

    Isoscalar giant resonances and low spin states in $^{32}$S have been measured with inelastic $\\alpha$ scattering at extremely forward angles including zero degrees at E$_{\\alpha}$ = 386 MeV. By applying the multipole decomposition analysis, various excited states are classified according to their spin and parities (J$^{\\pi}$), and are discussed in relation to the super deformed and $^{28}$Si + $\\alpha$ cluster bands.

  11. Using the (p-arrow-right,p-arrow-right ') reaction to study. delta. S = 0 giant resonances

    Energy Technology Data Exchange (ETDEWEB)

    Baker, F.T.; Bimbot, L.; Fergerson, R.W.; Glashausser, C.; Jones, K.; Green, A.; Nakayama, K.; Nanda, S.

    1988-03-01

    Measurements of spin-flip probabilities for inelastic scattering of 318 MeV protons from /sup 40/Ca reveal that much of the background underlying the giant dipole and quadrupole resonances at small angles is from ..delta..S = 1 transitions. This holds the promise of allowing a much better estimate of this background than has previously been possible;one model-dependent parameter is necessary. Subsequent analysis with a first estimate of this parameter is presented

  12. TERRESTRIAL PLANET FORMATION DURING THE MIGRATION AND RESONANCE CROSSINGS OF THE GIANT PLANETS

    Energy Technology Data Exchange (ETDEWEB)

    Lykawka, Patryk Sofia [Astronomy Group, Faculty of Social and Natural Sciences, Kinki University, Shinkamikosaka 228-3, Higashiosaka-shi, Osaka 577-0813 (Japan); Ito, Takashi, E-mail: patryksan@gmail.com [National Astronomical Observatory of Japan, Osawa 2-21-1, Mitaka, Tokyo 181-8588 (Japan)

    2013-08-10

    The newly formed giant planets may have migrated and crossed a number of mutual mean motion resonances (MMRs) when smaller objects (embryos) were accreting to form the terrestrial planets in the planetesimal disk. We investigated the effects of the planetesimal-driven migration of Jupiter and Saturn, and the influence of their mutual 1:2 MMR crossing on terrestrial planet formation for the first time, by performing N-body simulations. These simulations considered distinct timescales of MMR crossing and planet migration. In total, 68 high-resolution simulation runs using 2000 disk planetesimals were performed, which was a significant improvement on previously published results. Even when the effects of the 1:2 MMR crossing and planet migration were included in the system, Venus and Earth analogs (considering both orbits and masses) successfully formed in several runs. In addition, we found that the orbits of planetesimals beyond a {approx} 1.5-2 AU were dynamically depleted by the strengthened sweeping secular resonances associated with Jupiter's and Saturn's more eccentric orbits (relative to the present day) during planet migration. However, this depletion did not prevent the formation of massive Mars analogs (planets with more than 1.5 times Mars's mass). Although late MMR crossings (at t > 30 Myr) could remove such planets, Mars-like small mass planets survived on overly excited orbits (high e and/or i), or were completely lost in these systems. We conclude that the orbital migration and crossing of the mutual 1:2 MMR of Jupiter and Saturn are unlikely to provide suitable orbital conditions for the formation of solar system terrestrial planets. This suggests that to explain Mars's small mass and the absence of other planets between Mars and Jupiter, the outer asteroid belt must have suffered a severe depletion due to interactions with Jupiter/Saturn, or by an alternative mechanism (e.g., rogue super-Earths)

  13. Temperature dependence of the giant dipole resonance width in 152Gd

    Science.gov (United States)

    Ghosh, C.; Mishra, G.; Rhine Kumar, A. K.; Dokania, N.; Nanal, V.; Pillay, R. G.; Kumar, Suresh; Rout, P. C.; Joshi, Sandeep; Arumugam, P.

    2016-07-01

    To investigate the dependence of giant dipole resonance (GDR) width on temperature (T ) and angular momentum (J ), high energy γ -ray spectra were measured in the reaction 28Si+124Sn at E28Si=135 MeV. The J information was deduced from multiplicity of low-energy γ rays. The GDR parameters, namely, the centroid energy and width are extracted using statistical model analysis. The observed variation of the GDR width for T ˜1.2 -1.37 MeV and J ˜20 ℏ -40 ℏ is consistent with the universal scaling given by Kusnezov et al., which is applicable in the liquid-drop regime. The GDR input cross sections extracted from the statistical model best fits are compared with thermal shape fluctuation model (TSFM) calculations and are found to be in good agreement. The TSFM calculations predominantly favor the noncollective oblate shape, while the statistical model fit with both prolate and oblate shapes describes the data. The present data together with earlier measurements indicate a very slow variation of the GDR width for T ˜1.2 to 1.5 MeV. The observed trend is well explained by the TSFM calculations, although the calculated values are ˜4 %-13% higher than the data.

  14. Isoscalar giant monopole resonance in Sn isotopes by Coulomb excitations using a quantum molecular dynamics model

    CERN Document Server

    Tao, C; Zhang, G Q; Cao, X G; Fang, D Q; Wang, H W; Xu, J

    2013-01-01

    The isoscalar giant monopole resonance (ISGMR) in Sn isotopes and other nuclei has been investigated by Coulomb excitations in the framework of the isospin-dependent quantum molecular dynamics (IQMD) model. The spectrum of GMR has been calculated by taking the root-mean-square (RMS) radius of a nucleus as its monopole moment. The peak energy, the full width at half maximum (FWHM), and the strength of GMR extracted by a Gaussian fit to the spectrum have been studied. The GMR peak energies for Sn isotopes from the calculations using a mass-number dependent Gaussian wave-packet width $\\sigma_r$ for nucleons are found to be overestimated and show a weak dependence on the mass number compared with the experimental data. However, it has been found that experimental data of the GMR peak energies for $^{40}$Ca, $^{56}$Ni, $^{90}$Zr and $^{208}$Pb as well as Sn isotopes can be nicely reproduced after taking into account the isospin dependence in isotope chains in addition to the mass number dependence of $\\sigma_r$ fo...

  15. Giant exciton Fano resonance in quasi-one-dimensional Ta2NiSe5

    Science.gov (United States)

    Larkin, T. I.; Yaresko, A. N.; Pröpper, D.; Kikoin, K. A.; Lu, Y. F.; Takayama, T.; Mathis, Y.-L.; Rost, A. W.; Takagi, H.; Keimer, B.; Boris, A. V.

    2017-05-01

    We report the complex dielectric function of the quasi-one-dimensional chalcogenide Ta2NiSe5 , which undergoes a structural phase transition presumably associated with exciton condensation below Tc=326 K [Y. Wakisaka et al., Phys. Rev. Lett. 103, 026402 (2009), 10.1103/PhysRevLett.103.026402; Y. F. Lu et al., Nat. Commun. 8, 14408 (2017), 10.1038/ncomms14408], and of the isostructural Ta2NiS5 , which does not exhibit such a transition. Using spectroscopic ellipsometry, we have detected exciton doublets with pronounced Fano line shapes in both the compounds. The exciton Fano resonances in Ta2NiSe5 display an order-of-magnitude higher intensity than those in Ta2NiS5 . In conjunction with prior theoretical work [E. Rashba, Sov. Phys. Semicond. 8, 807 (1975)], we attribute this observation to the giant oscillator strength of spatially extended exciton-phonon bound states in Ta2NiSe5 . The formation of exciton-phonon complexes in Ta2NiS5 and Ta2NiSe5 is confirmed by the pronounced temperature dependence of sharp interband transitions in the optical spectra, the peak energies and widths of which scale with the thermal population of optical phonon modes. The description of the optically excited states in terms of strongly overlapping exciton complexes is in good agreement with the hypothesis of an exciton insulator ground state.

  16. Experimental study of the isovector giant dipole resonance in 80Zr and 81Rb

    Science.gov (United States)

    Ceruti, S.; Camera, F.; Bracco, A.; Mentana, A.; Avigo, R.; Benzoni, G.; Blasi, N.; Bocchi, G.; Bottoni, S.; Brambilla, S.; Crespi, F. C. L.; Giaz, A.; Leoni, S.; Million, B.; Morales, A. I.; Nicolini, R.; Pellegri, L.; Riboldi, S.; Wieland, O.; Bazzacco, D.; Ciemala, M.; Farnea, E.; Gottardo, A.; Kmiecik, M.; Maj, A.; Mengoni, D.; Michelagnoli, C.; Modamio, V.; Montanari, D.; Napoli, D.; Recchia, F.; Sahin, E.; Ur, C.; Valiente-Dobón, J. J.; Wasilewska, B.; Zieblinski, M.

    2017-01-01

    The isovector giant dipole resonance (IVGDR) γ decay was measured in the compound nuclei 80Zr and 81Rb at an excitation energy of E*=54 MeV. The fusion reaction 40Ca+40Ca at Ebeam=136 MeV was used to form the compound nucleus 80Zr, while the reaction 37Cl+44Ca at Ebeam=95 MeV was used to form the compound nucleus 81Rb at the same excitation energy. The IVGDR parameters extracted from the analysis were compared with the ones found at higher excitation energy (E*=83 MeV). The comparison allows one to observe two different nuclear mechanisms: (i) the IVGDR intrinsic width remains constant with the excitation energy in the nucleus 81Rb; (ii) the isospin-violating spreading width (i.e., Coulomb spreading width) remains constant with the excitation energy in the nucleus 80Zr. The experimental setup used for the γ -ray detection was composed by the AGATA demonstrator array coupled to the large-volume LaBr3:Ce detectors of the HECTOR+ array.

  17. Signature of clustering in quantum many-body systems probed by the giant dipole resonance

    Science.gov (United States)

    Pandit, Deepak; Mondal, Debasish; Dey, Balaram; Bhattacharya, Srijit; Mukhopadhyay, S.; Pal, Surajit; De, A.; Banerjee, S. R.

    2017-03-01

    The present experimental study illustrates how large deformations attained by nuclei due to cluster formation are perceived through the giant dipole resonance (GDR) strength function. The high energy GDR γ rays have been measured from 32S at different angular momenta (J ) but similar temperatures in the reactions 4He(Elab=45 MeV )+28Si and 20Ne(Elab=145 MeV )+12C . The experimental data at lower J (˜10 ℏ ) suggests a normal deformation, similar to the ground state value, showing no potential signature of clustering. However, it is found that the GDR lineshape is fragmented into two prominent peaks at high J (˜20 ℏ ) providing a direct measurement of the large deformation developed in the nucleus. The observed lineshape is also completely different from the ones seen for Jacobi shape transition at high J pointing towards the formation of cluster structure in superdeformed states of 32S at such high spin. Thus, the GDR can be regarded as a unique tool to study cluster formation at high excitation energies and angular momenta.

  18. Quenching of the Giant Dipole Resonance Strength at High Excitation Energy

    Energy Technology Data Exchange (ETDEWEB)

    Santonocito, D. [INFN - Laboratori Nazionali del Sud, via S. Sofia 62, I-95123 Catania (Italy); Blumenfeld, Y. [Institut de Physique Nucleaire, IN2P3-CNRS, F-91406 Orsay (France); Agodi, C. [INFN - Laboratori Nazionali del Sud, via S. Sofia 62, I-95123 Catania (Italy); Alba, R. [INFN - Laboratori Nazionali del Sud, via S. Sofia 62, I-95123 Catania (Italy); Bellia, G. [INFN - Laboratori Nazionali del Sud, via S. Sofia 62, I-95123 Catania (Italy); Dipartimento di Fisica e Astronomia dell' Universita di Catania, via S. Sofia 64, I-95123 Catania (Italy); Coniglione, R. [INFN - Laboratori Nazionali del Sud, via S. Sofia 62, I-95123 Catania (Italy); Delaunay, F. [Institut de Physique Nucleaire, IN2P3-CNRS, F-91406 Orsay (France); Del Zoppo, A. [INFN - Laboratori Nazionali del Sud, via S. Sofia 62, I-95123 Catania (Italy); Finocchiaro, P. [INFN - Laboratori Nazionali del Sud, via S. Sofia 62, I-95123 Catania (Italy); Frascaria, N. [Institut de Physique Nucleaire, IN2P3-CNRS, F-91406 Orsay (France); Hongmei, F. [INFN - Laboratori Nazionali del Sud, via S. Sofia 62, I-95123 Catania (Italy); Lima, V. [Institut de Physique Nucleaire, IN2P3-CNRS, F-91406 Orsay (France); Maiolino, C. [INFN - Laboratori Nazionali del Sud, via S. Sofia 62, I-95123 Catania (Italy); Migneco, E. [INFN - Laboratori Nazionali del Sud, via S. Sofia 62, I-95123 Catania (Italy); Dipartimento di Fisica e Astronomia dell' Universita di Catania, via S. Sofia 64, I-95123 Catania (Italy); Piattelli, P. [INFN - Laboratori Nazionali del Sud, via S. Sofia 62, I-95123 Catania (Italy); Sapienza, P. [INFN - Laboratori Nazionali del Sud, via S. Sofia 62, I-95123 Catania (Italy); Scarpaci, J.A. [Institut de Physique Nucleaire, IN2P3-CNRS, F-91406 Orsay (France)

    2007-05-15

    The evolution with excitation energy of the Giant Dipole Resonance features in nuclei of mass A{approx}108-136 is reviewed. We first discuss the results of the experiments performed with MEDEA studying the GDR gamma decay from hot nuclei populated at excitation energies above 300 MeV. The focus of the paper is on the excitation energy region between 160 and 290 MeV. This region has been investigated through the study of the reactions {sup 116}Sn + {sup 12}C at 17 and 23A MeV, and {sup 116}Sn + {sup 24}Mg at 17A MeV. Gamma-rays were detected using MEDEA in coincidence with evaporation residues detected in MACISTE. The analysis of the gamma-ray spectra and their comparison with statistical calculations are presented. The comparison with {gamma}-ray spectra from the reaction {sup 36}Ar + {sup 98}Mo at higher excitation energies shows a coherent scenario where a progressive reduction of {gamma} multiplicity relative to predictions for 100% of the Energy Weighted Sum Rule is observed above 200 MeV excitation energy. Finally, the existence of a link between disappearance of collective motion and the liquid-gas phase transitions is discussed.

  19. Thermal shape fluctuation model study of the giant dipole resonance in $^{152}$Gd

    CERN Document Server

    Kumar, A K Rhine

    2015-01-01

    We have studied the giant dipole resonance (GDR) in the hot and rotating nucleus $^{152}$Gd within the framework of thermal shape fluctuation model (TSFM) built on the microscopic-macroscopic calculations of the free energies with a macroscopic approach for the GDR. Our results for GDR cross sections are in good agreement with the experimental values except for a component peaking around 17 MeV where the data has large uncertainties. Such a component is beyond our description which properly takes care of the splitting of GDR components due to the deformation and Coriolis effects. Around this 17 MeV lies the half maximum in experimental cross sections, and hence the extracted GDR widths and deformations (estimated from these widths) turn out to be overestimated and less reliable. Reproducing these widths with empirical formulae could conceal the information contained in the cross sections. Fully microscopic GDR calculations and a more careful look at the data could be useful to understand the GDR component aro...

  20. Microscopic Study of the Isoscalar Giant Monopole Resonance in Cd, Sn and Pb Isotopes

    CERN Document Server

    Cao, Li-Gang; Colo, G

    2012-01-01

    The isoscalar giant monopole resonance (ISGMR) in Cd, Sn and Pb isotopes has been studied within the self-consistent Skyrme Hartree-Fock+BCS and quasi-particle random phase approximation (QRPA). Three Skyrme parameter sets are used in the calculations, i.e., SLy5, SkM* and SkP, since they are characterized by different values of the compression modulus in symmetric nuclear matter, namely K=230, 217, and 202 MeV, respectively. We also investigate the effect of different types of pairing forces on the ISGMR in Cd, Sn and Pb isotopes. The calculated peak energies and the strength distributions of ISGMR are compared with available experimental data. We find that SkP fails completely to describe the ISGMR strength distribution for all isotopes due to its low value of the nuclear matter incompressibility, namely K=202 MeV. On the other hand, the SLy5 parameter set, supplemented by an appropriate pairing interaction, gives a reasonable description of the ISGMR in Cd and Pb isotopes. A better description of ISGMR in ...

  1. Neutron-skin thickness from the study of the antianalog giant dipole resonance

    CERN Document Server

    Krasznahorkay, A; Csatlós, M; Algora, A; Gulyás, J; Timár, J; Paar, N; Vretenar, D; Boretzky, K; Heil, M; Litvinov, Yu A; Rossi, D; Scheidenberger, C; Simon, H; Weick, H; Bracco, A; Brambilla, S; Blasi, N; Camera, F; Giaz, A; Million, B; Pellegri, L; Riboldi, S; Wieland, O; Altstadt, S; Fonseca, M; Glorius, J; Göbel, K; Heftrich, T; Koloczek, A; Kräckmann, S; Langer, C; Plag, R; Pohl, M; Rastrepina, G; Reifarth, R; Schmidt, S; Sonnabend, K; Weigand, M; Harakeh, M N; Kalantar-Nayestanaki, N; Rigollet, C; Bagchi, S; Najafi, M A; Aumann, T; Atar, L; Heine, M; Holl, M; Movsesyan, A; Schrock, P; Volkov, V; Wamers, F; Fiori, E; Löher, B; Marganiec, J; Savaran, D; Johansson, H T; Fernández, P Diaz; Garg, U; Balabanski, D L

    2012-01-01

    The gamma-decay of the anti-analog of the giant dipole resonance (AGDR) has been measured to the isobaric analog state excited in the p(124Sn,n) reaction at a beam energy of 600 MeV/nucleon. The energy of the transition was also calculated with state-of-the-art self-consistent random-phase approximation (RPA) and turned out to be very sensitive to the neutron-skin thickness (\\DeltaR_(pn)). By comparing the theoretical results with the measured one, the \\DeltaR_(pn) value for 124Sn was deduced to be 0.18 \\pm 0.02 fm, which agrees well with the previous results. The energy of the AGDR measured previously for ^(208)Pb was also used to determine the \\DeltaR_(pn) for ^(208)Pb. In this way a very precise \\DeltaR_(pn) = 0.18 \\pm 0.02 neutron-skin thickness has been obtained for 208Pb. The present method offers new possibilities for measuring the neutron-skin thicknesses of very exotic isotopes.

  2. Excitation of giant monopole resonance in {sup 208}Pb and {sup 116}Sn using inelastic deuteron scattering

    Energy Technology Data Exchange (ETDEWEB)

    Patel, D.; Garg, U. [Department of Physics, University of Notre Dame, Notre Dame, IN 46556 (United States); Joint Institute for Nuclear Astrophysics, University of Notre Dame, Notre Dame, IN 46556 (United States); Itoh, M. [Cyclotron and Radioisotope Center, Tohoku University, Sendai 980-8578 (Japan); Akimune, H. [Department of Physics, Konan University, Kobe 568-8501 (Japan); Berg, G.P.A. [Department of Physics, University of Notre Dame, Notre Dame, IN 46556 (United States); Joint Institute for Nuclear Astrophysics, University of Notre Dame, Notre Dame, IN 46556 (United States); Fujiwara, M. [Research Center for Nuclear Physics, Osaka University, Osaka 567-0047 (Japan); Harakeh, M.N. [Kernfysisch Versneller Instituut, University of Groningen, 9747 AA Groningen (Netherlands); GANIL, CEA/DSM-CNRS/IN2P3, 14076 Caen (France); Iwamoto, C. [Department of Physics, Konan University, Kobe 568-8501 (Japan); Kawabata, T. [Division of Physics and Astronomy, Kyoto University, Kyoto 606-8502 (Japan); Kawase, K. [Japan Atomic Energy Agency, Kyoto 619-0215 (Japan); Matta, J.T. [Department of Physics, University of Notre Dame, Notre Dame, IN 46556 (United States); Joint Institute for Nuclear Astrophysics, University of Notre Dame, Notre Dame, IN 46556 (United States); Murakami, T. [Division of Physics and Astronomy, Kyoto University, Kyoto 606-8502 (Japan); Okamoto, A. [Department of Physics, Konan University, Kobe 568-8501 (Japan); Sako, T. [Japan Atomic Energy Agency, Kyoto 619-0215 (Japan); Schlax, K.W. [Department of Physics, University of Notre Dame, Notre Dame, IN 46556 (United States); Takahashi, F. [Research Center for Nuclear Physics, Osaka University, Osaka 567-0047 (Japan); White, M. [Department of Physics, University of Notre Dame, Notre Dame, IN 46556 (United States); Yosoi, M. [Research Center for Nuclear Physics, Osaka University, Osaka 567-0047 (Japan)

    2014-07-30

    The excitation of the isoscalar giant monopole resonance (ISGMR) in {sup 208}Pb and {sup 116}Sn has been investigated using small-angle (including 0°) inelastic scattering of 100 MeV/u deuteron and multipole-decomposition analysis (MDA). The extracted strength distributions agree well with those from inelastic scattering of 100 MeV/u α particles. These measurements establish deuteron inelastic scattering at E{sub d}∼100 MeV/u as a suitable probe for extraction of the ISGMR strength with MDA, making feasible the investigation of this resonance in radioactive isotopes in inverse kinematics.

  3. Finite amplitude method applied to the giant dipole resonance in heavy rare-earth nuclei

    Science.gov (United States)

    Oishi, Tomohiro; Kortelainen, Markus; Hinohara, Nobuo

    2016-03-01

    Background: The quasiparticle random phase approximation (QRPA), within the framework of nuclear density functional theory (DFT), has been a standard tool to access the collective excitations of atomic nuclei. Recently, the finite amplitude method (FAM) was developed in order to perform the QRPA calculations efficiently without any truncation on the two-quasiparticle model space. Purpose: We discuss the nuclear giant dipole resonance (GDR) in heavy rare-earth isotopes, for which the conventional matrix diagonalization of the QRPA is numerically demanding. A role of the Thomas-Reiche-Kuhn (TRK) sum rule enhancement factor, connected to the isovector effective mass, is also investigated. Methods: The electric dipole photoabsorption cross section was calculated within a parallelized FAM-QRPA scheme. We employed the Skyrme energy density functional self-consistently in the DFT calculation for the ground states and FAM-QRPA calculation for the excitations. Results: The mean GDR frequency and width are mostly reproduced with the FAM-QRPA, when compared to experimental data, although some deficiency is observed with isotopes heavier than erbium. A role of the TRK enhancement factor in actual GDR strength is clearly shown: its increment leads to a shift of the GDR strength to higher-energy region, without a significant change in the transition amplitudes. Conclusions: The newly developed FAM-QRPA scheme shows remarkable efficiency, which enables one to perform systematic analysis of GDR for heavy rare-earth nuclei. The theoretical deficiency of the photoabsorption cross section could not be improved by only adjusting the TRK enhancement factor, suggesting the necessity of an approach beyond self-consistent QRPA and/or a more systematic optimization of the energy density functional (EDF) parameters.

  4. Evolution of giant dipole resonance width at low temperatures – New perspectives

    Indian Academy of Sciences (India)

    S Mukhopadhyay

    2014-05-01

    High energy photons from the decay of giant dipole resonances (GDR) built on excited states provide an excellent probe in the study of nuclear structure properties, damping mechanisms etc., at finite temperatures. The dependence of GDR width on temperature () and angular momentum () has been the prime focus of many experimental and theoretical studies for the last few decades. The measured GDR widths for a wide range of nuclei at temperatures (1.5 < < 2.5 MeV) and spins (upto fission limit) were well described by the thermal shape fluctuation model (TSFM). But, at low temperatures ( < 1.5 MeV) there are large discrepancies between the existing theoretical models. The problem is compounded as there are very few experimental data in this region. At Variable Energy Cyclotron Centre, Kolkata, a programme for the systematic measurement of GDR width at very low temperatures has been initiated with precise experimental techniques. Several experiments have been performed by bombarding 7–12 MeV/nucleon alpha beam on various targets (63Cu, 115In and 197Au) and new datasets have been obtained at low temperatures ( < 1.5MeV) and at very lowspins ( < 20$\\hbar$). The TSFM completely fails to represent the experimental data at these low temperatures in the entire mass range. In fact, the GDR width appears to be constant at its ground state value until a critical temperature is reached and subsequently increases thereafter, whereas the TSFM predicts a gradual increase of GDR width from its ground state value for > 0 MeV. In order to explain this discrepancy at low , a new formalism has been put forward by including GDR-induced quadrupole moment in the TSFM.

  5. Isoscalar monopole and dipole excitations of cluster states and giant resonances in 12C

    Science.gov (United States)

    Kanada-En'yo, Yoshiko

    2016-05-01

    The isoscalar monopole (ISM) and dipole (ISD) excitations in 12C are investigated theoretically with the shifted antisymmetrized molecular dynamics (AMD) plus 3 α -cluster generator coordinate method (GCM). The small-amplitude vibration modes are described by coherent one-particle one-hole excitations expressed by a small shift of single-nucleon Gaussian wave functions within the AMD framework, whereas the large-amplitude cluster modes are incorporated by superposing 3 α -cluster wave functions in the GCM. The coupling of the excitations in the intrinsic frame with the rotation and parity transformation is taken into account microscopically by the angular-momentum and parity projections. The present a calculation that describes the ISM and ISD excitations over a wide energy region covering cluster modes in the low-energy region and the giant resonances in the high-energy region, although the quantitative description of the high-energy part is not satisfactory. The low-energy ISM and ISD strengths of the cluster modes are enhanced by the distance motion between α clusters, and they split into a couple of states because of the angular motion of α clusters. The low-energy ISM strengths exhaust 26% of the energy-weighted sum rule, which is consistent with the experimental data for the 12C(02+; 7.65 MeV) and 12C(03+; 10.3 MeV) measured by (e ,e') ,(α ,α') , and (6Li,6Li' ) scatterings. In the calculated low-energy ISD strengths, two 1- states (the 11- and 12- states) with the significant strengths are obtained over E =10 -15 MeV. The results indicate that the ISD excitations can be a good probe to experimentally search for new cluster states such as the 12C(12-) obtained in the present calculation.

  6. Giant Kondo Resonance of Parallel-Coupled Double Quantum Dots Embedded in an A-B Ring

    Institute of Scientific and Technical Information of China (English)

    CHEN Xiong-Wen; HE Da-Jiang; SONG Ke-Hui; WU Shao-Quan

    2006-01-01

    We theoretically study the properties of the ground state of the parallel-coupled double quantum dots embedded in a mesoscopic ring in the Kondo regime by means of the two-impurity Anderson Hamiltonian. The Hamiltonian is solved by means of the slave-boson mean-field theory. We find that in this system, the persistent current depends sensitively on both the parity of this system and the size of the ring. In the strong coupling regime, the giant sharp current peak appears, at the same time, the parity dependence of the persistent current disappears. These imply that in the strong coupling regime, there exists giant Kondo resonance and the two dots can be coupled coherently. Thus this system might be a candidate for future device applications.

  7. EXCITATION OF GIANT-RESONANCES IN PB-208, SN-120, ZR-90 AND NI-60 BY 84 MEV/NUCLEON O-17 IONS

    NARCIS (Netherlands)

    NETO, RL; ROUSSELCHOMAZ, P; ROCHAIS, L; ALAMANOS, N; AUGER, F; GASTEBOIS, J; GILLIBERT, A; LACEY, R; MICZAIKA, A; PIERROUTSAKOU, D; BARRETTE, J; MARK, SK; TURCOTTE, R; BLUMENFELD, Y; FRASCARIA, N; GARRON, JP; ROYNETTE, JC; SCARPACI, JA; SUOMIJARVI, T; VANDERWOUDE, A; VANDENBERG, AM

    1993-01-01

    Elastic and inelastic scattering of 1435 MeV 170 ions on Pb-208, Sn-120, Zr-90 and Ni-60 have been measured. Hindrance in the excitation of the first 3- states is observed. Parameters of the isoscalar giant monopole and quadrupole resonances are obtained. The quadrupole resonance exhausts approximat

  8. A microscopic particle-vibration coupling approach for atomic nuclei. Giant resonance properties and the renormalization of the effective interaction

    CERN Document Server

    Brenna, Marco

    2014-01-01

    The self-consistent mean-field (SCMF) theory describes many properties of the ground state and excited states of the atomic nucleus, such as masses, radii, deformations and giant resonance energies. SCMF models are based on the independent particle picture where nucleons are assumed to move in a self-generated average potential. In the first part of this work, we apply a state-of-the-art SCMF approach, based on the Skyrme effective interaction, to two different excitations (viz. the pygmy dipole resonance and the isovector giant quadrupole resonance), investigating their relation with the nuclear matter symmetry energy, which corresponds to the energy cost for changing protons into neutrons and is a key parameter for the nuclear equation of state. However, SCMF models present well known limitations which require the inclusion of further dynamical correlations, e.g. the ones coming from the interweaving between single-particle and collective degrees of freedom (particle-vibration coupling - PVC). In the second...

  9. Photovoltage detection of edge magnetoplasmon oscillations and giant magnetoplasmon resonances in a two-dimensional hole system

    Science.gov (United States)

    Mi, Jian; Wang, Jianli; Pfeiffer, L. N.; West, K. W.; Baldwin, K. W.; Zhang, Chi

    2016-09-01

    In our high mobility p -type AlGaAs/GaAs two-dimensional hole samples, we originally observe the B -periodic oscillation induced by microwave (MW) in photovoltage (PV) measurements. In the frequency range of our measurements (5-40 GHz), the period (Δ B ) is inversely proportional to the microwave frequency (f ). The distinct oscillations come from the edge magnetoplasmon (EMP) in the high quality heavy hole system. Simultaneously, we observe the giant plasmon resonance signals in our measurements on the shallow two-dimensional hole system (2DHS).

  10. Attosecond time delay in the photoionization of Mn in the $3p \\rightarrow 3d$ giant resonance region

    CERN Document Server

    Dolmatov, V K; Deshmukh, P C; Manson, S T

    2014-01-01

    The dramatic effect of the $3p \\rightarrow 3d$ giant autoionization resonance on time delay of photoemission from the $3d$ and $4s$ valence subshells of the Mn atom is unraveled. Strong sensitivity of the time delay of the $4s$ photoemission to the final-state term of the ion-remainder [${\\rm Mn^{+}}(4s^{1},$$^{5}S)$ vs. ${\\rm Mn^{+}}(4s^{1},$$^{7}S)$] is discovered. The features of time delay uncovered in Mn photoionization are expected to be general properties of transition-metal atoms and ions. The "spin-polarized" random phase approximation with exchange was employed in the study.

  11. Giant Dipole Resonance in the Hot and Thermalized Ce132 Nucleus: Damping of Collective Modes at Finite Temperature

    Science.gov (United States)

    Wieland, O.; Bracco, A.; Camera, F.; Benzoni, G.; Blasi, N.; Brambilla, S.; Crespi, F.; Giussani, A.; Leoni, S.; Mason, P.; Million, B.; Moroni, A.; Barlini, S.; Kravchuk, V. L.; Gramegna, F.; Lanchais, A.; Mastinu, P.; Maj, A.; Brekiesz, M.; Kmiecik, M.; Bruno, M.; Geraci, E.; Vannini, G.; Casini, G.; Chiari, M.; Nannini, A.; Ordine, A.; Ormand, E.

    2006-07-01

    The γ decay of the giant dipole resonance (GDR) in the Ce132 compound nucleus with temperature up to ≈4MeV has been measured, using the reaction Ni64+Zn68 at Ebeam=300, 400, and 500 MeV. The γ and charged particles measured in coincidence with recoils are consistent with a fully equilibrated compound nucleus emission. The GDR width, obtained with the statistical model analysis, is found to increase almost linearly with temperature. This increase is rather well reproduced within a model including thermal shape fluctuations and the lifetime of the compound nucleus.

  12. Measurement of the Am241(γ,n)Am240 reaction in the giant dipole resonance region

    Science.gov (United States)

    Tonchev, A. P.; Hammond, S. L.; Howell, C. R.; Huibregtse, C.; Hutcheson, A.; Kelley, J. H.; Kwan, E.; Raut, R.; Rusev, G.; Tornow, W.; Kawano, T.; Vieira, D. J.; Wilhelmy, J. B.

    2010-11-01

    The photodisintegration cross section of the radioactive nucleus Am241 has been obtained using activation techniques and monoenergetic γ-ray beams from the HIγS facility. The induced activity of Am240 produced via the Am241(γ,n) reaction was measured in the energy interval from 9 to 16 MeV utilizing high-resolution γ-ray spectroscopy. The experimental data for the Am241(γ,n) reaction in the giant dipole resonance energy region are compared with statistical nuclear-model calculations.

  13. Giant fibroma in the left ventricle of an infant: imaging findings in magnetic resonance imaging, echocardiography and angiography

    Energy Technology Data Exchange (ETDEWEB)

    Gutberlet, Matthias; Felix, Roland [Department of Radiology and Nuclear Medicine, Charite, Campus Virchow-Klinikum, Augustenburger Platz 1, 13353 Berlin (Germany); Abdul-Khaliq, Hashim; Stiller, Brigitte; Schubert, Ulf; Lange, Peter E. [Department of Pediatric Cardiology, Deutsches Herzzentrum, Berlin (Germany); Stoltenburg-Didinger, Gisela [Department of Neuropathology, Free University Berlin, Berlin (Germany); Hetzer, Roland [Department of Cardio-, Thoracic and Vascular Surgery, Deutsches Herzzentrum Berlin (Germany)

    2002-07-01

    The diagnosis of a rare case of giant intraventricular fibroma in an infant by MRI in comparison with other imaging modalities, such as echocardiography and angiography, is discussed. For preoperative planning only MRI showed the myocardial infiltration. The myocardial blood supply of the tumor could be evaluated qualitatively by contrast-enhanced MRI, but the direct visualization of the distally located branches could only be assessed by coronary angiography. Magnetic resonance coronary angiography using the navigator technique failed to depict the distal part of the coronaries. The obstruction of the left ventricle outflow tract could be assessed and quantified by all imaging modalities. (orig.)

  14. A SECOND GIANT PLANET IN 3:2 MEAN-MOTION RESONANCE IN THE HD 204313 SYSTEM

    Energy Technology Data Exchange (ETDEWEB)

    Robertson, Paul; Endl, Michael; Cochran, William D.; MacQueen, Phillip J.; Brugamyer, Erik J.; Barnes, Stuart I.; Caldwell, Caroline [Department of Astronomy and McDonald Observatory, University of Texas at Austin, Austin, TX 78712 (United States); Horner, J.; Wittenmyer, Robert A. [Department of Astrophysics and Optics, School of Physics, University of New South Wales, Sydney, NSW 2052 (Australia); Simon, Attila E., E-mail: paul@astro.as.utexas.edu [Konkoly Observatory of the Hungarian Academy of Sciences, P.O. Box 67, H-1525 Budapest (Hungary)

    2012-07-20

    We present eight years of high-precision radial velocity (RV) data for HD 204313 from the 2.7 m Harlan J. Smith Telescope at McDonald Observatory. The star is known to have a giant planet (Msin i = 3.5 M{sub J} ) on a {approx}1900 day orbit, and a Neptune-mass planet at 0.2 AU. Using our own data in combination with the published CORALIE RVs of Segransan et al., we discover an outer Jovian (Msin i = 1.6 M{sub J} ) planet with P {approx} 2800 days. Our orbital fit suggests that the planets are in a 3:2 mean motion resonance, which would potentially affect their stability. We perform a detailed stability analysis and verify that the planets must be in resonance.

  15. Using Schumann Resonance Measurements for Constraining the Water Abundance on the Giant Planets - Implications for the Solar System Formation

    Science.gov (United States)

    Simoes, Fernando; Pfaff, Robert; Hamelin, Michel; Klenzing, Jeffrey; Freudenreich, Henry; Beghin, Christian; Berthelier, Jean-Jacques; Bromund, Kenneth; Grard, Rejean; Lebreton, Jean-Pierre; Martin, Steven; Rowland, Douglas; Sentman, Davis; Takahashi, Yukihiro; Yair, Yoav

    2012-01-01

    The formation and evolution of the Solar System is closely related to the abundance of volatiles, namely water, ammonia, and methane in the protoplanetary disk. Accurate measurement of volatiles in the Solar System is therefore important to understand not only the nebular hypothesis and origin of life but also planetary cosmogony as a whole. In this work, we propose a new, remote sensing technique to infer the outer planets water content by measuring Tremendously and Extremely Low Frequency (TLF-ELF) electromagnetic wave characteristics (Schumann resonances) excited by lightning in their gaseous envelopes. Schumann resonance detection can be potentially used for constraining the uncertainty of volatiles of the giant planets, mainly Uranus and Neptune, because such TLF-ELF wave signatures are closely related to the electric conductivity profile and water content.

  16. How the presence of a gas giant affects the formation of mean-motion resonances between two low-mass planets in a locally isothermal gaseous disc

    CERN Document Server

    Podlewska-Gaca, Edyta

    2013-01-01

    In this paper we investigate the possibility of a migration-induced resonance locking in systems containing three planets, namely an Earth analog, a super-Earth and a gas giant. The planets have been listed in order of increasing orbital periods. All three bodies are embedded in a locally isothermal gaseous disc and orbit around a solar mass star. We are interested in answering the following question: Will the low-mass planets form the same resonant structures with each other in the vicinity of the gas giant as in the case when the gas giant is absent? When there is no gas giant in the system, it has been already shown that if the two low-mass planets undergo a convergent differential migration, they will capture each other in a mean-motion resonance. For the choices of disc parameters and planet masses made in this paper, the formation of the 5:4 resonance in the absence of the Jupiter has been observed. In this work we add a gas giant on the most external orbit of the system in such a way that its different...

  17. Giant dipole resonance built on hot rotating nuclei produced during evaporation of light particles from the 88Mo compound nucleus

    Science.gov (United States)

    Ciemała, M.; Kmiecik, M.; Maj, A.; Mazurek, K.; Bracco, A.; Kravchuk, V. L.; Casini, G.; Barlini, S.; Baiocco, G.; Bardelli, L.; Bednarczyk, P.; Benzoni, G.; Bini, M.; Blasi, N.; Brambilla, S.; Bruno, M.; Camera, F.; Carboni, S.; Cinausero, M.; Chbihi, A.; Chiari, M.; Corsi, A.; Crespi, F. C. L.; D'Agostino, M.; Degerlier, M.; Fornal, B.; Giaz, A.; Gramegna, F.; Krzysiek, M.; Leoni, S.; Marchi, T.; Matejska-Minda, M.; Mazumdar, I.; Meczyński, W.; Million, B.; Montanari, D.; Morelli, L.; Myalski, S.; Nannini, A.; Nicolini, R.; Pasquali, G.; Piantelli, S.; Prete, G.; Roberts, O. J.; Schmitt, Ch.; Styczeń, J.; Szpak, B.; Valdré, S.; Wasilewska, B.; Wieland, O.; Wieleczko, J. P.; Ziebliński, M.; Dudek, J.; Dinh Dang, N.

    2015-05-01

    High-energy giant dipole resonance (GDR) γ rays were measured following the decay of the hot, rotating compound nucleus of 88Mo, produced at excitation energies of 124 and 261 MeV. The reaction 48Ti + 40Ca at 300 and 600 MeV bombarding energies has been used. The data were analyzed using the statistical model Monte Carlo code gemini++. It allowed extracting the giant dipole resonance parameters by fitting the high-energy γ -ray spectra. The extracted GDR widths were compared with the available data at lower excitation energy and with theoretical predictions based on (i) The Lublin-Strasbourg drop macroscopic model, supplemented with thermal shape fluctuations analysis, and (ii) The phonon damping model. The theoretical predictions were convoluted with the population matrices of evaporated nuclei from the statistical model gemini++. Also a comparison with the results of a phenomenological expression based on the existing systematics, mainly for lower temperature data, is presented and discussed. A possible onset of a saturation of the GDR width was observed around T =3 MeV.

  18. (. pi. sup +- ,. pi. sup +- prime N) reactions on sup 12 C and sup 208 Pb near the giant resonance region

    Energy Technology Data Exchange (ETDEWEB)

    Yoo, Sung Hoon.

    1990-05-01

    Angular distributions for the {sup 12}C({pi}{sup {plus minus}}, {pi}{sup {plus minus}}{prime} p) and {sup 208}Pb({pi}{sup {plus minus}}, {pi}{sup {plus minus}}{prime} p or n) reactions near the giant resonance region have been measured at T{sub {pi}} = 180 MeV, and found different between {pi}{sup +} and {pi}{sup {minus}} data. This observation is interpreted as evidence for different excitation mechanisms dominating the {pi}{sup {minus}}-nucleus and {pi}{sup +}-nucleus interactions in the giant resonance region of these targets. A comparison with the single-nucleon knock-out distorted-wave impulse approximation calculations shows, even though these calculations underestimate ({pi}{sup {plus minus}}, {pi}{sup {plus minus}}{prime} N) data for both targets, the dominance of direct process for ({pi}{sup +}, {pi}{sup {plus}}{prime} p) or ({pi}{sup {minus}}, {pi}{sup {minus}}{prime} n) in contrast to ({pi}{sup {minus}}, {pi}{sup {minus}}{prime} p) or ({pi}{sup +}, {pi}{sup +}{prime} n). In the ({pi}{sup +}, {pi}{sup +}{prime} p) reaction proton-proton hole states are excited directly and appear to have a large probability for direct decay with escape width, whereas in ({pi}{sup {minus}}, {pi}{sup {minus}}{prime} p) the preferentially excited neutron-neutron hole doorway states couple to resonance states and decay with spreading width. This interpretation led us to suggest that the ratio of cross-sections for inelastic scattering to the giant resonance region should be written in terms of an incoherent sum of cross-sections to neutron and proton doorway states. In a heavy nucleus such as {sup 208}Pb, neutron and proton doorway states. In a heavy nucleus such as {sup 208}Pb, neutron and proton doorway states contribute incoherently because the different decay processes do not populate the same final states of the residual nucleus.

  19. How the presence of a gas giant affects the formation of mean-motion resonances between two low-mass planets in a locally isothermal gaseous disc

    Science.gov (United States)

    Podlewska-Gaca, E.; Szuszkiewicz, E.

    2014-03-01

    In this paper we investigate the possibility of a migration-induced resonance locking in systems containing three planets, namely an Earth analogue (1 M⊕), a super-Earth (4 M⊕) and a gas giant (one Jupiter mass). The planets have been listed in order of increasing orbital periods. All three bodies are embedded in a locally isothermal gaseous disc and orbit around a solar mass star. We are interested in answering the following questions: will the low-mass planets form the same resonant structures with each other in the vicinity of the gas giant as in the case when the gas giant is absent? More in general, how will the presence of the gas giant affect the evolution of the two low-mass planets? When there is no gas giant in the system, it has been already shown that if the two low-mass planets undergo a convergent differential migration, they will capture each other in a mean-motion resonance. For the choices of disc parameters and planet masses made in this paper, the formation of the 5:4 resonance in the absence of the Jupiter has been observed in a previous investigation and confirmed here. In this work we add a gas giant on the most external orbit of the system in such a way that its differential migration is convergent with the low-mass planets. We show that the result of this set-up is the speeding up of the migration of the super-Earth and, after that, all three planets become locked in a triple mean-motion resonance. However, this resonance is not maintained due to the low-mass planet eccentricity excitation, a fact that leads to close encounters between planets and eventually to the ejection from the internal orbits of one or both low-mass planets. We have observed that the ejected low-mass planets can leave the system, fall into a star or become the external planet relative to the gas giant. In our simulations the latter situation has been observed for the super-Earth. It follows from the results presented here that the presence of a Jupiter-like planet

  20. Axial symmetry around the recoil axis for the 238U(α, α'f) reaction and the fission probability in the giant resonance region

    NARCIS (Netherlands)

    Leo, R. de; Harakeh, M.N.; Micheletti, S.; Plicht, J. van der; van der Woude, Adriaan; David, P.; Janszen, H.

    1982-01-01

    A measurement of the α-spectrum in the region of the isoscalar giant resonances from 238U at Eα = 120 MeV in coincidence with out-of-plane fission fragments shows the validity of the hypothesis of axial symmetry with respect to the recoil axis. Similar to what was observed in previous in-plane

  1. Giant dipole resonance in 88Mo from phonon damping model strength functions averaged over temperature and angular momentum distributions

    Science.gov (United States)

    Dinh Dang, N.; Ciemala, M.; Kmiecik, M.; Maj, A.

    2013-05-01

    The line shapes of giant dipole resonance (GDR) in the decay of the compound nucleus 88Mo, which is formed after the fusion-evaporation reaction 48Ti + 40Ca at various excitation energies E* from 58 to 308 MeV, are generated by averaging the GDR strength functions predicted within the phonon damping model (PDM) using the empirical probabilities for temperature and angular momentum. The average strength functions are compared with the PDM strength functions calculated at the mean temperature and mean angular momentum, which are obtained by averaging the values of temperature and angular momentum using the same temperature and angular momentum probability distributions, respectively. It is seen that these two ways of generating the GDR linear line shape yield very similar results. It is also shown that the GDR width approaches a saturation at angular momentum J≥ 50 ℏ at T=4 MeV and at J≥ 70 ℏ at any T.

  2. Giant dipole resonance in $^{88}$Mo from phonon damping model's strength functions averaged over temperature and angular momentum distributions

    CERN Document Server

    Dang, N Dinh; Kmiecik, M; Maj, A

    2013-01-01

    The line shapes of giant dipole resonance (GDR) in the decay of the compound nucleus $^{88}$Mo, which is formed after the fusion-evaporation reaction $^{48}$Ti + $^{40}$Ca at various excitation energies $E^{*}$ from 58 to 308 MeV, are generated by averaging the GDR strength functions predicted within the phonon damping model (PDM) using the empirical probabilities for temperature and angular momentum. The average strength functions are compared with the PDM strength functions calculated at the mean temperature and mean angular momentum, which are obtained by averaging the values of temperature and angular momentum using the same temperature and angular-momentum probability distributions, respectively. It is seen that these two ways of generating the GDR linear line shape yield very similar results. It is also shown that the GDR width approaches a saturation at angular momentum $J\\geq$ 50$\\hbar$ at $T=$ 4 MeV and at $J\\geq$ 70$\\hbar$ at any $T$.

  3. Effects of self-consistency violation in Hartree-Fock RPA calculations for nuclear giant resonances revisited

    CERN Document Server

    Sil, T; Reinhard, P G; Shlomo, S; Sil, Tapas

    2006-01-01

    We provide accurate assessments of the consequences of violations of self-consistency in Hartree-Fock (HF) based random phase approximation (RPA) calculations of the centroid energy $E_{cen}$ of isoscalar and isovector giant resonances of multi-polarities $L=0-3$ in a wide range of nuclei. This is done by carrying out highly accurate HF-RPA calculations neglecting the particle-hole (ph) spin-orbit or Coulomb interaction in the RPA and comparing with the fully self-consistent HF-RPA results. We find that the shifts in the value of $E_{cen}$ due to self-consistency violation associated with the spin-orbit and Coulomb interactions are comparable or larger than the current experimental errors in $E_{cen}$.

  4. Impact of giant resonant dispersion on the response of intracavity phase interferometry and laser gyros

    CERN Document Server

    Hendrie, James; Diels, Jean Claude; Arissian, Ladan

    2016-01-01

    Intracavity Phase Interferometry is a phase sensing technique using mode-locked lasers in which two intracavity pulses circulate. The beat frequency between the two output frequency combs is proportional to a phase shift to be measured. A laser gyro is a particular implementation of this device. The demonstrated sensitivity of $10^{-8}$ could be manipulated by applying a giant dispersion to each tooth of the comb. Such coupling is achieved with an intracavity etalon, resulting a large change in phase response of a ring laser. This change is shown to be unrelated to the average pulse velocity within the laser cavity.

  5. Studies of Pressure-Broadening of Alkali Atom Resonance Lines for Modeling Atmospheres of Extrasolar Giant Planets and Brown Dwarfs

    Science.gov (United States)

    Kirby, Kate; Babb, J.; Yoshino, K.

    2004-01-01

    In L-dwarfs and T-dwarfs the resonance lines of sodium and potassium are so profoundly pressure-broadened that their wings extend several hundred nanometers from line center. With accurate knowledge of the line profiles as a function of temperature and pressure: such lines can prove to be valuable diagnostics of the atmospheres of such objects. We have initiated a joint program of theoretical and experimental research to study the line-broadening of alkali atom resonance lines due to collisions with species such as helium and molecular hydrogen. Although potassium and sodium are the alkali species of most interest in the atmospheres of cool brown dwarfs and extrasolar giant planets, some of our theoretical focus this year has involved the calculation of pressure-broadening of lithium resonance lines by He, as a test of a newly developed suite of computer codes. In addition, theoretical calculations have been carried out to determine the leading long range van der Waals coefficients for the interactions of ground and excited alkali metal atoms with helium atoms, to within a probable error of 2%. Such data is important in determining the behavior of the resonance line profiles in the far wings. Important progress has been made on the experimental aspects of the program since the arrival of a postdoctoral fellow in September. A new absorption cell has been designed, which incorporates a number of technical improvements over the previous cell, including a larger cell diameter to enhance the signal, and fittings which allow for easier cleaning, thereby significantly reducing the instrument down-time.

  6. Atom Resonance Lines for Modeling Atmosphere: Studies of Pressure-Broadening of Alkali Atom Resonance Lines for Modeling Atmospheres of Extrasolar Giant Planets and Brown Dwarfs

    Science.gov (United States)

    Hasan, Hashima (Technical Monitor); Kirby, K.; Babb, J.; Yoshino, K.

    2005-01-01

    We report on progress made in a joint program of theoretical and experimental research to study the line-broadening of alkali atom resonance lines due to collisions with species such as helium and molecular hydrogen. Accurate knowledge of the line profiles of Na and K as a function of temperature and pressure will allow such lines to serve as valuable diagnostics of the atmospheres of brown dwarfs and extra-solar giant planets. A new experimental apparatus has been designed, built and tested over the past year, and we are poised to begin collecting data on the first system of interest, the potassium resonance lines perturbed by collisions with helium. On the theoretical front, calculations of line-broadening due to sodium collisions with helium are nearly complete, using accurate molecular potential energy curves and transition moments just recently computed for this system. In addition we have completed calculations of the three relevant potential energy curves and associated transition moments for K - He, using the MOLPRO quantum chemistry codes. Currently, calculations of the potential surfaces describing K-H2 are in progress.

  7. Improvements and Testing Practical Expressions for Photon Strength Functions of E1 Gamma-Transitions

    CERN Document Server

    Plujko, Vladimir; Kadenko, Igor; Solodovnyk, Kateryna

    2016-01-01

    Analytical expression for the E1 photon strength functions (PSF) is modified to account for the low-energy enhancement due to nuclear structure effects (presence of low-energy state (LES)). A closed-form expression of the E1 PSF function includes response of two nuclear states: LES and giant diplole resonance (GDR). Expression for the nuclear response function on electromagnetic field is based on a model of excitation of two coupled damped states. These approach is tested for different data sets for spherical nuclei. Impact on PSF shape of coupling between LES and GDR excitations is considered.

  8. Isomeric Yields Ratios in 120Te(γ,n)119m,gTe Reaction in the E1-GIANT Resonance Region

    Science.gov (United States)

    Mazur, V. M.; Symochko, D. M.; Bigan, Z. M.; Poltorzhytska, T. V.

    Isomeric state excitation in the 120Te(γ,n)119m,gTe reaction within the 10-20 MeV energy range has been studied with bremsstrahlung beams. Energy dependences of experimental isomeric yields ratios and reaction cross-sections have been obtained. Experimental results are compared with TALYS-1.2 calculations.

  9. THE ANGULAR-MOMENTUM DEPENDENCE OF THE GIANT-DIPOLE RESONANCE IN DY-154

    NARCIS (Netherlands)

    NOORMAN, RF; BACELAR, JC; HARAKEH, MN; HESSELINK, WHA; HOFMANN, HJ; Kalantar-Nayestanaki, Nasser; VANSCHAGEN, JPS; STOLK, A; SUJKOWSKI, Z; DEVOIGT, MJA; VANDERWOUDE, A

    1994-01-01

    The statistical gamma-ray decay of the compound nucleus 154Dy* formed at an excitation energy of 69 MeV is studied in three angular-momentum windows [J] = 31,42 and 50h. The GDR strength function extracted from the data indicates a constant centroid energy for the resonance E(GDR) = 15.2 +/- 0.5 MeV

  10. Giant Goos-Hänchen effect and Fano resonance at photonic crystal surfaces.

    Science.gov (United States)

    Soboleva, I V; Moskalenko, V V; Fedyanin, A A

    2012-03-23

    The Goos-Hänchen effect and Fano resonance are studied in photonic crystals that are considered Fourier counterparts in wave-vector-coordinate space. The Goos-Hänchen effect, which is enhanced by the excitation of Bloch surface electromagnetic waves, is visualized using far-field microscopy and measured at the surface of photonic crystals by angular spectroscopy. The maximal Goos-Hänchen shift is observed to be 66  μm.

  11. Constraints on the Neutron Skin and the Symmetry Energy from the Anti-analog Giant Dipole Resonance in 208Pb

    CERN Document Server

    Cao, L G; Colo', G; Sagawa, H

    2015-01-01

    We investigate the impact of the neutron-skin thickness Delta(R) on the energy difference between the anti-analog giant dipole resonance (AGDR), E(AGDR), and the isobaric analog state (IAS), E(IAS), in a heavy nucleus such as 208Pb. For guidance, we first develop a simple and analytic, yet physical, approach based on the Droplet Model that linearly connects the energy difference E(AGDR)-E(IAS) with Delta(R). To test this correlation on more fundamental grounds, we employ a family of systematically varied Skyrme energy density functionals where variations on the value of the symmetry energy at saturation density J are explored. The calculations have been performed within the fully self consistent Hartree-Fock (HF) plus charge-exchange random phase approximation (RPA) framework. We confirm the linear correlation within our microscopic apporach and, by comparing our results with available experimental data in 208Pb, we find that our analysis is consistent with Delta(R) = 0.204 \\pm 0.009 fm, J = 31.4 \\pm 0.5 MeV ...

  12. Giant In-Particle Field Concentration and Fano Resonances at Light Scattering by High-Refractive Index Particles

    CERN Document Server

    Tribelsky, M I

    2015-01-01

    A detailed analytical inspection of light scattering by a particle with high refractive index m+i\\kappa and small dissipative constant \\kappa is presented. We have shown that there is a dramatic difference in the behavior of the electromagnetic field within the particle (inner problem) and the scattered field outside it (outer problem). With an increase in m at fix values of the other parameters, the field within the particle asymptotically converges to a periodic function of m. The electric and magnetic type Mie resonances of different orders overlap substantially. It may lead to a giant concentration of the electromagnetic energy within the particle. At the same time, we demonstrate that identical transformations of the solution for the outer problem allow to present each partial scattered wave as a sum of two partitions. One of them corresponds to the m-independent wave, scattered by a perfectly reflecting particle and plays the role of a background, while the other is associated with the excitation of a s...

  13. Superfluid-Normal Phase Transition in Finite Systems and its Effect on Damping of Hot Giant Resonances

    Science.gov (United States)

    Dang, Nguyen Dinh

    2007-04-01

    Thermal fluctuations of quasiparticle number are included making use of the secondary Bogolyubov's transformation, which turns quasiparticles operators into modified-quasiparticle ones. This restores the unitarity relation for the generalized single-particle density operator, which is violated within the Hartree-Fock-Bogolyubov (HFB) theory at finite temperature. The resulting theory is called the modified HFB (MHFB) theory, whose limit of a constant pairing interaction yields the modified BCS (MBCS) theory. Within the MBCS theory, the pairing gap never collapses at finite temperature T as it does within the BCS theory, but decreases monotonously with increasing T. It is demonstrated that this non-vanishing thermal pairing is the reason why the width of the giant dipole resonance (GDR) does not increase with T up to T ~ 1 MeV. At higher T, when the thermal pairing is small, the GDR width starts to increase with T. The calculations within the phonon-damping model yield the results in good agreement with the most recent experimental systematic for the GDR width as a function of T. A similar effect, which causes a small GDR width at low T, is also seen after thermal pairing is included in the thermal fluctuation model.

  14. Giant peak to valley ratio in a GaN based resonant tunnel diode with barrier width modulation

    Science.gov (United States)

    Sankaranarayanan, Sandeep; Saha, Dipankar

    2016-10-01

    A barrier width modulated GaN based resonant tunnel diode is theoretically proposed which exhibits a giant peak to valley current ratio as high as 60 and a high negative differential conductance (NDC) of 1.77 × 106 S/cm2 with very low valley current density of 3 mA/cm2. This is achieved by the unique characteristic of the device current which monotonically decreases for applied voltages greater than the valley voltage in our simulation window. This is in contrast to all the other negative differential conductance based devices which experience an immediate exponential increase in current after the NDC region. The proposed device is also the first bidirectional tunneling diode which shows negative differential conductance for both polarity of the applied bias which is normally not observed with the conventional GaN/AlGaN double barrier structures due to the strong asymmetry arising from the internal electric fields due to polarization. The unique characteristics of the device can be attributed to the use of a modulated barrier width which is made possible by a polarization modulating InGaN layer and efficient utilization of internal electric fields in III-nitrides.

  15. Giant Dipole Resonance in the hot and thermalized 132Ce nucleus: damping of collective modes at finite temperature

    Energy Technology Data Exchange (ETDEWEB)

    Wieland, O; Bracco, A; Camera, F; Benzoni, G; Blasi, N; Brambilla, S; Crespi, F; Giussani, A; Leoni, S; Million, B; Moroni, A; Barlini, S; Kravchuk, V L; Gramegna, F; Lanchais, A; Mastinu, P; Maj, A; Brekiesz, M; Kmiecik, M; Bruno, M; Geraci, E; Vannini, G; Casini, G; Chiari, M; Nannini, A; Ordine, A; Ormand, W E

    2006-06-16

    The {gamma} decay of the Giant Dipole Resonance in the {sup 132}Ce compound nucleus with temperature up to {approx} 4 MeV has been measured. The symmetric {sup 64}Ni + {sup 68}Zn at E{sub beam} = 300, 400, 500 MeV and the asymmetric reaction {sup 16}O + {sup 116}Sn at E{sub beam} = 130, 250 MeV have been investigated. Light charged particles and {gamma} rays have been detected in coincidence with the recoiling compound system. In the case of the mass symmetric {sup 64}Ni induced reaction the {gamma} and charged particle spectral shapes are found to be consistent with the emission from a fully equilibrated compound nuclei and the GDR parameters are extracted from the data using a statistical model analysis. The GDR width is found to increase almost linear with temperature. This increase is rather well reproduced within a model which includes both the thermal fluctuation of the nuclear shape and the lifetime of the compound nucleus.

  16. Isomeric ratios in photonuclear reactions of molybdenum isotopes induced by bremsstrahlung in the giant dipole resonance region

    Science.gov (United States)

    Thiep, Tran Duc; An, Truong Thi; Cuong, Phan Viet; Vinh, Nguyen The; Hue, Bui Minh; Belov, A. G.; Maslov, O. D.; Mishinsky, G. V.; Zhemenik, V. I.

    2017-01-01

    We have determined the isomeric ratios of isomeric pairs 97m,gNb, 95m,gNb and 91m,gMo produced in 98Mo(γ, p)97m,gNb, 96Mo(γ, p)95m,gNb and 92Mo(γ, n)91m,gMo photonuclear reactions in the giant dipole resonance (GDR) region by the activation method. The results were analyzed, discussed and compared with the similar data from literature to examine the role of excitation energy, neutron configuration, channel effect and direct and pre-equilibrium processes in (γ, p) photonuclear reactions. In this work the isomeric ratios for 97m,gNb from 14 to 19 MeV, for 195m,gNb from14 to 24 MeV except 20 and 23.5 MeV and for 91m,gMo at 14 and 15 MeV are the first time measurements.

  17. Generating giant and tunable nonlinearity in a macroscopic mechanical resonator from a single chemical bond

    Science.gov (United States)

    Huang, Pu; Zhou, Jingwei; Zhang, Liang; Hou, Dong; Lin, Shaochun; Deng, Wen; Meng, Chao; Duan, Changkui; Ju, Chenyong; Zheng, Xiao; Xue, Fei; Du, Jiangfeng

    2016-05-01

    Nonlinearity in macroscopic mechanical systems may lead to abundant phenomena for fundamental studies and potential applications. However, it is difficult to generate nonlinearity due to the fact that macroscopic mechanical systems follow Hooke's law and respond linearly to external force, unless strong drive is used. Here we propose and experimentally realize high cubic nonlinear response in a macroscopic mechanical system by exploring the anharmonicity in chemical bonding interactions. We demonstrate the high tunability of nonlinear response by precisely controlling the chemical bonding interaction, and realize, at the single-bond limit, a cubic elastic constant of 1 × 1020 N m-3. This enables us to observe the resonator's vibrational bi-states transitions driven by the weak Brownian thermal noise at 6 K. This method can be flexibly applied to a variety of mechanical systems to improve nonlinear responses, and can be used, with further improvements, to explore macroscopic quantum mechanics.

  18. High-Resolution Measurement of the {sup 4}He({gamma},n) Reaction in the Giant Resonance Region

    Energy Technology Data Exchange (ETDEWEB)

    Nilsson, Bjoern

    2003-03-01

    A comprehensive near-threshold {sup 4}He(gamma,n) absolute cross section measurement has been performed at the high-resolution tagged-photon facility MAX-lab located in Lund, Sweden. The 20 < Eg < 45 MeV tagged photons (covering the Giant Dipole Resonance energy region) were directed towards a liquid {sup 4}He target, and knocked-out neutrons were detected in a pair of 60 cm x 60 cm vetoed NE213A liquid scintillator arrays. The intense and varying charge-neutral experimental backgrounds were carefully quantified and removed from the data using a precision fitting procedure. Eight average laboratory angles (30, 45, 60, 75, 90, 105, 120, and 135 deg) were investigated for eight photon energy bins (25, 27, 29, 31, 35, 36, 39, and 41 MeV), resulting in 64 differential cross sections. These angular distributions were integrated to produce total cross sections as a function of photon energy. The resulting cross sections peak at 1.9 mb at a photon energy of 27 MeV, and fall off to a near-constant value of 1.1 mb by 36 MeV. Further, they are in excellent agreement with those measured by Sims et al. using tagged photons in the Quasi-Deuteron energy region. Overall, the results favor modern theoretical models which are based upon a charge-symmetric nucleon-nucleon force, in marked contrast to the recommendations made by Calarco et al. in 1983 based on the sparse {sup 4}He(gamma,n) data available at the time.

  19. The Pan-Pacific Planet Search. IV. Two super-Jupiters in a 3:5 resonance orbiting the giant star HD33844

    CERN Document Server

    Wittenmyer, Robert A; Butler, R P; Horner, Jonathan; Wang, Liang; Robertson, Paul; Jones, M I; Jenkins, J S; Brahm, R; Tinney, C G; Mengel, M W; Clark, J

    2015-01-01

    We report the discovery of two giant planets orbiting the K giant HD 33844 based on radial velocity data from three independent campaigns. The planets move on nearly circular orbits with semimajor axes $a_b=1.60\\pm$0.02 AU and $a_c=2.24\\pm$0.05 AU, and have minimum masses (m sin $i$) of $M_b=1.96\\pm$0.12 Mjup and $M_c=1.76\\pm$0.18 Mjup. Detailed N-body dynamical simulations show that the two planets remain on stable orbits for more than $10^6$ years for low eccentricities, and are most likely trapped in a mutual 3:5 mean-motion resonance.

  20. Giant distal humeral geode

    Energy Technology Data Exchange (ETDEWEB)

    Maher, M.M. [Department of Radiology, Mater Misericordiae Hospital, Dublin (Ireland); Department of Radiology, St. Vincent' s Hospital, Elm Park, Dublin 4 (Ireland); Kennedy, J.; Hynes, D. [Department of Orthopaedics, Mater Misericordiae Hospital, Dublin (Ireland); Murray, J.G.; O' Connell, D. [Department of Radiology, Mater Misericordiae Hospital, Dublin (Ireland)

    2000-03-30

    We describe the imaging features of a giant geode of the distal humerus in a patient with rheumatoid arthritis, which presented initially as a pathological fracture. The value of magnetic resonance imaging in establishing this diagnosis is emphasized. (orig.)

  1. Testing the Mutually Enhanced Magicity Effect in Nuclear Incompressibility via the Giant Monopole Resonance in the $^{204,206,208}$Pb Isotopes

    CERN Document Server

    Patel, D; Fujiwara, M; Adachi, T; Akimune, H; Berg, G P A; Harakeh, M N; Itoh, M; Iwamoto, C; Long, A; Matta, J T; Murakami, T; Okamoto, A; Sault, K; Talwar, R; Uchida, M; Yosoi, M

    2013-01-01

    Using inelastic $\\alpha$-scattering at extremely forward angles, including $0^\\circ$, the strength distributions of the isoscalar giant monopole resonance (ISGMR) have been measured in the $^{204,206,208}$Pb isotopes in order to examine the proposed mutually enhanced magicity (MEM) effect on the nuclear incompressibility. The MEM effect had been suggested as a likely explanation of the "softness" of nuclear incompressibility observed in the ISGMR measurements in the Sn and Cd isotopes. Our experimental results rule out any manifestation of the MEM effect in nuclear incompressibility and leave the question of the softness of the open-shell nuclei unresolved still.

  2. Doorway-state analysis of the fine structure in the giant quadrupole resonance in 208Pb observed in inelastic electron scatteredrefid="FN1">†

    Science.gov (United States)

    Winchenbach, J.; Pingel, K.; Holzwarth, G.; Kühner, G.; Richter, A.

    1983-11-01

    The fine structure observed in high resolution inelastic electron scattering data obtained at DALINAC for 208Pb in the excitation energy range of the giant quadrupole resonance (GQR) has been analysed under the assumption that the measured strongly fragmented E2 strength distribution is due to the coupling of one or two doorway states to a large number of more complicated states. The coupling matrix elements derived from the analysis allow the determination of the escape and spreading widths Γ ↑ and Γ ↓, the excitation energies Ed, the energy shifts ΔEd, and their energy dependence, for the underlying doorways.

  3. Isomeric yield ratios of the {sup 90}Zr({gamma},n){sup 88m,g}Zr reaction up the giant dipole resonance

    Energy Technology Data Exchange (ETDEWEB)

    Bodrov, I.V.; Davydov, M.G.; Rakhmanov, I.B. [Rostov State Univ., Rostov-na-Donu (Russian Federation)] [and others

    1994-08-01

    The isomeric yield ratios Y{sub m}/Y{sub g} of the {sup 90}Zr({gamma},n){sup 88m,g}Zr reaction are measured in the energy range from 13 to 21 MeV with a step of 0.5 MeV. The experimental isomeric ratios are compared with the data obtained by other authors and with the results of theoretical calculations based on the statistical theory and on the model of {open_quotes}semidirect{close_quotes} decay of the giant dipole resonance. 30 refs., 1 fig., 2 tabs.

  4. Giant Choledochal Cyst Mimicking Massive Gallbladder Hydrops in an Adult Patient: Multi Detector Computed Tomography and Magnetic Resonance Imaging Findings Correlated to Gross and Histopathological Findings

    Directory of Open Access Journals (Sweden)

    Joon-Il Choi

    2013-01-01

    Full Text Available Choledochal cysts are uncommon congenital anomalies of the biliary tree, commonly presenting in infancy, generally in the 1 st year of life. Presentation in adult life is less common, accounting for 20% of cases. A 19-year-old female patient presented to the Emergency Department with severe abdominal distension, a palpable abdominal mass, mild jaundice and low grade fever. Ultrasound, computed tomography (CT and magnetic resonance imaging of the abdomen showed a massive septated cystic lesion filling the entire abdomen with a significant mass effect on surrounding structures. Origin of the lesion was unclear and diagnosis included a giant mesenteric or duplication cyst, massive gallbladder with hydrops, biliary cystadenoma and giant choledochal cyst, among others. Final diagnosis was a Type IA choledochal cyst with massive asymmetric cystic dilatation of the extra-hepatic segments of the left hepatic duct with asymmetric dilatation of the right hepatic duct. Patient had an uneventful recovery after resection of the entire extrahepatic cyst and Roux-en-Y hepaticojejunostomy at the level of the hilum. In this article, we correlate CT and MRI findings to gross and histopathological findings of this giant Todani′s Type IA choledochal cyst.

  5. Giant electric field control of magnetism and narrow ferromagnetic resonance linewidth in FeCoSiB/Si/SiO2/PMN-PT multiferroic heterostructures

    Science.gov (United States)

    Gao, Y.; Wang, X.; Xie, L.; Hu, Z.; Lin, H.; Zhou, Z.; Nan, T.; Yang, X.; Howe, B. M.; Jones, J. G.; Brown, G. J.; Sun, N. X.

    2016-06-01

    It has been challenging to achieve combined strong magnetoelectric coupling and narrow ferromagnetic resonance (FMR) linewidth in multiferroic heterostructures. Electric field induced large effective field of 175 Oe and narrow FMR linewidth of 40 Oe were observed in FeCoSiB/Si/SiO2/PMN-PT heterostructures with substrate clamping effect minimized through removing the Si substrate. As a comparison, FeCoSiB/PMN-PT heterostructures with FeCoSiB film directly deposited on PMN-PT showed a comparable voltage induced effective magnetic field but a significantly larger FMR linewidth of 283 Oe. These multiferroic heterostructures exhibiting combined giant magnetoelectric coupling and narrow ferromagnetic resonance linewidth offer great opportunities for integrated voltage tunable RF magnetic devices.

  6. Visualization of luminal thrombosis and mural Iron accumulation in giant aneurysms with Ex vivo 4.7T magnetic resonance imaging

    Directory of Open Access Journals (Sweden)

    Petri Honkanen

    2014-01-01

    Full Text Available Background: Better diagnostic tools to identify rupture-prone saccular intracranial aneurysms (sIA are needed. Inflammation and luminal thrombus associate with degeneration and rupture of the sIA wall. Iron-uptake has been detected in the inflammatory cells of the sIA wall and thrombus is the likely source of this iron. We investigated ex vivo the use of magnetic resonance imaging (MRI to detect iron accumulation and luminal thrombus in giant sIAs. Methods: Giant sIAs (n = 3 were acquired from microsurgical operations, fixed with formalin, embedded in agar and imaged at 4.7T. Samples were sectioned maintaining the orientation of the axial plane of MRI scans, and stained (hematoxylin-eosin and Prussian blue. Results: All three giant sIAs showed a degenerated hypocellular wall with both mural and adventitial iron accumulation and displayed different degrees of luminal thrombus formation and thrombus organization. Signal intensity varied within the same sIA wall and associated with iron accumulation in all tested sequences. Wall areas with iron accumulation had significantly lower signal to noise ratio (SNR compared with areas without iron accumulation (P = 0.002. Fresh and organizing thrombus differed in their MRI presentation and differed in signal intensity of the aneurysm wall (P = 0.027. Conclusion: MRI can detect ex vivo the accumulation of iron in giant sIA wall, as well as fresh and organizing luminal thrombus. These features have been previously associated with fragile, rupture-prone aneurysm wall. Further studies of iron accumulation as a marker of rupture-prone aneurysm wall are needed.

  7. Giant Electric Field Control of Magnetism and Narrow Ferromagnetic Resonance Linewidth in FeCoSiB/Si/SiO2/PMN PT Multiferroic Heterostructures (Open Access Author’s Manuscript)

    Science.gov (United States)

    2016-06-06

    1 Giant electric field control of magnetism and narrow ferromagnetic resonance linewidth in FeCoSiB/Si/SiO2/PMN-PT multiferroic heterostructures...coupling and narrow ferromagnetic resonance (FMR) linewidth in multiferroic heterostructures. Electric field induced large effective field of 175Oe...in which the electric field applied to the piezoelectric layer produces a mechanical deformation that couples to the magnetic film, and hence induces

  8. Isoscalar giant monopole resonance for drip-line and super heavy nuclei in the framework of a relativistic mean field formalism with scaling calculation

    CERN Document Server

    Biswal, S K

    2014-01-01

    We study the isoscalar giant monopole resonance for drip-lines and super heavy nuclei in the frame work of a relativistic mean field theory with scaling approach. The well known extended Thomas-Fermi approximation in the non-linear $\\sigma$-$\\omega$ model is used to estimate the giant monopole excitation energy for some selected light spherical nuclei starting from the region of proton to neutron drip-lines. The application is extended to super heavy region for Z=114 and 120, which are predicted by several models as the next proton magic number beyond Z=82. We compared the excitation energy obtained by four successful force parameters NL1, NL3, NL3$^*$ and FSUGold. The monopole energy decreases toward the proton and neutron drip-lines in an isotopic chain for lighter mass nuclei contrary to a monotonous decrease for super heavy isotopes. The maximum and minimum monopole excitation energies are obtained for nuclei with minimum and maximum isospin, respectively in an isotopic chain.

  9. Giant Monopole Resonance in even-A Cd isotopes, the asymmetry term in nuclear incompressibility, and the "softness" of Sn and Cd nuclei

    CERN Document Server

    Patel, D; Fujiwara, M; Akimune, H; Berg, G P A; Harakeh, M N; Itoh, M; Kawabata, T; Kawase, K; Nayak, B K; Ohta, T; Ouchi, H; Piekarewicz, J; Uchida, M; Yoshida, H P; Yosoi, M

    2012-01-01

    The isoscalar giant monopole resonance (ISGMR) in even-A Cd isotopes has been studied by inelastic ${\\alpha}$-scattering at 100 MeV/u and at extremely forward angles, including 0deg. The asymmetry term in the nuclear incompressibility extracted from the ISGMR in Cd isotopes is found to be $K_{\\tau} = -555 \\pm 75$ MeV, confirming the value previously obtained from the Sn isotopes. ISGMR strength has been computed in relativistic RPA using NL3 and FSUGold effective interactions. Both models significantly overestimate the centroids of the ISGMR strength in the Cd isotopes. Combined with other recent theoretical effort, the question of the "softness" of the open-shell nuclei in the tin region remains open still.

  10. Giant monopole resonance in even-A Cd isotopes, the asymmetry term in nuclear incompressibility, and the 'softness' of Sn and Cd nuclei

    Energy Technology Data Exchange (ETDEWEB)

    Patel, D. [Department of Physics, University of Notre Dame, Notre Dame, IN 46556 (United States); Garg, U., E-mail: garg@nd.edu [Department of Physics, University of Notre Dame, Notre Dame, IN 46556 (United States); Fujiwara, M. [Research Center for Nuclear Physics, Osaka University, Osaka 567-0047 (Japan); Akimune, H. [Department of Physics, Konan University, Kobe 568-8501 (Japan); Berg, G.P.A. [Department of Physics, University of Notre Dame, Notre Dame, IN 46556 (United States); Harakeh, M.N. [Kernfysisch Versneller Instituut, University of Groningen, 9747 AA Groningen (Netherlands); Itoh, M. [Cyclotron and Radioisotope Center, Tohoku University, Sendai 980-8578 (Japan); Kawabata, T. [Center for Nuclear Studies, University of Tokyo, Tokyo 113-0033 (Japan); Kawase, K. [Institute of Scientific and Industrial Research, Osaka University, Osaka 567-0047 (Japan); Nayak, B.K. [Department of Physics, University of Notre Dame, Notre Dame, IN 46556 (United States); Ohta, T. [Research Center for Nuclear Physics, Osaka University, Osaka 567-0047 (Japan); Ouchi, H. [Cyclotron and Radioisotope Center, Tohoku University, Sendai 980-8578 (Japan); Piekarewicz, J. [Department of Physics, Florida State University, Tallahassee, FL 32306 (United States); Uchida, M. [Department of Physics, Tokyo Institute of Technology, Tokyo 152-8850 (Japan); Yoshida, H.P. [Cyclotron and Radioisotope Center, Tohoku University, Sendai 980-8578 (Japan); Yosoi, M. [Research Center for Nuclear Physics, Osaka University, Osaka 567-0047 (Japan)

    2012-12-05

    The isoscalar giant monopole resonance (ISGMR) in even-A Cd isotopes has been studied by inelastic {alpha}-scattering at 100 MeV/u and at extremely forward angles, including 0 Degree-Sign . The asymmetry term in the nuclear incompressibility extracted from the ISGMR in Cd isotopes is found to be K{sub {tau}}=-555{+-}75 MeV, confirming the value previously obtained from the Sn isotopes. ISGMR strength has been computed in relativistic RPA using NL3 and FSUGold effective interactions. Both models significantly overestimate the centroids of the ISGMR strength in the Cd isotopes. Combined with other recent theoretical effort, the question of the 'softness' of the open-shell nuclei in the tin region remains open still.

  11. Light Charged Particles Emission and the Giant Dipole Resonance in Highly Excited Ce Nucleus Formed in Reactions with Different Mass Asymmetries

    Science.gov (United States)

    Barlini, S.; Kravchuk, V. L.; Wieland, O.; Bracco, A.; Gramegna, F.; Airoldi, A.; Benzoni, G.; Blasi, N.; Brambilla, S.; Brekiesz, M.; Bruno, M.; Camera, F.; Casini, G.; Chiari, M.; D'Agostino, M.; De Sanctis, J.; Geraci, E.; Kmiecik, M.; Lanchais, A.; Leoni, S.; Maj, A.; Mastinu, P. F.; Million, B.; Moroni, A.; Nannini, A.; Ordine, A.; Sacchi, R.; Vannini, G.

    2006-08-01

    Recent measurements have been performed at the National Laboratoty of Legnaro using mass-symmetric (400, 500 MeV 64Ni + 68Zn) and mass-asymmetric (250 MeV 16O + 116Sn) entrance channel reactions to form 132Ce compound nucleus at different excitation energies (E*=150, 200 and 200 MeV, respectively). The decay of the composite system has been followed studying the γ-rays and Light Charged Particles (LCP) spectra emitted in coincidence with the Evaporation Residues (ER). In this way the emission mechanism of the LCP, depending on the mass-asymmetry at the entrance channel and on the projectile energy, and the results of the Full Width Half-Maximum (FWHM) of the Giant Dipole Resonance as a function of the nuclear temperature have been studied.

  12. [Giant retroperitoneal liposarcoma].

    Science.gov (United States)

    Mezzour, Mohamed Hicham; El Messaoudi, Yasser Arafat; Fekak, Hamid; Rabii, Redouane; Marnissi, Farida; Karkouri, Mehdi; Salam, Siham; Iraki, Moulay Ahmed; Joual, Abdenbi; Meziane, Fathi

    2006-02-01

    The authors report a case of giant retroperitoneal liposarcoma. The diagnosis was suspected after scanography and magnetic resonance imaging and confirmed by the histological analysis of the extracted piece after surgical treatment. Postoperative evolution was favourable after one year without recurrence or distant metastasis. The authors discuss the pathologic and therapeutic aspects and the prognosis of retroperitoneal liposarcoma.

  13. Experiment for a measurement of the charge radius of the proton at the S-DALINAC and investigation of the fine structure of giant resonances in {sup 28}Si, {sup 48}Ca and {sup 166}Er with the help of the wavelet analysis; Experiment zur Messung des Ladungsradius des Protons am S-DALINAC und Untersuchung der Feinstruktur von Riesenresonanzen in {sup 28}Si, {sup 48}Ca und {sup 166}Er mit Hilfe der Waveletanalyse

    Energy Technology Data Exchange (ETDEWEB)

    Pysmenetska, Inna

    2009-07-22

    The present thesis consists of two parts. In the first part a novel experimental method for the measurement of the proton root-mean-square radius at the S-DALINAC is presented. A setup based on semiconductor detectors is realized. In contrast to previous experiments it allows a simultaneous measurement of the momentum transfer dependence of the elastic electron scattering cross section. A possible suppression of the significant electron and bremsstrahlung background observed in a test experiment was investigated with the help of different methods, such as {delta}E-E telescopes, the time of flight method with a pulsed beam and pulse shape discrimination. The combination of these methods allows a reduction of the background at all scattering angles, which should allow a successful measurement. The response of the detector system was studied with the help of Monte-Carlo simulations with an emphasis on the dependence of the expected accuracy of different parameters. The second part of this work describes an investigation of the fine structure of giant resonances in {sup 28}Si, {sup 48}Ca and {sup 166}Er with the help of a wavelet analysis. The discrete wavelet transform was used for a background determination in spectra of the iso vector E1 and the M2 giant resonances in {sup 48}Ca. This allows the extraction of 1{sup -} und 2{sup -} level densities in the excitation energy region of the respective resonances with the help of a fluctuation analysis. A fluctuation analysis of the fine structure of the isoscalar E2 resonance in {sup 166}Er allows the extraction of the coherent widths of the 2{sup +} states. In the excitation energy region E{sub x}=10-16 MeV widths between 30 and 80 eV are found. The fine structure of the giant resonances is furthermore specified by characteristic scales. In this thesis scales in {sup 28}Si and {sup 48}Ca are extracted with the help of the above mentioned wavelet transform. In {sup 28}Si the isovector E1 and isoscalar E2 resonances were

  14. Neutron-skin thickness of 208Pb, and symmetry-energy constraints from the study of the anti-analog giant dipole resonance

    CERN Document Server

    Krasznahorkay, A; Csige, L; Eriksen, T K; Giacoppo, F; Görgen, A; Hagen, T W; Harakeh, M N; Julin, R; Koehler, P; Paar, N; Siem, S; Stuhl, L; Tornyi, T; Vretenar, D

    2013-01-01

    The 208Pb(p,ngamma p)207Pb reaction at a beam energy of 30 MeV has been used to excite the anti-analog of the giant dipole resonance (AGDR) and to measure its gamma-decay of to the isobaric analog state. The energy of the transition has also been calculated with the self-consistent relativistic random-phase approximation (RRPA), and found to be linearly correlated to the predicted value of the neutron-skin thickness (DR_pn). By comparing the theoretical results with the measured transition energy, the value of 0.190 +- 0.028 fm has been determined for DR_pn of 208Pb, in agreement with previous experimental results. The AGDR excitation energy has also been used to calculate the symmetry energy at saturation (J=32.7+- 0.6 MeV) and the slope of the symmetry energy (L=49.7 +- 4.4 MeV), resulting in more stringent constraints than most of the previous studies.

  15. Torsional Alfv\\xE9n resonances as an efficient damping mechanism for non-radial oscillations in red giant stars

    Science.gov (United States)

    Loi, Shyeh Tjing; Papaloizou, John C. B.

    2017-05-01

    Stars are self-gravitating fluids in which pressure, buoyancy, rotation and magnetic fields provide the restoring forces for global modes of oscillation. Pressure and buoyancy energetically dominate, while rotation and magnetism are generally assumed to be weak perturbations and often ignored. However, observations of anomalously weak dipole mode amplitudes in red giant stars suggest that a substantial fraction of these are subject to an additional source of damping localized to their core region, with indirect evidence pointing to the role of a deeply buried magnetic field. It is also known that in many instances, the gravity-mode character of affected modes is preserved, but so far, no effective damping mechanism has been proposed that accommodates this aspect. Here we present such a mechanism, which damps the oscillations of stars harbouring magnetised cores via resonant interactions with standing Alfvén modes of high harmonic index. The damping rates produced by this mechanism are quantitatively on par with those associated with turbulent convection, and in the range required to explain observations, for realistic stellar models and magnetic field strengths. Our results suggest that magnetic fields can provide an efficient means of damping stellar oscillations without needing to disrupt the internal structure of the modes, and lay the groundwork for an extension of the theory of global stellar oscillations that incorporates these effects.

  16. X-ray excited photoluminescence near the giant resonance in solid-solution Gd(1-x)Tb(x)OCl nanocrystals and their retention upon solvothermal topotactic transformation to Gd(1-x)Tb(x)F3.

    Science.gov (United States)

    Waetzig, Gregory R; Horrocks, Gregory A; Jude, Joshua W; Zuin, Lucia; Banerjee, Sarbajit

    2016-01-14

    Design rules for X-ray phosphors are much less established as compared to their optically stimulated counterparts owing to the absence of a detailed understanding of sensitization mechanisms, activation pathways and recombination channels upon high-energy excitation. Here, we demonstrate a pronounced modulation of the X-ray excited photoluminescence of Tb(3+) centers upon excitation in proximity to the giant resonance of the host Gd(3+) ions in solid-solution Gd1-xTbxOCl nanocrystals prepared by a non-hydrolytic cross-coupling method. The strong suppression of X-ray excited optical luminescence at the giant resonance suggests a change in mechanism from multiple exciton generation to single thermal exciton formation and Auger decay processes. The solid-solution Gd1-xTbxOCl nanocrystals are further topotactically transformed with retention of a nine-coordinated cation environment to solid-solution Gd1-xTbxF3 nanocrystals upon solvothermal treatment with XeF2. The metastable hexagonal phase of GdF3 can be stabilized at room temperature through this topotactic approach and is transformed subsequently to the orthorhombic phase. The fluoride nanocrystals indicate an analogous but blue-shifted modulation of the X-ray excited optical luminescence of the Tb(3+) centers upon X-ray excitation near the giant resonance of the host Gd(3+) ions.

  17. Localized surface plasmon resonances dominated giant lateral photovoltaic effect observed in ZnO/Ag/Si nanostructure

    Science.gov (United States)

    Zhang, Ke; Wang, Hui; Gan, Zhikai; Zhou, Peiqi; Mei, Chunlian; Huang, Xu; Xia, Yuxing

    2016-03-01

    We report substantially enlarged lateral photovoltaic effect (LPE) in the ZnO/Ag/Si nanostructures. The maximum LPE sensitivity (55.05 mv/mm) obtained in this structure is about seven times larger than that observed in the control sample (7.88 mv/mm) of ZnO/Si. We attribute this phenomenon to the strong localized surface plasmon resonances (LSPRs) induced by nano Ag semicontinuous films. Quite different from the traditional LPE in PN junction type structures, in which light-generated carriers contributed to LPE merely depends on direct excitation of light in semiconductor, this work firstly demonstrates that, by introducing a super thin metal Ag in the interface between two different kinds of semiconductors, the nanoscale Ag embedded in the interface will produce strong resonance of localized field, causing extra intraband excitation, interband excitation and an enhanced direct excitation. As a consequence, these LSPRs dominated contributions harvest much more carriers, giving rise to a greatly enhanced LPE. In particular, this LSPRs-driven mechanism constitutes a sharp contrast to the traditional LPE operation mechanism. This work suggests a brand new LSPRs approach for tailoring LPE-based devices and also opens avenues of research within current photoelectric sensors area.

  18. Emerging giant resonant exciton induced by Ta substitution in anatase TiO2: A tunable correlation effect

    Science.gov (United States)

    Yong, Z.; Trevisanutto, P. E.; Chiodo, L.; Santoso, I.; Barman, A. R.; Asmara, T. C.; Dhar, S.; Kotlov, A.; Terentjevs, A.; Della Sala, F.; Olevano, V.; Rübhausen, M.; Venkatesan, T.; Rusydi, A.

    2016-05-01

    Titanium dioxide (TiO2) has rich physical properties with potential implications for both fundamental physics and new applications. To date, the main focus of applied research is to tune its optical properties, which is usually done via doping and/or nanoengineering. However, understanding the role of d electrons in materials and possible functionalization of d -electron properties are still major challenges. Herewith, within a combination of an innovative experimental technique, high-energy optical conductivity, and state-of-the-art ab initio electronic structure calculations, we report an emerging, novel resonant exciton in the deep ultraviolet region of the optical response. The resonant exciton evolves upon low-concentration Ta substitution in anatase TiO2 films. It is surprisingly robust and related to strong electron-electron and electron-hole interactions. The d - and f -orbital localization, due to Ta substitution, plays an unexpected role, activating strong electronic correlations and dominating the optical response under photoexcitation. Our results shed light on a new optical phenomenon in anatase TiO2 films and on the possibility of tuning electronic properties by Ta substitution.

  19. Giant optical nonlinearity of silver-doped silicon thin film at low power input: laser-triggered cluster resonance

    Energy Technology Data Exchange (ETDEWEB)

    Wei, Jingsong [Chinese Academy of Sciences, Shanghai Institute of Optics and Fine Mechanics, Shanghai (China); Zhejiang University, State Key Lab of Silicon Materials, Hangzhou (China); Liu, Jing [Chinese Academy of Sciences, Shanghai Institute of Optics and Fine Mechanics, Shanghai (China); Xiao, Mufei [Universidad Nacional Autonoma de Mexico, Centro de Nanociencias y Nanotecnologia, Apartado Postal 365, Ensenada, Baja California (Mexico)

    2011-09-15

    Silver-doped silicon thin films were deposited on glass substrate in a co-sputtering procedure. Silver nanoparticles were segregatedly distributed. The nonlinear properties were extracted by z-scan measurements at low laser input power. For about 50% silver density, the nonlinear absorption and refraction coefficients peaked, respectively, at -8.086 x 10{sup -2} m/W and 1.47 x 10{sup -9} m{sup 2}/W, which, with respect to the input intensity, are several orders higher than reported data. The sudden surge of nonlinear responses was explained satisfactorily based on a self-consistent microscopic model calculation for silver clusters. Resonances exist and depend apparently on the laser-modified local cluster concentration. (orig.)

  20. Dipole strength distribution below the giant dipole resonance in {sup 92}Mo, {sup 98}Mo and {sup 100}Mo

    Energy Technology Data Exchange (ETDEWEB)

    Rusev, G.Y.

    2006-07-01

    Investigations of the dipole-strength distributions in {sup 92}Mo, {sup 98}Mo and {sup 100}Mo were carried out by means of the method of nuclear resonance fluorescence. The low-lying excitations in the nuclides {sup 92}Mo, {sup 98}Mo and {sup 100}Mo have been studied in photon-scattering experiments at an electron energy of 6 MeV at the ELBE accelerator and at electron energies from 3.2 to 3.8 MeV at the Dynamitron accelerator. Five levels were observed in {sup 92}Mo. Five levels in {sup 98}Mo and 14 in {sup 100}Mo were identified for the first time in the energy range from 2 to 4 MeV. Dipole-strength distributions up to the neutron-separation energies in the nuclides {sup 92}Mo, {sup 98}Mo and {sup 100}Mo have been investigated at the ELBE accelerator. Because of the possible observation of transitions in the neighboring nuclei produced via ({gamma},n) reaction, additional measurements at electron energies of 8.4 and 7.8 MeV, below the neutron-separation energy, were performed on {sup 98}Mo and {sup 100}Mo, respectively. The number of transitions assigned to {sup 92}Mo, {sup 98}Mo and {sup 100}Mo is 340, 485 and 499, respectively, the main part of them being dipole transitions. Statistical properties of the observed transitions are obtained. The continuum contains the ground-state transitions as well as the branching transitions to the low-lying levels and the subsequent deexcitations of these levels. (orig.)

  1. Resonances

    DEFF Research Database (Denmark)

    an impetus or drive to that account: change, innovation, rupture, or discontinuity. Resonances: Historical Essays on Continuity and Change explores the historiographical question of the modes of interrelation between these motifs in historical narratives. The essays in the collection attempt to realize...... theoretical consciousness through historical narrative ‘in practice’, by discussing selected historical topics from Western cultural history, within the disciplines of history, literature, visual arts, musicology, archaeology, philosophy, and theology. The title Resonances indicates the overall perspective...

  2. Giant Planets

    CERN Document Server

    Guillot, Tristan

    2014-01-01

    We review the interior structure and evolution of Jupiter, Saturn, Uranus and Neptune, and giant exoplanets with particular emphasis on constraining their global composition. Compared to the first edition of this review, we provide a new discussion of the atmospheric compositions of the solar system giant planets, we discuss the discovery of oscillations of Jupiter and Saturn, the significant improvements in our understanding of the behavior of material at high pressures and the consequences for interior and evolution models. We place the giant planets in our Solar System in context with the trends seen for exoplanets.

  3. On the collectivity of Pygmy Dipole Resonance within schematic TDA and RPA models

    CERN Document Server

    Baran, V; Colonna, M; Di Toro, M; Croitoru, A; Nicolin, A I

    2014-01-01

    Within schematic models based on the Tamm-Dancoff Approximation and the Random-Phase Approximation with separable interactions, we investigate the physical conditions which determine the emergence of the Pygmy Dipole Resonance in the E1 response of atomic nuclei. We find that if some particle-hole excitation manifests a different, weaker residual interaction, an additional mode will appear, with an energy centroid closer to the distance between two major shells and therefore well below the Giant Dipole Resonance. This state, together with Giant Dipole Resonance, exhausts all the transition strength in the Tamm-Dancoff Approximation and all the Energy Weighted Sum Rule in the Random-Phase Approximation. These features suggest a collective nature for this mode which we identify with the Pygmy Dipole Resonance.

  4. Pygmy dipole resonance and dipole polarizability in 90Zr

    Science.gov (United States)

    Iwamoto, C.; Tamii, A.; Utsunomiya, H.; Akimune, H.; Nakada, H.; Shima, T.; Hashimoto, T.; Yamagata, T.; Kawabata, T.; Fujita, Y.; Matsubara, H.; Suzuki, T.; Fujita, H.; Shimbara, Y.; Nagashima, M.; Sakuda, M.; Mori, T.; Izumi, T.; Okamoto, A.; Kondo, T.; Lui, T.-W.; Bilgier, B.; Kozer, H. C.; Hatanaka, K.

    2014-05-01

    Electric dipole (E1) reduced transition probability B(E1) of 90Zr was obtained by the inelastic proton scattering near 0 degrees using a 295 MeV proton beam and multipole decomposition analysis of the angular distribution by the distorted-wave Born approximation with the Hartree-Fock plus random-phase approximation model and inclusion of El Coulomb excitation, and the E1 strength of the pygmy dipole resonance was found in the vicinity of the neutron threshold in the low-energy tail of the giant dipole resonance. Using the data, we plan to determine the precise dipole polarizability αD which is defined as an inversely energy-weighted sum value of the elecrric dipole strength. The dipole polarizability is expected to constrain the symmetry energy term of the neutron matter equation of state. Thus systematical measurement of the dipole polarizability is important.

  5. Pygmy dipole resonance and dipole polarizability in {sup 90}Zr

    Energy Technology Data Exchange (ETDEWEB)

    Iwamoto, C.; Tamii, A.; Shima, T.; Hashimoto, T.; Suzuki, T.; Fujita, H.; Hatanaka, K. [Research Center for Nuclear Physics, Osaka University, Ibaraki, Osaka 567-0047 (Japan); Utsunomiya, H.; Akimune, H.; Yamagata, T.; Okamoto, A.; Kondo, T. [Department of Physics, Konan University, Okamoto 8-9-1, Higashinada, Kobe 658-8501 (Japan); Nakada, H. [Department of Physics, Graduate School of Science, Chiba University, Yayoi-cho 1-33, Inage, Chiba 263-8522 (Japan); Kawabata, T. [Department of Physics, Kyoto University, Kyoto 606-8502 (Japan); Fujita, Y. [Department of Physics, Osaka University, Toyonaka, Osaka, 560-0043 (Japan); Matsubara, H. [RIKEN Nishina Center, Wako, Saitama 351-0198 (Japan); Shimbara, Y.; Nagashima, M. [Department of Physics, Niigata University, Niigata 950-21-2 (Japan); Sakuda, M.; Mori, T. [Department of Physics, Okayama University, Okayama 900-0082 (Japan); and others

    2014-05-02

    Electric dipole (E1) reduced transition probability B(E1) of {sup 90}Zr was obtained by the inelastic proton scattering near 0 degrees using a 295 MeV proton beam and multipole decomposition analysis of the angular distribution by the distorted-wave Born approximation with the Hartree-Fock plus random-phase approximation model and inclusion of El Coulomb excitation, and the E1 strength of the pygmy dipole resonance was found in the vicinity of the neutron threshold in the low-energy tail of the giant dipole resonance. Using the data, we plan to determine the precise dipole polarizability α{sub D} which is defined as an inversely energy-weighted sum value of the elecrric dipole strength. The dipole polarizability is expected to constrain the symmetry energy term of the neutron matter equation of state. Thus systematical measurement of the dipole polarizability is important.

  6. Giant arachnoid granulation in a patient with benign intracranial hypertension

    Energy Technology Data Exchange (ETDEWEB)

    Kiroglu, Yilmaz; Yaqci, Baki; Cirak, Bayram; Karabulut, Nevzat [Pamukkale University, Department of Radiology, School of Medicine, Denizli (Turkey)

    2008-10-15

    We report magnetic resonance (MR), computed tomography (CT) and angiographic imaging of an unusual giant arachnoid granulation in the superior sagittal sinus in a man with headache and vertigo. Intrasinus pressure measurements revealed a significant pressure gradient across the lesion. MR imaging is useful to identify giant arachnoid granulation and dural sinus thrombosis, whereas dural sinus pressure measurement in certain cases of giant arachnoid granulations can be used to evaluate the lesion as the cause of the patient's symptoms. (orig.)

  7. Study of thermally excited nuclei through E1 and E2 decay from collective modes

    Energy Technology Data Exchange (ETDEWEB)

    Million, B.; Bracco, A.; Benzoni, G.; Leoni, S.; Camera, F.; Wieland, O. [Dipartimento di Fisica, Universita di Milano and INFN, via Celoria 16, 20133, Milano (Italy); Maj, A.; Kmiecik, M. [Niewodniczanski Institute of Nuclear Physics, 31-342, Krakow (Poland); Gadea, A. [Laboratori Nazionali di Legnaro, via Romea, Legnaro (Italy); Herskind, B. [The Niels Bohr Institute, Blegdamsvej 15-17, 2100, Copenhagen (Denmark)

    2004-04-01

    The nuclear system at the limit of excitation energy and angular momentum is here studied in the case of the superdeformed nucleus {sup 143}Eu using {gamma}-spectroscopy techniques. The data are based on a EUROBALL experiment using the reaction {sup 37}Cl+{sup 110}Pd{yields}{sup 143}Eu+4n. The influence of thermal energy on superdeformed configurations is investigated through the analysis of the quasi-continuum spectra formed by E2 transitions among states of excited rotational bands with energy extending up to 4-5 MeV above the yrast line. In particular, the effective lifetimes of the discrete rotational bands forming ridge structures in {gamma}-{gamma} coincidence matrices is measured by a Doppler Shift Attenuation Method. The deduced quadrupole deformation of Q{sub t} {approx}10 eb indicates that the nucleus maintains its collectivity with increasing excitation energy, supporting the superdeformed character of the excited nuclear rotation. The obtained number of superdeformed discrete bands forming the ridge structures is found in good agreement with microscopic cranked shell model calculations including the decay-out process into the lower deformation minimum. In addition, the nuclear properties at higher excitation energies are investigated through the E1 {gamma}-decay of the giant dipole resonance (GDR). It is found that the intensity of the superdeformed yrast and excited bands increases by a factor of approximately 1.6 when a coincidence with a high-energy {gamma}-ray is required, showing the importance of the E1 cooling in the feeding mechanism of the superdeformed states. (orig.)

  8. Pygmies, Giants, and Skins

    CERN Document Server

    Piekarewicz, J

    2012-01-01

    Understanding the equation of state (EOS) of neutron-rich matter is a central goal of nuclear physics that cuts across a variety of disciplines. Indeed, the limits of nuclear existence, the collision of energetic heavy ions, the structure of neutron stars, and the dynamics of core-collapse supernova all depend critically on the nuclear-matter EOS. In this contribution I focus on the EOS of cold baryonic matter with special emphasis on its impact on the structure, dynamics, and composition of neutron stars. In particular, I discuss how laboratory experiments on neutron skins as well as on Pygmy and Giant resonances can help us elucidate the structure of these fascinating objects.

  9. Transforming giants.

    Science.gov (United States)

    Kanter, Rosabeth Moss

    2008-01-01

    Large corporations have long been seen as lumbering, inflexible, bureaucratic--and clueless about global developments. But recently some multinationals seem to be transforming themselves: They're engaging employees, moving quickly, and introducing innovations that show true connection with the world. Harvard Business School's Kanter ventured with a research team inside a dozen global giants--including IBM, Procter & Gamble, Omron, CEMEX, Cisco, and Banco Real--to discover what has been driving the change. After conducting more than 350 interviews on five continents, she and her colleagues came away with a strong sense that we are witnessing the dawn of a new model of corporate power: The coordination of actions and decisions on the front lines now appears to stem from widely shared values and a sturdy platform of common processes and technology, not from top-down decrees. In particular, the values that engage the passions of far-flung workforces stress openness, inclusion, and making the world a better place. Through this shift in what might be called their guidance systems, the companies have become as creative and nimble as much smaller ones, even while taking on social and environmental challenges of a scale that only large enterprises could attempt. IBM, for instance, has created a nonprofit partnership, World Community Grid, through which any organization or individual can donate unused computing power to research projects and see what is being done with the donation in real time. IBM has gained an inspiring showcase for its new technology, helped business partners connect with the company in a positive way, and offered individuals all over the globe the chance to contribute to something big.

  10. Giant Cell Arteritis

    Science.gov (United States)

    Giant cell arteritis is a disorder that causes inflammation of your arteries, usually in the scalp, neck, and arms. ... arteries, which keeps blood from flowing well. Giant cell arteritis often occurs with another disorder called polymyalgia ...

  11. Large Mn25 single-molecule magnet with spin S = 51/2: magnetic and high-frequency electron paramagnetic resonance spectroscopic characterization of a giant spin state.

    Science.gov (United States)

    Murugesu, Muralee; Takahashi, Susumu; Wilson, Anthony; Abboud, Khalil A; Wernsdorfer, Wolfgang; Hill, Stephen; Christou, George

    2008-10-20

    The synthesis and structural, spectroscopic, and magnetic characterization of a Mn25 coordination cluster with a large ground-state spin of S = 51/2 are reported. Reaction of MnCl2 with pyridine-2,6-dimethanol (pdmH2) and NaN3 in MeCN/MeOH gives the mixed valence cluster [Mn25O18(OH)2(N3)12(pdm)6(pdmH)6]Cl2 (1; 6Mn(II), 18Mn(III), Mn(IV)), which has a barrel-like cage structure. Variable temperature direct current (dc) magnetic susceptibility data were collected in the 1.8-300 K temperature range in a 0.1 T field. Variable-temperature and -field magnetization (M) data were collected in the 1.8-4.0 K and 0.1-7 T ranges and fit by matrix diagonalization assuming only the ground state is occupied at these temperatures. The fit parameters were S = 51/2, D = -0.020(2) cm(-1), and g = 1.87(3), where D is the axial zero-field splitting parameter. Alternating current (ac) susceptibility measurements in the 1.8-8.0 K range and a 3.5 G ac field oscillating at frequencies in the 50-1500 Hz range revealed a frequency-dependent out-of-phase (chi(M)'') signal below 3 K, suggesting 1 to be a single-molecule magnet (SMM). This was confirmed by magnetization vs dc field sweeps, which exhibited hysteresis loops but with no clear steps characteristic of resonant quantum tunneling of magnetization (QTM). However, magnetization decay data below 1 K were collected and used to construct an Arrhenius plot, and the fit of the thermally activated region above approximately 0.5 K gave U(eff)/k = 12 K, where U(eff) is the effective relaxation barrier. The g value and the magnitude and sign of the D value were independently confirmed by detailed high-frequency electron paramagnetic resonance (HFEPR) spectroscopy on polycrystalline samples. The combined studies confirm both the high ground-state spin S = 51/2 of complex 1 and that it is a SMM that, in addition, exhibits QTM.

  12. A possible proton pygmy resonance in 17Ne

    Institute of Scientific and Technical Information of China (English)

    2011-01-01

    The low-lying electric dipole strengths in proton-rich nuclei 17F and 17Ne, which can be produced at HIRFL-CSR in Lanzhou, are investigated. In the framework of the covariant density functional theory the self-consistent relativistic Hartree Bogoliubov model and the relativistic quasiparticle random phase approximation with the NL3 parameter set and Gogny pairing interaction are adopted in the calculations. A pronounced dipole peak appears below 10 MeV in17Ne, but does not occur in 17F. The prop erties of this low-lying E1 excitation in 17Ne are studied, which may correspond to a proton pygmy resonance with different characteristics from those of giant dipole resonance.

  13. Giant Cell Arteritis

    Science.gov (United States)

    ... Cryopyrin-Associated Autoinflammatory Syndrome (CAPS) (Juvenile) Dermatomyositis (Juvenile) Familial Mediterranean Fever (Juvenile) Fibromyalgia Giant Cell Arteritis Glucocorticoid-induced Osteoperosis ...

  14. Nanodielectrics with giant permittivity

    Indian Academy of Sciences (India)

    S K Saha

    2008-06-01

    Nanodielectrics is an emerging area of research because of its potential application in energy storage and transducers. One-dimensional metallic nanostructures with localized electronic wave functions show giant dielectric constant. Following the prediction, during the last couple of years we have investigated the effect of giant permittivity in one-dimensional systems of conventional metals and conjugated polymer chains. In this article, we have tried to summarize the works on giant permittivity and finally the fabrication of nanocapacitor using metal nanowires, which shows giant permittivity is also discussed.

  15. The Implementation of E1 Clock Recovery

    Directory of Open Access Journals (Sweden)

    Wang Ziyu

    2016-01-01

    Full Text Available Clock transform and recovery is of significant importance in microwave TDM service, and it is always extracted from the E1 line data stream in most cases. However, intrinsically uncertain delay and jitter caused by packet transmission of E1 data information, may lead to the indexes of the data recovery clock exceed the clock performance template. Through analysis of the E1 clock indexes and measuring methods, this paper proposes a new clock recovery method. The method employs two buffers, the first RAM is used as a buffer to deduct excess information, and the second FIFO is used as a buffer to recovery the clock and data. The first buffer has a feedback from the second one, and is able to actively respond to changes in the data link and requests from the second one. The test results validate the effectiveness of the method, and the corresponding scheme is also valuable for the other communication systems.

  16. Peripheral giant cell granuloma

    Directory of Open Access Journals (Sweden)

    Padam Narayan Tandon

    2012-01-01

    Full Text Available Peripheral giant cell granuloma or the so-called "giant cell epulis" is the most common oral giant cell lesion. It normally presents as a soft tissue purplish-red nodule consisting of multinucleated giant cells in a background of mononuclear stromal cells and extravasated red blood cells. This lesion probably does not represent a true neoplasm, but rather may be reactive in nature, believed to be stimulated by local irritation or trauma, but the cause is not certainly known. This article reports a case of peripheral giant cell granuloma arising at the maxillary anterior region in a 22-year-old female patient. The lesion was completely excised to the periosteum level and there is no residual or recurrent swelling or bony defect apparent in the area of biopsy after a follow-up period of 6 months.

  17. Painful Charcot-Marie-Tooth neuropathy type 2E/1F due to a novel NEFL mutation.

    Science.gov (United States)

    Doppler, Kathrin; Kunstmann, Erdmute; Krüger, Stefan; Sommer, Claudia

    2017-05-01

    Charcot-Marie-Tooth neuropathy (CMT) 2E/1F is caused by mutations in the neurofilament light-chain polypeptide (NEFL) gene. Giant axons are a histological hallmark frequently seen in nerves of patients with CMT2E. We describe the case of a 43-year-old patient with a painful, predominantly sensory neuropathy. The patient's sural nerve biopsy showed multiple giant axons. Genetic sequencing of the NEFL gene revealed that the patient was heterozygous for an altered sequence of the gene, c.816C>G, p.Asn272Lys, which has not yet been described in CMT2E/1F. In contrast to other cases of CMT2E/1F, where motor symptoms are predominant, pain was the most disabling symptom in this patient. Muscle Nerve 55: 752-755, 2017. © 2016 Wiley Periodicals, Inc.

  18. Tilting Saturn without tilting Jupiter: Constraints on giant planet migration

    CERN Document Server

    Brasser, R

    2015-01-01

    The migration and encounter histories of the giant planets in our Solar System can be constrained by the obliquities of Jupiter and Saturn. We have performed secular simulations with imposed migration and N-body simulations with planetesimals to study the expected obliquity distribution of migrating planets with initial conditions resembling those of the smooth migration model, the resonant Nice model and two models with five giant planets initially in resonance (one compact and one loose configuration). For smooth migration, the secular spin-orbit resonance mechanism can tilt Saturn's spin axis to the current obliquity if the product of the migration time scale and the orbital inclinations is sufficiently large (exceeding 30 Myr deg). For the resonant Nice model with imposed migration, it is difficult to reproduce today's obliquity values, because the compactness of the initial system raises the frequency that tilts Saturn above the spin precession frequency of Jupiter, causing a Jupiter spin-orbit resonance...

  19. Quantum Giant Magnons

    CERN Document Server

    Zarembo, K

    2008-01-01

    The giant magnons are classical solitons of the O(N) sigma-model, which play an important role in the AdS/CFT correspondence. We study quantum giant magnons first at large N and then exactly using Bethe Ansatz, where giant magnons can be interpreted as holes in the Fermi sea. We also identify a solvable limit of Bethe Ansatz in which it describes a weakly-interacting Bose gas at zero temperature. The examples include the O(N) model at large N, weakly interacting non-linear Schrodinger model, and nearly isotropic XXZ spin chain in the magnetic field.

  20. Dynamos of giant planets

    CERN Document Server

    Busse, F H; 10.1017/S1743921307000920

    2009-01-01

    Possibilities and difficulties of applying the theory of magnetic field generation by convection flows in rotating spherical fluid shells to the Giant Planets are outlined. Recent progress in the understanding of the distribution of electrical conductivity in the Giant Planets suggests that the dynamo process occurs predominantly in regions of semiconductivity. In contrast to the geodynamo the magnetic field generation in the Giant Planets is thus characterized by strong radial conductivity variations. The importance of the constraint on the Ohmic dissipation provided by the planetary luminosity is emphasized. Planetary dynamos are likely to be of an oscillatory type, although these oscillations may not be evident from the exterior of the planets.

  1. Giant Cell Fibroma

    OpenAIRE

    Tahere Nosratzehi; Lale Maleki

    2013-01-01

    Giant cell fibroma is a fibrous tumor which represents about 2 to 5% of all oral fibrotic proliferations. Compared to traumatic fibroma, giant (traumatic fibroma or irritation fibroma) cell fibroma occurs at a younger age. In about 60% of the cases the lesion is diagnosed within the first three decades of life and is slightly more in women. 50% of the cases is observed in the gum and will appear as a nodule with a papillary surface [1]. The giant cell fibroma is treated by conservative excisi...

  2. Metaphyseal giant cell tumor

    Energy Technology Data Exchange (ETDEWEB)

    Pereira, L.F.; Hemais, P.M.P.G.; Aymore, I.L.; Carmo, M.C.R. do; Cunha, M.E.P.R. da; Resende, C.M.C.

    Three cases of metaphyseal giant cell tumor are presented. A review of the literature is done, demostrating the lesion is rare and that there are few articles about it. Age incidence and characteristics of the tumor are discussed.

  3. The Giant Cell.

    Science.gov (United States)

    Stockdale, Dennis

    1998-01-01

    Provides directions for the construction of giant plastic cells, including details for building and installing the organelles. Also contains instructions for preparing the ribosomes, nucleolus, nucleus, and mitochondria. (DDR)

  4. Seismology of Giant Planets

    CERN Document Server

    Gaulme, Patrick; Schmider, Francois-Xavier; Guillot, Tristan

    2014-01-01

    Seismology applied to giant planets could drastically change our understanding of their deep interiors, as it has happened with the Earth, the Sun, and many main-sequence and evolved stars. The study of giant planets' composition is important for understanding both the mechanisms enabling their formation and the origins of planetary systems, in particular our own. Unfortunately, its determination is complicated by the fact that their interior is thought not to be homogeneous, so that spectroscopic determinations of atmospheric abundances are probably not representative of the planet as a whole. Instead, the determination of their composition and structure must rely on indirect measurements and interior models. Giant planets are mostly fluid and convective, which makes their seismology much closer to that of solar-like stars than that of terrestrial planets. Hence, helioseismology techniques naturally transfer to giant planets. In addition, two alternative methods can be used: photometry of the solar light ref...

  5. Giant magnetostrictive materials

    Institute of Scientific and Technical Information of China (English)

    LIU JingHua; JIANG ChengBao; XU HuiBin

    2012-01-01

    Giant magnetostrictive materials are a kind of functional materials developed since 1970s,known as their large magnetostrain and high energy density.In this paper,an introduction of magnetosttiction and the history of magnetostrictive materials are described firstly.Then we review the recent developments of both rare earth and non-rare earth magnetostrictive materials.Finally,the tendency of developing new giant magnetostrictive materials is presented.

  6. E1M1 and E1E2 transition probabilities in one-electron ions

    Science.gov (United States)

    Labzowsky, L. N.; Shonin, A. V.

    2004-12-01

    The quantum electrodynamical (QED) theory of the two-photon transitions in hydrogenlike ions is presented. The emission probability for 2s→2γ(E1)+1s transitions is calculated and compared to the results of the previous calculations. The emission probabilities 2p→γ(E1)+γ(E2)+1s and 2p→γ(E1)+γ(M1)+1s are also calculated for the nuclear charge Z values 1⩽Z⩽100. This is the first calculation of the two latter probabilities. The results are given in two different gauges.

  7. Red giant seismology: Observations

    Directory of Open Access Journals (Sweden)

    Mosser B.

    2013-03-01

    Full Text Available The CoRoT and Kepler missions provide us with thousands of red-giant light curves that allow a very precise asteroseismic study of these objects. Before CoRoT and Kepler, the red-giant oscillation patterns remained obscure. Now, these spectra are much more clear and unveil many crucial interior structure properties. For thousands of red giants, we can derive from seismic data precise estimates of the stellar mass and radius, the evolutionary status of the giants (with a clear difference between clump and RGB stars, the internal differential rotation, the mass loss, the distance of the stars... Analyzing this amount of information is made easy by the identification of the largely homologous red-giant oscillation patterns. For the first time, both pressure and mixed mode oscillation patterns can be precisely depicted. The mixed-mode analysis allows us, for instance, to probe directly the stellar core. Fine details completing the red-giant oscillation pattern then provide further information on the interior structure, including differential rotation.

  8. ′Face of the giant panda′ sign in Wilson′s disease : revisited.

    Directory of Open Access Journals (Sweden)

    Kuruvilla A

    2000-10-01

    Full Text Available We report a patient, with Wilson′s disease, who showed the characteristic radiological sign known as ′Face of the giant panda sign′ on magnetic resonance imaging (MRI of the brain.

  9. E1 and M1 strength functions at low energy

    Directory of Open Access Journals (Sweden)

    Schwengner Ronald

    2017-01-01

    Full Text Available We report photon-scattering experiments using bremsstrahlung at the γELBE facility of Helmholtz-Zentrum Dresden-Rossendorf and using quasi-monoenergetic, polarized γ beams at the HIγS facility of the Triangle Universities Nuclear Laboratory in Durham. To deduce the photoabsorption cross sections at high excitation energy and high level density, unresolved strength in the quasicontinuum of nuclear states has been taken into account. In the analysis of the spectra measured by using bremsstrahlung at γELBE, we perform simulations of statistical γ-ray cascades using the code γDEX to estimate intensities of inelastic transitions to low-lying excited states. Simulated average branching ratios are compared with model-independent branching ratios obtained from spectra measured by using monoenergetic γ beams at HIγS. E1 strength in the energy region of the pygmy dipole resonance is discussed in nuclei around mass 90 and in xenon isotopes. M1 strength in the region of the spin-flip resonance is also considered for xenon isotopes. The dipole strength function of 74Ge deduced from γELBE experiments is compared with the one obtained from experiments at the Oslo Cyclotron Laboratory. The low-energy upbend seen in the Oslo data is interpreted as M1 strength on the basis of shell-model calculations.

  10. Giant cell tumor of the flexor hallucis longus tendon sheath: a case study.

    Science.gov (United States)

    Findling, Jeff; Lascola, Natalie K; Groner, Thomas W

    2011-01-01

    Giant cell tumor of tendon sheath is infrequently documented in the foot and even less near the ankle. This case report involves such a tumor of the flexor hallucis longus tendon presenting at the posterior ankle. Diagnosis was aided by magnetic resonance imaging, and treatment consisted of complete surgical excision. Pathologic examination verified the diagnosis of giant cell tumor of tendon sheath, and follow-up magnetic resonance imaging revealed no remnants or recurrence of tumor 1 year after surgery.

  11. Thermal Giant Gravitons

    CERN Document Server

    Armas, Jay; Obers, Niels A; Orselli, Marta; Pedersen, Andreas Vigand

    2012-01-01

    We study the giant graviton solution as the AdS_5 X S^5 background is heated up to finite temperature. The analysis employs the thermal brane probe technique based on the blackfold approach. We focus mainly on the thermal giant graviton corresponding to a thermal D3-brane probe wrapped on an S^3 moving on the S^5 of the background at finite temperature. We find several interesting new effects, including that the thermal giant graviton has a minimal possible value for the angular momentum and correspondingly also a minimal possible radius of the S^3. We compute the free energy of the thermal giant graviton in the low temperature regime, which potentially could be compared to that of a thermal state on the gauge theory side. Moreover, we analyze the space of solutions and stability of the thermal giant graviton and find that, in parallel with the extremal case, there are two available solutions for a given temperature and angular momentum, one stable and one unstable. In order to write down the equations of mot...

  12. Rapidly rotating red giants

    CERN Document Server

    Gehan, Charlotte; Michel, Eric

    2016-01-01

    Stellar oscillations give seismic information on the internal properties of stars. Red giants are targets of interest since they present mixed modes, which behave as pressure modes in the convective envelope and as gravity modes in the radiative core. Mixed modes thus directly probe red giant cores, and allow in particular the study of their mean core rotation. The high-quality data obtained by CoRoT and Kepler satellites represent an unprecedented perspective to obtain thousands of measurements of red giant core rotation, in order to improve our understanding of stellar physics in deep stellar interiors. We developed an automated method to obtain such core rotation measurements and validated it for stars on the red giant branch. In this work, we particularly focus on the specific application of this method to red giants having a rapid core rotation. They show complex spectra where it is tricky to disentangle rotational splittings from mixed-mode period spacings. We demonstrate that the method based on the id...

  13. "Bi-modal" isoscalar giant dipole strength in Ni-58

    NARCIS (Netherlands)

    Nayak, B. K.; Garg, U.; Hedden, M.; Koss, M.; Li, T.; Liu, Y.; Rao, P. V. Madhusudhana; Zhu, S.; Itoh, M.; Sakaguchi, H.; Takeda, H.; Uchida, M.; Yasuda, Y.; Yosoi, M.; Fujimura, H.; Fujiwara, M.; Hara, K.; Kawabata, T.; Akimune, H.; Harakeh, M. N.

    2006-01-01

    The strength distribution of the isoscalar giant dipole resonance (ISGDR) in Ni-58 has been obtained over the energy range 10.5-49.5 MeV via extreme forward angle scattering (including 0 degrees) of 386 MeV alpha particles. We observe a "bi-modal" El strength distribution for the first time in an A

  14. Giant hepatic regenerative nodules in Alagille syndrome

    Energy Technology Data Exchange (ETDEWEB)

    Rapp, Jordan B. [Lewis Katz School of Medicine at Temple University, Department of Radiology, Temple University Hospital, Philadelphia, PA (United States); Bellah, Richard D.; Anupindi, Sudha A. [The Children' s Hospital of Philadelphia, Department of Radiology, Philadelphia, PA (United States); University of Pennsylvania, Perelman School of Medicine, Philadelphia, PA (United States); Maya, Carolina [The Children' s Hospital of Philadelphia, Department of Radiology, Philadelphia, PA (United States); Pawel, Bruce R. [University of Pennsylvania, Perelman School of Medicine, Philadelphia, PA (United States); The Children' s Hospital of Philadelphia, Department of Pathology and Laboratory Medicine, Philadelphia, PA (United States)

    2017-02-15

    Children with Alagille syndrome undergo surveillance radiologic examinations as they are at risk for developing cirrhosis and hepatocellular carcinoma. There is limited literature on the imaging of liver masses in Alagille syndrome. We report the ultrasound (US) and magnetic resonance imaging (MRI) appearances of incidental benign giant hepatic regenerative nodules in this population. To describe the imaging findings of giant regenerative nodules in patients with Alagille syndrome. A retrospective search of the hospital database was performed to find all cases of hepatic masses in patients with Alagille syndrome during a 10-year period. Imaging, clinical charts, laboratory data and available pathology were reviewed and analyzed and summarized for each patient. Twenty of 45 patients with confirmed Alagille syndrome had imaging studies. Of those, we identified six with giant focal liver masses. All six patients had large central hepatic masses that were remarkably similar on US and MRI, in addition to having features of cirrhosis. In each case, the mass was located in hepatic segment VIII and imaging showed the mass splaying the main portal venous branches at the hepatic hilum, as well as smaller portal and hepatic venous branches coursing through them. On MRI, signal intensity of the mass was isointense to liver on T1-weighted sequences in four of six patients, but hyperintense on T1 in two of six patients. In all six cases, the mass was hypointense on T2- weighted sequences. The mass post-contrast was isointense to adjacent liver in all phases in five the cases. Five out of six patients had pathological correlation demonstrating preserved ductal architecture confirming the final diagnosis of a regenerative nodule. Giant hepatic regenerative nodules with characteristic US and MR features can occur in patients with Alagille syndrome with underlying cirrhosis. Recognizing these lesions as benign giant hepatic regenerative nodules should, thereby, mitigate any need for

  15. E1M1 and E1E2 transition probabilities in one-electron ions

    Energy Technology Data Exchange (ETDEWEB)

    Labzowsky, L.N. [Institute of Physics, St. Petersburg State University, Uljanovskaya 1, Petrodvorets, 198904 St. Petersburg (Russian Federation) and Petersburg Nuclear Physics Institute, Gatchina, 188350 St. Petersburg (Russian Federation)]. E-mail: leonti@landau.phys.spbu.ru; Shonin, A.V. [Institute of Physics, St. Petersburg State University, Uljanovskaya 1, Petrodvorets, 198904 St. Petersburg (Russian Federation)

    2004-12-06

    The quantum electrodynamical (QED) theory of the two-photon transitions in hydrogenlike ions is presented. The emission probability for 2s1/2->2{gamma}(E1)+1s1/2 transitions is calculated and compared to the results of the previous calculations. The emission probabilities 2p1/2->{gamma}(E1)+{gamma}(E2)+1s1/2 and 2p1/2->{gamma}(E1)+{gamma}(M1)+1s1/2 are also calculated for the nuclear charge Z values 1=

  16. Giant star seismology

    CERN Document Server

    Hekker, S

    2016-01-01

    The internal properties of stars in the red-giant phase undergo significant changes on relatively short timescales. Long near-interrupted high-precision photometric timeseries observations from dedicated space missions such as CoRoT and Kepler have provided seismic inferences of the global and internal properties of a large number of evolved stars, including red giants. These inferences are confronted with predictions from theoretical models to improve our understanding of stellar structure and evolution. Our knowledge and understanding of red giants have indeed increased tremendously using these seismic inferences, and we anticipate that more information is still hidden in the data. Unraveling this will further improve our understanding of stellar evolution. This will also have significant impact on our knowledge of the Milky Way Galaxy as well as on exo-planet host stars. The latter is important for our understanding of the formation and structure of planetary systems.

  17. Giant choledochal calculosis: Surgical treatment

    Directory of Open Access Journals (Sweden)

    Hasan Bektas

    2014-01-01

    Full Text Available Context: Gallstone disease is one of the most common surgical pathologies. Choledocholithiasis may occur in some of these cases and require surgical intervention. Although there are relatively non-invasive procedures such as endoscopic retrograde cholangiopancreatography (ERCP, this technique is usually unsuccessful in patients with stones larger than 10 mm. In our case, we aimed to report a giant choledochal stone (15 cm × 4.5 cm, which is rare in surgical practice and our treatment with open surgery. Case Report: The patient was a 59-year-old woman. Magnetic resonance cholangiopancreatography (MRCP had showed a hydropic gallbladder with an excessively dilated CBD and a 110 mm × 41 mm stone. In the operation, an excessively dilated CBD was seen and after choledochotomy and a very large calculus that filled CBD completely. Choledochotomy incision was carried forward and a T-tube choledochostomy with choledochoduodenostomy (CD was performed. The patient was discharged without any complications on postoperative 8 th day. Conclusion: Benign gallstone disease is a multifactorial process, with risk factors such as obesity, hemolytic diseases, diabetes mellitus, and pregnancy. Risk factors for choledocholithiasis are similar to those for gallstone disease. MRCP is a non-invasive technique in detecting choledocholithiasis. The gold standard intervention for CBD stones is ERCP. Stones in CBD may reach very considerable dimensions without causing serious symptoms. The most common symptom is jaundice. During preoperative radiological examination, giant stones may be interfered with malignancies. Surgeons should obey conventional algorithms in diagnosis and open surgery must be kept in mind in earlier stages without being too insistent on endoscopic interventions.

  18. Giant cell tumor of soft tissue: a case report with emphasis on MR imaging

    Energy Technology Data Exchange (ETDEWEB)

    Lee, Moon Young; Jee, Won-Hee [The Catholic University of Korea, Department of Radiology, Seoul St. Mary' s Hospital, School of Medicine, Seocho-gu, Seoul (Korea, Republic of); Jung, Chan Kwon [The Catholic University of Korea, Department of Pathology, Seoul St. Mary' s Hospital, College of Medicine, Seocho-gu, Seoul (Korea, Republic of); Yoo, Ie Ryung [The Catholic University of Korea, Department of Nuclear Medicine, Seoul St. Mary' s Hospital, College of Medicine, Seocho-gu, Seoul (Korea, Republic of); Chung, Yang-Guk [The Catholic University of Korea, Department of Orthopedic Surgery, Seoul St. Mary' s Hospital, College of Medicine, Seocho-gu, Seoul (Korea, Republic of)

    2015-04-03

    Giant cell tumor of soft tissue is a rare neoplasm, histologically resembling giant cell tumor of bone. In this report, we describe a deep and solid giant cell tumor of soft tissue interpreted as a benign soft tissue tumor based on magnetic resonance (MR) findings with hypointense to intermediate signals on T2-weighted images and impeded diffusivity (water movement) on diffusion-weighted imaging (DWI), which could suggest a giant-cell-containing benign soft tissue tumor, despite the malignancy suggested by {sup 18}F-fluorodeoxyglucose positron emission tomography-computed tomography in a 35-year-old male. To our knowledge, this report introduces the first deep, solid giant cell tumor of soft tissue with MR features of a giant-cell-containing benign soft tissue tumor, despite the malignancy-mimicking findings on {sup 18}F-FDG PET-CT. (orig.)

  19. Adenovirus E1A/E1B Transformed Amniotic Fluid Cells Support Human Cytomegalovirus Replication

    Directory of Open Access Journals (Sweden)

    Natascha Krömmelbein

    2016-02-01

    Full Text Available The human cytomegalovirus (HCMV replicates to high titers in primary human fibroblast cell cultures. A variety of primary human cells and some tumor-derived cell lines do also support permissive HCMV replication, yet at low levels. Cell lines established by transfection of the transforming functions of adenoviruses have been notoriously resistant to HCMV replication and progeny production. Here, we provide first-time evidence that a permanent cell line immortalized by adenovirus type 5 E1A and E1B (CAP is supporting the full HCMV replication cycle and is releasing infectious progeny. The CAP cell line had previously been established from amniotic fluid cells which were likely derived from membranes of the developing fetus. These cells can be grown under serum-free conditions. HCMV efficiently penetrated CAP cells, expressed its immediate-early proteins and dispersed restrictive PML-bodies. Viral DNA replication was initiated and viral progeny became detectable by electron microscopy in CAP cells. Furthermore, infectious virus was released from CAP cells, yet to lower levels compared to fibroblasts. Subviral dense bodies were also secreted from CAP cells. The results show that E1A/E1B expression in transformed cells is not generally repressive to HCMV replication and that CAP cells may be a good substrate for dense body based vaccine production.

  20. Mass loss from red giants - Results from ultraviolet spectroscopy

    Science.gov (United States)

    Linsky, J. L.

    1985-01-01

    New instrumentation in space, primarily the IUE spacecraft, has enabled the application of ultraviolet spectroscopic techniques to the determination of physical properties and reliable mass loss rates for red giant winds. One important result is the determination of where in the H-R diagram are found stars with hot outer atmospheres and with cool winds. So far it appears that single cool stars, except perhaps the so-called hybrid stars, have either hot outer atmospheres or cool winds but not both. The C II resonance (1335 A) and intersystem (2325 A) multiplets have been used to derive temperatures, densities, and geometrical extents for the chromospheric portions of red giant winds, with the result that the red giants and the earlier giants with hot coronae have qualitatively different chromospheres. Mass loss rates can now be derived accurately from the analysis of asymmetric emission lines, such as the Mg II resonance lines, and from P Cygni profile lines of atoms in the dominant ionization stage when a hot star is available to probe the wind of a red giant. The Zeta Aur systems, consisting of a K-M supergiant and a main sequence B star are important systems for reliable mass loss rates for the red supergiant components are becoming available.

  1. Juvenile giant fibroadenoma

    Directory of Open Access Journals (Sweden)

    Vipul Yagnik

    2011-07-01

    Full Text Available Fibroadenomas are benign solid tumor associated with aberration of normal lobular development. Juvenile giant fibroadenoma is usually single and >5 cm in size /or >500 gms in weight. Important differential diagnoses are: phyllodes tumor and juvenile gigantomastia. Simple excision is the treatment of choice.

  2. Giant Congenital Melanocytic Nevus

    DEFF Research Database (Denmark)

    Rasmussen, Bo Sonnich; Henriksen, Trine Foged; Kølle, Stig-Frederik Trojahn

    2015-01-01

    Giant congenital melanocytic nevi (GCMN) occur in 1:20,000 livebirths and are associated with increased risk of malignant transformation. The treatment of GCMN from 1981 to 2010 in a tertiary referral center was reviewed evaluating the modalities used, cosmetic results, associated complications...

  3. Waking the Sleeping Giant

    NARCIS (Netherlands)

    Ollenburger, Mary H.; Descheemaeker, Katrien; Crane, Todd A.; Sanogo, Ousmane M.; Giller, Ken E.

    2016-01-01

    The World Bank argued that West Africa's Guinea Savannah zone forms part of “Africa's Sleeping Giant,” where increases in agricultural production could be an engine of economic growth, through expansion of cultivated land in sparsely populated areas. The district of Bougouni, in southern Mali,

  4. Microwave plasmatrons for giant integrated circuit processing

    Energy Technology Data Exchange (ETDEWEB)

    Petrin, A.B.

    2000-02-01

    A method for calculating the interaction of a powerful microwave with a plane layer of magnetoactive low-pressure plasma under conditions of electron cyclotron resonance is presented. In this paper, the plasma layer is situated between a plane dielectric layer and a plane metal screen. The calculation model contains the microwave energy balance, particle balance, and electron energy balance. The equation that expressed microwave properties of nonuniform magnetoactive plasma is found. The numerical calculations of the microwave-plasma interaction for a one-dimensional model of the problem are considered. Applications of the results for microwave plasmatrons designed for processing giant integrated circuits are suggested.

  5. Main: 1E1E [RPSD[Archive

    Lifescience Database Archive (English)

    Full Text Available 1E1E トウモロコシ Corn Zea mays L. Beta-Glucosidase, Chloroplast Precursor Name=Glu1; Zea...TDDAYASQEVNGPDGKPIGPPMGNPWIYMYPEGLKDLLMIMKNKYGNPPIYITENGIGDVDTKETPLPMEAALNDYKRLDYIQRHIATLKESIDLGSNVQGYFAWSLLDNFEWFAGFTERYGIVYVDRNNNCTRYMKESAKWLKEFNTAKKPSKKILTPA corn_1E1E.jpg ...

  6. Main: 1E1F [RPSD[Archive

    Lifescience Database Archive (English)

    Full Text Available 1E1F トウモロコシ Corn Zea mays L. Beta-Glucosidase, Chloroplast Precursor Name=Glu1; Zea...QRHIATLKESIDLGSNVQGYFAWSLLDNFEWFAGFTERYGIVYVDRNNNCTRYMKESAKWLKEFNTAKKPSKKILTPA corn_1E1F.jpg ...

  7. Giant Cell Arteritis.

    Science.gov (United States)

    Hoffman, Gary S

    2016-11-01

    This issue provides a clinical overview of giant cell arteritis, focusing on diagnosis, treatment, and practice improvement. The content of In the Clinic is drawn from the clinical information and education resources of the American College of Physicians (ACP), including MKSAP (Medical Knowledge and Self-Assessment Program). Annals of Internal Medicine editors develop In the Clinic in collaboration with the ACP's Medical Education and Publishing divisions and with the assistance of additional science writers and physician writers.

  8. Intraoral giant condyloma acuminatum

    Directory of Open Access Journals (Sweden)

    Gupta R

    2001-09-01

    Full Text Available A case of intraoral giant condyloma acuminatum is reported in a 50- year- old Indian. He did not respond to topical application of podophyllin 20% but responded partially to electric cauterisation. Surgical excision was done to get rid of the warty growh completely. Since there were no skin or genital lesions and no history of marital or extramarital sexual contact the lesion was probably acquired from environmental sources. Nonsexual transmission should be considered especially when the lesions are extragenital.

  9. Giant Otters in Peru

    Directory of Open Access Journals (Sweden)

    Schenk C.

    1992-02-01

    Full Text Available We are in the second year of fieldwork surveying for Giant Otters in the southeastern rainforest of Peru, in three areas with differing levels of legal protection. While there is some illegal hunting still happening outside the protected areas, the main threat to the otters is badly-conducted tourism. Well-organised tourism can be a promising argument for establishing protected areas like national parks.

  10. A giant graviton genealogy

    CERN Document Server

    Lozano, Yolanda; Prinsloo, Andrea

    2013-01-01

    In this article we extend the construction of giant gravitons from holomorphic surfaces [arXiv:hep-th/0010206] to the ABJM correspondence. We construct a new class of 1/6-BPS M5-branes wrapping 5-manifolds in S^7/Z_k and supported by a large angular momentum in the orbifold space. These orbifold giant gravitons undergo a supersymmetry enhancement to 1/3-BPS and 1/2-BPS configurations in special cases. The compactification of M-theory on AdS_4 x S^7/Z_k to type IIA superstring theory on AdS_4 x CP^3 then gives rise to another new class of 1/6-BPS D4 and NS5-branes wrapping 4 and 5-manifolds in CP^3. The D4-branes carry a combination of D0-brane charge and angular momentum in the complex projective space, while the NS5-branes are supported only by D0-brane charge. Finally, we present a detailed analysis of a one-parameter family of 1/2-BPS M5-brane orbifold giant gravitons, and their D4 and NS5-brane CP^3 descendants.

  11. Giant prolactinomas in women

    DEFF Research Database (Denmark)

    Delgrange, Etienne; Raverot, Gerald; Bex, Marie

    2014-01-01

    OBJECTIVE: To characterise distinctive clinical features of giant prolactinomas in women. DESIGN: A multicentre, retrospective case series and literature review. METHODS: We collected data from 15 female patients with a pituitary tumour larger than 4 cm and prolactin levels above 1000 μg/l and id......OBJECTIVE: To characterise distinctive clinical features of giant prolactinomas in women. DESIGN: A multicentre, retrospective case series and literature review. METHODS: We collected data from 15 female patients with a pituitary tumour larger than 4 cm and prolactin levels above 1000 μg....../l and identified 19 similar cases from the literature; a gender-based comparison of the frequency and age distribution was obtained from a literature review. RESULTS: The initial PubMed search using the term 'giant prolactinomas' identified 125 patients (13 women) responding to the inclusion criteria. The female......:male ratio was 1:9. Another six female patients were found by extending the literature search, while our own series added 15 patients. The median age at diagnosis was 44 years in women compared with 35 years in men (Pwomen (n=34), we...

  12. Multicentric Giant Cell Tumor of Bone: Synchronous and Metachronous Presentation

    Directory of Open Access Journals (Sweden)

    Reiner Wirbel

    2013-01-01

    Full Text Available A 27-year-old man treated 2.5 years ago for synchronous multicentric giant cell tumor of bone located at the right proximal humerus and the right 5th finger presented now with complaints of pain in his right hip and wrist of two-month duration. Radiology and magnetic resonance revealed multicentric giant cell tumor lesions of the right proximal femur, the left ileum, the right distal radius, and the left distal tibia. The patient has an eighteen-year history of a healed osteosarcoma of the right tibia that was treated with chemotherapy, resection, and allograft reconstruction. A literature review establishes this as the first reported case of a patient with synchronous and metachronous multicentric giant cell tumor who also has a history of osteosarcoma.

  13. Giant bullae mimicking tension pneumothorax

    Directory of Open Access Journals (Sweden)

    Ahmet Erbey

    2012-12-01

    Full Text Available Giant bullae may mimic tension pneumothorax radiologicallyso that it may expand completely to hemithorax,increase of radiolucency mediastinal shift, flattening ofdiaphragm and printing on trachea. Sixty one year oldmale patient with giant bullae misdiagnosed as tensionpneumothorax and underwent to tube thoracostomy. Thedifferential diagnosis of giant bullae and tension pneumothoraxmay be confusing. The therapeutic approaches ofthese two radiologically similar entities differ significantly.Thus proper physical assessment and radiological examinationis crucial in the differential diagnosis and computedtomography examination should be performed before theadjustment of therapy. J Clin Exp Invest 2012; 3(4: 548-551Key words: Tension pneumothorax, giant bullae, computedtomography, tube thoracostomy

  14. Superdimensional Metamaterial Resonators

    CERN Document Server

    Greenleaf, Allan; Kurylev, Yaroslav; Lassas, Matti; Uhlmann, Gunther

    2014-01-01

    We propose a fundamentally new method for the design of metamaterial arrays, valid for any waves modeled by the Helmholtz equation, including scalar optics and acoustics. The design and analysis of these devices is based on eigenvalue and eigenfunction asymptotics of solutions to Schr\\"odinger wave equations with harmonic and degenerate potentials. These resonators behave superdimensionally, with a higher local density of eigenvalues and greater concentration of waves than expected from the physical dimension, e.g., planar resonators function as 3- or higher-dimensional media, and bulk material as effectively of dimension 4 or higher. Applications include antennas with a high density of resonant frequencies and giant focussing, and are potentially broadband.

  15. CYP2E1-catalyzed oxidation contributes to the sperm toxicity of 1-bromopropane in mice.

    Science.gov (United States)

    Garner, C Edwin; Sloan, C; Sumner, S C J; Burgess, J; Davis, J; Etheridge, A; Parham, A; Ghanayem, B I

    2007-03-01

    1-bromopropane (1-BrP) induces dose- and time-dependent reproductive organ toxicity and reduced sperm motility in rodents. The contribution of cytochrome P4502E1 (CYP2E1) to both 1-BrP metabolism and the induction of male reproductive toxicity was investigated using wild-type (WT) and Cyp2e1-/- mice. In gas uptake inhalation studies, the elimination half-life of [1,2,3-(13)C]-1-BrP was longer in Cyp2e1-/- mice relative to WT (3.2 vs. 1.3 h). Urinary metabolites were identified by 13C nuclear magnetic resonance. The mercapturic acid of 1-bromo-2-hydroxypropane (2OHBrP) was the major urinary metabolite in WT mice, and products of conjugation of 1-BrP with glutathione (GSH) were insignificant. The ratio of GSH conjugation to 2-hydroxylation increased 5-fold in Cyp2e1-/- mice relative to WT. After 1-BrP exposure, hepatic GSH was decreased by 76% in WT mice vs. 47% in Cyp2e1-/- mice. Despite a 170% increase in 1-BrP exposure in Cyp2e1-/- vs. WT mice, sperm motility in exposed Cyp2e1-/- mice did not change relative to unexposed matched controls. This suggests that metabolites produced through CYP2E1-mediated oxidation may be responsible for 1-BrP-induced sperm toxicity. Both 1-BrP and 2OHBrP inhibited the motility of sperm obtained from WT mice in vitro. However, only 2OHBrP reduced the motility of sperm obtained from Cyp2e1-/- mice in vitro, suggesting that conversion of parent compound to 2OHBrP within the spermatozoa may contribute, at least in part, to reduced motility. Overall, these data suggest that metabolism of 1-BrP is mediated in part by CYP2E1, and activation of 1BrP via this enzyme may contribute to the male reproductive toxicity of this chemical.

  16. Imaging Extrasolar Giant Planets

    Science.gov (United States)

    Bowler, Brendan P.

    2016-10-01

    High-contrast adaptive optics (AO) imaging is a powerful technique to probe the architectures of planetary systems from the outside-in and survey the atmospheres of self-luminous giant planets. Direct imaging has rapidly matured over the past decade and especially the last few years with the advent of high-order AO systems, dedicated planet-finding instruments with specialized coronagraphs, and innovative observing and post-processing strategies to suppress speckle noise. This review summarizes recent progress in high-contrast imaging with particular emphasis on observational results, discoveries near and below the deuterium-burning limit, and a practical overview of large-scale surveys and dedicated instruments. I conclude with a statistical meta-analysis of deep imaging surveys in the literature. Based on observations of 384 unique and single young (≈5-300 Myr) stars spanning stellar masses between 0.1 and 3.0 M ⊙, the overall occurrence rate of 5-13 M Jup companions at orbital distances of 30-300 au is {0.6}-0.5+0.7 % assuming hot-start evolutionary models. The most massive giant planets regularly accessible to direct imaging are about as rare as hot Jupiters are around Sun-like stars. Dividing this sample into individual stellar mass bins does not reveal any statistically significant trend in planet frequency with host mass: giant planets are found around {2.8}-2.3+3.7 % of BA stars, planets spanning a broad range of masses and ages.

  17. GIANT PROSTHETIC VALVE THROMBUS

    Directory of Open Access Journals (Sweden)

    Prashanth Kumar

    2015-04-01

    Full Text Available Mechanical prosthetic valves are predisposed to bleeding, thrombosis & thromboembolic complications. Overall incidence of thromboembolic complications is 1% per year who are on oral anticoagulants, whereas bleeding complications incidence is 0.5% to 6.6% per year. 1, 2 Minimization of Scylla of thromboembolic & Charybdis of bleeding complication needs a balancing act of optimal antithrombotic therapy. We are reporting a case of middle aged male patient with prosthetic mitral valve presenting in heart failure. Patient had discontinued anticoagulants, as he had subdural hematoma in the past. He presented to our institute with a giant prosthetic valve thrombus.

  18. A Giant Urethral Calculus.

    Science.gov (United States)

    Sigdel, G; Agarwal, A; Keshaw, B W

    2014-01-01

    Urethral calculi are rare forms of urolithiasis. Majority of the calculi are migratory from urinary bladder or upper urinary tract. Primary urethral calculi usually occur in presence of urethral stricture or diverticulum. In this article we report a case of a giant posterior urethral calculus measuring 7x3x2 cm in a 47 years old male. Patient presented with acute retention of urine which was preceded by burning micturition and dribbling of urine for one week. The calculus was pushed in to the bladder through the cystoscope and was removed by suprapubic cystolithotomy.

  19. Giant infantile pulmonary hemangioma

    Energy Technology Data Exchange (ETDEWEB)

    Pandya, Rajul; Tummala, Venkat [Hurley Medical Center One Hurley Plaza, Department of Radiology, Flint, MI (United States)

    2010-12-15

    We present a very unusual case of giant infantile pulmonary hemangioma presenting as a large solitary pulmonary mass. This was successfully managed with surgical resection. Histological examination revealed that the mass was positive for GLUT-1 receptor, a marker for infantile hemangioma. To our knowledge only a few cases of pulmonary hemangioma have been described previously in the literature. Pulmonary hemangiomas are very rare lesions, most of them presenting as a pulmonary mass. This case emphasizes the fact that this rare lesion should be considered in the differential of an enhancing pulmonary mass in an infant. (orig.)

  20. Multiple giant congenital melanocytic nevi with central nervous system melanosis: A case report

    Directory of Open Access Journals (Sweden)

    Ahuja S

    2003-10-01

    Full Text Available A case of multiple giant congenital melanocytic naevi in whom central nervous system melanosis was detected at 6 weeks of age is described. The infant was asymptomatic, but presence of risk factors such as multiple naevi, giant naevi and naevi on scalp and posterior axial location prompted a magnetic resonance imaging study of the brain. To our knowledge, neurocutaneous melanosis at such a young age has not been reported in Indian literature.

  1. Giant Pandas and Their Conservation

    Institute of Scientific and Technical Information of China (English)

    GarethDavey

    2004-01-01

    IT is paradoxical that themost well-known conservation symbol in the world,the giant panda, is a criti-cally endangered species.The estimated 1,600 thatremain live in the high-altitude for-ests of southwest China (within theprovinces of Sichuan, Gansu andShaanxi). Giant pandas are popularand elicit affection and admiration

  2. Famine Threatens the Giant Panda

    Institute of Scientific and Technical Information of China (English)

    2005-01-01

    Large swathes of arrow bamboo groves at and above 2,700 meters in the Piankou Nature Reserve in Sichuan's Mianyang are producing purple blooms, and some groves have started to wither and die. An absence of bamboo means famine for giant pandas living there. Sichuan has consequently activated its giant panda contingency plan.

  3. Giant Intradiverticular Bladder Tumor

    Science.gov (United States)

    Noh, Mohamad Syafeeq Faeez Md; Aziz, Ahmad Fuad Abdul; Ghani, Khairul Asri Mohd; Siang, Christopher Lee Kheng; Yunus, Rosna; Yusof, Mubarak Mohd

    2017-01-01

    Patient: Male, 74 Final Diagnosis: Giant intradiverticular bladder tumor with metastasis Symptoms: Hematuria Medication:— Clinical Procedure: — Specialty: Urology Objective: Rare disease Background: Intradiverticular bladder tumors are rare. This renders diagnosis of an intradiverticular bladder tumor difficult. Imaging plays a vital role in achieving the diagnosis, and subsequently staging of the disease. Case Report: A 74-year-old male presented to our center with a few months history of constitutional symptoms. Upon further history, he reported hematuria two months prior to presentation, which stopped temporarily, only to recur a few days prior to coming to the hospital. The patient admitted to having lower urinary tract symptoms. However, there was no dysuria, no sandy urine, and no fever. Palpation of his abdomen revealed a vague mass at the suprapubic region, which was non tender. In view of his history and the clinical examination findings, an ultrasound of the abdomen and computed tomography (CT) was arranged. These investigations revealed a giant tumor that seemed to be arising from a bladder diverticulum, with a mass effect and hydronephrosis. He later underwent operative intervention. Conclusions: Intradiverticular bladder tumors may present a challenge to the treating physician in an atypical presentation; thus requiring a high index of suspicion and knowledge of tumor pathophysiology. As illustrated in our case, CT with its wide availability and multiplanar imaging capabilities offers a useful means for diagnosis, disease staging, operative planning, and follow-up. PMID:28246375

  4. Rapidly Evolving Giant Dermatofibroma

    Directory of Open Access Journals (Sweden)

    K. J. Lang

    2010-01-01

    Full Text Available Dermatofibroma, also known as “fibrous histiocytoma”, is a benign dermal or subcutaneous poorly circumscribed proliferation of spindle-shaped fibroblasts and macrophages in the dermis. Although it is commonly present as a brownish nodule the legs of females, it may also arise on the upper extremities, trunk, and rarely on the head. The exact pathogenesis is unclear. However, it is widely believed that the originating insult to the dermis is a folliculitis, an arthropod bite, or an unspecified initial inflammatory condition. Giant dermatofibromas of greater than 5 cm in diameter are rare, with only 22 cases reported in the literature. We present a case of a rapidly evolving pedunculated mass in the groin of a male patient. Histological examination confirmed this to be a giant dermatofibroma. Though this specimen cannot is not confirmed as such, the cellular subtype is sometimes present as a larger lesion with anecdotal reports of local recurrence and distant metastases. The clinical and radiological features which were somewhat suspicious of malignancy are considered in the context of the definitive pathological diagnosis of a benign lesion.

  5. A Case of Giant Uterine Lipoleiomyoma Simulating Malignancy

    OpenAIRE

    Erbil Karaman; Numan Çim; Gülay Bulut; Gülhan Elçi; Esra Andıç; Mustafa Tekin; Ali Kolusarı

    2015-01-01

    Introduction. Uterine leiomyoma is the most common benign pathology in women and lipoleiomyoma is an extremely rare and specific type of leiomyoma. Here, we report an unusual case of giant pedunculated subserous lipoleiomyoma misdiagnosed preoperatively as leiomyosarcoma. Case. A 45-year-old woman admitted to our gynecology outpatient clinic for complaints of abdominal distention, tiredness, and pelvic pain for the last 6 months. Sonography and abdominal magnetic resonance imaging (MRI) showe...

  6. Separation of Pygmy Dipole and M1 Resonances in Zr90 by a High-Resolution Inelastic Proton Scattering Near 0°

    Science.gov (United States)

    Iwamoto, C.; Utsunomiya, H.; Tamii, A.; Akimune, H.; Nakada, H.; Shima, T.; Yamagata, T.; Kawabata, T.; Fujita, Y.; Matsubara, H.; Shimbara, Y.; Nagashima, M.; Suzuki, T.; Fujita, H.; Sakuda, M.; Mori, T.; Izumi, T.; Okamoto, A.; Kondo, T.; Bilgier, B.; Kozer, H. C.; Lui, Y.-W.; Hatanaka, K.

    2012-06-01

    A high-resolution measurement of inelastic proton scattering off Zr90 near 0° was performed at 295 MeV with a focus on a pronounced strength previously reported in the low-energy tail of giant dipole resonance. A forest of fine structure was observed in the excitation energy region 7-12 MeV. A multipole decomposition analysis of the angular distribution for the forest was carried out using the ECIS95 distorted-wave Born approximation code with the Hartree-Fock plus random-phase approximation model of E1 and M1 transition densities and inclusion of E1 Coulomb excitation. The analysis separated pygmy dipole and M1 resonances in the forest at EPDR=9.15±0.18MeV with ΓPDR=2.91±0.64MeV and at EM1=9.53±0.06MeV with ΓM1=2.70±0.17MeV in the Lorentzian function, respectively. The B(E1)↑ value for pygmy dipole resonance over 7-11 MeV is 0.75±0.08e2fm2, which corresponds to 2.1±0.2% of the Thomas-Reiche-Kuhn sum rule.

  7. Reinflating Giant Planets

    Science.gov (United States)

    Kohler, Susanna

    2017-01-01

    Two new, large gas-giant exoplanets have been discovered orbiting close to their host stars. A recent study examining these planets and others like them may help us to better understand what happens to close-in hot Jupiters as their host stars reach the end of their main-sequence lives.OversizedGiantsUnbinned transit light curves for HAT-P-65b. [Adapted from Hartman et al. 2016]The discovery of HAT-P-65b and HAT-P-66b, two new transiting hot Jupiters, is intriguing. These planets have periods of just under 3 days and masses of roughly 0.5 and 0.8 times that of Jupiter, but their sizes are whats really interesting: they have inflated radii of 1.89 and 1.59 times that of Jupiter.These two planets, discovered using the Hungarian-made Automated Telescope Network (HATNet) in Arizona and Hawaii, mark the latest in an ever-growing sample of gas-giant exoplanets with radii larger than expected based on theoretical planetary structure models.What causes this discrepancy? Did the planets just fail to contract to the expected size when they were initially formed, or were they reinflated later in their lifetimes? If the latter, how? These are questions that scientists are only now starting to be able to address using statistics of the sample of close-in, transiting planets.Unbinned transit light curves for HAT-P-66b. [Hartman et al. 2016]Exploring Other PlanetsLed by Joel Hartman (Princeton University), the team that discovered HAT-P-65b and HAT-P-66b has examined these planets observed parameters and those of dozens of other known close-in, transiting exoplanets discovered with a variety of transiting exoplanet missions: HAT, WASP, Kepler, TrES, and KELT. Hartman and collaborators used this sample to draw conclusions about what causes some of these planets to have such large radii.The team found that there is a statistically significant correlation between the radii of close-in giant planets and the fractional ages of their host stars (i.e., the stars age divided by its full

  8. CYP2E1 Metabolism of Styrene Involves Allostery

    OpenAIRE

    2012-01-01

    We are the first to report allosterism during styrene oxidation by recombinant CYP2E1 and human liver microsomes. At low styrene concentrations, oxidation is inefficient because of weak binding to CYP2E1 (Ks = 830 μM). A second styrene molecule then binds CYP2E1 with higher affinity (Kss = 110 μM) and significantly improves oxidation to achieve a kcat of 6.3 nmol · min−1 · nmol CYP2E1−1. The transition between these metabolic cycles coincides with reported styrene concentrations in blood from...

  9. Proton pygmy resonances: predictions for N=20 isotones

    CERN Document Server

    Kim, Y

    2015-01-01

    We study theoretically the low-energy electric-dipole response of N=20 isotones to assess the possibility of detecting a proton-pygmy mode in the near future and to examine the factors that would determine such an outcome. We present results from a quasiparticle random-phase approximation (QRPA) and a continuum random-phase approximation (CRPA), and we compare our results with other calculations of proton-rich nuclei. According to our analysis, enhanced E1 strength is expected energetically well below the giant dipole resonance in the proton-rich isotones. A proton-skin oscillation could develop especially in 46Fe. We identify factors which affect theoretical predictions, besides the equation of state (EoS) of infinite matter: the nucleon separation energy, accordingly the proper description of non localized threshold transitions, and the nucleon effective mass in mean-field treatments. Future measurements of E1 transitions in proton-rich nuclei and comparisons with mirror stable nuclei could help disentangle...

  10. Design and fabrication of a low frequency giant magnetostrictive transducer

    Energy Technology Data Exchange (ETDEWEB)

    Dhilsha, K.R. [Nat. Inst. of Ocean Technol, Madras (India); Markandeyulu, G.; Subrahmanyeswara Rao, B.V.P.; Rama Rao, K.V.S. [Magnetism and Magnetic Materials Laboratory, Department of Physics, Indian Institute of Technology, Madras 600 036 (India)

    1997-08-01

    A Tonpilz-type single ended transducer employing two rods of giant magnetostrictive materials has been fabricated and its underwater acoustic characteristics have been studied. The transducer resonated at a frequency of 3.1 kHz in air and at 2.65 kHz in water with a Q factor of 6. The TCR and RS at resonance in water have been measured to be 172.1 dB re 1 {mu}Pa/A at 1 m and -196.7 dB re 1 V/{mu}Pa respectively. The dimensions of the transducer are 60 mm in diameter and 110 mm long. (orig.)

  11. CYP2E1 autoantibodies in liver diseases

    Science.gov (United States)

    Sutti, Salvatore; Rigamonti, Cristina; Vidali, Matteo; Albano, Emanuele

    2014-01-01

    Autoimmune reactions involving cytochrome P4502E1 (CYP2E1) are a feature of idiosyncratic liver injury induced by halogenated hydrocarbons and isoniazid, but are also detectable in about one third of the patients with advanced alcoholic liver disease (ALD) and chronic hepatitis C (CHC). In these latter the presence of anti-CYP2E1 auto-antibodies is an independent predictor of extensive necro-inflammation and fibrosis and worsens the recurrence of hepatitis following liver transplantation, indicating that CYP2E1-directed autoimmunity can contribute to hepatic injury. The molecular characterization of the antigens recognized by anti-CYP2E1 auto-antibodies in ALD and CHC has shown that the targeted conformational epitopes are located in close proximity on the molecular surface. Furthermore, these epitopes can be recognized on CYP2E1 expressed on hepatocyte plasma membranes where they can trigger antibody-mediated cytotoxicity. This does not exclude that T cell-mediated responses against CYP2E1 might also be involved in causing hepatocyte damage. CYP2E1 structural modifications by reactive metabolites and molecular mimicry represent important factors in the breaking of self-tolerance against CYP2E1 in, respectively, ALD and CHC. However, genetic or acquired interferences with the mechanisms controlling the homeostasis of the immune system are also likely to contribute. More studies are needed to better characterize the impact of anti-CYP2E1 autoimmunity in liver diseases particularly in relation to the fact that common metabolic alterations such as obesity and diabetes stimulates hepatic CYP2E1 expression. PMID:25462068

  12. New insights into FoxE1 functions: identification of direct FoxE1 targets in thyroid cells.

    Directory of Open Access Journals (Sweden)

    Lara P Fernández

    Full Text Available BACKGROUND: FoxE1 is a thyroid-specific forkhead transcription factor essential for thyroid gland development, as well as for the maintenance of the thyroid differentiated state in adults. FoxE1 recognizes and binds to a short DNA sequence present in thyroglobulin (Tg and thyroperoxidase (Tpo promoters, but FoxE1 binding to regulatory regions other than Tg and Tpo promoters remains almost unexplored. Improving knowledge of the regulatory functions of FoxE1 is necessary to clarify its role in endocrine syndromes and cancer susceptibility. METHODOLOGY/PRINCIPAL FINDING: In order to further investigate downstream FoxE1 targets, we performed a genome-wide expression screening after knocking-down FoxE1 and obtained new insights into FoxE1 transcriptional networks in thyroid follicular cells. After validation, we confirmed Adamts9, Cdh1, Duox2 and S100a4 as upregulated genes and Casp4, Creld2, Dusp5, Etv5, Hsp5a, Nr4a2 and Tm4sf1 as downregulated genes when FoxE1 was silenced. In promoter regions of putative FoxE1-regulated genes and also in the promoters of the classical thyroid genes Nis, Pax8 and Titf1, we performed an in silico search of the FoxE1 binding motif that was in close proximity to the NF1/CTF binding sequence, as previously described for other forkhead factors. Using chromatin immunoprecipitation we detected specific in vivo FoxE1 binding to novel regulatory regions in two relevant thyroid genes, Nis and Duox2. Moreover, we demonstrated simultaneous binding of FoxE1 and NF1/CTF to the Nis upstream enhancer region, as well as a clear functional activation of the Nis promoter by both transcription factors. CONCLUSIONS/SIGNIFICANCE: In search for potential downstream mediators of FoxE1 function in thyroid cells, we identified two novel direct FoxE1 target genes. To our knowledge, this is the first evidence regarding the implication of Nis and Duox2 in executing the transcriptional program triggered by FoxE1. Furthermore, this study points

  13. 26 CFR 1.927(e)-1 - Special sourcing rule.

    Science.gov (United States)

    2010-04-01

    ... 26 Internal Revenue 10 2010-04-01 2010-04-01 false Special sourcing rule. 1.927(e)-1 Section 1.927... (CONTINUED) INCOME TAXES Earned Income of Citizens of United States § 1.927(e)-1 Special sourcing rule. (a... under section 925 with respect to such transaction applied to such transaction. This special sourcing...

  14. 26 CFR 1.514(e)-1 - Allocation rules.

    Science.gov (United States)

    2010-04-01

    ... 26 Internal Revenue 7 2010-04-01 2010-04-01 true Allocation rules. 1.514(e)-1 Section 1.514(e)-1... Allocation rules. Where only a portion of property is debt-financed property, proper allocation of the basis...)(iii) of § 1.514(b)-1 for illustrations of proper allocation....

  15. 26 CFR 1.642(e)-1 - Depreciation and depletion.

    Science.gov (United States)

    2010-04-01

    ... 26 Internal Revenue 8 2010-04-01 2010-04-01 false Depreciation and depletion. 1.642(e)-1 Section 1... (CONTINUED) INCOME TAXES Estates, Trusts, and Beneficiaries § 1.642(e)-1 Depreciation and depletion. An estate or trust is allowed the deductions for depreciation and depletion, but only to the extent...

  16. Seesaw nystagmus caused by giant pituitary adenoma: case report Nistagmo em gangorra causado por adenoma pituitário gigante: relato de caso

    OpenAIRE

    Frederico Castelo Moura; Allan Christian Pieroni Gonçalves; Mário Luiz Ribeiro Monteiro

    2006-01-01

    Giant pituitary adenomas are uncommonly large tumors, greater than 4 cm in size that can produces endocrine symptoms, visual loss and cranial nerve palsies. We report the rare occurrence of seesaw nystagmus as the presenting sign of giant pituitary adenoma. A 50-year-old man presented with headache associated with visual loss and seesaw nystagmus. Perimetry revealed bitemporal hemianopia and magnetic resonance imaging showed a giant pituitary adenoma. After surgery, nystagmus disappeared. Our...

  17. [Giant esophageal fibrovascular polyp].

    Science.gov (United States)

    Palacios, Fernando; Contardo, Carlos; Guevara, Jorge; Vera, Augusto; Aguilar, Luis; Huamán, Manuel; Palomino, Américo; Yabar, Alejandro

    2003-01-01

    Fibrovascular polyps are extremely rare benign neoplasias of the esophagus, which usually originate in the lower cricoid area. They do not produce any discomfort in the patient for a long time, however it may make itself evident by the patient's regurgitation of the polyp, producing asphyxia or, more frequently, dysphagia. The case of a 58 year old male patient is presented herein, with a 9 month record of dysphagia, weight loss and intermittent melena. The barium x-ray showed a distended esophagus, with a tumor running from the upper esophageal sphincter to the cardia. The endoscopy confirmed the presence of a pediculated tumor, implanted in the cervical esophagus. Surgeons suspected the potential malignancy of the tumor and performed a transhiatal esophagectomy. The final pathologic diagnosis was giant fibrovascular esophageal polyp.

  18. Giant arachnoid granulation mimicking dural sinus thrombosis.

    Science.gov (United States)

    Ayaz, Ercan; Atalay, Basak; Baysal, Begumhan; Senturk, Senem; Aslan, Ahmet

    2017-01-01

    Arachnoid granulations (AG) are composed of dense, collagenous connective tissue that includes clusters of arachnoid cells. They tend to invaginate into the dural sinuses, through which cerebrospinal fluid enters the venous system. AG are most commonly seen at the junction between the middle and lateral thirds of the transverse sinuses near the entry sites of the superficial veins. Presently described is the case of a 21-year-old female who presented at the clinic with recurrent headaches. Magnetic resonance (MR) imaging revealed a 3.5-cm lesion, which extended from confluens sinuum through the superior sagittal sinus. The lesion had created a scallop-shaped area of erosion in the neighboring occipital bone. To exclude sinus thrombosis, MR venography was performed, which displayed a maintained venous flow around the lesion. Headaches were treated symptomatically with medical therapy. Giant AG can be misdiagnosed as dural sinus thrombosis. MR imaging combined with MR venography is the most useful diagnostic tool to differentiate giant AG from dural sinus thrombosis.

  19. A giant Ordovician anomalocaridid.

    Science.gov (United States)

    Van Roy, Peter; Briggs, Derek E G

    2011-05-26

    Anomalocaridids, giant lightly sclerotized invertebrate predators, occur in a number of exceptionally preserved early and middle Cambrian (542-501 million years ago) biotas and have come to symbolize the unfamiliar morphologies displayed by stem organisms in faunas of the Burgess Shale type. They are characterized by a pair of anterior, segmented appendages, a circlet of plates around the mouth, and an elongate segmented trunk lacking true tergites with a pair of flexible lateral lobes per segment. Disarticulated body parts, such as the anterior appendages and oral circlet, had been assigned to a range of taxonomic groups--but the discovery of complete specimens from the middle Cambrian Burgess Shale showed that these disparate elements all belong to a single kind of animal. Phylogenetic analyses support a position of anomalocaridids in the arthropod stem, as a sister group to the euarthropods. The anomalocaridids were the largest animals in Cambrian communities. The youngest unequivocal examples occur in the middle Cambrian Marjum Formation of Utah but an arthropod retaining some anomalocaridid characteristics is present in the Devonian of Germany. Here we report the post-Cambrian occurrence of anomalocaridids, from the Early Ordovician (488-472 million years ago) Fezouata Biota in southeastern Morocco, including specimens larger than any in Cambrian biotas. These giant animals were an important element of some marine communities for about 30 million years longer than previously realized. The Moroccan specimens confirm the presence of a dorsal array of flexible blades attached to a transverse rachis on the trunk segments; these blades probably functioned as gills.

  20. The Giant Magnetocaloric Effect

    Science.gov (United States)

    Pecharsky, Vitalij K.

    1998-03-01

    Since the discovery of the magnetocaloric effect in pure iron by E.Warburg in 1881, it has been measured experimentally on many magnetic metals and compounds. The majority of the materials studied order magnetically undergoing a second order phase transformation. The magnetocaloric effect, typically peaking near the Curie or the Néel temperature, generally ranges from 0.5 to 2 K (in terms of adiabatic temperature change) or at 1 to 4 J/kg K (in terms of isothermal magnetic entropy change) per 1 T magnetic field change. The giant magnetocaloric effect recently discovered in Gd_5(Si_xGe_1-x)4 alloys, where x refrigerant capacity, which is the measure of how much heat can be transferred from a cold to a hot reservoir in one ideal thermodynamic cycle, is larger than that of the best second order phase transition materials by 25 to 100%. When the Gd_5(Si_xGe_1-x)4 alloys are compared with other known materials, which show first order magnetic phase transition, such as Dy, Ho, Er, HoCo_2, NdMn_2Si_2, Fe_0.49Rh_0.51, and (Hf_0.83Ta_0.17)Fe_2+x, only Fe_0.49Rh_0.51 has comparable magnetocaloric properties. However, the first order magnetic phase transition in Fe_0.49Rh_0.51 is irreversible, and the magnetocaloric effect disappears after one magnetizing/demagnetizing cycle. A study of the crystal structure, thermodynamics, and magnetism of the Gd_5(Si_xGe_1-x)4 alloys, where 0 basic relations between the composition, the crystal structure, and the change in thermodynamics and magnetocaloric properties, which occur in the Gd_5(Si_xGe_1-x)4 system, and which brings about the giant magnetocaloric effect when x <= 0.5.

  1. CYP2E1 Metabolism of Styrene Involves Allostery

    Science.gov (United States)

    Hartman, Jessica H.; Boysen, Gunnar

    2012-01-01

    We are the first to report allosterism during styrene oxidation by recombinant CYP2E1 and human liver microsomes. At low styrene concentrations, oxidation is inefficient because of weak binding to CYP2E1 (Ks = 830 μM). A second styrene molecule then binds CYP2E1 with higher affinity (Kss = 110 μM) and significantly improves oxidation to achieve a kcat of 6.3 nmol · min−1 · nmol CYP2E1−1. The transition between these metabolic cycles coincides with reported styrene concentrations in blood from exposed workers; thus, this CYP2E1 mechanism may be relevant in vivo. Scaled modeling of the in vitro-positive allosteric mechanism for styrene metabolism to its in vivo clearance led to significant deviations from the traditional model based on Michaelis-Menten kinetics. Low styrene levels were notably much less toxic than generally assumed. We interrogated the allosteric mechanism using the CYP2E1-specific inhibitor and drug 4-methylpyrazole, which we have shown binds two CYP2E1 sites. From the current studies, styrene was a positive allosteric effector on 4-methylpyrazole binding, based on a 10-fold increase in 4-methylpyrazole binding affinity from Ki 0.51 to Ksi 0.043 μM. The inhibitor was a negative allosteric effector on styrene oxidation, because kcat decreased 6-fold to 0.98 nmol · min−1 · nmol CYP2E1−1. Consequently, mixtures of styrene and other molecules can induce allosteric effects on binding and metabolism by CYP2E1 and thus mitigate the efficiency of their metabolism and corresponding effects on human health. Taken together, our elucidation of mechanisms for these allosteric reactions provides a powerful tool for further investigating the complexities of CYP2E1 metabolism of drugs and pollutants. PMID:22807108

  2. New probe of M1 and E1 strengths in GDR regions

    Energy Technology Data Exchange (ETDEWEB)

    Hayakawa, T. [Japan Atomic Energy Agency and National Astronomical Observatory in Japan (Japan); Ogata, K. [RCNP, Osaka University (Japan); Miyamoto, S.; Mochizuki, T.; Horikawa, K.; Amano, S. [University of Hyogo (Japan); Imazaki, K.; Li, D.; Izawa, Y. [Institute for Laser Technology (Japan); Chiba, S. [Tokyo Institute of Technology (Japan)

    2014-05-02

    The M1 strengths (or level density of 1{sup +} states) are of importance for estimation of interaction strengths between neutrinos and nuclei for the study of the supernova neutrino-process. In 1957, Agodi predicted theoretically angular distribution of neutrons emitted from states excited via dipole transitions with linearly polarized gamma-ray beam at the polar angle of θ=90° should be followed by a simple function, a + b cos(2φ), where φ, is azimuthal angel. However, this theoretical prediction has not been verified over the wide mass region except for light nuclei as deuteron. We have measured neutron angular distributions with (polarized gamma, n) reactions on Au, Nal, and Cu. We have verified the Agodi's prediction for the first time over the wide mass region. This suggests that (polarized gamma, n) reactions may be useful tools to study M1 strengths in giant resonance regions.

  3. A giant frontoethmoid mucocele with intracranial extension.

    Science.gov (United States)

    Işık, Abdülcemal Ümit; Arslan, Selçuk; Arslan, Erhan; Baykal, Süleyman

    2015-02-01

    Mucoceles are mucus-containing cysts lined by epithelium. Although benign, they may show expansive growth and remain undiagnosed until symptoms due to compression of surrounding structures arise. We report a rare case of frontoethmoid mucocele with intracranial extension in an 80-year-old woman with complaints of headache, right diplopia and proptosis. A right frontoorbital craniotomy was performed, and a mucocele in the frontal sinus extending into the frontal lobe and orbit was totally removed. The patient was successfully treated without any complication. The two-year follow-up results were satisfactory. Magnetic resonance imaging excluded any recurrence of the mucocele. Combined intranasal and transcranial approach is necessary to treat giant frontoetmoid mucoceles with intracranial extension. © The Author(s) 2014 Reprints and permissions: sagepub.co.uk/journalsPermissions.nav.

  4. The Resonant Transneptunian Populations

    CERN Document Server

    Gladman, B; Petit, J-M; Kavelaars, J; Jones, R L; Parker, J Wm; Van Laerhoven, C; Nicholson, P; Rousselot, P; Bieryla, A; Ashby, M L N

    2012-01-01

    The transneptunian objects (TNOs) trapped in mean-motion resonances with Neptune were likely emplaced there during planet migration late in the giant-planet formation process. We perform detailed modelling of the resonant objects detected in the Canada-France Ecliptic Plane Survey (CFEPS) in order to provide population estimates and, for some resonances, constrain the complex internal orbital element distribution. Detection biases play a critical role because phase relationships with Neptune make object discovery more likely at certain longitudes. This paper discusses the 3:2, 5:2, 2:1, 3:1, 5:1, 4:3, 5:3, 7:3, 5:4, and 7:4 mean-motion resonances, all of which had CFEPS detections, along with our upper limit on 1:1 Neptune Trojans (which is consistent with their small population estimated elsewhere). For the plutinos (TNOs in the 3:2 resonance) we refine the orbital element distribution given in Kavelaars et al. (2009) and show that steep H-magnitude distributions (N(H) proportional to 10aH, with a=0.8-0.9) a...

  5. Landscape of the lost giants

    Science.gov (United States)

    2013-09-01

    The Pleistocene megafauna extinction erased a group of remarkable animals. Whether humans had a prominent role in the extinction remains controversial, but it is emerging that the disappearance of the giants has markedly affected the environment.

  6. Atmospheres of Extrasolar Giant Planets

    CERN Document Server

    Marley, M S; Seager, S; Barman, T; Marley, Mark S.; Fortney, Jonathan; Seager, Sara; Barman, Travis

    2006-01-01

    The key to understanding an extrasolar giant planet's spectrum--and hence its detectability and evolution--lies with its atmosphere. Now that direct observations of thermal emission from extrasolar giant planets are in hand, atmosphere models can be used to constrain atmospheric composition, thermal structure, and ultimately the formation and evolution of detected planets. We review the important physical processes that influence the atmospheric structure and evolution of extrasolar giant planets and consider what has already been learned from the first generation of observations and modeling. We pay particular attention to the roles of cloud structure, metallicity, and atmospheric chemistry in affecting detectable properties through Spitzer Space Telescope observations of the transiting giant planets. Our review stresses the uncertainties that ultimately limit our ability to interpret EGP observations. Finally we will conclude with a look to the future as characterization of multiple individual planets in a ...

  7. Atmospheres of Extrasolar Giant Planets

    Science.gov (United States)

    Marley, Mark

    2006-01-01

    The next decade will almost certainly see the direct imaging of extrasolar giant planets around nearby stars. Unlike purely radial velocity detections, direct imaging will open the door to characterizing the atmosphere and interiors of extrasola planets and ultimately provide clues on their formation and evolution through time. This process has already begun for the transiting planets, placing new constraints on their atmospheric structure, composition, and evolution. Indeed the key to understanding giant planet detectability, interpreting spectra, and constraining effective temperature and hence evolution-is the atmosphere. I will review the universe of extrasolar giant planet models, focusing on what we have already learned from modeling and what we will likely be able to learn from the first generation of direct detection data. In addition to these theoretical considerations, I will review the observations and interpretation of the - transiting hot Jupiters. These objects provide a test of our ability to model exotic atmospheres and challenge our current understanding of giant planet evolution.

  8. Annular Elastolytic Giant Cell Granuloma

    Directory of Open Access Journals (Sweden)

    Khandpur Sujay

    2001-01-01

    Full Text Available The clinical and histopathological features of annular elastolytic giant cell granuloma in a 42â€"year-old female patient are described. The condition presented as annular erythematous plaques over sun- exposed skin sparing the face. Histopathology revealed dense granulomatous infiltrate consisting of numerous giant cells and lymphohistiocytes without any palisading arrangement or necrobiosis. The features differentiating it from other similar granulomatous disorders are discussed.

  9. Resonant Removal of Exomoons During Planetary Migration

    CERN Document Server

    Spalding, Christopher; Adams, Fred C

    2015-01-01

    Jupiter and Saturn play host to an impressive array of satellites, making it reasonable to suspect that similar systems of moons might exist around giant extrasolar planets. Furthermore, a significant population of such planets is known to reside at distances of several Astronomical Units (AU), leading to speculation that some moons thereof might support liquid water on their surfaces. However, giant planets are thought to undergo inward migration within their natal protoplanetary disks, suggesting that gas giants currently occupying their host star's habitable zone formed further out. Here we show that when a moon-hosting planet undergoes inward migration, dynamical interactions may naturally destroy the moon through capture into a so-called "evection resonance." Within this resonance, the lunar orbit's eccentricity grows until the moon eventually collides with the planet. Our work suggests that moons orbiting within about 10 planetary radii are susceptible to this mechanism, with the exact number dependent ...

  10. A Case of Giant Uterine Lipoleiomyoma Simulating Malignancy.

    Science.gov (United States)

    Karaman, Erbil; Çim, Numan; Bulut, Gülay; Elçi, Gülhan; Andıç, Esra; Tekin, Mustafa; Kolusarı, Ali

    2015-01-01

    Introduction. Uterine leiomyoma is the most common benign pathology in women and lipoleiomyoma is an extremely rare and specific type of leiomyoma. Here, we report an unusual case of giant pedunculated subserous lipoleiomyoma misdiagnosed preoperatively as leiomyosarcoma. Case. A 45-year-old woman admitted to our gynecology outpatient clinic for complaints of abdominal distention, tiredness, and pelvic pain for the last 6 months. Sonography and abdominal magnetic resonance imaging (MRI) showed a giant semisolid mass that filled whole abdominal cavity from pelvis to subdiaphragmatic area. A primary diagnosis of uterine sarcoma or ovarian malignancy was made. On operation, total abdominal hysterectomy with a pedunculated mass of size 30 × 23 × 12 cm and weighing 5.4 kg and bilateral salpingo-oophorectomy were performed. The histopathology revealed a lipoleiomyoma with extensive cystic and fatty degeneration without any malignancy. Discussion. The diagnosis of leiomyoma is done usually with pelvic ultrasound but sometimes it is difficult to reach a correct diagnosis especially in cases of giant and pedunculated lipoleiomyoma that included fatty tissue which may mimick malignancy. Conclusion. Subserous pedunculated giant lipoleiomyoma should be kept in mind in the differential diagnosis of leiomyosarcoma or ovarian malignancy.

  11. A Case of Giant Uterine Lipoleiomyoma Simulating Malignancy

    Directory of Open Access Journals (Sweden)

    Erbil Karaman

    2015-01-01

    Full Text Available Introduction. Uterine leiomyoma is the most common benign pathology in women and lipoleiomyoma is an extremely rare and specific type of leiomyoma. Here, we report an unusual case of giant pedunculated subserous lipoleiomyoma misdiagnosed preoperatively as leiomyosarcoma. Case. A 45-year-old woman admitted to our gynecology outpatient clinic for complaints of abdominal distention, tiredness, and pelvic pain for the last 6 months. Sonography and abdominal magnetic resonance imaging (MRI showed a giant semisolid mass that filled whole abdominal cavity from pelvis to subdiaphragmatic area. A primary diagnosis of uterine sarcoma or ovarian malignancy was made. On operation, total abdominal hysterectomy with a pedunculated mass of size 30 × 23 × 12 cm and weighing 5.4 kg and bilateral salpingo-oophorectomy were performed. The histopathology revealed a lipoleiomyoma with extensive cystic and fatty degeneration without any malignancy. Discussion. The diagnosis of leiomyoma is done usually with pelvic ultrasound but sometimes it is difficult to reach a correct diagnosis especially in cases of giant and pedunculated lipoleiomyoma that included fatty tissue which may mimick malignancy. Conclusion. Subserous pedunculated giant lipoleiomyoma should be kept in mind in the differential diagnosis of leiomyosarcoma or ovarian malignancy.

  12. A distance regular graph of type E1 Ed

    Institute of Scientific and Technical Information of China (English)

    2000-01-01

    In this note, the distance regular graph of type E1 Ed is considered and some characterization of the type graph is given. The results generalize the characterization of tight distance regular graphs.

  13. Inhibition of human papillomavirus DNA replication by an E1-derived p80/UAF1-binding peptide.

    Science.gov (United States)

    Lehoux, Michaël; Fradet-Turcotte, Amélie; Lussier-Price, Mathieu; Omichinski, James G; Archambault, Jacques

    2012-04-01

    The papillomavirus E1 helicase is recruited by E2 to the viral origin, where it assembles into a double hexamer that orchestrates replication of the viral genome. We previously identified the cellular WD40 repeat-containing protein p80/UAF1 as a novel interaction partner of E1 from anogenital human papillomavirus (HPV) types. p80 was found to interact with the first 40 residues of HPV type 31 (HPV31) E1, and amino acid substitutions within this domain abrogated the maintenance of the viral episome in keratinocytes. In this study, we report that these p80-binding substitutions reduce by 70% the ability of E1 to support transient viral DNA replication without affecting its interaction with E2 and assembly at the origin in vivo. Microscopy studies revealed that p80 is relocalized from the cytoplasm to discrete subnuclear foci by E1 and E2. Chromatin immunoprecipitation assays further revealed that p80 is recruited to the viral origin in an E1- and E2-dependent manner. Interestingly, overexpression of a 40-amino-acid-long p80-binding peptide, derived from HPV31 E1, was found to inhibit viral DNA replication by preventing the recruitment of endogenous p80 to the origin. Mutant peptides defective for p80 interaction were not inhibitory, demonstrating the specificity of this effect. Characterization of this E1 peptide by nuclear magnetic resonance (NMR) showed that it is intrinsically disordered in solution, while mapping studies indicated that the WD repeats of p80 are required for E1 interaction. These results provide additional evidence for the requirement for p80 in anogenital HPV DNA replication and highlight the potential of E1-p80 interaction as a novel antiviral target.

  14. 5s correlation confinement resonances in Xe-endo-fullerenes

    CERN Document Server

    Dolmatov, V K

    2011-01-01

    Spectacular trends in the modification of the Xe 5s photoionization via interchannel coupling with confinement resonances emerging in the Xe 4d giant resonance upon photoionization of the Xe@C60, Xe@C240 and Xe@C60@C240 endo-fullerenes are theoretically unraveled and interpreted.

  15. Bringing Low the Giants

    CERN Multimedia

    2001-01-01

    Their work goes on unseen, because they a hundred metres beneath your feet. But while the race against the clock to build the LHC has begun on the surface, teams underground are feverishly engaged to dismantle LEP and its experiments. Four months after the start of dismantling, the technical coordinators of the different experiments discuss the progress of work. Little men attack the giant ALEPH. The barrel and its two endcaps have been removed to the end of the cavern and stripped of their cables. The breaking up of the detector can now begin. At ALEPH, counting rooms removed all in one go Jean-Paul Fabre, technical coordinator at ALEPH:'After making safe the structure, the first step was to remove the wiring and cables. Some 210 cubic metres were brought out. Then the counting rooms all round the detector were taken out. They were brought up from the cavern all in one go, up through the shaft, which is 10 metres wide and 150 metres deep. They made it with 15 centimetres to spare. They have been emptied of...

  16. Giant high occipital encephalocele

    Directory of Open Access Journals (Sweden)

    Agrawal Amit

    2016-03-01

    Full Text Available Encephaloceles are rare embryological mesenchymal developmental anomalies resulting from inappropriate ossification in skull through with herniation of intracranial contents of the sac. Encephaloceles are classified based on location of the osseous defect and contents of sac. Convexity encephalocele with osseous defect in occipital bone is called occipital encephalocele. Giant occipital encephaloceles can be sometimes larger than the size of baby skull itself and they pose a great surgical challenge. Occipital encephaloceles (OE are further classified as high OE when defect is only in occipital bone above the foramen magnum, low OE when involving occipital bone and foramen magnum and occipito-cervical when there involvement of occipital bone, foramen magnum and posterior upper neural arches. Chiari III malformation can be associated with high or low occipital encephaloceles. Pre-operatively, it is essential to know the size of the sac, contents of the sac, relation to the adjacent structures, presence or absence of venous sinuses/vascular structures and osseous defect size. Sometimes it becomes imperative to perform both CT and MRI for the necessary information. Volume rendered CT images can depict the relation of osseous defect to foramen magnum and provide information about upper neural arches which is necessary in classifying these lesions.

  17. Giant cell arteritis.

    Science.gov (United States)

    Ninan, Jem; Lester, Susan; Hill, Catherine

    2016-02-01

    Giant cell arteritis (GCA) is the most common vasculitis of the elderly. The diagnosis can be challenging at times because of the limitation of the American Rheumatology Association (ARA) classification criteria and the significant proportion of biopsy-negative patients with GCA. We discuss the role of advanced imaging techniques, including positron emission tomography (PET) scanning, in establishing diagnosis and improved histopathology techniques to improve the sensitivity of temporal artery biopsy. There have been significant advances in the understanding of the pathogenesis of GCA, particularly the role of cytokine pathways such as the interleukins, IL-6-IL-17 axis, and the IL-12-interferon-γ axis and their implication for new therapies. We highlight that glucocorticoids remain the primary treatment for GCA, but recognize the risk of steroid-induced side effects. A number of pharmacotherapies to enable glucocorticoid dose reduction and prevent relapse have been studied. Early diagnosis and fast-track pathways have improved outcomes by encouraging adherence to evidence-based practice. Copyright © 2016 Elsevier Ltd. All rights reserved.

  18. Rotation of Giant Stars

    CERN Document Server

    Kissin, Yevgeni

    2015-01-01

    The internal rotation of post-main sequence stars is investigated, in response to the convective pumping of angular momentum toward the stellar core, combined with a tight magnetic coupling between core and envelope. The spin evolution is calculated using model stars of initial mass 1, 1.5 and $5\\,M_\\odot$, taking into account mass loss on the giant branches and the partitioning of angular momentum between the outer and inner envelope. We also include the deposition of orbital angular momentum from a sub-stellar companion, as influenced by tidal drag as well as the excitation of orbital eccentricity by a fluctuating gravitational quadrupole moment. A range of angular velocity profiles $\\Omega(r)$ is considered in the deep convective envelope, ranging from solid rotation to constant specific angular momentum. We focus on the backreaction of the Coriolis force on the inward pumping of angular momentum, and the threshold for dynamo action in the inner envelope. Quantitative agreement with measurements of core ro...

  19. Imaging Extrasolar Giant Planets

    CERN Document Server

    Bowler, Brendan P

    2016-01-01

    High-contrast adaptive optics imaging is a powerful technique to probe the architectures of planetary systems from the outside-in and survey the atmospheres of self-luminous giant planets. Direct imaging has rapidly matured over the past decade and especially the last few years with the advent of high-order adaptive optics systems, dedicated planet-finding instruments with specialized coronagraphs, and innovative observing and post-processing strategies to suppress speckle noise. This review summarizes recent progress in high-contrast imaging with particular emphasis on observational results, discoveries near and below the deuterium-burning limit, and a practical overview of large-scale surveys and dedicated instruments. I conclude with a statistical meta-analysis of deep imaging surveys in the literature. Based on observations of 384 unique and single young ($\\approx$5--300~Myr) stars spanning stellar masses between 0.1--3.0~\\Msun, the overall occurrence rate of 5--13~\\Mjup \\ companions at orbital distances ...

  20. Preclinical safety assessment of Ad[I/PPT-E1A], a novel oncolytic adenovirus for prostate cancer.

    Science.gov (United States)

    Schenk, Ellen; Essand, Magnus; Kraaij, Robert; Adamson, Rachel; Maitland, Norman J; Bangma, Chris H

    2014-03-01

    Prostate cancer is the most common malignancy in the Western world. Patients can be cured only when the tumor has not metastasized outside the prostate. However, treatment with curative intent fails in a significant number of men, often resulting in untreatable progressive disease with a fatal outcome. Oncolytic adenovirus therapy may be a promising adjuvant treatment to reduce local failure or the outgrowth of micrometastatic disease. Within the European gene therapy consortium GIANT, we have developed a novel prostate-specific oncolytic adenovirus: Ad[I/PPT-E1A]. This adenovirus specifically kills prostate cells via prostate-specific replication. This article describes the clinical development of Ad[I/PPT-E1A] with particular reference to the preclinical safety assessment of this novel virus. The preclinical safety assessment involved an efficacy study in a human orthotopic xenograft mouse model, a specificity study in human primary cells, and a toxicity study in normal mice. These studies confirmed that Ad[I/PPT-E1A] efficiently kills prostate tumor cells in vivo, is not harmful to other organs, and is well tolerated in mice after systemic delivery. The safety, as well as the immunological effects of Ad[I/PPT-E1A] as a local adjuvant therapy, will now be studied in a phase I dose-escalating trial in patients with localized prostate cancer who are scheduled for curative radical prostatectomy and can be used as an updated paradigm for similar therapeutic viruses.

  1. Pre-clinical safety assessment of Ad[I/PPT-E1A], a novel oncolytic adenovirus for prostate cancer.

    Science.gov (United States)

    Schenk, Ellen; Essand, Magnus; Kraaij, Robert; Adamson, Rachel; Maitland, Norman; Bangma, Chris H

    2014-02-18

    Prostate cancer is the most common malignancy in the Western world. Patients can only be cured when the tumour has not metastasised outside the prostate. However, treatment with curative intent fails in a significant number of men, often resulting in untreatable progressive disease with a fatal outcome. Oncolytic adenovirus therapy may be a promising adjuvant treatment to reduce local failure or the outgrowth of micrometastatic disease. Within the European gene therapy consortium GIANT, we have developed a novel prostate-specific oncolytic adenovirus: Ad[I/PPT-E1A] that specifically kills prostate cells via prostate-specific replication. This paper describes the clinical development of Ad[I/PPT-E1A] with particular reference to the pre-clinical safety assessment of this novel virus. The pre-clinical safety assessment involved an efficacy study in a human orthotopic xenograft mouse model, a specificity study in human primary cells and a toxicity study in normal mice. These studies confirmed that Ad[I/PPT-E1A] efficiently kills prostate tumour cells in vivo, is not harmful to other organs and is well-tolerated in mice after systemic delivery. The safety, as well as the immunological effects of Ad[I/PPT-E1A] as a local adjuvant therapy will now be studied in a phase I dose-escalating trial in patients with localised prostate cancer who are scheduled for curative radical prostatectomy and can be used as an updated paradigm for similar therapeutic viruses.

  2. Constructing the secular architecture of the solar system I: The giant planets

    CERN Document Server

    Alessandro, Morbidelli; Tsiganis, Kleomenis; Gomes, Rodney; Levison, Harold F

    2009-01-01

    Using numerical simulations, we show that smooth migration of the giant planets through a planetesimal disk leads to an orbital architecture that is inconsistent with the current one: the resulting eccentricities and inclinations of their orbits are too small. The crossing of mutual mean motion resonances by the planets would excite their orbital eccentricities but not their orbital inclinations. Moreover, the amplitudes of the eigenmodes characterising the current secular evolution of the eccentricities of Jupiter and Saturn would not be reproduced correctly; only one eigenmode is excited by resonance-crossing. We show that, at the very least, encounters between Saturn and one of the ice giants (Uranus or Neptune) need to have occurred, in order to reproduce the current secular properties of the giant planets, in particular the amplitude of the two strongest eigenmodes in the eccentricities of Jupiter and Saturn.

  3. Arthroscopic Decompression for a Giant Meniscal Cyst.

    Science.gov (United States)

    Ohishi, Tsuyoshi; Suzuki, Daisuke; Matsuyama, Yukihiro

    2016-01-01

    The authors report the case of a giant medial meniscal cyst in an osteoarthritic knee of an 82-year-old woman that was successfully treated with only arthroscopic cyst decompression. The patient noticed a painful mass on the medial side of the right knee that had been gradually growing for 5 years. Magnetic resonance imaging showed an encapsulated large medial cystic mass measuring 80×65×40 mm that was adjacent to the medial meniscus. An accompanying horizontal tear was also detected in the middle and posterior segments of the meniscus. The medial meniscus was resected up to the capsular attachment to create bidirectional flow between the joint and the cyst with arthroscopic surgery. Magnetic resonance imaging performed 14 months postoperatively showed that the cyst had completely disappeared, and no recurrence was observed during a 2-year follow-up period. An excellent result could be obtained by performing limited meniscectomy to create a channel leading to the meniscal cyst, even though the cyst was large. Among previously reported cases of meniscal cysts, this case is the largest to be treated arthroscopically without open excision.

  4. Oncolytic Replication of E1b-Deleted Adenoviruses

    Directory of Open Access Journals (Sweden)

    Pei-Hsin Cheng

    2015-11-01

    Full Text Available Various viruses have been studied and developed for oncolytic virotherapies. In virotherapy, a relatively small amount of viruses used in an intratumoral injection preferentially replicate in and lyse cancer cells, leading to the release of amplified viral particles that spread the infection to the surrounding tumor cells and reduce the tumor mass. Adenoviruses (Ads are most commonly used for oncolytic virotherapy due to their infection efficacy, high titer production, safety, easy genetic modification, and well-studied replication characteristics. Ads with deletion of E1b55K preferentially replicate in and destroy cancer cells and have been used in multiple clinical trials. H101, one of the E1b55K-deleted Ads, has been used for the treatment of late-stage cancers as the first approved virotherapy agent. However, the mechanism of selective replication of E1b-deleted Ads in cancer cells is still not well characterized. This review will focus on three potential molecular mechanisms of oncolytic replication of E1b55K-deleted Ads. These mechanisms are based upon the functions of the viral E1B55K protein that are associated with p53 inhibition, late viralmRNAexport, and cell cycle disruption.

  5. Primary scientific results of Chang’E-1 lunar mission

    Institute of Scientific and Technical Information of China (English)

    2010-01-01

    The strategic plan for the development of the unmanned Chinese Lunar Exploration Program is characterized by three distinct stages: "orbiting around", "landing on" and "returning from" the Moon. The first Chinese lunar probe, Chang’E-1, which was successfully launched on October 24th, 2007 at Xichang Satellite Launch Center, and guided to crash on the Moon on March 1st, 2009, at 52.36°E, 1.50°S, in the north of Mare Fecunditatis, is the first step towards the "orbiting around" stage. The Chang’E-1 mission lasted 495 days, exceeding the expected life-span by about four months. A total of 1.37 TB raw data was received from Chang’E-1. It was then processed into 4 TB scientific data products at various levels. Many scientific results have been obtained by analyzing these data, including especially the "global lunar image from the first Chinese lunar explora- tion mission". All scientific goals of Chang’E-1 have been achieved. It provides much useful materials for further advances of lunar sciences and planetary chemistry. Meanwhile, these results will serve as a firm basis for future Chinese lunar missions.

  6. Performance Analysis of Two Ethernet over E1 Schemes

    Institute of Scientific and Technical Information of China (English)

    CHEN Wentao; JIN Depeng; ZENG Lieguang

    2007-01-01

    The Ethernet over E1 approach,which takes advantage of widely deployed telecom networks,is an efficient and economical way to interconnect two Ethernets in different regions.Two Ethernet over E1 schemes, namely a byte granularity scheme and a frame granularity scheme are discussed. The byte granularity scheme partitions Ethernet frames into several pieces for transmission and has a strict requirement on the maximum delay difference of multiple E1 links. To solve this problem, the newly proposed frame granularity scheme transmits separately each frame through E1 links without any partitioning. The architecture designs of both schemes are presented. This paper evaluates the throughput and delay performances of both schemes, both analytically from results calculated from delay models and using test results from field programmable gate array (FPGA) implementation. Although the frame granularity scheme has a slightly worse delay performance, it has a higher throughput, and is the only choice able to overcome large delay differences of the E1 links.

  7. Giant Ising-Type Magnetic Anisotropy in Trigonal Bipyramidal Ni(II) Complexes : Experiment and Theory

    NARCIS (Netherlands)

    Ruamps, Renaud; Maurice, Remi; Batchelor, Luke; Boggio-Pasqua, Martial; Guillot, Regis; Barra, Anne Laure; Liu, Junjie; Bendeif, El-Eulmi; Pillet, Sebastien; Hill, Stephen; Mallah, Talal; Guihery, Nathalie

    2013-01-01

    This paper reports the experimental and theoretical investigations of two trigonal bipyramidal Ni(II) complexes, [Ni(Me(6)tren)Cl](ClO4) (1) and [Ni(Me(6)tren)Br](Br) (2). High-field, high-frequency electron paramagnetic resonance spectroscopy performed on a single crystal of 1 shows a giant uniaxia

  8. Giant Ising-Type Magnetic Anisotropy in Trigonal Bipyramidal Ni(II) Complexes : Experiment and Theory

    NARCIS (Netherlands)

    Ruamps, Renaud; Maurice, Remi; Batchelor, Luke; Boggio-Pasqua, Martial; Guillot, Regis; Barra, Anne Laure; Liu, Junjie; Bendeif, El-Eulmi; Pillet, Sebastien; Hill, Stephen; Mallah, Talal; Guihery, Nathalie

    2013-01-01

    This paper reports the experimental and theoretical investigations of two trigonal bipyramidal Ni(II) complexes, [Ni(Me(6)tren)Cl](ClO4) (1) and [Ni(Me(6)tren)Br](Br) (2). High-field, high-frequency electron paramagnetic resonance spectroscopy performed on a single crystal of 1 shows a giant

  9. Leonardo Da Vinci’s giant crossbow

    CERN Document Server

    Landrus, Matt

    2010-01-01

    Leonardo's Giant Crossbow is one of his least understood drawings. This fascinating book offers the first in-depth account of its likely purpose and its highly resolved design. It presents original research and new discoveries about the giant crossbow.

  10. Highly sensitive surface plasmon resonance chemical sensor based on Goos-Hanchen effects

    Science.gov (United States)

    Yin, Xiaobo; Hesselink, Lambertus

    2006-08-01

    The resonance enhanced Goos-Hanchen shifts at attenuated total internal reflection enables the possibility for highly sensitive surface plasmon resonance sensor. The observed giant displacements result from the singular phase retardation at the resonance where the phase is continuous but changes dramatically. The phenomenon is proposed for chemical sensing and the superior sensitivity is demonstrated.

  11. Atmospheres of Extrasolar Giant Planets

    Science.gov (United States)

    Marley, M. S.; Fortney, J.; Seager, S.; Barman, T.

    The key to understanding an extrasolar giant planet's spectrum - and hence its detectability and evolution - lies with its atmosphere. Now that direct observations of thermal emission from extrasolar giant planets (EGPs) are in hand, atmosphere models can be used to constrain atmospheric composition, thermal structure, and ultimately the formation and evolution of detected planets. We review the important physical processes that influence the atmospheric structure and evolution of EGPs and consider what has already been learned from the first generation of observations and modeling. We pay particular attention to the roles of cloud structure, metallicity, and atmospheric chemistry in affecting detectable properties through Spitzer Space Telescope observations of the transiting giant planets. Our review stresses the uncertainties that ultimately limit our ability to interpret EGP observations. Finally we will conclude with a look to the future as characterization of multiple individual planets in a single stellar system leads to the study of comparative planetary architectures.

  12. Giant lobelias exemplify convergent evolution.

    Science.gov (United States)

    Givnish, Thomas J

    2010-01-14

    Giant lobeliads on tropical mountains in East Africa and Hawaii have highly unusual, giant-rosette growth forms that appear to be convergent on each other and on those of several independently evolved groups of Asteraceae and other families. A recent phylogenetic analysis by Antonelli, based on sequencing the widest selection of lobeliads to date, raises doubts about this paradigmatic example of convergent evolution. Here I address the kinds of evidence needed to test for convergent evolution and argue that the analysis by Antonelli fails on four points. Antonelli's analysis makes several important contributions to our understanding of lobeliad evolution and geographic spread, but his claim regarding convergence appears to be invalid. Giant lobeliads in Hawaii and Africa represent paradigmatic examples of convergent evolution.

  13. Giant lobelias exemplify convergent evolution

    Directory of Open Access Journals (Sweden)

    Givnish Thomas J

    2010-01-01

    Full Text Available Abstract Giant lobeliads on tropical mountains in East Africa and Hawaii have highly unusual, giant-rosette growth forms that appear to be convergent on each other and on those of several independently evolved groups of Asteraceae and other families. A recent phylogenetic analysis by Antonelli, based on sequencing the widest selection of lobeliads to date, raises doubts about this paradigmatic example of convergent evolution. Here I address the kinds of evidence needed to test for convergent evolution and argue that the analysis by Antonelli fails on four points. Antonelli's analysis makes several important contributions to our understanding of lobeliad evolution and geographic spread, but his claim regarding convergence appears to be invalid. Giant lobeliads in Hawaii and Africa represent paradigmatic examples of convergent evolution.

  14. Structure of giant muscle proteins

    Directory of Open Access Journals (Sweden)

    Nathan Thompson Wright

    2013-12-01

    Full Text Available Giant muscle proteins (e.g. titin, nebulin, and obscurin play a seminal role in muscle elasticity, stretch response, and sarcomeric organization. Each giant protein consists of multiple tandem structural domains, usually arranged in a modular fashion ranging from 500 kDa to 4 MDa. Although many of the domains are similar in structure, subtle differences create a unique function of each domain. Recent high and low resolution structural and dynamic studies now suggest more nuanced overall protein structures than previously realized. These findings show that atomic structure, interactions between tandem domains, and intrasarcomeric environment all influence the shape, motion, and therefore function of giant proteins. In this article we will review the current understanding of titin, obscurin, and nebulin structure, from the atomic level through the molecular level.

  15. Chang'e-1 Satellite Completed Its Preset Objectives

    Institute of Scientific and Technical Information of China (English)

    He Ying

    2008-01-01

    @@ By October 23, Chang'e-1 satellite with a one-year design lifetime has been operating in lunar orbit for one year, completed more than 4000 orbits, covering the entire moon 12 times. The satellite's platform works normally at present and all systems and equipment onboard work in their main mode. The satellite has obtained a large quantity of scientific data and achieved the preset objectives of precise orbit maneuver, successful moon orbiting, effective exploration and oneyear lifetime. The Chang'e-1 mission is a complete success.

  16. Sizing Up Red-Giant Twins

    Science.gov (United States)

    Kohler, Susanna

    2016-02-01

    In KIC 9246715, two red-giant stars twins in nearly every way circle each other in a 171-day orbit. This binary pair may be a key to learning about masses and radii of stars with asteroseismology, the study of oscillations in the interiors of stars.Two Ways to MeasureIn order to understand a stars evolution, it is critical that we know its mass and radius. Unfortunately, these quantities are often difficult to pin down!One of the few cases in which we can directly measure stars masses and radii is in eclipsing binaries, wherein two stars eclipse each other as they orbit. If we have a well-sampled light curve for the binary, as well as radial velocities for both stars, then we can determine the stars complete orbital information, including their masses and radii.But there may be another way to obtain stellar mass and radius: asteroseismology. In asteroseismology, oscillations inside stars are used to characterize the stellar interiors. Conveniently, if a star with a convective envelope exhibits solar-like oscillations, these oscillations can be directly compared to those of the Sun. Mass and radius scaling relations which use the Sun as a benchmark and scale based on the stars temperature can then be used to derive the mass and radius of the star.Test Subjects from KeplerSolar-like oscillations from KIC 9246715 are shown in red across different resonant frequencies. The oscillations of a single red-giant star with similar properties are shown upside down in grey for reference. [Rawls et al. 2016]Of course, scaling relations are only useful if we can test them! A team of scientists including Meredith Rawls (New Mexico State University) has identified 18 red-giant eclipsing binaries in the Kepler field of view that also exhibit solar-like oscillations perfect for testing the scaling relations.In a recent study led by Rawls, the team analyzed the first of these binaries, KIC 9246715. Using the Kepler light curves in addition to radial velocity measurements from high

  17. Giant intravesical calculus during pregnancy.

    Science.gov (United States)

    Escobar-del Barco, Laura; Rodriguez-Colorado, Silvia; Dueñas-Garcia, Omar Felipe; Avilez-Cevasco, Juan Carlos

    2008-10-01

    Urolithiasis is commonly found during pregnancy; but the presence of a giant vesical calculus during pregnancy is a very rare entity, associated with several potential obstetric complications. A 25-year-old primigravida at 25 weeks of gestational age was referred to our tertiary care unit because she presented a giant hyperechoic intravesical mass and inability to pass urine with suprapubic pain since 2 days. An open cystolithotomy revealed a huge intravesical calculus. The patient continued with her pregnancy until full term without adverse perinatal outcomes.

  18. Giant fields in southwest Mexico

    Energy Technology Data Exchange (ETDEWEB)

    1981-07-20

    According to Petroleos Mexicanos southeastern Mexico's Isthmus Saline basin holds five new giant fields - Tonala-El Burro, El Plan, Cinco Presidentes, Oraggio, and Magallanes - producing oil and gas from Tertiary sandstones. Numerous normal faults resulting from salt intrusion have given rise to multiple blocks, each with its own reservoir conditions. Previously discovered basins in the area include the Macuspana, which holds three giant gas- and condensate-producing fields: Jose Colomo, Chilapilla, and Hormiquero. The 3100-mi/sup 2/ Campeche marine platform, extending offshore nearby, contains the Cantarell complex, Mexico's most productive hydrocarbon province.

  19. Spectrally resolved resonant propulsion of dielectric microspheres

    CERN Document Server

    Li, Yangcheng; Limberopoulos, Nicholaos I; Urbas, Augustine M; Astratov, Vasily N

    2015-01-01

    Use of resonant light forces opens up a unique approach to high-volume sorting of microspherical resonators with much higher uniformity of resonances compared to that in coupled-cavity structures obtained by the best semiconductor technologies. In this work, the spectral response of the propulsion forces exerted on polystyrene microspheres near tapered microfibers is directly observed. The measurements are based on the control of the detuning between the tunable laser and internal resonances in each sphere with accuracy higher than the width of the resonances. The measured spectral shape of the propulsion forces correlates well with the whispering-gallery mode resonances in the microspheres. The existence of a stable radial trap for the microspheres propelled along the taper is demonstrated. The giant force peaks observed for 20-{\\mu}m spheres are found to be in a good agreement with a model calculation demonstrating an efficient use of the light momentum for propelling the microspheres.

  20. Secular resonances with Ceres and Vesta

    CERN Document Server

    Tsirvoulis, Georgios

    2016-01-01

    In this work we explore dynamical perturbations induced by the massive asteroids Ceres and Vesta on main-belt asteroids through secular resonances. First we determine the location of the linear secular resonances with Ceres and Vesta in the main belt, using a purely numerical technique. Then we use a set of numerical simulations of fictitious asteroids to investigate the importance of these secular resonances in the orbital evolution of main-belt asteroids. We found, evaluating the magnitude of the perturbations in the proper elements of the test particles, that in some cases the strength of these secular resonances is comparable to that of known non-linear secular resonances with the giant planets. Finally we explore the asteroid families that are crossed by the secular resonances we studied, and identified several cases where the latter seem to play an important role in their post-impact evolution.

  1. 26 CFR 31.3302(e)-1 - Successor employer.

    Science.gov (United States)

    2010-04-01

    ... TAXES AND COLLECTION OF INCOME TAX AT SOURCE EMPLOYMENT TAXES AND COLLECTION OF INCOME TAX AT SOURCE Federal Unemployment Tax Act (Chapter 23, Internal Revenue Code of 1954) § 31.3302(e)-1 Successor employer. (a) In general. In addition to the credits against the tax allowable under section 3302(a) and...

  2. Experimental and Theoretical Studies of Pressure Broadened Alkali-Metal Atom Resonance Lines

    Science.gov (United States)

    Shindo, F.; Zhu, C.; Kirby, K.; Babb, J. F.

    2006-01-01

    We are carrying out a joint theoretical and experimental research program to study the broadening of alkali atom resonance lines due to collisions with helium and molecular hydrogen for applications to spectroscopic studies of brown dwarfs and extrasolar giant planets.

  3. Giant lipomas of the hand

    Directory of Open Access Journals (Sweden)

    Gokce Yildiran

    2015-04-01

    Conclusion: Giant lipomas of the hand are very rare and may cause compressions and other complications. Thus, they require a careful preoperative evaluation in order to make a proper differential diagnosis. [Hand Microsurg 2015; 4(1.000: 8-11

  4. A Giant or a Dwarf?

    DEFF Research Database (Denmark)

    Schmid, Herman

    2005-01-01

    EU may appear to be a giant when it can act on behalf of a united Europe, but usually it is hampered by conflicting member state interests. The EU economic and administrative resources for foreign and trade policy are quite small (on level with one of its major member states) and the hopes in man...

  5. The giant panda gut microbiome.

    Science.gov (United States)

    Wei, Fuwen; Wang, Xiao; Wu, Qi

    2015-08-01

    Giant pandas (Ailuropoda melanoleuca) are bamboo specialists that evolved from carnivores. Their gut microbiota probably aids in the digestion of cellulose and this is considered an example of gut microbiota adaptation to a bamboo diet. However, this issue remains unresolved and further functional and compositional studies are needed. Copyright © 2015 Elsevier Ltd. All rights reserved.

  6. Michigan has a sleeping giant

    CERN Multimedia

    Brock, Raymond; Nichols, Sue

    2007-01-01

    "That giant is 750 miles of fiber optic cable that lassoes its three biggest research universities and Van Andel Institute to the future. Its mission: to uncover the nature of the Big Bang by connecton U.S. physicists to their huge experiment ATLAS in Geneva.." (4 pages)

  7. A Giant or a Dwarf?

    DEFF Research Database (Denmark)

    Schmid, Herman

    2005-01-01

    EU may appear to be a giant when it can act on behalf of a united Europe, but usually it is hampered by conflicting member state interests. The EU economic and administrative resources for foreign and trade policy are quite small (on level with one of its major member states) and the hopes in man...

  8. Cloud formation in giant planets

    CERN Document Server

    Helling, Christiane

    2007-01-01

    We calculate the formation of dust clouds in atmospheres of giant gas-planets. The chemical structure and the evolution of the grain size distribution in the dust cloud layer is discussed based on a consistent treatment of seed formation, growth/evaporation and gravitational settling. Future developments are shortly addressed.

  9. Giant nontraumatic intradiploic arachnoid cyst in a young male*

    Science.gov (United States)

    Sharma, Rajesh; Gupta, Puneet; Mahajan, Manik; Sharma, Poonam; Gupta, Anchal; Khurana, Arti

    2016-01-01

    Intradiploic arachnoid cysts have scarcely been reported in the literature, most reported cases being secondary to trauma. Nontraumatic arachnoid cysts are quite rare and have been reported mostly in adults. Here, we report the case of a 16-year-old male presenting with a slowly growing mass in the occipital region and intermittent headaches. On the basis of the findings of X-rays, computed tomography scans, and magnetic resonance imaging scans of the head, the mass was diagnosed as a giant intradiploic arachnoid cyst. PMID:27818549

  10. Face of the giant panda sign in Wilson disease

    Directory of Open Access Journals (Sweden)

    Sumit Chakraborty

    2013-08-01

    Full Text Available Wilson disease usually presents with neurologic or hepatic manifestations. Magnetic resonance imaging (MRI of the brain is very informative in diagnosiing of this disease, especially in patients with neurological features. High T2 signal intensity in the corpus striatum is the most commonly encountered MRI finding. The 'face of the giant panda' sign is seen on axial T2-weighted MRI, and results from abnormal signal intensities in the midbrain. Though uncommon, the sign is considered as the pathognomonic MRI sign of Wilson disease.

  11. Giant non traumatic intradiploic arachnoid cyst in a young male

    Energy Technology Data Exchange (ETDEWEB)

    Sharma, Rajesh [Department of Radiodiagnosis and Imaging, ASCOMS Hospital, Sidhra, Jammu (India); Gupta, Puneet; Mahajan, Manik, E-mail: puneetgupta619@yahoo.com [Department of Radiodiagnosis and Imaging, Lady Hardinge Medical College, New Delhi (India); Sharma, Poonam [Department of Pathology, GMC, Jammu (India); Gupta, Anchal; Khurana, Arti [Department of Radiodiagnosis and Imaging, GMC, Jammu (J and K) (India)

    2016-09-15

    Intradiploic arachnoid cysts have scarcely been reported in the literature, most reported cases being secondary to trauma. Non traumatic arachnoid cysts are quite rare and have been reported mostly in adults. Here, we report the case of a 16-year-old male presenting with a slowly growing mass in the occipital region and intermittent headaches. On the basis of the findings of X-rays, computed tomography scans, and magnetic resonance imaging scans of the head, the mass was diagnosed as a giant intradiploic arachnoid cyst. Keywords: Arachnoid cysts; Cerebrospinal fluid; Headache/diagnosis. (author)

  12. Bone Deformities as a Complication of Giant Thoracic Aortic Aneurysm.

    Science.gov (United States)

    Aslan, Ahmet; Kartal, Yiğitcan; Ayaz, Ercan; Aslan, Mine; Bulut, Safiye Sanem Dereli; Ağırbaşlı, Mehmet Ali; Oysu, Aslıhan Semiz

    2017-07-01

    The contained rupture of thoracic aortic aneurysm and related bone deformities is a rare condition. The diagnosis is critical due to potential and fatal complications. Radiologic evaluation is required to show the location, extension, and complications. Herein we present the X-ray radiography, ultrasonography, computed tomography, and magnetic resonance images of a giant dissected and contained rupture of the thoracic aortic aneurysm. The aneurysm destructed the adjacent vertebrae and rib, resulting in compression of dural sac and spinal cord, and obliteration of the neural foramina. Our case demonstrates a gigantic expansion of an aneurysm (14 cm) with chronic skeletal complications.

  13. Giant Optomechanical Enhancement in the Presence of Gain and Loss

    CERN Document Server

    Jing, H; Lv, Xin-You; Zhang, Jing; Nori, F

    2014-01-01

    The parity-time-symmetric structure was experimentally accessible very recently in coupled optical resonators with which, for normal or non-PT-symmetric cases, a phonon laser device had also been realized. Here we study cavity optomechanics of this system now with tunable gain-loss ratio. We find that nonlinear behaviors emerge for cavity-photon populations around balanced point, resulting giant enhancement of both optical pressure and phonon-lasing action. Potential applications range from enhancing mechanical cooling to designing highly-efficient phonon-laser amplifier.

  14. Giant nontraumatic intradiploic arachnoid cyst in a young male

    Directory of Open Access Journals (Sweden)

    Rajesh Sharma

    Full Text Available Abstract Intradiploic arachnoid cysts have scarcely been reported in the literature, most reported cases being secondary to trauma. Nontraumatic arachnoid cysts are quite rare and have been reported mostly in adults. Here, we report the case of a 16-year-old male presenting with a slowly growing mass in the occipital region and intermittent headaches. On the basis of the findings of X-rays, computed tomography scans, and magnetic resonance imaging scans of the head, the mass was diagnosed as a giant intradiploic arachnoid cyst.

  15. Giant-resonance studies with radioactive beams : Perspectives

    NARCIS (Netherlands)

    Harakeh, M.N.

    First-generation radioactive ion-beam facilities have already been in operation for some time. Advanced facilities that will deliver high-intensity radioactive nuclear beams ranging in energy from below the Coulomb barrier to up to several hundred MeV per nucleon (MeV/u) are either starting

  16. Isoscalar Giant Resonances of 120Sn in the Quasiparticle RRPA

    Institute of Scientific and Technical Information of China (English)

    CAOLi-gang; MAZhong-yu

    2003-01-01

    In present work we have formulated the quasiparticle relativistic random phase approximation (QRRPA) model based on the relativistic mean field ground state in the response function formalism. The pairing correlations are taken into account in the BCS approximation with a constant pairing gap extracted from the experimental binding energies of neighboring nuclei.

  17. Giant Dipole Resonance decay of hot rotating 88Mo

    Directory of Open Access Journals (Sweden)

    Ciemała M.

    2014-03-01

    Full Text Available An experiment focusing on study of the properties of hot rotating compound nucleus of 88Mo was performed in LNL Legnaro using 48Ti beam at energies of 300 and 600 MeV on 40Ca target. The compound nucleus was produced at the temperatures of 3 and 4.5 MeV, with angular momentum distribution with lmax > 60 ħ (i.e. exceeding the crtical angular momentum for fission. High-energy gamma rays, measured in coincidence with evaporation residues and alpha particles, were analyzed with the statistical model. The GDR parameters were obtained from the best fit to the data, which allowed investigating an evolution of the GDR width up to high temperatures.

  18. Giant Dipole Resonance decay of hot rotating 88Mo

    Science.gov (United States)

    Ciemała, M.; Kmiecik, M.; Maj, A.; Kravchuk, V. L.; Gramegna, F.; Barlini, S.; Casini, G.; Camera, F.

    2014-03-01

    An experiment focusing on study of the properties of hot rotating compound nucleus of 88Mo was performed in LNL Legnaro using 48Ti beam at energies of 300 and 600 MeV on 40Ca target. The compound nucleus was produced at the temperatures of 3 and 4.5 MeV, with angular momentum distribution with lmax > 60 ħ (i.e. exceeding the crtical angular momentum for fission). High-energy gamma rays, measured in coincidence with evaporation residues and alpha particles, were analyzed with the statistical model. The GDR parameters were obtained from the best fit to the data, which allowed investigating an evolution of the GDR width up to high temperatures.

  19. Giant magnetic quadrupole resonance studied with 180 deg. electron scattering

    CERN Document Server

    Neumann-Cosel, P V

    1999-01-01

    The nuclei sup 4 sup 8 Ca and sup 9 sup 0 Zr were investigated in 180 deg. high-resolution inelastic electron scattering for momentum transfers q approx =0.35-0.8 fm sup - sup 1. Complete M2 strength distributions could be extracted in both nuclei up to excitation energies of about 15 MeV utilizing a fluctuation analysis technique. Second-RPA calculations successfully describe the experimentally observed strong fragmentation of the M2 mode. The quenching of the spin part is found to be comparable to the M1 case, contrary to previous claims suggesting a stronger reduction. A quantitative reproduction of the data requires the presence of appreciable orbital strength which can be interpreted as a torsional elastic vibration (the so-called twist mode).

  20. On the Nature and Timing of Giant Planet Migration in the Solar System

    Science.gov (United States)

    Agnor, Craig B.

    2016-05-01

    Giant planet migration is a natural outcome of gravitational scattering and planet formation processes (Fernandez & Ip 1984). There is compelling evidence that the solar system's giant planets experienced large-scale migration involving close approaches between planets as well as smooth radial migration via planetesimal scattering. Aspects of giant planet migration have been invoked to explain many features of the outer solar system including the resonant structure of the Kuiper Belt (e.g., Malhotra 1993, Levison et al. 2008), the eccentricities of Jupiter and Saturn (Tsiganis et al. 2005, Morbidelli et al. 2009), the capture of Jupiter's Trojan companions (Morbidelli et al. 2005) and the capture of irregular planetary satellites (e.g., Nesvorny et al. 2007) to name a few. If this migration epoch occurred after the formation of the inner planets, then it may also explain the so-called lunar Late Heavy Bombardment (Gomes et al. 2005). This scenario necessarily requires coeval terrestrial and migrating giant planets. Recent N-body integrations exploring this issue have shown that giant planet migration may excite the terrestrial system via nodal and apsidal secular resonances (e.g., Brasser et al. 2013), may drive the terrestrial planets to crossing orbits (Kaib & Chambers 2016) or alternatively leave the inner solar system in a state closely resembling the observed one (Roig et al. 2016). The factors accounting for the large range of outcomes remain unclear. Using linear secular models and N-body simulations I am identifying and characterising the principal aspects of giant planet migration that excite the terrestrial planets' orbits. I will present these results and discuss how they inform the nature and timing of giant planet migration in the solar system.

  1. Stability and Formation of the Resonant System HD 73526

    CERN Document Server

    Sándor, Z; Klagyivik, P

    2007-01-01

    Based on radial velocity measurements it has been found recently that the two giant planets detected around the star HD 73526 are in 2:1 resonance. However, as our numerical integration shows, the derived orbital data for this system result in chaotic behavior of the giant planets, which is uncommon among the resonant extrasolar planetary systems. We intend to present regular (non-chaotic) orbital solutions for the giant planets in the system HD 73526 and offer formation scenarios based on combining planetary migration and sudden perturbative effects such as planet-planet scattering or rapid dispersal of the protoplanetary disk. A comparison with the already studied resonant system HD 128311, exhibiting similar behavior, is also done. The new sets of orbital solutions have been derived by the Systemic Console (www.oklo.org). The stability of these solutions has been investigated by the Relative Lyapunov indicator, while the migration and scattering effects are studied by gravitational N-body simulations apply...

  2. Giant colon lipoma.

    Science.gov (United States)

    Yaman, İsmail; Derici, Hayrullah; Demirpolat, Gülen

    2015-01-01

    Colon lipomas are rare, non-epithelial tumors. They are generally smaller than two centimeters and asymptomatic, they are incidentally diagnosed and do not require treatment. Large and symptomatic colon lipomas are rather rare. Its differential diagnosis is generally made by histopathological examination of the resected specimen. A fifty-year-old female patient presented with the symptoms of abdominal pain, swelling in the abdomen and loss of weight. During colonoscopy, there was a submucosal mass of 8×6 cm, which almost completely obstructed the lumen in the hepatic flexure and was covered by a mucosa that was sporadically ulcerated and necrotic in nature. In magnetic resonance imaging, an ovoid mass with a diameter of 8.5 cm at its widest dimension was detected, which had signal intensity similar to that of adipose tissue. Since the patient was symptomatic and differential diagnosis could not be made, she underwent laparoscopic right hemicolectomy. A submucosal lipoma was detected on histopathological examination of the specimen. The patient was discharged without any problems on post-operative day 7. Definite diagnosis of lipomas before surgery is challenging; they may be mistaken for malignancy, especially if the lesion is large and ulcerated. For large and symptomatic colon lipomas, surgery is required to both prevent complications and rule out malignancy.

  3. Do we expect to find the Super-Earths close to the gas giants?

    CERN Document Server

    Podlewska, E

    2009-01-01

    We have investigated the evolution of a pair of interacting planets embedded in a gaseous disc, considering the possibility of the resonant capture of a Super-Earth by a Jupiter mass gas giant. First, we have examined the situation where the Super-Earth is on the internal orbit and the gas giant on the external one. It has been found that the terrestrial planet is scattered from the disc or the gas giant captures the Super-Earth into an interior 3:2 or 4:3 mean-motion resonance. The stability of the latter configurations depends on the initial planet positions and on eccentricity evolution. The behaviour of the system is different if the Super-Earth is the external planet. We have found that instead of being captured in the mean-motion resonance, the terrestrial planet is trapped at the outer edge of the gap opened by the gas giant. This effect prevents the occurrence of the first order mean-motion commensurability. These results are particularly interesting in light of recent exoplanet discoveries and provid...

  4. Congenital giant aneurysm of the left coronary artery.

    Science.gov (United States)

    Berdajs, Denis; Ruchat, Patrick; Suva, Mario; Ferrari, Enrico; Ligang, Liu; von Segesser, Ludwig K

    2011-10-01

    We report an unusual case of congenital giant coronary aneurysm. A 23 year-old male with a history of acute myocardial infarction presented an abnormal shadow in the left cardiac border on routine X-ray. Electrocardiogram and physical examination were normal without any clinical signs of inflammation, but computed tomography (CT) scan and cardiac magnetic resonance imaging (MRI) revealed a giant (>50mm) coronary aneurysm. Coronary artery bypass grafting (CABG) with coronary artery aneurysm (CAA) resection resolved the CAA. Coronary artery aneurysms are entities of localised dilation and can be common events in chronic infectious disease as a result of the systemic inflammatory state; however, giant coronary aneurysms (measuring more than 50mm) are rare. This is especially true where the pathological aetiology was not clearly defined or was believed to be of congenital origin. To date only a few published case reports exist for this type of pathological entity. Copyright © 2011 Australasian Society of Cardiac and Thoracic Surgeons and the Cardiac Society of Australia and New Zealand. Published by Elsevier B.V. All rights reserved.

  5. Two giant outbursts of V0332+53 observed with INTEGRAL

    Science.gov (United States)

    Ferrigno, Carlo; Ducci, Lorenzo; Bozzo, Enrico; Kretschmar, Peter; Kühnel, Matthias; Malacaria, Christian; Pottschmidt, Katja; Santangelo, Andrea; Savchenko, Volodymyr; Wilms, Jörn

    2016-10-01

    Context. In July 2015, the high-mass X-ray binary V0332+53 underwent a giant outburst, a decade after the previous one. V0332+53 hosts a strongly magnetized neutron star. During the 2004-2005 outburst, an anti-correlation between the centroid energy of its fundamental cyclotron resonance scattering features (CRSFs) and the X-ray luminosity was observed. Aims: The long (≈100 d) and bright (Lx ≈ 1038 erg s-1) 2015 outburst provided the opportunity to study the unique properties of the fundamental CRSF during another outburst and to study its dependence on the X-ray luminosity. Methods: The source was observed by the INTEGRAL satellite for ~330 ks. We exploit the spectral resolution at high energies of the SPectrometer on INTEGRAL (SPI) and the Joint European X-ray Monitors to characterize its spectral properties, focusing in particular on the CRSF-luminosity dependence. We complement the data of the 2015 outburst with those collected by SPI in 2004-2005, which have so far been left unpublished. Results: We find a highly significant anti-correlation of the centroid energy of the fundamental CRSF and the 3-100 keV luminosity of E1 ∝ -0.095(8)L37 keV. This trend is observed for both outbursts. We confirm the correlation between the width of the fundamental CRSF and the X-ray luminosity previously found in the JEM-X and IBIS dataset of the 2004-2005 outburst. By exploiting the RXTE/ASM and Swift/BAT monitoring data, we also report on the detection of a ~34 d modulation superimposed on the mean profiles and roughly consistent with the orbital period of the pulsar. We discuss possible interpretations of such variability.

  6. Photoresponse of 60Ni below 10-MeV excitation energy: Evolution of dipole resonances in fp-shell nuclei near N=Z

    Science.gov (United States)

    Scheck, M.; Ponomarev, V. Yu.; Fritzsche, M.; Joubert, J.; Aumann, T.; Beller, J.; Isaak, J.; Kelley, J. H.; Kwan, E.; Pietralla, N.; Raut, R.; Romig, C.; Rusev, G.; Savran, D.; Schorrenberger, L.; Sonnabend, K.; Tonchev, A. P.; Tornow, W.; Weller, H. R.; Zilges, A.; Zweidinger, M.

    2013-10-01

    Background: Within the last decade, below the giant dipole resonance the existence of a concentration of additional electric dipole strength has been established. This accumulation of low-lying E1 strength is commonly referred to as pygmy dipole resonance (PDR).Purpose: The photoresponse of 60Ni has been investigated experimentally and theoretically to test the evolution of the PDR in a nucleus with only a small neutron excess. Furthermore, the isoscalar and isovector M1 resonances were investigated.Method: Spin-1 states were excited by exploiting the (γ,γ') nuclear resonance fluorescence technique with unpolarized continuous bremsstrahlung as well as with fully linearly polarized, quasimonochromatic, Compton-backscattered laser photons in the entrance channel of the reaction.Results: Up to 10 MeV a detailed picture of J=1 levels was obtained. For the preponderant number of the individual levels spin and parity were firmly assigned. Furthermore, branching ratios, transition widths, and reduced B(E1) or B(M1) excitation probability were calculated from the measured scattering cross sections. A comparison with theoretical results obtained within the quasiparticle phonon model allows an insight into the microscopic structure of the observed states.Conclusions: Below 10 MeV the directly observed E1 strength [∑B(E1)↑=(153.8±9.5) e2(fm)2] exhausts 0.5% of the Thomas-Reiche-Kuhn sum rule. This value increases to 0.8% of the sum rule [∑B(E1)↑=(250.9±31.1) e2(fm)2] when indirectly observed branches to lower-lying levels are considered. Two accumulations of M1 excited spin-1 states near 8 and 9 MeV excitation energy are identified as isoscalar and isovector M1 resonances dominated by proton and neutron f7/2→f5/2 spin-flip excitations. The B(M1)↑ strength of these structures accumulates to 3.94(27)μN2.

  7. Asteroseismology of Red Giant stars

    CERN Document Server

    Tarrant, N J; Elsworth, Y P; Spreckley, S A; Stevens, I R

    2008-01-01

    Sun-like oscillations, that is p-modes excited stochastically by convective noise, have now been observed in a number of Red Giant stars. Compared to those seen in the Sun, these modes are of large amplitude and long period, making the oscillations attractive prospects for observation. However, the low Q-factor of these modes, and issues relating to the rising background at low frequencies, present some interesting challenges for identifying modes and determining the related asteroseismic parameters. We report on the analysis procedure adopted for peak-bagging by our group at Birmingham, and the techniques used to robustly ensure these are not a product of noise. I also show results from a number of giants extracted from multi-year observations with the SMEI instrument.

  8. Giant condyloma acuminatum of vulva

    Directory of Open Access Journals (Sweden)

    S. M. Ramiz Ahmed

    2017-09-01

    Full Text Available In this paper, A 23 year old married woman who was diagnosed as a case of giant condyloma acuminatum of vulva measuring about 15 x 8 x 3 cm, irregular surface with multiple projections, oval in shape, firm to hard in consistency, mildly tender, exophytic, cauliflower like growth involving the whole vulva (lower part of mons pubis, labia, vestibule, clitoris, around vaginal opening. Another multiple small lesions were present at perineal region but there was no inguinal lymphadenopathy. She underwent a combined electro cauterization and cryotherapy for small to moderate size multiple primary and recurrent warty lesions and wide surgical excision with fasciocutaneous advancement flaps procedure for a giant lesions in the vulva. Excisional biopsies were performed to detect potential malignancy but malignancy was not found histologically. The patient was advised to first follow-up 1 month after operation when multiple small warty lesions were developed and treated and the subsequent follow-ups for 3 months.

  9. Idiopathic giant right atrial aneurysm

    Science.gov (United States)

    Uppu, Santosh C; Sachdeva, Ritu; Imamura, Michiaki

    2013-01-01

    A 2-year-old boy with an incidental finding of massive cardiomegaly on a chest X-ray was diagnosed with a giant right atrial aneurysm upon further investigation with echocardiography. The patient underwent successful surgical reduction of the right atrium and closure of the patent foramen ovale to prevent thromboembolic complications and to lower the risk of atrial arrhythmias. The resected atrium had paper-thin walls and pathological features of interstitial fibrosis with endocardial thickening. PMID:23626440

  10. Idiopathic giant right atrial aneurysm

    OpenAIRE

    Uppu, Santosh C; Ritu Sachdeva; Michiaki Imamura

    2013-01-01

    A 2-year-old boy with an incidental finding of massive cardiomegaly on a chest X-ray was diagnosed with a giant right atrial aneurysm upon further investigation with echocardiography. The patient underwent successful surgical reduction of the right atrium and closure of the patent foramen ovale to prevent thromboembolic complications and to lower the risk of atrial arrhythmias. The resected atrium had paper-thin walls and pathological features of interstitial fibrosis with endocardial thicken...

  11. Giant sialocele following facial trauma

    OpenAIRE

    Medeiros Júnior,Rui; Rocha Neto,Alípio Miguel da; Queiroz, Isaac Vieira; Cauby,Antônio de Figueiredo; Gueiros,Luiz Alcino Monteiro; Leão,Jair Carneiro

    2012-01-01

    Injuries in the parotid and masseter region can cause serious impairment secondary to damage of important anatomical structures. Sialocele is observed as facial swelling associated with parotid duct rupture due to trauma. The aim of this paper is to report a case of a giant traumatic sialocele in the parotid gland, secondary to a knife lesion in a 40-year-old woman. Conservative measures could not promote clinical resolution and a surgical intervention for the placement of a vacuum drain was ...

  12. Idiopathic giant right atrial aneurysm

    Directory of Open Access Journals (Sweden)

    Santosh C Uppu

    2013-01-01

    Full Text Available A 2-year-old boy with an incidental finding of massive cardiomegaly on a chest X-ray was diagnosed with a giant right atrial aneurysm upon further investigation with echocardiography. The patient underwent successful surgical reduction of the right atrium and closure of the patent foramen ovale to prevent thromboembolic complications and to lower the risk of atrial arrhythmias. The resected atrium had paper-thin walls and pathological features of interstitial fibrosis with endocardial thickening.

  13. Phenomenology of heavy quarkonium radiative E1 transitions

    Energy Technology Data Exchange (ETDEWEB)

    Martinez, Hector E. [Physik-Department, Technische Universität München, James-Franck-Str. 1, 85748 Garching (Germany)

    2016-01-22

    We present preliminary results of the evaluation of the next-to-leading-order (NLO) relativistic corrections to the heavy quarkonium electric dipole transition (E1) rate. In our evaluation we use the quark-antiquark potential up to 1/m{sup 2} corrections that includes the effective string theory expression for the long range, a review on the method to construct this potential is given. Our results compare favorable with the experiments and may provide predictions for the rates for which no experimental data is yet available.

  14. The chang’E-1 topographic atlas of the Moon

    CERN Document Server

    Li, Chunlai; Mu, Lingli; Ren, Xin; Zuo, Wei

    2016-01-01

    This atlas is based on the lunar global Digital Elevation Models (DEM) of Chang'E-1 (CE-1), and presents CCD stereo image data with digital photogrammetry. The spatial resolution of the DEM in this atlas is 500m, with horizontal accuracy of 192m and vertical accuracy of 120m. Color-shaded relief maps with contour lines are used to show the lunar topographical characteristics. The topographical data gathered by CE-1 can provide fundamental information for the study of lunar topographical, morphological and geological structures, as well as for lunar evolution research.

  15. The role of cyclin E1 in hepatocellular carcinoma

    OpenAIRE

    Chan, Yan-yan; 陳茵茵

    2014-01-01

    Hepatocellular carcinoma (HCC) accounts for 70-85% of liver cancer, which is the sixth most common cancer in the world. Prognosis of HCC is dismal with little chance of complete recovery after diagnosis. It is of essence to discover the key molecules involved in the tumor progression. This could help earlier detection of HCC and establish targeted molecular therapies. Cyclin E1 (CCNE1) is a cyclin molecule responsible for the transition from G1 to S phase of the cell cycle and is often dysreg...

  16. Guiding the Giant

    Science.gov (United States)

    1998-08-01

    New ESO Survey Provides Targets for the VLT Giant astronomical telescopes like the ESO Very Large Telescope (VLT) must be used efficiently. Observing time is expensive and there are long waiting lines of excellent research programmes. Thus the work at the telescope must be very well prepared and optimized as much as possible - mistakes should be avoided and no time lost! Astronomers working with the new 8-m class optical/infrared telescopes must base their observations on detailed lists of suitable target objects if they want to perform cutting-edge science. This is particularly true for research programmes that depend on observations of large samples of comparatively rare, distant objects. This type of work requires that extensive catalogues of such objects must be prepared in advance. One such major catalogue - that will serve as a very useful basis for future VLT observations - has just become available from the new ESO Imaging Survey (EIS). The Need for Sky Surveys Astronomers have since long recognized the need to carry out preparatory observations with other telescopes in order to "guide" large telescopes. To this end, surveys of smaller or larger parts of the sky have been performed by wide-field telescopes, paving the way for subsequent work at the limits of the largest available ground-based telescopes. For instance, a complete photographic survey of the sourthern sky (declination deep imaging surveys have thus become an indispensable complement to the 8-m telescopes. The new generation of imaging surveys will, without doubt, be the backbone of future research and are likely to be as long-lived as their earlier counterparts, which have served the astronomical community so well over the past decades. The new surveys are now becoming possible, thanks to the new, extremely light-sensitive CCD-mosaics mounted on wide-field telescopes. The ESO Imaging Survey (EIS) A very successful, major step in this direction has recently been taken at ESO. It concerns an

  17. Electrodynamics in Giant Planet Atmospheres

    Science.gov (United States)

    Koskinen, T.; Yelle, R. V.; Lavvas, P.; Cho, J.

    2014-12-01

    The atmospheres of close-in extrasolar giant planets such as HD209458b are strongly ionized by the UV flux of their host stars. We show that photoionization on such planets creates a dayside ionosphere that extends from the thermosphere to the 100 mbar level. The resulting peak electron density near the 1 mbar level is higher than that encountered in any planetary ionosphere of the solar system, and the model conductivity is in fact comparable to the atmospheres of Sun-like stars. As a result, the momentum and energy balance in the upper atmosphere of HD209458b and similar planets can be strongly affected by ion drag and resistive heating arising from wind-driven electrodynamics. Despite much weaker ionization, electrodynamics is nevertheless also important on the giant planets of the solar system. We use a generic framework to constrain the conductivity regimes on close-in extrasolar planets, and compare the results with conductivites based on the same approach for Jupiter and Saturn. By using a generalized Ohm's law and assumed magnetic fields, we then demonstrate the basic effects of wind-driven ion drag in giant planet atmospheres. Our results show that ion drag is often significant in the upper atmosphere where it can also substantially alter the energy budget through resistive heating.

  18. Observed Properties of Giant Cells

    Science.gov (United States)

    Hathaway, David H.; Upton, Lisa; Colegrove, Owen

    2014-01-01

    The existence of Giant Cells has been suggested by both theory and observation for over 45 years. We have tracked the motions of supergranules in SDO/HMI Doppler velocity data and find larger (Giant Cell) flows that persist for months. The flows in these cells are clockwise around centers of divergence in the north and counter-clockwise in the south. Equatorward flows are correlated with prograde flows - giving the transport of angular momentum toward the equator that is needed to maintain the Sun's rapid equatorial rotation. The cells are most pronounced at mid- and high-latitudes where they exhibit the rotation rates representative of those latitudes. These are clearly large, long-lived, cellular features, with the dynamical characteristics expected from the effects of the Sun's rotation, but the shapes of the cells are not well represented in numerical models. While the Giant Cell flow velocities are small (<10 m/s), their long lifetimes should nonetheless substantially impact the transport of magnetic flux in the Sun's near surface layers.

  19. KEPLER RAPIDLY ROTATING GIANT STARS

    Energy Technology Data Exchange (ETDEWEB)

    Costa, A. D.; Martins, B. L. Canto; Bravo, J. P.; Paz-Chinchón, F.; Chagas, M. L. das; Leão, I. C.; Oliveira, G. Pereira de; Silva, R. Rodrigues da; Roque, S.; Oliveira, L. L. A. de; Silva, D. Freire da; De Medeiros, J. R., E-mail: renan@dfte.ufrn.br [Departamento de Física Teórica e Experimental, Universidade Federal do Rio Grande do Norte, Campus Universitário, Natal RN (Brazil)

    2015-07-10

    Rapidly rotating giant stars are relatively rare and may represent important stages of stellar evolution, resulting from stellar coalescence of close binary systems or accretion of substellar companions by their hosting stars. In the present Letter, we report 17 giant stars observed in the scope of the Kepler space mission exhibiting rapid rotation behavior. For the first time, the abnormal rotational behavior for this puzzling family of stars is revealed by direct measurements of rotation, namely from photometric rotation period, exhibiting a very short rotation period with values ranging from 13 to 55 days. This finding points to remarkable surface rotation rates, up to 18 times the rotation of the Sun. These giants are combined with six others recently listed in the literature for mid-infrared (IR) diagnostics based on Wide-field Infrared Survey Explorer information, from which a trend for an IR excess is revealed for at least one-half of the stars, but at a level far lower than the dust excess emission shown by planet-bearing main-sequence stars.

  20. Kepler rapidly rotating giant stars

    CERN Document Server

    Costa, A D; Bravo, J P; Paz-Chinchón, F; Chagas, M L das; Leão, I C; de Oliveira, G Pereira; da Silva, R Rodrigues; Roque, S; de Oliveira, L L A; da Silva, D Freire; De Medeiros, J R

    2015-01-01

    Rapidly rotating giant stars are relatively rare and may represent important stages of stellar evolution, resulting from stellar coalescence of close binary systems or accretion of sub-stellar companions by their hosting stars. In the present letter we report 17 giant stars observed in the scope of the Kepler space mission exhibiting rapid rotation behavior. For the first time the abnormal rotational behavior for this puzzling family of stars is revealed by direct measurements of rotation, namely from photometric rotation period, exhibiting very short rotation period with values ranging from 13 to 55 days. This finding points for remarkable surface rotation rates, up to 18 times the Sun rotation. These giants are combined with 6 other recently listed in the literature for mid-IR diagnostic based on WISE information, from which a trend for an infrared excess is revealed for at least a half of the stars, but at a level far lower than the dust excess emission shown by planet-bearing main-sequence stars.

  1. Crossover Analysis of CHANG'E-1 Laser Altimeter Data

    Science.gov (United States)

    Hu, W.; Yue, Z.; Di, K.

    2011-08-01

    This paper presents a preliminary result of crossover analysis and adjustment of Chang'E-1(CE-1) Laser Altimeter (LAM) data of the Moon for global and regional mapping applications. During the operation of Chang'E-1 from November 28, 2007 to December 4, 2008, the laser altimeter acquired 1400 orbital profiles with about 9.12 million altimetric points. In our experiment, we derived more than 1.38 million crossovers from 1395 ground tracks covering the entire lunar surface after eliminating outliers of orbits and altimetric points. A method of least-squares crossover adjustment with a series of basis functions of time (trigonometric functions and polynomials) is developed to reconcile the LAM data by minimizing the crossover residuals globally. The normal equations are very large but sparse; therefore they are stored and solved using sparse matrix technique. In a test area (0°N~60°N, 50°W~0°W), the crossover residuals are reduced from 62.1m to 32.8m, and the quality of the DEM generated from the adjusted LAM data is improved accordingly. We will optimize the method for the global adjustment to generate a high precision consistent global DEM, which can be used as absolute control for lunar mapping with orbital images.

  2. Giant Frontal Mucocele Occurring 32 Years after Frontal Bone Fracture: A Case Report

    Directory of Open Access Journals (Sweden)

    Yuuta Kamoshima

    2012-01-01

    Full Text Available Giant mucoceles of the frontal sinus are rare but their recognition is important in the differential diagnosis of proptosis and fronto-orbital lesions. The authors describe a patient with frontal giant mucocele with intracranial as well as orbit and ethmoid sinus involvement. Thirty-two years after a frontal sinus fracture, a 51-year-old female presented with headache, and left exophthalmos and ophthalmoplegia. Computed tomography and magnetic resonance imaging demonstrated a giant frontal sinus mucocele with extension into the left anterior cranial fossa. The mucocele was treated with a transcranial and endoscopic transnasal approach. The frontal sinus was then cranialized with reconstruction of the posterior wall, and finally a wide nasal drainage was performed. The clinical symptoms disappeared immediately after surgery.

  3. Rapid improvement in visual loss with cabergoline treatment in a giant prolactinoma case: 5 years survey.

    Science.gov (United States)

    Tasan, Ertugrul; Hanimoglu, Hakan; Turgut, Seda; Ilhan, Mahmut Muzaffer; Evran, Sevket; Kaynar, Mehmet Yasar

    2015-01-01

    Giant prolactinoma is a rare subset of macroadenomas. Limited studies demonstrated which therapy could be successfully used in the first-line therapy of giant prolactinoma. We presented a case with a 54 × 40 × 40 mm pituitary adenoma and optic chiasmatic compression with left sphenoid sinus invasion. The tumor caused a loss of visual field of the right side. Cabergoline treatment was started with dose of 1.5 mg/week. Fifteen days later, the clinical visual acuity examination showed a significant improvement in the patient with visual field defect. After the five years follow-up magnetic resonance imagining showed reduction of the adenoma size (17 × 12 mm) was significant. Our findings suggest that, cabergoline can be used as a first-line therapy in giant prolactinomas because tumoral shrinkage without a surgical procedure and rapid improvement in visual field defect is achieved with this medical treatment.

  4. Diagnosis of Giant Cell Tumor of Temporomandibular Joint with Ultrasound-guided Core Needle Biopsy

    Directory of Open Access Journals (Sweden)

    Chih Yung Yang

    2014-09-01

    Full Text Available Temporomandibular joint (TMJ tumors may initially present with symptoms similar to TMJ internal derangements and myositis of masticatory muscles. However, malignant tumors and specific types of benign tumors, such as giant cell tumors, may need aggressive surgical intervention. The current case is a 41-year-old man who initially presented with right preauricular pain. Computed tomography (CT revealed a destructive bone lesion over the right TMJ with temporal bone destruction. A biopsy conducted with an ultrasound-guided core needle confirmed that the lesion was a giant cell tumor. Giant cell tumors can eventually destroy the surrounding tissue. Magnetic resonance imaging and CT have been traditionally used to evaluate TMJ disorders, whereas ultrasonography provides real-time imaging for evaluating the joint structure, movement, and biopsy guidance. For a TMJ tumor, a precise diagnosis is necessary for adequate planning of treatment. Ultrasound-guided core needle biopsy is a safe and effective method for confirming a diagnosis.

  5. Rapid Formation of Ice Giant Planets

    CERN Document Server

    Boss, A P; Haghighipour, N; Boss, Alan P.; Wetherill, George W.; Haghighipour, Nader

    2002-01-01

    The existence of Uranus and Neptune presents severe difficulties for the core accretion model for the formation of ice giant planets. We suggest an alternative mechanism, namely disk instability leading to the formation of gas giant protoplanets, coagulation and settling of dust grains to form ice/rock cores at their centers, and photoevaporation of their gaseous envelopes by a nearby OB star, as a possible means of forming ice giant planets.

  6. Solitary ulcerated congenital giant juvenile xanthogranuloma

    Directory of Open Access Journals (Sweden)

    Su Yuen Ng

    2015-01-01

    Full Text Available A 3-month-old female patient with a giant ulcerated nodule over the back since birth was diagnosed as congenital giant juvenile xanthogranuloma (JXG based on clinical and histopathological examination. Congenital giant JXG with ulceration at birth is a rare presentation of JXG and commonly misdiagnosed. This case emphasizes the importance of being aware of the myriad presentations of JXG in order to make a correct diagnosis and avoid unnecessary investigations or treatment.

  7. Astrocitoma subependimário de células gigantes em pacientes com esclerose tuberosa: achados em ressonância magnética de dez casos Subependymal giant cell astrocytoma in patients with tuberous sclerosis: magnetic resonance imaging findings in ten cases

    Directory of Open Access Journals (Sweden)

    Karina Takata

    2007-06-01

    Full Text Available OBJETIVO: Relatar os achados de ressonância magnética (RM em 10 casos de astrocitoma subependimário de células gigantes (ASCG em pacientes com esclerose tuberosa (ET. MÉTODO: Foram estudados de forma retrospectiva 10 pacientes com ET e diagnóstico histológico comprovado de ASCG. Quatro pacientes eram do sexo masculino e seis do feminino, com idade média de 15,7 anos. Todos os pacientes foram investigados com RM, sendo os exames revisados por dois radiologistas, havendo decisão por consenso sobre os achados de imagem. Foram analisados os seguintes achados: localização, dimensões, intensidade de sinal em T1/T2, realce pós-contraste e outros achados associados. RESULTADOS: Todos os pacientes apresentaram lesão única sugestiva de ASCG, medindo entre 1,5 cm e 8 cm em seu maior diâmetro. Oito lesões foram encontradas junto ao forame de Monro (80% e duas adjacentes ao corpo do ventrículo lateral (20%. Os tumores apresentavam nas imagens pesadas em T1 médio sinal (70% e em T2 alto sinal (100%, com realce intenso após a administração do gadolínio (100%. CONCLUSÃO: Os astrocitomas subependimários de células gigantes em pacientes com ET em geral apresentam-se como lesão única próxima ao forame de Monro, com médio sinal nas imagens ponderadas em T1, alto sinal em T2 e realce intenso após a administração de contraste.OBJECTIVE: To report the magnetic resonance imaging (MRI findings in 10 patients with subependimal giant cell astrocytoma (SGCA and tuberous sclerosis (TS. METHOD: Ten patients were retrospectively studied, presenting TS and histologically proven SGCA. Four patients were male and six female, with mean age 15.7 years. All patients underwent MRI, which was analyzed by two radiologists, final diagnosis was reached by consensus. The following findings were studied: topography, size, signal intensity on T1/T2-weighted images, contrast enhancement and associated findings. RESULTS: All patients presented a single lesion

  8. Low Cost Network Emulator with Ethernet and E1 Interfaces

    Directory of Open Access Journals (Sweden)

    Zbynek Kocur

    2010-01-01

    Full Text Available Contemporary Next Generation Networks (NGN are mainly built on the Internet Protocol (IP and Ethernet. Major challenge for emerging types of wired and wireless IP-based networks is to provide an adequate Quality of Service (QoS for different services. The quality of evaluation requires a detailed knowledge of the performance requirements for particular services and applications. The paper is primarily oriented to the end-to-end testing for the Ethernet-based terminal equipment. The low cost Ethernet network emulator was developed on the Department of Telecommunication Technology of the Faculty of Electrical Engineering of the Czech Technical University in Prague. The extension for emulation network with the E1 interfaces and TDM over IP transmission can be used with external converters.

  9. Photothermal resonance

    DEFF Research Database (Denmark)

    2014-01-01

    The present invention relates to a method for detecting photo-thermal absorbance of a material utilising a mechanically temperature sensitive resonator (20) and a sample being arrange in thermal communication with the temperature sensitive resonator. The present invention further relates to an ap......The present invention relates to a method for detecting photo-thermal absorbance of a material utilising a mechanically temperature sensitive resonator (20) and a sample being arrange in thermal communication with the temperature sensitive resonator. The present invention further relates...... to an apparatus for detecting photo-thermal absorbance of a sample....

  10. Subcellular Localization of Rat CYP2E1 Impacts Metabolic Efficiency toward Common Substrates

    OpenAIRE

    2015-01-01

    Cytochrome P450 2E1 (CYP2E1) detoxifies or bioactivates many low molecular-weight compounds. Most knowledge about CYP2E1 activity relies on studies of the enzyme localized to endoplasmic reticulum (erCYP2E1); however, CYP2E1 undergoes transport to mitochondria (mtCYP2E1) and becomes metabolically active. We report the first comparison of in vitro steady-state kinetic profiles for erCYP2E1 and mtCYP2E1 oxidation of probe substrate 4-nitrophenol and pollutants styrene and aniline using subcellu...

  11. Data of evolutionary structure change: 1E1QA-2HLDT [Confc[Archive

    Lifescience Database Archive (English)

    Full Text Available 1E1QA-2HLDT 1E1Q 2HLD A T DLEETGRVLSIGDGIARVHGLRNVQAEEMVEFSSGLKGM...VDALVPIGRGQRELIIGDRQTGKTAVALDTILNQKRWNNGSDESKKLYCVYVAVGQKRSTVAQLVQTLEQHDAMKYSIIVAATASEAAPLQYLAPFTAASIGEWFRDN...bID> T 2HLDT ALKQVAGS

  12. Data of evolutionary structure change: 1E1RC-2HLDT [Confc[Archive

    Lifescience Database Archive (English)

    Full Text Available 1E1RC-2HLDT 1E1R 2HLD C T ADTSVDLEETGRVLSIGDGIARVHGLRNVQAEEMVEFSS...VQTGLKAVDALVPIGRGQRELIIGDRQTGKTAVALDTILNQKRWNNGSDESKKLYCVYVAVGQKRSTVAQLVQTLEQHDAMKYSIIVAATASEAAPLQYLAPFTAASI... 2HLD T 2HLDT AAFAQ--

  13. Data of evolutionary structure change: 1E1RA-2HLDT [Confc[Archive

    Lifescience Database Archive (English)

    Full Text Available 1E1RA-2HLDT 1E1R 2HLD A T DLEETGRVLSIGDGIARVHGLRNVQAEEMVEFSSGLKGM...VDALVPIGRGQRELIIGDRQTGKTAVALDTILNQKRWNNGSDESKKLYCVYVAVGQKRSTVAQLVQTLEQHDAMKYSIIVAATASEAAPLQYLAPFTAASIGEWFRDN...bChain>T 2HLDT ALKQVAGSLKLFL

  14. Tilting Saturn without Tilting Jupiter or Ejecting an Ice Giant: Constraints on migration

    Science.gov (United States)

    McNeil, Douglas S.; Lee, M. H.

    2010-10-01

    The obliquities of the giant planets preserve information about their migration and encounter histories. Are the classic Nice models (Tsiganis et al. 2005) or the resonant Nice models (Morbidelli et al. 2007) compatible with Jupiter's 3 degree tilt and Saturn's 27? Here we consider the obliquity evolution of the giants during the planetesimal-driven migration phase using two methods: (1) a purely secular integration of the Laplace-Lagrange equations with spin, and (2) a hybrid N-body scheme with full interactions between the Sun and the giants but imposed prescriptions for migration and eccentricity and inclination damping. We find that it is difficult to reproduce today's obliquity values as migration timescales sufficient to tilt Saturn via the Hamilton & Ward (2004) secular spin-orbit resonance mechanism generally suffice to tilt Jupiter more than is observed. Moreover, long migration timescales which make tilting Saturn easier simultaneously reduce the survival fraction (to below 20% for timescales longer than 20 Myr.) We discuss the constraints these observations provide on the dynamical history of the giant planets, and the remaining possibility of tilting Saturn during a late very slow migration of Neptune to its present location after the main phase of migration is complete. [This work was supported by Hong Kong RGC grant HKU 7024/08P.

  15. Giant thoracic schwannoma presenting with abrupt onset of abdominal pain: a case report

    Directory of Open Access Journals (Sweden)

    Yang Isaac

    2009-10-01

    Full Text Available Abstract Introduction Giant intradural extramedullary schwannomas of the thoracic spine are not common. Schwannomas, that is, tumors derived from neoplastic Schwann cells, and neurofibromas represent the most common intradural extramedullary spinal lesions. We report the case of a patient with a giant thoracic schwannoma presenting unusually with acute abdominal pain and with delayed neurological impairment. Case presentation A 26-year-old Hispanic man with no previous medical problems presented with acute periumbilical pain. After extensive work-up including an exploratory laparotomy for appendectomy, magnetic resonance imaging scans of the lumbar and thoracic spine revealed a giant intradural extramedullary thoracic schwannoma within the spinal canal posterior to the T9, T10, and T11 vertebral bodies. Magnetic resonance imaging signal prolongation was noted in the spinal cord both rostral and caudal to the schwannoma. The patient underwent an urgent laminectomy from T8 to L1. After sacrificing the T10 root, the tumor was removed en bloc. Postoperatively, the patient improved significantly gaining antigravity strength in both lower extremities. Conclusion The T10 dermatome is represented by the umbilical region. This referred pain may represent a mechanism by which a giant thoracic schwannoma may present as acute abdominal pain. Acute, intense abdominal pain with delayed neurologic deficit is a rare presentation of a thoracic schwannoma but should be considered as a possible cause of abdominal pain presenting without clear etiology. Although these lesions may be delayed in their diagnosis, early diagnosis and treatment may lead to an improved clinical outcome.

  16. Giant adrenal cyst - a case report and classification; Cisto gigante da adrenal - relato de caso e classificacao

    Energy Technology Data Exchange (ETDEWEB)

    Pitaki, Sergio Augusto Munhoz; Louveira, Maria Helena [Clinica Radiologica Pitaki, Curitiba, PR (Brazil). Alphasonic; Rorato, Luciana; Antonik, Gustavo; Andrade, Andre Luis Lugnani de; Teixeira, Ana Maria Gonzaga [Faculdade Evangelica de Medicina do Parana (FEMPAR), Curitiba, PR (Brazil)

    1999-12-01

    Cystic lesions of the adrenal gland are relatively rare, but they must be considering in the differential diagnosis of abdominal masses. The authors report a case of a giant adrenal cyst assessed by ultrasonography, computed tomography and magnetic resonance imaging, and outline their features and classification. (author)

  17. Giant magneto-resistance devices

    CERN Document Server

    Hirota, Eiichi; Inomata, Koichiro

    2002-01-01

    This book deals with the application of giant magneto-resistance (GMR) effects to electronic devices. It will appeal to engineers and graduate students in the fields of electronic devices and materials. The main subjects are magnetic sensors with high resolution and magnetic read heads with high sensitivity, required for hard-disk drives with recording densities of several gigabytes. Another important subject is novel magnetic random-access memories (MRAM) with non-volatile non-destructive and radiation-resistant characteristics. Other topics include future GMR devices based on bipolar spin transistors, spin field-effect transistors (FETs) and double-tunnel junctions.

  18. GIANT OILFIELD DISCOVERED IN BOHAI

    Institute of Scientific and Technical Information of China (English)

    2007-01-01

    @@ PetroChina announced a discovery of a giant oilfield in the beginning of May, which has a reserve of one billion tons, or about 7.35 billion barrels, the largest discovery in China over four decades. Of the reserves, the basically proven oil in place is 405 million tons with the average thickness of oil formations ranging between 80 meters and 100 meters. The oilfield lies in the Nanpu block of PetroChina Jidong Oilfield Company in Caofeidian industrial zone, north China's Hebei province. The area is expected to enjoy a better chance of becoming a national oil strategic reserve base following the discovery of the Nanpu Oilfield.

  19. On the Shoulders of Giants...

    Science.gov (United States)

    2013-01-01

    On the shoulders of giantsI Basil A. Pruitt, Jr., MD and Todd E. Rasmussen, MD I n a letter dated February 5, 1676 (dated 1675 using the Julian...T.E.R.), Fort Sam Houston, San Antonio, TX. Address for reprints: Basil A. Pruitt, Jr, MD, Division of Trauma, Department of Surgery, The University...default.htm. 20. Moore FD. Edward Delos Churchill (1895Y1972). Ann Surg. 1973; 177:507Y508. 21. The Board for the Study of the Severely Wounded. The

  20. Internal rotation of red giants by asteroseismology

    CERN Document Server

    Di Mauro, M P; Ventura, R; Stello, D; Beck, P G; Davies, G; Elsworth, Y; Garcıa, R A; Hekker, S; Mosser, B; Christensen-Dalsgaard, J; Bloemen, S; Catanzaro, G; De Smedt, K; Tkachenko, A

    2012-01-01

    We present an asteroseismic approach to study the dynamics of the stellar interior in red-giant stars by asteroseismic inversion of the splittings induced by the stellar rotation on the oscillation frequencies. We show preliminary results obtained for the red giant KIC4448777 observed by the space mission Kepler.

  1. Giant Rings in the CMB Sky

    CERN Document Server

    Kovetz, Ely D; Itzhaki, Nissan

    2010-01-01

    We find a unique direction in the CMB sky around which giant rings have an anomalous mean temperature profile. This direction is in very close alignment with the afore measured anomalously large bulk flow direction. We argue that a cosmic defect seeded by a pre-inflationary particle could explain the giant rings, the large bulk flow and their alignment.

  2. Totally thrombosed giant anterior communicating artery aneurysm

    Directory of Open Access Journals (Sweden)

    V R Roopesh Kumar

    2015-01-01

    Full Text Available Giant anterior communicating artery aneurysmsarerare. Apatient presented with visual dysfunction, gait ataxia and urinary incontinence. MRI showed a giant suprasellar mass.At surgery, the lesion was identified as being an aneurysm arising from the anterior communicating artery.The difficulty in preoperative diagnosis and relevant literature are reviewed.

  3. Surgical treatment for giant incisional hernia

    DEFF Research Database (Denmark)

    Eriksson, A; Rosenberg, J; Bisgaard, T

    2014-01-01

    INTRODUCTION: Repair for giant incisional hernias is a challenge due to unacceptable high morbidity and recurrence rates. Several surgical techniques are available, but all are poorly documented. This systematic review was undertaken to evaluate the existing literature on repair for giant incisio...... procedure and severely lack evidence-based research from high-quality, large-scaled randomised studies....

  4. THE CASE OF THE GIANT-CELL ARTERITIS MANIFESTED AS DORSOLATERAL MEDULLARY INFARCTION

    Directory of Open Access Journals (Sweden)

    V. S. Akimov

    2014-01-01

    Full Text Available The case of a giant-cell arteritis is presented. First clinical signs of the disease were fewer and development of infarction in the basin of the left vertebral artery. Magnetic resonance angiography showed its prolonged diminution. Laboratory results were remarkable for the high rate of erythrocyte sedimentation and the increase of C-reactive protein (CRP concentration. Physical examination revealed acrotism in temporal arteries. Diagnosis was proven by biopsy results which included giant multinucleate cells. Authors discuss problems of diagnosis of the disease, the role of radiological methods (angio-ultrasonography, magnetic resonance and computed tomography aided angiography, positron-emission tomography and the necessity to pay particular attention to the elderly patients with high rate of erythrocyte sedimentation and the increased CRP concentration.

  5. Nonlinear resonances

    CERN Document Server

    Rajasekar, Shanmuganathan

    2016-01-01

    This introductory text presents the basic aspects and most important features of various types of resonances and anti-resonances in dynamical systems. In particular, for each resonance, it covers the theoretical concepts, illustrates them with case studies, and reviews the available information on mechanisms, characterization, numerical simulations, experimental realizations, possible quantum analogues, applications and significant advances made over the years. Resonances are one of the most fundamental phenomena exhibited by nonlinear systems and refer to specific realizations of maximum response of a system due to the ability of that system to store and transfer energy received from an external forcing source. Resonances are of particular importance in physical, engineering and biological systems - they can prove to be advantageous in many applications, while leading to instability and even disasters in others. The book is self-contained, providing the details of mathematical derivations and techniques invo...

  6. Giant Planet Formation, Evolution, and Internal Structure

    CERN Document Server

    Helled, Ravit; Podolak, Morris; Boley, Aaron; Meru, Farzana; Nayakshin, Sergei; Fortney, Jonathan J; Mayer, Lucio; Alibert, Yann; Boss, Alan P

    2013-01-01

    The large number of detected giant exoplanets offers the opportunity to improve our understanding of the formation mechanism, evolution, and interior structure of gas giant planets. The two main models for giant planet formation are core accretion and disk instability. There are substantial differences between these formation models, including formation timescale, favorable formation location, ideal disk properties for planetary formation, early evolution, planetary composition, etc. First, we summarize the two models including their substantial differences, advantages, and disadvantages, and suggest how theoretical models should be connected to available (and future) data. We next summarize current knowledge of the internal structures of solar- and extrasolar- giant planets. Finally, we suggest the next steps to be taken in giant planet exploration.

  7. MRI of giant cell tumor of tendon sheath of the hand: a report of three cases

    Energy Technology Data Exchange (ETDEWEB)

    Khan, S. [San Francisco Magnetic Resonance, San Francisco, CA (United States)]|[Dept. of Radiology, Kings College Hospital, London (United Kingdom); Neumann, C.H. [San Francisco Magnetic Resonance, San Francisco, CA (United States)]|[Dept. Radiology, Univ. of California, San Francisco, CA (United States)]|[Dept. of Radiology, Desert Hospital, Palm Springs, CA (United States); Steinbach [San Francisco Magnetic Resonance, San Francisco, CA (United States)]|[Dept. Radiology, Univ. of California, San Francisco, CA (United States); Harrington, K.D. [Dept. of Orthopedic Surgery, Childrens Hospital, San Francisco, CA (United States)

    1995-12-31

    Giant cell tumor of tendon sheath is a common tumor of the hand. Magnetic resonance can be used to confirm its presence, as well as characterize and determine its extent, contributing to the presurgical diagnosis, planning of the surgical approach, and diagnosis of recurrence. The authors describe the MR appearances in three cases, using spin-echo sequences with and without fat saturation and intravenous gadopentetate dimeglumine administration. Previous literature on the subject is also reviewed. (orig.)

  8. Estrogen sulfotransferase/SULT1E1 promotes human adipogenesis.

    Science.gov (United States)

    Ihunnah, Chibueze A; Wada, Taira; Philips, Brian J; Ravuri, Sudheer K; Gibbs, Robert B; Kirisci, Levent; Rubin, J Peter; Marra, Kacey G; Xie, Wen

    2014-05-01

    Estrogen sulfotransferase (EST/SULT1E1) is known to catalyze the sulfoconjugation and deactivation of estrogens. The goal of this study is to determine whether and how EST plays a role in human adipogenesis. By using human primary adipose-derived stem cells (ASCs) and whole-fat tissues from the abdominal subcutaneous fat of obese and nonobese subjects, we showed that the expression of EST was low in preadipocytes but increased upon differentiation. Overexpression and knockdown of EST in ASCs promoted and inhibited differentiation, respectively. The proadipogenic activity of EST in humans was opposite to the antiadipogenic effect of the same enzyme in rodents. Mechanistically, EST promoted adipogenesis by deactivating estrogens. The proadipogenic effect of EST can be recapitulated by using an estrogen receptor (ER) antagonist or ERα knockdown. In contrast, activation of ER in ASCs inhibited adipogenesis by decreasing the recruitment of the adipogenic peroxisome proliferator-activated receptor γ (PPARγ) onto its target gene promoters, whereas ER antagonism increased the recruitment of PPARγ to its target gene promoters. Linear regression analysis revealed a positive correlation between the expression of EST and body mass index (BMI), as well as a negative correlation between ERα expression and BMI. We conclude that EST is a proadipogenic factor which may serve as a druggable target to inhibit the turnover and accumulation of adipocytes in obese patients.

  9. Data of evolutionary structure change: 1E1QC-2HLDA [Confc[Archive

    Lifescience Database Archive (English)

    Full Text Available 1E1QC-2HLDA 1E1Q 2HLD C A ADTSVDLEETGRVLSIGDGIARVHGLRNVQAEEMVEFSS...ELFYKGIRPAINVGLSVSRVGSAAQTRAMKQVAGTMKLELAQYREVAAFAQFGSDLDAATQQLLSRGVRLTELLKQGQYSPMAIEEQVAVIYAGVRGYLDKLEPSKIT...RPAINVGLSVSRVGSAAQVKALKQVAGSLKLFLAQYREVAAFAQS--DLDASTKQTLVRGERLTQLLKQNQYSPLATEEQV...> 0 2HLD A 2HLDA AFAQS--DLDA...ain> 1E1Q C 1E1QC AFAQFGSDLDA

  10. Separating gas-giant and ice-giant planets by halting pebble accretion

    Science.gov (United States)

    Lambrechts, M.; Johansen, A.; Morbidelli, A.

    2014-12-01

    In the solar system giant planets come in two flavours: gas giants (Jupiter and Saturn) with massive gas envelopes, and ice giants (Uranus and Neptune) with much thinner envelopes around their cores. It is poorly understood how these two classes of planets formed. High solid accretion rates, necessary to form the cores of giant planets within the life-time of protoplanetary discs, heat the envelope and prevent rapid gas contraction onto the core, unless accretion is halted. We find that, in fact, accretion of pebbles (~cm sized particles) is self-limiting: when a core becomes massive enough it carves a gap in the pebble disc. This halt in pebble accretion subsequently triggers the rapid collapse of the super-critical gas envelope. Unlike gas giants, ice giants do not reach this threshold mass and can only bind low-mass envelopes that are highly enriched by water vapour from sublimated icy pebbles. This offers an explanation for the compositional difference between gas giants and ice giants in the solar system. Furthermore, unlike planetesimal-driven accretion scenarios, our model allows core formation and envelope attraction within disc life-times, provided that solids in protoplanetary discs are predominantly made up of pebbles. Our results imply that the outer regions of planetary systems, where the mass required to halt pebble accretion is large, are dominated by ice giants and that gas-giant exoplanets in wide orbits are enriched by more than 50 Earth masses of solids.

  11. Photophoresis boosts giant planet formation

    CERN Document Server

    Teiser, Jens

    2013-01-01

    In the core accretion model of giant planet formation, a solid protoplanetary core begins to accrete gas directly from the nebula when its mass reaches about 5 earth masses. The protoplanet has at most a few million years to reach runaway gas accretion, as young stars lose their gas disks after 10 million years at the latest. Yet gas accretion also brings small dust grains entrained in the gas into the planetary atmosphere. Dust accretion creates an optically thick protoplanetary atmosphere that cannot efficiently radiate away the kinetic energy deposited by incoming planetesimals. A dust-rich atmosphere severely slows down atmospheric cooling, contraction, and inflow of new gas, in contradiction to the observed timescales of planet formation. Here we show that photophoresis is a strong mechanism for pushing dust out of the planetary atmosphere due to the momentum exchange between gas and dust grains. The thermal radiation from the heated inner atmosphere and core is sufficient to levitate dust grains and to ...

  12. Giant sialocele following facial trauma.

    Science.gov (United States)

    Medeiros Júnior, Rui; Rocha Neto, Alípio Miguel da; Queiroz, Isaac Vieira; Cauby, Antônio de Figueiredo; Gueiros, Luiz Alcino Monteiro; Leão, Jair Carneiro

    2012-01-01

    Injuries in the parotid and masseter region can cause serious impairment secondary to damage of important anatomical structures. Sialocele is observed as facial swelling associated with parotid duct rupture due to trauma. The aim of this paper is to report a case of a giant traumatic sialocele in the parotid gland, secondary to a knife lesion in a 40-year-old woman. Conservative measures could not promote clinical resolution and a surgical intervention for the placement of a vacuum drain was selected. Under local anesthesia, a small incision was performed adjacent to parotid duct papilla, followed by muscular divulsion and draining of significant amount of saliva. An active vacuum suction drain was placed for 15 days, aiming to form a new salivary duct. This technique was shown to be a safe, effective and low-cost option, leading to complete resolution and no recurrence after 28 months of follow up.

  13. Giant Vulvar Epidermoid Cyst in an Adolescent Girl

    Directory of Open Access Journals (Sweden)

    Erbil Karaman

    2015-01-01

    Full Text Available Introduction. Vulvar cyst in adolescent girls is very uncommon. Epidermoid cyst can be seen in many sites including face, trunk, and extremities but its occurrence in vulva is uncommon. This is the first case of epidermoid cyst of vulva reported in an adolescent girl. Case. A 17-year-old, adolescent girl admitted to our gynecology outpatient clinic with a complaint of painful and palpable mass in her vulva. On examination, a giant mass located in left vulva and labia majora with 11 cm in diameter was seen. The magnetic resonance imaging (MRI showed a well-defined cystic mass without contrast enhancement. The surgery was advised to the patient and the pathologic examination of mass revealed vulvar epidermoid cyst. Discussion. Vulvar cysts generally grow slowly and the main etiologies are vulvar trauma and surgical interventions including episiotomy and female circumcision in some culture. The exact treatment is total surgical excision and pathologic examination. MRI is an important imaging modality for detection of extension to deep perineal tissue and localization of mass in vulva especially in giant ones. Conclusion. Although vulvar mass in adolescents is rare, the epidermoid cyst with benign origin should be kept in mind.

  14. A Rare Entity: Adult Asymptomatic Giant Vallecular Cyst

    Directory of Open Access Journals (Sweden)

    Mümtaz Taner Torun

    2015-01-01

    Full Text Available Background. Cysts in the larynx are rare and generally asymptomatic. However, large cysts in adults can be symptomatic. If they are symptomatic, they typically present with respiratory and feeding difficulties. They are usually benign in terms of pathology. Several surgical techniques may be used for treatment. Case Report. A 56-year-old man presented to our clinic with hoarseness. Routine laryngeal examination revealed a giant mass and the larynx could not be visualized. At magnetic resonance imaging (MRI, a cystic mass originating from the vallecula was detected. There was no pathology at the glottic level. We planned tracheotomy for the airway and endoscopic surgery for excision. The mass was excised using CO2 laser and was reported as benign. Conclusion. An asymptomatic vallecular cyst may cause difficult intubation in any operation. It may also cause respiratory or other complications. Airway management should be led by an ear, nose, and throat surgeon, since tracheotomy may be required. Endoscopic excision with CO2 laser is a good choice for treatment in elective cases. In this report, we discuss the diagnosis and treatment of a patient with an asymptomatic giant vallecular cyst.

  15. A Rare Entity: Adult Asymptomatic Giant Vallecular Cyst

    Science.gov (United States)

    Torun, Mümtaz Taner; Seçkin, Ender; Tuncel, Ümit; Kılıç, Caner; Özkan, Özalkan

    2015-01-01

    Background. Cysts in the larynx are rare and generally asymptomatic. However, large cysts in adults can be symptomatic. If they are symptomatic, they typically present with respiratory and feeding difficulties. They are usually benign in terms of pathology. Several surgical techniques may be used for treatment. Case Report. A 56-year-old man presented to our clinic with hoarseness. Routine laryngeal examination revealed a giant mass and the larynx could not be visualized. At magnetic resonance imaging (MRI), a cystic mass originating from the vallecula was detected. There was no pathology at the glottic level. We planned tracheotomy for the airway and endoscopic surgery for excision. The mass was excised using CO2 laser and was reported as benign. Conclusion. An asymptomatic vallecular cyst may cause difficult intubation in any operation. It may also cause respiratory or other complications. Airway management should be led by an ear, nose, and throat surgeon, since tracheotomy may be required. Endoscopic excision with CO2 laser is a good choice for treatment in elective cases. In this report, we discuss the diagnosis and treatment of a patient with an asymptomatic giant vallecular cyst. PMID:26688767

  16. Studies show giant panda could survive

    Institute of Scientific and Technical Information of China (English)

    2007-01-01

    @@ The giant panda (Ailuropoda melanoleuca) is not a relic species, and it can survive, according to scientists. Employing microsatellite and mitochondrial control region (CR) sequences as genetic markers, CAS researchers have obtained some key information about the giant panda and its recent evolution history. Their discovery that the lovely creature still possesses high genetic diversity and evolution potentials challenges the hypothesis suggesting the giant panda is facing an"evolutionary dead-end." The research was reported in a recent issue of Molecular Biology and Evolution by a team of scientists led by Prof.WEI Fuwen of the CAS Institute of Zoology and Prof. Michael W.Bruford of Cardiff University.

  17. SYNOVIAL GIANT CELL TUMOR OF THE KNEE.

    Science.gov (United States)

    Abdalla, Rene Jorge; Cohen, Moisés; Nóbrega, Jezimar; Forgas, Andrea

    2009-01-01

    Synovial giant cell tumor is a benign neoplasm, rarely reported in the form of malignant metastasis. Synovial giant cell tumor most frequently occurs on the hand, and, most uncommon, on the ankle and knee. In the present study, the authors describe a rare case of synovial giant cell tumor on the knee as well as the treatment approach. Arthroscopy has been shown, in this case, to be the optimal method for treating this kind of lesion, once it allowed a less aggressive approach, while providing good visualization of all compartments of knee joint and full tumor resection.

  18. Giant Cell Tumor: Role of Conservative Treatment

    Institute of Scientific and Technical Information of China (English)

    Anatolii Diedkov[1; Pavlo Kovalchuk[1; Marija Kukushkina[2; Sergey Bojchuk[1; Viktor Kostyuk[1

    2014-01-01

    Giant cell tumor is aggressive bone tumor. Surgical treatment is considered to be the only effective method of treatment ofthese tumors. The problem of inoperable patients with giant cell tumors is a challenge. A total of 8 patients had giant cell bone tumorsof pelvis and sacrum. 3 patients were treated by bisphosphonates, radiation therapy and embolization of tumor-nutrient arteries. 5patients received denosumab. The efficiency was assessed according to clinical data and CT scan control. Median follow up is 28months. All 8 patients had reduction of pain intensity. Treatment with denosumab demonstrated more than 30% tumor regression. Allof the patients are in remission.

  19. There might be giants: unseen Jupiter-mass planets as sculptors of tightly-packed planetary systems

    CERN Document Server

    Hands, T O

    2015-01-01

    The limited completeness of the Kepler sample for planets with orbital periods $\\gtrsim$ 1 yr leaves open the possibility that exoplanetary systems may host undetected giant planets. Should such planets exist, their dynamical interactions with the inner planets may prove vital in sculpting the final orbital configurations of these systems. Using an $N$-body code with additional forces to emulate the effects of a protoplanetary disc, we perform simulations of the assembly of compact systems of super-Earth-mass planets with unseen giant companions. The simulated systems are analogous to Kepler-11 or Kepler-32 in that they contain 4 or 5 inner super-Earths, but our systems also contain longer-period giant companions which are unlikely to have been detected by Kepler. We find that giant companions tend to break widely-spaced, first-order mean-motion resonances, allowing the inner planets to migrate into tighter resonances. This leads to more compact architectures and increases the occurrence rate of Laplace reson...

  20. STUDIES ON THE INGESTION CHARACTERISTICS OF GIANT FRESHWATER PRAWN, CHINESE PRAWN AND GIANT TIGER PRAWN

    Institute of Scientific and Technical Information of China (English)

    2000-01-01

    The ingestion of giant freshwater prawn, Chinese prawn and giant tiger prawn had continuity and the ingestion high peak occurred at night. Light and temperature had significant effects on the daily ingestion rate (DIR) of giant freshwater prawn Macrobrachium rosenbergii. Red light and blue light favorably induced favorable ingestion. In the adaptive range of temperature, the DIR increased with rising temperature and feeding frequency, but decreased with rising body weight.

  1. Giant black hole ringings induced by massive gravity

    CERN Document Server

    Decanini, Yves; Hadj, Mohamed Ould El

    2014-01-01

    A distorted black hole radiates gravitational waves in order to settle down in one of the geometries permitted by the no-hair theorem. During that relaxation phase, a characteristic damped ringing is generated. It can be theoretically constructed from the black hole quasinormal frequencies (which govern its oscillating behavior and its decay) and from the associated excitation factors (which determine intrinsically its amplitude) by carefully taking into account the source of the distortion. Here, by considering the Schwarzschild black hole in the framework of massive gravity, we show that the excitation factors have an unexpected strong resonant behavior leading to giant ringings which are, moreover, slowly decaying. Such extraordinary black hole ringings could be observed by the next generations of gravitational wave detectors and allow us to test the various massive gravity theories or their absence could be used to impose strong constraints on the graviton mass.

  2. Hierarchical spin-orbital polarization of a giant Rashba system.

    Science.gov (United States)

    Bawden, Lewis; Riley, Jonathan M; Kim, Choong H; Sankar, Raman; Monkman, Eric J; Shai, Daniel E; Wei, Haofei I; Lochocki, Edward B; Wells, Justin W; Meevasana, Worawat; Kim, Timur K; Hoesch, Moritz; Ohtsubo, Yoshiyuki; Le Fèvre, Patrick; Fennie, Craig J; Shen, Kyle M; Chou, Fangcheng; King, Phil D C

    2015-09-01

    The Rashba effect is one of the most striking manifestations of spin-orbit coupling in solids and provides a cornerstone for the burgeoning field of semiconductor spintronics. It is typically assumed to manifest as a momentum-dependent splitting of a single initially spin-degenerate band into two branches with opposite spin polarization. Combining polarization-dependent and resonant angle-resolved photoemission measurements with density functional theory calculations, we show that the two "spin-split" branches of the model giant Rashba system BiTeI additionally develop disparate orbital textures, each of which is coupled to a distinct spin configuration. This necessitates a reinterpretation of spin splitting in Rashba-like systems and opens new possibilities for controlling spin polarization through the orbital sector.

  3. Giant Rabi splitting in metal/semiconductor nanohybrids

    Science.gov (United States)

    Bellessa, Joel; Symonds, Clementine; Vynck, Kevin; Beaur, Luc; Brioude, Arnaud; Lemaitre, Aristide

    2011-03-01

    We present strong coupling regime between localized plasmon in lithographed nanoparticles and excitons in an organic semiconductor. The lithographed nanoparticles allow a very good control of the particle size and environment, thereby avoiding a large inhomogeneous broadening of the plasmonic resonances which could partially mask the plasmon/exciton hybridization. The nanoparticles diameter ranges from 100 to 200 nm. A giant Rabi splitting energy of 450 meV is obtained, and typical behaviors of mixed states, i.e. anticrossing of their energies and crossing of their linewidths, are observed. Three-dimensional finite-difference time-domain simulations and coupled oscillator calculations are used to analyze and corroborate the experimental results.

  4. Resonant Removal of Exomoons during Planetary Migration

    Science.gov (United States)

    Spalding, Christopher; Batygin, Konstantin; Adams, Fred C.

    2016-01-01

    Jupiter and Saturn play host to an impressive array of satellites, making it reasonable to suspect that similar systems of moons might exist around giant extrasolar planets. Furthermore, a significant population of such planets is known to reside at distances of several Astronomical Units (AU), leading to speculation that some moons thereof might support liquid water on their surfaces. However, giant planets are thought to undergo inward migration within their natal protoplanetary disks, suggesting that gas giants currently occupying their host star’s habitable zone formed farther out. Here we show that when a moon-hosting planet undergoes inward migration, dynamical interactions may naturally destroy the moon through capture into a so-called evection resonance. Within this resonance, the lunar orbit’s eccentricity grows until the moon eventually collides with the planet. Our work suggests that moons orbiting within about ∼10 planetary radii are susceptible to this mechanism, with the exact number dependent on the planetary mass, oblateness, and physical size. Whether moons survive or not is critically related to where the planet began its inward migration, as well as the character of interlunar perturbations. For example, a Jupiter-like planet currently residing at 1 AU could lose moons if it formed beyond ∼5 AU. Cumulatively, we suggest that an observational census of exomoons could potentially inform us on the extent of inward planetary migration, for which no reliable observational proxy currently exists.

  5. AFSC/ABL: Female Giant Grenadier maturity

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — Giant grenadiers Albatrossia pectoralis are caught as bycatch in deep-sea commercial fisheries in relatively large numbers. The population appears to be stable,...

  6. growing African giant rats Cricetomys gambianus

    African Journals Online (AJOL)

    bolism, conductance and evaporative water loss changes in relation to physical and behavioural development in growing giant rat pups ... evaporation) into dry air was collected in a pre-weighed column of silica ..... Principles and adaptation.

  7. Giant prostatic fossa with misleading radiographic features.

    Science.gov (United States)

    Stenzl, A; Fuchs, G J

    1989-01-01

    The long-term complication of a perforation of the prostatic capsule during transurethral resection of the prostate is described. Calcifications in a giant prostatic fossa led to initially misleading radiologic findings.

  8. Giant planet and brown dwarf formation

    CERN Document Server

    Chabrier, G; Janson, M; Rafikov, R

    2014-01-01

    Understanding the dominant brown dwarf and giant planet formation processes, and finding out whether these processes rely on completely different mechanisms or share common channels represents one of the major challenges of astronomy and remains the subject of heated debates. It is the aim of this review to summarize the latest developments in this field and to address the issue of origin by confronting different brown dwarf and giant planet formation scenarios to presently available observational constraints. As examined in the review, if objects are classified as "Brown Dwarfs" or "Giant Planets" on the basis of their formation mechanism, it has now become clear that their mass domains overlap and that there is no mass limit between these two distinct populations. Furthermore, while there is increasing observational evidence for the existence of non-deuterium burning brown dwarfs, some giant planets, characterized by a significantly metal enriched composition, might be massive enough to ignite deuterium bur...

  9. Metabolic inactivation of resolvin E1 and stabilization of its anti-inflammatory actions.

    Science.gov (United States)

    Arita, Makoto; Oh, Sungwhan F; Chonan, Tomomichi; Hong, Song; Elangovan, Siva; Sun, Yee-Ping; Uddin, Jasim; Petasis, Nicos A; Serhan, Charles N

    2006-08-11

    The resolvins (Rv) are lipid mediators derived from omega-3 polyunsaturated fatty acids that act within a local inflammatory milieu to stop leukocyte recruitment and promote resolution. Resolvin E1 (RvE1; (5S,12R,18R)-trihydroxy-6Z,8E,10E,14Z,16E-eicosapentaenoic acid) is an oxygenase product derived from omega-3 eicosapentaenoic acid that displays potent anti-inflammation/pro-resolution actions in vivo. Here, we determined whether oxidoreductase enzymes catalyze the conversion of RvE1 and assessed the biological activity of the RvE1 metabolite. With NAD+ as a cofactor, recombinant 15-hydroxyprostaglandin dehydrogenase acted as an 18-hydroxyl dehydrogenase to form 18-oxo-RvE1. In the murine lung, dehydrogenation of the hydroxyl group at carbon 18 position to form 18-oxo-RvE1 represented the major initial metabolic route for RvE1. At a concentration where RvE1 potently reduced polymorphonuclear leukocyte (PMN) recruitment in zymosan-induced peritonitis, 18-oxo-RvE1 was devoid of activity. In human neutrophils, carbon 20 hydroxylation of RvE1 was the main route of conversion. An RvE1 analog, i.e. 19-(p-fluorophenoxy)-RvE1, was synthesized that resisted rapid metabolic inactivation and proved to retain biological activity reducing PMN infiltration and pro-inflammatory cytokine/chemokine production in vivo. These results established the structure of a novel RvE1 initial metabolite, indicating that conversion of RvE1 to the oxo product represents a mode of RvE1 inactivation. Moreover, the designed RvE1 analog, which resisted further metabolism/inactivation, could be a useful tool to evaluate the actions of RvE1 in complex disease models.

  10. Giant rhinophyma: Excision with coblation assisted surgery

    Directory of Open Access Journals (Sweden)

    Caner Sahin

    2014-01-01

    Full Text Available An 83-year-old man presented with an unusually severe case of rhinophyma. Giant rhinopyhma is very rare in literature. The giant lesion was widely excised using sharp surgical incision and coblation assisted surgery. Using direct coblation to the nasal dorsum may cause edema in the surrounding tissue. There was minimal edema in surrounding tissue using this technique. A full thickness-skin graft was applied after excision. Cosmetic and functional postoperative results were satisfactory.

  11. Giant rhinophyma: Excision with coblation assisted surgery.

    Science.gov (United States)

    Sahin, Caner; Turker, Mesut; Celasun, Bulent

    2014-01-01

    An 83-year-old man presented with an unusually severe case of rhinophyma. Giant rhinopyhma is very rare in literature. The giant lesion was widely excised using sharp surgical incision and coblation assisted surgery. Using direct coblation to the nasal dorsum may cause edema in the surrounding tissue. There was minimal edema in surrounding tissue using this technique. A full thickness-skin graft was applied after excision. Cosmetic and functional postoperative results were satisfactory.

  12. Taxonomy of Indonesian giant clams (Cardiidae, Tridacninae)

    OpenAIRE

    UDHI EKO HERNAWAN

    2012-01-01

    Hernawan E. 2012. Taxonomy of Indonesian giant clams (Cardiidae, Tridacninae). Biodiversitas 13: 118-123. A taxonomic study was conducted on the giant clam’s specimens deposited in Museum Zoologicum Bogoriense (MZB), Cibinong Indonesia. Taxonomic overviews of the examined specimens are given with diagnostic characters, remarks, habitat and distribution. Discussion is focused on specific characters distinguishing each species. From seven species known to distribute in Indonesian waters, there ...

  13. Perianal Giant Condyloma Acuminatum: A Case Report

    Institute of Scientific and Technical Information of China (English)

    2007-01-01

    @@ Rare giant condyloma acuminatum (CA) reported by this paper is an interesting unusual case in China. Giant CA is a tumor that primarily affects the genital and perianal areas. Its feature is the high rate of local recurrence and transformation into squamous cell carcinoma. Making choice of wide surgical excision and using interferon as antiviral and immunoenhancement for CA after operation, we obtain satisfactory functional and cosmetic results.

  14. Decay Properties Of The Dipole Isobaric Analog Resonances

    NARCIS (Netherlands)

    Gorelik, M. L.; Safonov, I. V.; Urin, M. H.

    2006-01-01

    Abstract: A continuum-RPA-based approach is applied to describe the decay properties of isolated dipole isobaric analog resonances in nuclei having not-too-large neutron excess. Calculated for a few resonances in 90Zr the elastic E1-radiative width and partial proton widths for decay into one-hole s

  15. Testing planet formation theories with Giant stars

    CERN Document Server

    Pasquini, Luca; Hatzes, A; Setiawan, J; Girardi, L; da Silva, L; De Medeiros, J R

    2008-01-01

    Planet searches around evolved giant stars are bringing new insights to planet formation theories by virtue of the broader stellar mass range of the host stars compared to the solar-type stars that have been the subject of most current planet searches programs. These searches among giant stars are producing extremely interesting results. Contrary to main sequence stars planet-hosting giants do not show a tendency of being more metal rich. Even if limited, the statistics also suggest a higher frequency of giant planets (at least 10 %) that are more massive compared to solar-type main sequence stars. The interpretation of these results is not straightforward. We propose that the lack of a metallicity-planet connection among giant stars is due to pollution of the star while on the main sequence, followed by dilution during the giant phase. We also suggest that the higher mass and frequency of the planets are due to the higher stellar mass. Even if these results do not favor a specific formation scenario, they su...

  16. Bayesian Inference of Giant Exoplanet Physics

    Science.gov (United States)

    Thorngren, Daniel; Fortney, Jonathan J.

    2017-01-01

    The physical processes within a giant planet directly set its observed radius for a given mass, age, and insolation. The important aspects are the planet’s bulk composition and its interior thermal evolution. By studying many giant planets as an ensemble, we can gain insight into this physics. We demonstrate two novel examples here. We examine 50 cooler transiting giant planets, whose insolation is sufficiently low (T_eff < 1000 K) that they are not affected by the hot Jupiter radius inflation effect. For these planets, the thermal evolution is relatively well understood, and we show that the bulk planet metallicity increases with the total planet mass, which directly impacts plans for future atmospheric studies. We also examine the relation with stellar metallicity and discuss how these relations place new constraints on the core accretion model of planet formation. Our newest work seeks to quantify the flow of energy into hot Jupiters needed to explain their enlarged radii, in addition to their bulk composition. Because the former is related to stellar insolation and the latter is related to mass, we are able to create a hierarchical Bayesian model to disentangle the two effects in our sample of ~300 transiting giant planets. Our results show conclusively that the inflation power is not a simple fraction of stellar insolation: instead, the power increases with incident flux at a much higher rate. We use these results to test published models of giant planet inflation and to provide accurate empirical mass-radius relations for giant planets.

  17. Multiquark Resonances

    CERN Document Server

    Esposito, A.; Polosa, A.D.

    2016-01-01

    Multiquark resonances are undoubtedly experimentally observed. The number of states and the amount of details on their properties has been growing over the years. It is very recent the discovery of two pentaquarks and the confirmation of four tetraquarks, two of which had not been observed before. We mainly review the theoretical understanding of this sector of particle physics phenomenology and present some considerations attempting a coherent description of the so called X and Z resonances. The prominent problems plaguing theoretical models, like the absence of selection rules limiting the number of states predicted, motivate new directions in model building. Data are reviewed going through all of the observed resonances with particular attention to their common features and the purpose of providing a starting point to further research.

  18. Multiquark resonances

    Science.gov (United States)

    Esposito, A.; Pilloni, A.; Polosa, A. D.

    2017-01-01

    Multiquark resonances are undoubtedly experimentally observed. The number of states and the amount of details on their properties have been growing over the years. It is very recent the discovery of two pentaquarks and the confirmation of four tetraquarks, two of which had not been observed before. We mainly review the theoretical understanding of this sector of particle physics phenomenology and present some considerations attempting a coherent description of the so called X and Z resonances. The prominent problems plaguing theoretical models, like the absence of selection rules limiting the number of states predicted, motivate new directions in model building. Data are reviewed going through all of the observed resonances with particular attention to their common features and the purpose of providing a starting point to further research.

  19. Data of evolutionary structure change: 1E1QC-2HLDT [Confc[Archive

    Lifescience Database Archive (English)

    Full Text Available 1E1QC-2HLDT 1E1Q 2HLD C T ADTSVDLEETGRVLSIGDGIARVHGLRNVQAEEMVEFSS...VQTGLKAVDALVPIGRGQRELIIGDRQTGKTAVALDTILNQKRWNNGSDESKKLYCVYVAVGQKRSTVAQLVQTLEQHDAMKYSIIVAATASEAAPLQYLAPFTAASI...yChain> 2HLD T 2HLDT VAAFA---QDLD

  20. Data of evolutionary structure change: 1E1QB-2HLDT [Confc[Archive

    Lifescience Database Archive (English)

    Full Text Available 1E1QB-2HLDT 1E1Q 2HLD B T DLEETGRVLSIGDGIARVHGLRNVQAEEMVEFSSGLKGM...SDRLVKEGELVKRTGNIVDVPVGPGLLGRVVDALGNPIDGKGPIDAAGRSRAQVKAPGILPRRSVHEPVQTGLKAVDALVPIGRGQRELIIGDRQTGKTAVALDT...dbChain> 2HLDT ALKQVAGSLKLFL 2HLD T 2HLDT VAAFAQDLDAST

  1. Data of evolutionary structure change: 1E1RB-2HLDT [Confc[Archive

    Lifescience Database Archive (English)

    Full Text Available 1E1RB-2HLDT 1E1R 2HLD B T DLEETGRVLSIGDGIARVHGLRNVQAEEMVEFSSGLKGM...SDRLVKEGELVKRTGNIVDVPVGPGLLGRVVDALGNPIDGKGPIDAAGRSRAQVKAPGILPRRSVHEPVQTGLKAVDALVPIGRGQRELIIGDRQTGKTAVALDT...T 2HLDT ALKQVAGSLKLFL2HLD T 2HLDT VAAFAQDLDAST

  2. A note on inextensible flows of partially and pseudo null curves in E_1^4

    OpenAIRE

    Yuzbasi, Zuhal Kucukarslan; Bektas, Mehmet

    2013-01-01

    In this paper, we study inextensible flows of partially null and pseudo null curves in E_1^4. We give neccessary and sufficent conditions for inextensible flows of partially null and pseudo null curves in E_1^4

  3. Data of evolutionary structure change: 1E1RC-2HLDA [Confc[Archive

    Lifescience Database Archive (English)

    Full Text Available 1E1RC-2HLDA 1E1R 2HLD C A ADTSVDLEETGRVLSIGDGIARVHGLRNVQAEEMVEFSS...ELFYKGIRPAINVGLSVSRVGSAAQTRAMKQVAGTMKLELAQYREVAAFAQFGSDLDAATQQLLSRGVRLTELLKQGQYSPMAIEEQVAVIYAGVRGYLDKLEPSKIT...RPAINVGLSVSRVGSAAQVKALKQVAGSLKLFLAQYREVAAFAQS--DLDASTKQTLVRGERLTQLLKQNQYSPLATEEQV...fEVID> 0 2HLD A 2HLDA AFAQS--DLDAS GGG -- HH

  4. Asteroseismology of red-giant stars as a novel approach in the search for gravitational waves

    CERN Document Server

    Campante, Tiago L; Bossini, Diego; Miglio, Andrea; Chaplin, William J

    2016-01-01

    Stars are massive resonators that may be used as gravitational-wave (GW) detectors with isotropic sensitivity. New insights on stellar physics are being made possible by asteroseismology, the study of stars by the observation of their natural oscillations. The continuous monitoring of oscillation modes in stars of different masses and sizes (e.g., as carried out by NASA's Kepler mission) opens the possibility of surveying the local Universe for GW radiation. Red-giant stars are of particular interest in this regard. Since the mean separation between red giants in open clusters is small (a few light years), this can in principle be used to look for the same GW imprint on the oscillation modes of different stars as a GW propagates across the cluster. Furthermore, the frequency range probed by oscillations in red giants complements the capabilities of the planned eLISA space interferometer. We propose asteroseismology of red giants as a novel approach in the search for gravitational waves.

  5. Giant aeolian dune size determined by the average depth of the atmospheric boundary layer

    Science.gov (United States)

    Claudin, P.; Fourrière, A.; Andreotti, B.; Murray, A. B.

    2009-12-01

    Depending on the wind regime, sand dunes exhibit linear, crescent-shaped or star-like forms resulting from the interaction between dune morphology and sand transport. Small-scale dunes form by destabilization of the sand bed with a wavelength (a few tens of metres) determined by the sand transport saturation length. The mechanisms controlling the formation of giant dunes, and in particular accounting for their typical time and length scales, have remained unknown. Using a combination of field measurements and aerodynamic calculations, we show here that the growth of aeolian giant dunes, ascribed to the nonlinear interaction between small-scale superimposed dunes, is limited by the confinement of the flow within the atmospheric boundary layer. Aeolian giant dunes and river dunes form by similar processes, with the thermal inversion layer that caps the convective boundary layer in the atmosphere acting analogously to the water surface in rivers. In both cases, the bed topography excites surface waves on the interface that in turn modify the near-bed flow velocity. This mechanism is a stabilizing process that prevents the scale of the pattern from coarsening beyond the resonant condition. Our results can explain the mean spacing of aeolian giant dunes ranging from 300 m in coastal terrestrial deserts to 3.5 km. We propose that our findings could serve as a starting point for the modelling of long-term evolution of desert landscapes under specific wind regimes.

  6. Baryon Resonances

    CERN Document Server

    Oset, E; Sun, Bao Xi; Vacas, M J Vicente; Ramos, A; Gonzalez, P; Vijande, J; Torres, A Martinez; Khemchandani, K

    2009-01-01

    In this talk I show recent results on how many excited baryon resonances appear as systems of one meson and one baryon, or two mesons and one baryon, with the mesons being either pseudoscalar or vectors. Connection with experiment is made including a discussion on old predictions and recent results for the photoproduction of the $\\Lambda(1405)$ resonance, as well as the prediction of one $1/2^+$ baryon state around 1920 MeV which might have been seen in the $\\gamma p \\to K^+ \\Lambda$ reaction.

  7. Baryon Resonances

    Energy Technology Data Exchange (ETDEWEB)

    Oset, E. [Departamento de Fisica Teorica and IFIC, Centro Mixto Universidad de Valencia-CSIC, Institutos de Investigacion de Paterna, Aptdo. 22085, 46071 Valencia (Spain); Sarkar, S. [Variable Energy Cyclotron Centre, 1/AF, Bidhannagar, Kolkata 700064 (India); Sun Baoxi [Institute of Theoretical Physics, College of Applied Sciences, Beijing University of Technology, Beijing 100124 (China); Vicente Vacas, M.J. [Departamento de Fisica Teorica and IFIC, Centro Mixto Universidad de Valencia-CSIC, Institutos de Investigacion de Paterna, Aptdo. 22085, 46071 Valencia (Spain); Ramos, A. [Departament d' Estructura i Constituents de la Materia and Institut de Ciencies del Cosmos, Universitat de Barcelona, 08028 Barcelona (Spain); Gonzalez, P. [Departamento de Fisica Teorica and IFIC, Centro Mixto Universidad de Valencia-CSIC, Institutos de Investigacion de Paterna, Aptdo. 22085, 46071 Valencia (Spain); Vijande, J. [Departamento de Fisica Atomica Molecular y Nuclear and IFIC, Centro Mixto Universidad de Valencia-CSIC, Institutos de Investigacion de Paterna, Aptdo. 22085, 46071 Valencia (Spain); Martinez Torres, A. [Departamento de Fisica Teorica and IFIC, Centro Mixto Universidad de Valencia-CSIC, Institutos de Investigacion de Paterna, Aptdo. 22085, 46071 Valencia (Spain); Khemchandani, K. [Centro de Fisica Computacional, Departamento de Fisica, Universidade de Coimbra, P-3004-516 Coimbra (Portugal)

    2010-04-01

    In this talk I show recent results on how many excited baryon resonances appear as systems of one meson and one baryon, or two mesons and one baryon, with the mesons being either pseudoscalar or vectors. Connection with experiment is made including a discussion on old predictions and recent results for the photoproduction of the {lambda}(1405) resonance, as well as the prediction of one 1/2{sup +} baryon state around 1920 MeV which might have been seen in the {gamma}p{yields}K{sup +}{lambda} reaction.

  8. Neuroaesthetic Resonance

    DEFF Research Database (Denmark)

    Brooks, Anthony Lewis

    2013-01-01

    sessions are achieved via adaptive action-analyzed activities. These interactive virtual environments are designed to empower patients’ creative and/or playful expressions via digital feedback stimuli. Unconscious self- pushing of limits result from innate distractive mechanisms offered by the alternative...... the unencumbered motion-to-computer-generated activities - ‘Music Making’, ‘Painting’, ‘Robotic’ and ‘Video Game’ control. A focus of this position paper is to highlight how Aesthetic Resonance, in this context, relates to the growing body of research on Neuroaesthetics to evolve Neuroaesthetic Resonance....

  9. Cell-based analysis of Chikungunya virus E1 protein in membrane fusion

    Directory of Open Access Journals (Sweden)

    Kuo Szu-Cheng

    2012-04-01

    Full Text Available Abstract Background Chikungunya fever is a pandemic disease caused by the mosquito-borne Chikungunya virus (CHIKV. E1 glycoprotein mediation of viral membrane fusion during CHIKV infection is a crucial step in the release of viral genome into the host cytoplasm for replication. How the E1 structure determines membrane fusion and whether other CHIKV structural proteins participate in E1 fusion activity remain largely unexplored. Methods A bicistronic baculovirus expression system to produce recombinant baculoviruses for cell-based assay was used. Sf21 insect cells infected by recombinant baculoviruses bearing wild type or single-amino-acid substitution of CHIKV E1 and EGFP (enhanced green fluorescence protein were employed to investigate the roles of four E1 amino acid residues (G91, V178, A226, and H230 in membrane fusion activity. Results Western blot analysis revealed that the E1 expression level and surface features in wild type and mutant substituted cells were similar. However, cell fusion assay found that those cells infected by CHIKV E1-H230A mutant baculovirus showed little fusion activity, and those bearing CHIKV E1-G91D mutant completely lost the ability to induce cell-cell fusion. Cells infected by recombinant baculoviruses of CHIKV E1-A226V and E1-V178A mutants exhibited the same membrane fusion capability as wild type. Although the E1 expression level of cells bearing monomeric-E1-based constructs (expressing E1 only was greater than that of cells bearing 26S-based constructs (expressing all structural proteins, the sizes of syncytial cells induced by infection of baculoviruses containing 26S-based constructs were larger than those from infections having monomeric-E1 constructs, suggesting that other viral structure proteins participate or regulate E1 fusion activity. Furthermore, membrane fusion in cells infected by baculovirus bearing the A226V mutation constructs exhibited increased cholesterol-dependences and lower pH thresholds

  10. Absence of NR2E1 mutations in patients with aniridia

    DEFF Research Database (Denmark)

    Corso-Díaz, Ximena; Borrie, Adrienne E; Bonaguro, Russell;

    2012-01-01

    Nuclear receptor 2E1 (NR2E1) is a transcription factor with many roles during eye development and thus may be responsible for the occurrence of certain congenital eye disorders in humans. To test this hypothesis, we screened NR2E1 for candidate mutations in patients with aniridia and other congen...

  11. Early Solar System Bombardment: Exploring the Echos of Planetary Migration and Lost Ice Giants

    Science.gov (United States)

    Bottke, William

    2017-01-01

    Heavily cratered surfaces on the Moon, Mars, Mercury show the terrestrial planets were battered by an intense bombardment during their first billion years or more, but the timing, sources, and dynamical implications of these impacts are controversial. The Late Heavy Bombardment refers to impact events that occurred after stabilization of planetary lithospheres such that they could be preserved as craters. Lunar melt rocks and meteorite shock ages point toward a discrete episode of elevated impact flux between ~3.5 to ~4.2 Ga and a relative quiescence between ~4.0-4.2 to ~4.4 Ga. Evidence from Precambrian impact spherule layers suggest a long-lived tail of terrestrial impactors lasted to ~2.0-2.5 Ga.Dynamical models that include populations residual from primary accretion and destabilized by giant planet migration can potentially account for observations, although all have pros and cons. The most parsimonious solution to match constraints is a hybrid model with discrete early, post-accretion and later, planetary instability-driven impactor populations.For the latter, giant planet instability models can successfully reproduce the orbits of the giant planets, the origin/properties of Jupiter/Neptune Trojans, irregular satellites, the structure of the main asteroid and Kuiper belts, and the presence of comet-like bodies in the main belt, Hilda, and Trojan asteroid populations. The best solutions, however, postulate there were once five giant planets: Jupiter, Saturn, and three ice giants, one that was eventually ejected out of the Solar System by a Jupiter encounter. Intriguing evidence for this “lost” ice giant planet can be found in the orbital properties of bodies captured in the main asteroid belt.The applicability of giant planet instabilities to exoplanet systems seems likely, with the initial configuration of giant planet orbits a byproduct of their early migration and subsequent capture into mutual mean motion resonances. The question is how long can a

  12. Separating gas-giant and ice-giant planets by halting pebble accretion

    CERN Document Server

    Lambrechts, Michiel; Morbidelli, Alessandro

    2014-01-01

    In the Solar System giant planets come in two flavours: 'gas giants' (Jupiter and Saturn) with massive gas envelopes and 'ice giants' (Uranus and Neptune) with much thinner envelopes around their cores. It is poorly understood how these two classes of planets formed. High solid accretion rates, necessary to form the cores of giant planets within the life-time of protoplanetary discs, heat the envelope and prevent rapid gas contraction onto the core, unless accretion is halted. We find that, in fact, accretion of pebbles (~ cm-sized particles) is self-limiting: when a core becomes massive enough it carves a gap in the pebble disc. This halt in pebble accretion subsequently triggers the rapid collapse of the super-critical gas envelope. As opposed to gas giants, ice giants do not reach this threshold mass and can only bind low-mass envelopes that are highly enriched by water vapour from sublimated icy pebbles. This offers an explanation for the compositional difference between gas giants and ice giants in the S...

  13. Giant hepatocellular adenoma; case report

    Energy Technology Data Exchange (ETDEWEB)

    Pitella, F.A.; Coutinho, A.M.N.; Coura Filho, G.B.; Costa, P.L.A.; Ono, C.R.; Watanabe, T.; Sapienza, M.T.; Hironaka, F.; Cerri, G.G.; Buchpiguel, C.A. [Universidade de Sao Paulo (FM/USP), SP (Brazil). Inst. de Radiologia. Servico de Medicina Nuclear

    2008-07-01

    Full text: Introduction: Hepatocellular adenoma is a benign hepatic tumor identified mainly in women during fertility age, with estimated incidence of 4/1000 inhabitants. It is usually unique, well circumscribed, with or without a capsule, size varying from 1 to 30 cm, with possible central areas of necrosis and hemorrhage. Case Report: A 37-year-old female patient presenting with no comorbities, use of hormonal birth control pills for 18 years, a condition of reduction in the consistency of feces, increase in number of daily defecations, abdominal cramps, and a stuffed sensation after meals for two years. A palpable abdominal mass extending from the right hypochondriac to the right iliac fossa was noticed four months ago. A computerized tomography (CT) showed an extensive hepatic mass on the right which was considered, within the diagnostic hypotheses, hepatic adenomatosis, without ruling out secondary lesions. A hepatic scintillography with {sup 99m}Tc-DISIDA showed an extensive exophytic area from segment V to the right iliac fossa with arterialized blood flow and hepatocytic activity, as well as a hepatic nodule in segment VII with hepatocytic activity consistent with the hepatic adenomas hypothesis. The biopsy confirmed the hepatic adenoma diagnosis and the patient was submitted to a partial hepatectomy and cholecystectomy with good clinical evolution. Conclusion: Nuclear Medicine may supplement the assessment of hepatic nodules, including giant masses, thus suggesting new hypotheses and direction to therapeutic conduct. (author)

  14. Migration of accreting giant planets

    Science.gov (United States)

    Crida, A.; Bitsch, B.; Raibaldi, A.

    2016-12-01

    We present the results of 2D hydro simulations of giant planets in proto-planetary discs, which accrete gas at a more or less high rate. First, starting from a solid core of 20 Earth masses, we show that as soon as the runaway accretion of gas turns on, the planet is saved from type I migration : the gap opening mass is reached before the planet is lost into its host star. Furthermore, gas accretion helps opening the gap in low mass discs. Consequently, if the accretion rate is limited to the disc supply, then the planet is already inside a gap and in type II migration. We further show that the type II migration of a Jupiter mass planet actually depends on its accretion rate. Only when the accretion is high do we retrieve the classical picture where no gas crosses the gap and the planet follows the disc spreading. These results impact our understanding of planet migration and planet population synthesis models. The e-poster presenting these results in French can be found here: L'e-poster présentant ces résultats en français est disponible à cette adresse: http://sf2a.eu/semaine-sf2a/2016/posterpdfs/156_179_49.pdf.

  15. Endoscopically removed giant submucosal lipoma

    Directory of Open Access Journals (Sweden)

    Jovanović Ivan

    2007-01-01

    Full Text Available Background. Although uncommon, giant submucosal colon lipomas merit attention as they are often presented with dramatic clinical features such as bleeding, acute bowel obstruction, perforation and sometimes may be mistaken for malignancy. There is a great debate in the literature as to how to treat them. Case report. A patient, 67-year old, was admitted to the Clinic due to a constipation over the last several months, increasing abdominal pain mainly localized in the left lower quadrant accompanied by nausea, vomiting and abdominal distension. Physical examination was unremarkable and the results of the detailed laboratory tests and carcinoembryonic antigen remained within normal limits. Colonoscopy revealed a large 10 cm long, and 4 to 5 cm in diameter, mobile lesion in his sigmoid colon. Conventional endoscopic ultrasound revealed 5 cm hyperechoic lesion of the colonic wall. Twenty MHz mini-probe examination showed that lesion was limited to the submucosa. Since polyp appeared too large for a single transaction, it was removed piecemeal. Once the largest portion of the polyp has been resected, it was relatively easy to place the opened snare loop around portions of the residual polyp. Endoscopic resection was carried out safely without complications. Histological examination revealed the common typical histological features of lipoma elsewhere. The patient remained stable and eventually discharged home. Four weeks later he suffered no recurrent symptoms. Conclusion. Colonic lipomas can be endoscopically removed safely eliminating unnecessary surgery.

  16. Hot super-Earths and giant planet cores from different migration histories

    CERN Document Server

    Cossou, Christophe; Hersant, Franck; Pierens, Arnaud

    2014-01-01

    Planetary embryos embedded in gaseous protoplanetary disks undergo Type I orbital migration. Migration can be inward or outward depending on the local disk properties but, in general, only planets more massive than several $M_\\oplus$ can migrate outward. Here we propose that an embryo's migration history determines whether it becomes a hot super-Earth or the core of a giant planet. Systems of hot super-Earths (or mini-Neptunes) form when embryos migrate inward and pile up at the inner edge of the disk. Giant planet cores form when inward-migrating embryos become massive enough to switch direction and migrate outward. We present simulations of this process using a modified N-body code, starting from a swarm of planetary embryos. Systems of hot super-Earths form in resonant chains with the innermost planet at or interior to the disk inner edge. Resonant chains are disrupted by late dynamical instabilities triggered by the dispersal of the gaseous disk. Giant planet cores migrate outward toward zero-torque zones...

  17. Autostereogram resonators

    Science.gov (United States)

    Leavey, Sean; Rae, Katherine; Murray, Adam; Courtial, Johannes

    2012-09-01

    Autostereograms, or "Magic Eye" pictures, are repeating patterns designed to give the illusion of depth. Here we discuss optical resonators that create light patterns which, when viewed from a suitable position by a monocular observer, are autostereograms of the three-dimensional shape of one of the mirror surfaces.

  18. Giant elves: Lightning-generated electromagnetic pulses in giant planets.

    Science.gov (United States)

    Luque Estepa, Alejandro; Dubrovin, Daria; José Gordillo-Vázquez, Francisco; Ebert, Ute; Parra-Rojas, Francisco Carlos; Yair, Yoav; Price, Colin

    2015-04-01

    We currently have direct optical observations of atmospheric electricity in the two giant gaseous planets of our Solar System [1-5] as well as radio signatures that are possibly generated by lightning from the two icy planets Uranus and Neptune [6,7]. On Earth, the electrical activity of the troposphere is associated with secondary electrical phenomena called Transient Luminous Events (TLEs) that occur in the mesosphere and lower ionosphere. This led some researchers to ask if similar processes may also exist in other planets, focusing first on the quasi-static coupling mechanism [8], which on Earth is responsible for halos and sprites and then including also the induction field, which is negligible in our planet but dominant in Saturn [9]. However, one can show that, according to the best available estimation for lightning parameters, in giant planets such as Saturn and Jupiter the effect of the electromagnetic pulse (EMP) dominates the effect that a lightning discharge has on the lower ionosphere above it. Using a Finite-Differences, Time-Domain (FDTD) solver for the EMP we found [10] that electrically active storms may create a localized but long-lasting layer of enhanced ionization of up to 103 cm-3 free electrons below the ionosphere, thus extending the ionosphere downward. We also estimate that the electromagnetic pulse transports 107 J to 1010 J toward the ionosphere. There emissions of light of up to 108 J would create a transient luminous event analogous to a terrestrial elve. Although these emissions are about 10 times fainter than the emissions coming from the lightning itself, it may be possible to target them for detection by filtering the appropiate wavelengths. [1] Cook, A. F., II, T. C. Duxbury, and G. E. Hunt (1979), First results on Jovian lightning, Nature, 280, 794, doi:10.1038/280794a0. [2] Little, B., C. D. Anger, A. P. Ingersoll, A. R. Vasavada, D. A. Senske, H. H. Breneman, W. J. Borucki, and The Galileo SSI Team (1999), Galileo images of

  19. Infection with E1B-mutant adenovirus stabilizes p53 but blocks p53 acetylation and activity through E1A

    DEFF Research Database (Denmark)

    Savelyeva, I.; Dobbelstein, M.

    2011-01-01

    Wild-type adenovirus type 5 eliminates p53 through the E1B-55 kDa and E4-34 kDa gene products. Deletion or mutation of E1B-55 kDa has long been thought to confer p53-selective replication of oncolytic viruses. We show here that infection with E1B-defective adenovirus mutants induces massive...... accumulation of p53, without obvious defects in p53 localization, phosphorylation, conformation and oligomerization. Nonetheless, p53 completely failed to induce its target genes in this scenario, for example, p21/CDKN1A, Mdm2 and PUMA. Two regions of the E1A gene products independently contributed...... acetylation in infected cells. Mutating either of these E1A regions, in addition to E1B, partially restored p21 mRNA levels. Our findings argue that adenovirus attenuates p53-mediated p21 induction, through at least two E1B-independent mechanisms. Other virus species and cancer cells may employ analogous...

  20. Giant cell arteritis. Part I. Terminology, classification, clinical manifestations, diagnosis

    Directory of Open Access Journals (Sweden)

    Azamat Makhmudovich Satybaldyev

    2012-01-01

    Full Text Available Giant cell arteritis (GCA is a vasculitis affecting mainly large and medium-sized arteries, which the classification of systemic vasculitides refers to as those mainly involving the large vessels. GCA is typified by the involvement of extracranial aortic branches and intracranial vessels, the aorta and its large vessels are being affected most frequently. The paper considers the terminology, classification, prevalence, major pathogenic mechanisms, and morphology of GCA. A broad spectrum of its clinical subtypes is due to target vessel stenosis caused by intimal hyperplasia. In 40% of cases, GCA is shown to be accompanied by polymyalgia rheumatica that may either precede or manifest simultaneously with GCA, or follow this disease. The menacing complications of GCA may be visual loss or ischemic strokes at various sites depending on the location of the occluded vessel. Along with the gold standard verification of the diagnosis of GCA, namely temporal artery biopsy, the author indicates other (noninvasive methods for detection of vascular lesions: color Doppler ultrasonography of the temporal arteries, fluorescein angiography of the retina, mag-netic resonance angiography, magnetic resonance imaging, and computed tomography to rule out aortic aneurysm. Dynamic 18F positron emission tomography is demonstrated to play a role in the evaluation of therapeutic effectiveness.

  1. Giant many-body effects in liquid ammonia absorption spectrum

    Science.gov (United States)

    Ziaei, Vafa; Bredow, Thomas

    2016-11-01

    In the present work, we accurately calculate the absorption spectrum of liquid ammonia up to 13 eV using many-body perturbation approach. The electronic bandgap of liquid NH3 is perfectly described as the combination of density functional theory, Coulomb-hole screened exchange, and G0W0 approximation to the electronic self-energy, yielding a direct gap (Γ → Γ) of 7.71 eV, fully consistent with the experimentally measured gap from photo-emission spectroscopy. With respect to the NH3 optical properties, the entire spectrum in particular the low lying first absorption band is extremely affected by electron-hole interactions, leading to a fundamental redistribution of spectral weights of the independent-particle spectrum. Three well separated but broad main peaks are identified at 7.0, 9.8, and 11.8 eV with steadily increasing intensities in excellent agreement with the experimental data. Furthermore, we observe a giant net blue-shift of the first absorption peak of about 1.4 eV from gaseous to liquid phase as the direct consequence of many-body effects, allowing the associated liquid ammonia absorption band exciton to delocalize and feel more effectively the repulsion effects imposed by the surrounding solvent shells. Further, the spectrum is insensitive to the coupling of resonant and anti-resonant contributions. Concerning electronic response structure of liquid NH3, it is most sensitive to excitations at energies lower than its electronic gap.

  2. Glue embolization of the giant aneurysm by reducing thrombosis-induced volume expansion effect

    Energy Technology Data Exchange (ETDEWEB)

    Yeom, Yoo Kyung; Suh, Dae Chul [Dept. of Radiology and Research Institute of Radiology, University of Ulsan College of Medicine, Asan Medical Center, Seoul (Korea, Republic of)

    2015-04-15

    A giant aneurysm due to a large intra-aneurysmal volume can be complicated by a delayed massive volume expansion caused by thrombus formation. To prevent such a severe mass effect, we obliterated the aneurysmal lumen by gluing and prevented further development of thrombosis. A 52-year-old female with a giant aneurysm at the cavernous segment of the internal carotid artery presented with tinnitus and intermittent diplopia. After confirming with a negative occlusion test, the right internal carotid artery was trapped by coiling and with further obliteration of the aneurysmal lumen by gluing. She developed a mild diplopia after the procedure and recovered without any deficit. The magnetic resonance angiography showed a stable occlusion of the aneurysm and good collateral filling of the cerebral vessel 15 months later.

  3. Primary angiitis of the central nervous system with diffuse cerebral mass effect and giant cells.

    LENUS (Irish Health Repository)

    Kinsella, J A

    2012-02-01

    Primary angiitis of the central nervous system (PACNS), also called primary CNS vasculitis, is an idiopathic inflammatory condition affecting only intracranial and spinal cord vessels, particularly medium-sized and smaller arteries and arterioles. Angiography and histopathology typically do not reveal evidence of systemic vasculitis.(1,2) Histopathology usually reveals granulomatous inflammation affecting arterioles and small arteries of the parenchyma and\\/or leptomeninges, similar to that seen in Takayasu\\'s or giant cell arteritis.(1-3) We report a patient with biopsy-proven PACNS with giant cells and cerebral mass effect on MRI. Magnetic resonance angiography and cerebral angiography appeared normal and there was no evidence of extracranial vasculitis.

  4. Primary Giant Cell Malignant Fibrous Histiocytoma of the Kidney with Staghorn Calculi

    Directory of Open Access Journals (Sweden)

    Chen C

    2003-01-01

    Full Text Available Malignant fibrous histiocytomas (MFH as primary renal tumours are rare, with less than 50 cases described in the literature. We report a case of primary renal MFH of giant cell type in a 56-year-old man, who presented with bilateral dull flank pain, intermittent gross haematuria and body weight loss (6 kg in 3 months. Intravenous urography, computerized tomography (CT and magnetic resonance image (MRI showed right ureteral stones with mild hydronephrosis, and a solid mass at the lower pole of the left kidney associated with staghorn calculi, as well as tumour thrombi in the left renal vein and inferior vena cava. Left radical nephrectomy and evacuation of tumour thrombi from the left renal vein and inferior vena cava were performed. Histopathologic examination revealed malignant fibrous histiocytoma (MFH of giant cell type. To the best of our knowledge, this is the first report of primary renal MFH associated with staghorn calculi.

  5. Giant Desmoid Tumor of the Anterior Abdominal Wall in a Young Female: A Case Report

    Directory of Open Access Journals (Sweden)

    Mahim Koshariya

    2013-01-01

    Full Text Available Desmoid tumors (also called desmoids fibromatosis are rare slow growing benign and musculoaponeurotic tumors. Although these tumors have a propensity to invade surrounding tissues, they are not malignant. These tumors are associated with women of fertile age, especially during and after pregnancy. We report a young female patient with a giant desmoid tumor of the anterior abdominal wall who underwent primary resection. The patient had no history of an earlier abdominal surgery. Preoperative evaluation included abdominal ultrasound, computed tomography, and magnetic resonance imaging. The histology revealed a desmoid tumor. Primary surgical resection with immediate reconstruction of abdominal defect is the best management of this rarity. To the best of our knowledge and PubMed search, this is the first case ever reported in the medical literature of such a giant desmoid tumor arising from anterior abdominal wall weighing 6.5 kg treated surgically with successful outcome.

  6. Giant partially thrombosed 4 th ventricular posterior inferior cerebellar artery aneurysm; microsurgical management

    Directory of Open Access Journals (Sweden)

    Forhad Hossain Chowdhury

    2014-01-01

    Full Text Available A 42-year-old woman presented with a 3-month history of progressive occipital headache, vomiting, walking difficulty, and repeated fall. She had no history of sudden and severe headache. She had positive cerebellar signs, predominantly on the right side. Computerized tomography (CT scan, CT angiogram, and magnetic resonance image (MRI of the brain showed suspected partially thrombosed giant 4 th ventricular posterior inferior cerebellar artery aneurysm. Patient developed severe hypersensitivity reaction during both CT scan and MRI after contrast injection. Though needed, digital subtraction angiogram (DSA of cerebral vessels was not done. The aneurysm was managed by microsurgical clipping of the aneurysm neck and partial excision of thrombosed aneurysm. Here, we report the details of management of these difficult giant aneurysm without DSA.

  7. Lithium-Rich Giants in Globular Clusters

    CERN Document Server

    Kirby, Evan N; Zhang, Andrew J; Hong, Jerry; Guo, Michelle; Guo, Rachel; Cohen, Judith G; Cunha, Katia

    2016-01-01

    Although red giants deplete lithium on their surfaces, some giants are Li-rich. Intermediate-mass asymptotic giant branch (AGB) stars can generate Li through the Cameron-Fowler conveyor, but the existence of Li-rich, low-mass red giant branch (RGB) stars is puzzling. Globular clusters are the best sites to examine this phenomenon because it is straightforward to determine membership in the cluster and to identify the evolutionary state of each star. In 72 hours of Keck/DEIMOS exposures in 25 clusters, we found four Li-rich RGB and two Li-rich AGB stars. There were 1696 RGB and 125 AGB stars with measurements or upper limits consistent with normal abundances of Li. Hence, the frequency of Li-richness in globular clusters is (0.2 +/- 0.1)% for the RGB, (1.6 +/- 1.1)% for the AGB, and (0.3 +/- 0.1)% for all giants. Because the Li-rich RGB stars are on the lower RGB, Li self-generation mechanisms proposed to occur at the luminosity function bump or He core flash cannot explain these four lower RGB stars. We propo...

  8. Giant cell tumor in adipose package Hoffa

    Science.gov (United States)

    Etcheto, H. Rivarola; Escobar, G.; Blanchod, C. Collazo; Palanconi, M.; Zordan, J.; Salinas, E. Alvarez; Autorino₁, Carlos

    2017-01-01

    Tumors of adipose Hoffa package are very uncommon, with isolated cases reported in the literature. His presentation in pediatric patients knee is exceptional. The most frequently described tumors are benign including vellonodular synovitis. The extra-articular localized variant there of is known as giant cell tumor of the tendon sheath. It is characterized by locally aggressive nature, and has been described in reports of isolated cases. Objective: A case of giant cell tumor of the tendon sheath in adipose presentation package Hoffa in pediatric patients is presented in this paper. Methods: male patient eleven years with right knee pain after sports practice was evaluated. Physical examination, showed limited extension -30º, joint effusion, stable negative Lachman maneuver without peripheral knee laxity. MRI hyperintense on tumor is observed in T2 and hypointense on T1 homogeneous and defined edges content displayed prior to LCA related to adipose Hoffa package. Results: The tumor specimen was obtained and histopathology is defined as densely cellular tissue accumulation of xantomisados fibrocollagenous with histiocytes and multinucleated giant cells, compatible with giant cell tumor of tendon sheath. Conclusion: The presentation of giant cell tumors of the tendon sheath in Hoffa fat pad is exceptional. However, his suspicion allows adequate preoperative surgical planning, as a whole resection is the only procedure that has been shown to decrease the rate of recurrence of this disease.

  9. Infrared spectral properties of M giants

    CERN Document Server

    Sloan, G C; Ramirez, R M; Kraemer, K E; Engelke, C W

    2015-01-01

    We observed a sample of 20 M giants with the Infrared Spectrograph on the Spitzer Space Telescope. Most show absorption structure at 6.6-6.8 um which we identify as water vapor, and in some cases, the absorption extends from 6.4 um into the SiO band at 7.5 um. Variable stars show stronger H2O absorption. While the strength of the SiO fundamental at 8 um increases monotonically from spectral class K0 to K5, the dependence on spectral class weakens in the M giants. As with previously studied samples, the M giants show considerable scatter in SiO band strength within a given spectral class. All of the stars in our sample also show OH band absorption, most noticeably in the 14-17 um region. The OH bands behave much like the SiO bands, increasing in strength in the K giants but showing weaker dependence on spectral class in the M giants, and with considerable scatter. An examination of the photometric properties reveals that the V-K color may be a better indicator of molecular band strength than the spectral class...

  10. An MHD model for magnetar giant flares

    Energy Technology Data Exchange (ETDEWEB)

    Meng, Y.; Lin, J.; Zhang, Q. S. [Yunnan Observatories, Chinese Academy of Sciences, P.O. Box 110, Kunming, Yunnan 650011 (China); Zhang, L. [Department of Physics, Yunnan University, Kunming, Yunnan 650091 (China); Reeves, K. K. [Harvard-Smithsonian Center for Astrophysics, 60 Garden Street, Cambridge, MA 02138 (United States); Yuan, F., E-mail: mengy@ynao.ac.cn, E-mail: jlin@ynao.ac.cn [Key Laboratory for Research in Galaxies and Cosmology, Shanghai Astronomical Observatory, Chinese Academy of Sciences, 80 Nandan Road, Shanghai 200030 (China)

    2014-04-10

    Giant flares on soft gamma-ray repeaters that are thought to take place on magnetars release enormous energy in a short time interval. Their power can be explained by catastrophic instabilities occurring in the magnetic field configuration and the subsequent magnetic reconnection. By analogy with the coronal mass ejection events on the Sun, we develop a theoretical model via an analytic approach for magnetar giant flares. In this model, the rotation and/or displacement of the crust causes the field to twist and deform, leading to flux rope formation in the magnetosphere and energy accumulation in the related configuration. When the energy and helicity stored in the configuration reach a threshold, the system loses its equilibrium, the flux rope is ejected outward in a catastrophic way, and magnetic reconnection helps the catastrophe develop to a plausible eruption. By taking SGR 1806–20 as an example, we calculate the free magnetic energy released in such an eruptive process and find that it is more than 10{sup 47} erg, which is enough to power a giant flare. The released free magnetic energy is converted into radiative energy, kinetic energy, and gravitational energy of the flux rope. We calculated the light curves of the eruptive processes for the giant flares of SGR 1806–20, SGR 0526–66, and SGR 1900+14, and compared them with the observational data. The calculated light curves are in good agreement with the observed light curves of giant flares.

  11. Surface rotation of Kepler red giant stars

    Science.gov (United States)

    Ceillier, T.; Tayar, J.; Mathur, S.; Salabert, D.; García, R. A.; Stello, D.; Pinsonneault, M. H.; van Saders, J.; Beck, P. G.; Bloemen, S.

    2017-09-01

    Kepler allows the measurement of starspot variability in a large sample of field red giants for the first time. With a new method that combines autocorrelation and wavelet decomposition, we measure 361 rotation periods from the full set of 17 377 oscillating red giants in our sample. This represents 2.08% of the stars, consistent with the fraction of spectroscopically detected rapidly rotating giants in the field. The remaining stars do not show enough variability to allow us to measure a reliable surface rotation period. Because the stars with detected rotation periods have measured oscillations, we can infer their global properties, e.g. mass and radius, and quantitatively evaluate the predictions of standard stellar evolution models as a function of mass. Consistent with results for cluster giants when we consider only the 4881 intermediate-mass stars, M > 2.0 M⊙ from our full red giant sample, we do not find the enhanced rates of rapid rotation expected from angular momentum conservation. We therefore suggest that either enhanced angular momentum loss or radial differential rotation must be occurring in these stars. Finally, when we examine the 575 low-mass (Mhttp://cdsarc.u-strasbg.fr (http://130.79.128.5) or via http://cdsarc.u-strasbg.fr/viz-bin/qcat?J/A+A/605/A111

  12. Electrodynamics on extrasolar giant planets

    Energy Technology Data Exchange (ETDEWEB)

    Koskinen, T. T.; Yelle, R. V. [Lunar and Planetary Laboratory, University of Arizona, 1629 East University Boulevard, Tucson, AZ 85721-0092 (United States); Lavvas, P. [Groupe de Spectroscopie Moléculaire et Atmosphérique UMR CNRS 7331, Université Reims Champagne-Ardenne, F-51687 Reims (France); Cho, J. Y-K., E-mail: tommi@lpl.arizona.edu [Astronomy Unit, School of Mathematical Sciences, Queen Mary, University of London, Mile End Road, London E1 4NS (United Kingdom)

    2014-11-20

    Strong ionization on close-in extrasolar giant planets (EGPs) suggests that their atmospheres may be affected by ion drag and resistive heating arising from wind-driven electrodynamics. Recent models of ion drag on these planets, however, are based on thermal ionization only and do not include the upper atmosphere above the 1 mbar level. These models are also based on simplified equations of resistive magnetohydrodynamics that are not always valid in extrasolar planet atmospheres. We show that photoionization dominates over thermal ionization over much of the dayside atmosphere above the 100 mbar level, creating an upper ionosphere dominated by ionization of H and He and a lower ionosphere dominated by ionization of metals such as Na, K, and Mg. The resulting dayside electron densities on close-in exoplanets are higher than those encountered in any planetary ionosphere of the solar system, and the conductivities are comparable to the chromosphere of the Sun. Based on these results and assumed magnetic fields, we constrain the conductivity regimes on close-in EGPs and use a generalized Ohm's law to study the basic effects of electrodynamics in their atmospheres. We find that ion drag is important above the 10 mbar level where it can also significantly alter the energy balance through resistive heating. Due to frequent collisions of the electrons and ions with the neutral atmosphere, however, ion drag is largely negligible in the lower atmosphere below the 10 mbar level for a reasonable range of planetary magnetic moments. We find that the atmospheric conductivity decreases by several orders of magnitude in the night side of tidally locked planets, leading to a potentially interesting large-scale dichotomy in electrodynamics between the day and night sides. A combined approach that relies on UV observations of the upper atmosphere, phase curve and Doppler measurements of global dynamics, and visual transit observations to probe the alkali metals can potentially

  13. Anaplastic giant cell thyroid carcinoma.

    Science.gov (United States)

    Wallin, G; Lundell, G; Tennvall, J

    2004-01-01

    Anaplastic (giant cell) thyroid carcinoma (ATC), is one of the most aggressive malignancies in humans with a median survival time after diagnosis of 3-6 months. Death from ATC was earlier seen because of local growth and suffocation. ATC is uncommon, accounting for less than 5 % of all thyroid carcinomas. The diagnosis can be established by means of multiple fine needle aspiration biopsies, which are neither harmful nor troublesome for the patient. The cytological diagnosis of this high-grade malignant tumour is usually not difficult for a well trained cytologist. The intention to treat patients with ATC is cure, although only few of them survive. The majority of the patients are older than 60 years and treatment must be influenced by their high age. We have by using a combined modality regimen succeeded in achieving local control in most patients. Every effort should be made to control the primary tumour and thereby improve the quality of remaining life and it is important for patients, relatives and the personnel to know that cure is not impossible. Different treatment combinations have been used since 30 years including radiotherapy, cytostatic drugs and surgery, when feasible. In our latest combined regimen, 22 patients were treated with hyper fractionated radiotherapy 1.6Gy x 2 to a total target dose of 46 Gy given preoperatively, 20 mg doxorubicin was administered intravenously once weekly and surgery was carried out 2-3 weeks after the radiotherapy. 17 of these 22 patients were operated upon and none of these 17 patients got a local recurrence. In the future we are awaiting the development of new therapeutic approaches to this aggressive type of carcinoma. Inhibitors of angiogenesis might be useful. Combretastatin has displayed cytotoxicity against ATC cell lines and has had a positive effect on ATC in a patient. Sodium iodide symporter (NIS) genetherapy is also being currently considered for dedifferentiated thyroid carcinomas with the ultimate aim of

  14. Structural models of the membrane anchors of envelope glycoproteins E1 and E2 from pestiviruses

    Energy Technology Data Exchange (ETDEWEB)

    Wang, Jimin, E-mail: jimin.wang@yale.edu; Li, Yue; Modis, Yorgo, E-mail: yorgo.modis@yale.edu

    2014-04-15

    The membrane anchors of viral envelope proteins play essential roles in cell entry. Recent crystal structures of the ectodomain of envelope protein E2 from a pestivirus suggest that E2 belongs to a novel structural class of membrane fusion machinery. Based on geometric constraints from the E2 structures, we generated atomic models of the E1 and E2 membrane anchors using computational approaches. The E1 anchor contains two amphipathic perimembrane helices and one transmembrane helix; the E2 anchor contains a short helical hairpin stabilized in the membrane by an arginine residue, similar to flaviviruses. A pair of histidine residues in the E2 ectodomain may participate in pH sensing. The proposed atomic models point to Cys987 in E2 as the site of disulfide bond linkage with E1 to form E1–E2 heterodimers. The membrane anchor models provide structural constraints for the disulfide bonding pattern and overall backbone conformation of the E1 ectodomain. - Highlights: • Structures of pestivirus E2 proteins impose constraints on E1, E2 membrane anchors. • Atomic models of the E1 and E2 membrane anchors were generated in silico. • A “snorkeling” arginine completes the short helical hairpin in the E2 membrane anchor. • Roles in pH sensing and E1–E2 disulfide bond formation are proposed for E1 residues. • Implications for E1 ectodomain structure and disulfide bonding pattern are discussed.

  15. [Induction of rat hepatic CYP2E1 expression by arecoline in vivo].

    Science.gov (United States)

    Huang, Xiang-tao; Xiao, Run-mei; Wang, Ming-feng; Wang, Jun-jun; Chen, Yong

    2016-01-01

    The regulation mechanism of arecoline on rat hepatic CYP2E1 was studied in vivo. After oral administration of arecoline hydrobromide (AH; 4, 20 and 100 mg x kg(-1) x d(-1)) to rats for one week, the hepatic CYP2E1 mRNA level remained unchanged, but the hepatic CYP2E1 protein content was dose-dependently increased. Additionally, although the hepatic CYP2E1 activity was induced by AH treatment, the induction was attenuated with the increase in dosage. The results indicate that the effect of arecoline on rat hepaticdoes not involve transcriptional activation of the gene, but largely involves the stabilization of CYP2E1 protein against degradation or increased efficiency of CYP2E1 mRNA translation, and additionally involve the post- ranslational modification of CYP2E1 protein. Furthermore, the CYP2E1 response is fairly equal among the different species, the induction of rat hepatic CYP2E1 by arecoline suggests that there is a risk of metabolic interaction among the substrate drugs of CYP2E1 in betel-quid use human.

  16. Improved Plant-based Production of E1 endoglucanase Using Potato: Expression Optimization and Tissue Targeting

    Energy Technology Data Exchange (ETDEWEB)

    Dai, Ziyu [Pacific Northwest National Lab. (PNNL), Richland, WA (United States); Hooker, Brian S. [Pacific Northwest National Lab. (PNNL), Richland, WA (United States); Anderson, Daniel B. [Pacific Northwest National Lab. (PNNL), Richland, WA (United States); Thomas, Steven R. [National Renewable Energy Lab. (NREL), Golden, CO (United States)

    2000-06-01

    Optimization of Acidothermus cellulolyticus endoglucanase (E1) gene expression in transgenic potato (Solanum tuberosum L.) was examined in this study, where the E1 coding sequence was transcribed under control of a leaf specific promoter (tomato RbcS-3C) or the Mac promoter (a hybrid promoter of mannopine synthase promoter and cauliflower mosaic virus 35S promoter enhancer region). Average E1 activity in leaf extracts of potato transformants, in which E1 protein was targeted by a chloroplast signal peptide and an apoplast signal peptide were much higher than those by an E1 native signal peptide and a vacuole signal peptide. E1 protein accumulated up to 2.6% of total leaf soluble protein, where E1 gene was under control of the RbcS-3C promoter, alfalfa mosaic virus 5-untranslated leader, and RbcS-2A signal peptide. E1 protein production, based on average E1 activity and E1 protein accumulation in leaf extracts, is higher in potato than those measured previously in transgenic tobacco bearing the same transgene constructs. Comparisons of E1 activity, protein accumulation, and relative mRNA levels showed that E1 expression under control of tomato RbcS-3C promoter was specifically localized in leaf tissues, while E1 gene was expressed in both leaf and tuber tissues under control of Mac promoter. This suggests dual-crop applications in which potato vines serve as enzyme production `bioreactors' while tubers are preserved for culinary applications.

  17. Giant Uterine Leiomyoma. A Case Report

    Directory of Open Access Journals (Sweden)

    Luis Noel Marrero Quiala

    2014-09-01

    Full Text Available Giant uterine fibromyoma is a benign condition which has a very low incidence. Its management poses a challenge for the surgical team due to the volume of the surgical specimen and the variations in the distribution of the intra-abdominal organs caused by the uterine growth. The case of a 29-year-old patient misdiagnosed with giant hepatomegaly at admission is presented. Her symptoms included hard abdomen and feeling of heaviness. Successful completion of the interview, physical examination and imaging studies led to the correct diagnosis of giant uterine fibromyoma. Surgical treatment was applied. A total abdominal hysterectomy was performed with satisfactory results. This case is presented to the medical community for teaching purposes and due to its rarity.

  18. Red-giant stars in eccentric binaries

    Directory of Open Access Journals (Sweden)

    Beck P. G.

    2015-01-01

    Full Text Available The unparalleled photometric data obtained by NASA’s Kepler Space Telescope has led to improved understanding of red-giant stars and binary stars. We discuss the characterization of known eccentric system, containing a solar-like oscillating red-giant primary component. We also report several new binary systems that are candidates for hosting an oscillating companion. A powerful approach to study binary stars is to combine asteroseimic techniques with light curve fitting. Seismology allows us to deduce the properties of red giants. In addition, by modeling the ellipsoidal modulations we can constrain the parameters of the binary system. An valuable independent source are ground-bases, high-resolution spectrographs.

  19. Trace Molecules in Giant Planet Atmospheres

    Science.gov (United States)

    Huestis, D. L.; Smith, G. P.

    2010-12-01

    Chemical kinetics matters in the upper atmospheres of giant planets in our solar system and in extrasolar systems. The composition of a volume of gas depends not only on where it is, but also on how it got there. The giant planets in our own solar system still have much to teach us about what we will be observing on extrasolar giant planets and how to interpret what we observe. Some molecules, such as CO, C2H2, C2H6, PH3, and NH3, which we call tracer molecules, provide remotely observable signatures of vertical transport. PH3 and NH3 especially have complicated thermochemistry and chemical kinetics that, until recently, have been poorly understood. Based on analysis of recent literature, we have identified new chemical mechanisms for interconverting NH3 and N2 and for interconverting PH3 and NH4-H2PO4.

  20. Observations of Radio Giant Pulses with GAVRT

    CERN Document Server

    Jones, Glenn

    2015-01-01

    Radio giant pulses provide a unique opportunity to study the pulsar radio emission mechanism in exquisite detail. Previous studies have revealed a wide range of properties and phenomena, including extraordinarily high brightness temperatures, sub-nanosecond emission features, and banded dynamic spectra. New measurements of giant pulse characteristics can help guide and test theoretical emission models. To this end, an extensive observation campaign has begun which will provide more than 500 hours on the Crab with a 34-meter antenna located in California, USA. The observations are being done as part of an educational outreach program called the Goldstone-Apple Valley Radio Telescope (GAVRT). This antenna has a novel wide bandwidth receiver which provides up to 8 GHz of instantaneous bandwidth in the range of 2.5 to 14 GHz. These observations will provide detailed information about the variability, amplitude distribution, and detailed frequency structure of radio giant pulses. In addition, a database of pulses ...

  1. Giant Uterine Leiomyoma. A Case Report

    Directory of Open Access Journals (Sweden)

    Luis Noel Marrero Quiala

    2014-09-01

    Full Text Available Giant uterine fibromyoma is a benign condition which has a very low incidence. Its management poses a challenge for the surgical team due to the volume of the surgical specimen and the variations in the distribution of the intra-abdominal organs caused by the uterine growth. The case of a 29-year-old patient misdiagnosed with giant hepatomegaly at admission is presented. Her symptoms included hard abdomen and feeling of heaviness. Successful completion of the interview, physical examination and imaging studies led to the correct diagnosis of giant uterine fibromyoma. Surgical treatment was applied. A total abdominal hysterectomy was performed with satisfactory results. This case is presented to the medical community for teaching purposes and due to its rarity.

  2. Hepatic Giant Cell Arteritis and Polymyalgia Rheumatica

    Directory of Open Access Journals (Sweden)

    Donald R Duerksen

    1994-01-01

    Full Text Available Polymyalgia rheumatica (PMR is a clinical syndrome of the elderly characterized by malaise, proximal muscle aching and stiffness, low grade fever, elevated erythrocyte sedimentation rare and the frequent association with temporal giant cell arteritis. The authors describe a case of PMR associated with hepatic giant cell arteritis. This lesion has been described in two other clinical reports. The distribution of the arteritis may be patchy; in this report, diagnosis was made with a wedge biopsy performed after an initial nonspecific percutaneous liver biopsy. The authors review the spectrum of liver involvement in PMR and giant cell arteritis. Hepatic abnormalities respond to systemic corticosteroids, and patients with hepatic arteritis have a good prognosis.

  3. Asymptomatic post-rheumatic giant left atrium.

    Science.gov (United States)

    Özkartal, Tardu; Tanner, Felix C; Niemann, Markus

    2016-06-26

    A 78-year-old asymptomatic woman was referred to our clinic for a second opinion regarding indication for mitral valve surgery. An echocardiogram showed a moderate mitral stenosis with a concomitant severe regurgitation. The most striking feature, however, was a giant left atrium with a parasternal anteroposterior diameter of 79 mm and a left atrial volume index of 364 mL/m². There are various echocardiographic definitions of a giant left atrium, which are mainly based on measurements of the anteroposterior diameter of the left atrium using M-mode in the parasternal long axis view. Since the commonly accepted method for echocardiographic evaluation of left atrial size is left atrial volume index, we propose a cut-off value of 140 mL/m(2) for the definition of a "giant left atrium".

  4. EXCISION OF GIANT CELL TUMOR OF TENDON SHEATH WITH BONE INVOLVEMENT BY MEANS OF DOUBLE ACCESS APPROACH: CASE REPORT.

    Science.gov (United States)

    Alves, Marcelo de Pinho Teixeira

    2011-01-01

    Giant cell tumors of the tendon sheath are common lesions and are the second most frequent tumors in the hand, after synovial cysts. They are diagnosed by means of clinical examination and complementary examinations (simple radiography and magnetic resonance). Erosion and invasion of the phalangeal bone affected may be seen on radiological examination. Magnetic resonance may show a "fluorescent or radiant effect" may be observed, caused by the high quantity of hemosiderin inside the tumor. Surgical treatment is the commonest practice, and complete excision is important for avoiding recurrence of the tumor, especially when bone invasion is observed on imaging examinations, which is generally related to greater tumor recurrence. In this paper, a case of a giant cell tumor of the tendon sheath in the middle phalanx of the third finger of a 45-year-old female patient is presented. This was successfully treated by means of surgery using a double access approach (dorsal and volar).

  5. Lithium-rich Giants in Globular Clusters

    Science.gov (United States)

    Kirby, Evan N.; Guhathakurta, Puragra; Zhang, Andrew J.; Hong, Jerry; Guo, Michelle; Guo, Rachel; Cohen, Judith G.; Cunha, Katia

    2016-03-01

    Although red giants deplete lithium on their surfaces, some giants are Li-rich. Intermediate-mass asymptotic giant branch (AGB) stars can generate Li through the Cameron-Fowler conveyor, but the existence of Li-rich, low-mass red giant branch (RGB) stars is puzzling. Globular clusters are the best sites to examine this phenomenon because it is straightforward to determine membership in the cluster and to identify the evolutionary state of each star. In 72 hours of Keck/DEIMOS exposures in 25 clusters, we found four Li-rich RGB and two Li-rich AGB stars. There were 1696 RGB and 125 AGB stars with measurements or upper limits consistent with normal abundances of Li. Hence, the frequency of Li-richness in globular clusters is (0.2 ± 0.1)% for the RGB, (1.6 ± 1.1)% for the AGB, and (0.3 ± 0.1)% for all giants. Because the Li-rich RGB stars are on the lower RGB, Li self-generation mechanisms proposed to occur at the luminosity function bump or He core flash cannot explain these four lower RGB stars. We propose the following origin for Li enrichment: (1) All luminous giants experience a brief phase of Li enrichment at the He core flash. (2) All post-RGB stars with binary companions on the lower RGB will engage in mass transfer. This scenario predicts that 0.1% of lower RGB stars will appear Li-rich due to mass transfer from a recently Li-enhanced companion. This frequency is at the lower end of our confidence interval. The data presented herein were obtained at the W. M. Keck Observatory, which is operated as a scientific partnership among the California Institute of Technology, the University of California and the National Aeronautics and Space Administration. The Observatory was made possible by the generous financial support of the W. M. Keck Foundation.

  6. LITHIUM-RICH GIANTS IN GLOBULAR CLUSTERS

    Energy Technology Data Exchange (ETDEWEB)

    Kirby, Evan N.; Cohen, Judith G. [California Institute of Technology, 1200 E. California Boulevard, MC 249-17, Pasadena, CA 91125 (United States); Guhathakurta, Puragra [UCO/Lick Observatory and Department of Astronomy and Astrophysics, University of California, 1156 High Street, Santa Cruz, CA 95064 (United States); Zhang, Andrew J. [The Harker School, 500 Saratoga Avenue, San Jose, CA 95129 (United States); Hong, Jerry [Palo Alto High School, 50 Embarcadero Road, Palo Alto, CA, 94301 (United States); Guo, Michelle [Stanford University, 450 Serra Mall, Stanford, CA 94305 (United States); Guo, Rachel [Irvington High School, 41800 Blacow Road, Fremont, CA 94538 (United States); Cunha, Katia [Observatório Nacional, São Cristóvão Rio de Janeiro (Brazil)

    2016-03-10

    Although red giants deplete lithium on their surfaces, some giants are Li-rich. Intermediate-mass asymptotic giant branch (AGB) stars can generate Li through the Cameron–Fowler conveyor, but the existence of Li-rich, low-mass red giant branch (RGB) stars is puzzling. Globular clusters are the best sites to examine this phenomenon because it is straightforward to determine membership in the cluster and to identify the evolutionary state of each star. In 72 hours of Keck/DEIMOS exposures in 25 clusters, we found four Li-rich RGB and two Li-rich AGB stars. There were 1696 RGB and 125 AGB stars with measurements or upper limits consistent with normal abundances of Li. Hence, the frequency of Li-richness in globular clusters is (0.2 ± 0.1)% for the RGB, (1.6 ± 1.1)% for the AGB, and (0.3 ± 0.1)% for all giants. Because the Li-rich RGB stars are on the lower RGB, Li self-generation mechanisms proposed to occur at the luminosity function bump or He core flash cannot explain these four lower RGB stars. We propose the following origin for Li enrichment: (1) All luminous giants experience a brief phase of Li enrichment at the He core flash. (2) All post-RGB stars with binary companions on the lower RGB will engage in mass transfer. This scenario predicts that 0.1% of lower RGB stars will appear Li-rich due to mass transfer from a recently Li-enhanced companion. This frequency is at the lower end of our confidence interval.

  7. Neglected Giant Scalp Basal Cell Carcinoma

    Directory of Open Access Journals (Sweden)

    Anne Kristine Larsen, MD

    2014-03-01

    Full Text Available Summary: Rarely, basal cell carcinoma grows to a giant size, invading the underlying deep tissue and complicating the treatment and reconstruction modalities. A giant basal cell carcinoma on the scalp is in some cases treated with a combination of surgery and radiation therapy, resulting in local control, a satisfactory long-term cosmetic and functional result. We present a case with a neglected basal cell scalp carcinoma, treated with wide excision and postoperative radiotherapy, reconstructed with a free latissimus dorsi flap. The cosmetic result is acceptable and there is no sign of recurrence 1 year postoperatively.

  8. Mass loss from giant and supergiant stars

    Science.gov (United States)

    Wannier, P. G.; Sahai, R.

    1986-01-01

    The 12 m telescope of the National Radio Astronomy Observatory has been used at the J = 2-1 transition of CO to increase the known list of giant and supergiant stars with observable circumstellar envelopes. The candidate objects were generally M-type giants and supergiants, chosen for their strong infrared luminosities. Of the 35 objects which were previously undetected, or only marginally detected, 10 were found to produce detectable CO emission. Physical parameters of the envelopes are derived by source modeling. Mass-loss rates vary from 10 to the -7th to 4 x 10 to the -5th solar mass/yr.

  9. Enhanced recovery after giant ventral hernia repair

    DEFF Research Database (Denmark)

    Jensen, K K; Brøndum, T L; Harling, H.

    2016-01-01

    PURPOSE: Giant ventral hernia repair is associated with a high risk of postoperative morbidity and prolonged length of stay (LOS). Enhanced recovery (ERAS) measures have proved to lead to decreased morbidity and LOS after various surgical procedures, but never after giant hernia repair. The current....... Pain, nausea and fatigue were registered prospectively in all patients treated according to ERAS, as well as continuous measurement of transcutaneous capillary oxygen saturation. Postoperative morbidity and LOS were compared between patients treated according to ERAS and a historic group treated...

  10. Kepler Asteroseismology of Red-giant Stars

    DEFF Research Database (Denmark)

    Christensen-Dalsgaard, J.

    2012-01-01

    The Kepler mission, launched in March 2009, has revolutionized asteroseismology, providing detailed observations of thousands of stars. This has allowed in-depth analyses of stars ranging from compact hot subdwarfs to red giants, and including the detection of solar-like oscillations in hundreds...... of stars on or near the main sequence. Here I mainly consider solar-like oscillations in red giants, where Kepler observations are yielding results of a perhaps unexpected richness. In addition to giving a brief overview of the observational and numerical results for these stars, I present a simple...

  11. Neglected giant scalp Basal cell carcinoma

    DEFF Research Database (Denmark)

    Larsen, Anne Kristine; El-Charnoubi, Waseem-Asim Ghulam; Gehl, Julie;

    2014-01-01

    SUMMARY: Rarely, basal cell carcinoma grows to a giant size, invading the underlying deep tissue and complicating the treatment and reconstruction modalities. A giant basal cell carcinoma on the scalp is in some cases treated with a combination of surgery and radiation therapy, resulting in local...... control, a satisfactory long-term cosmetic and functional result. We present a case with a neglected basal cell scalp carcinoma, treated with wide excision and postoperative radiotherapy, reconstructed with a free latissimus dorsi flap. The cosmetic result is acceptable and there is no sign of recurrence...

  12. Design, analysis, and modeling of giant magnetostrictive transducers

    Science.gov (United States)

    Calkins, Frederick Theodore

    The increased use of giant magnetostrictive, Terfenol-D transducers in a wide variety of applications has led to a need for greater understanding of the materials performance. This dissertation attempts to add to the Terfenol-D transducer body of knowledge by providing an in-depth analysis and modeling of an experimental transducer. A description of the magnetostriction process related to Terfenol-D includes a discussion of material properties, production methods, and the effect of mechanical stress, magnetization, and temperature on the material performance. The understanding of the Terfenol-D material performance provides the basis for an analysis of the performance of a Terfenol-D transducer. Issues related to the design and utilization of the Terfenol-D material in the transducers are considered, including the magnetic circuit, application of mechanical prestress, and tuning of the mechanical resonance. Experimental results from two broadband, Tonpilz design transducers show the effects of operating conditions (prestress, magnetic bias, AC magnetization amplitude, and frequency) on performance. In an effort to understand and utlilize the rich performance space described by the experimental results a variety of models are considered. An overview of models applicable to Terfenol-D and Terfenol-D transducers is provided, including a discussion of modeling criteria. The Jiles-Atherton model of ferromagnetic hysteresis is employed to describe the quasi-static transducer performance. This model requires the estimation of only six physically-based parameters to accurately simulate performance. The model is shown to be robust with respect to model parameters over a range of mechanical prestress, magnetic biases, and AC magnetic field amplitudes, allowing predictive capability within these ranges. An additional model, based on electroacoustics theory, explains trends in the frequency domain and facilitates an analysis of efficiency based on impedance and admittance

  13. MAPPING DIRECTLY IMAGED GIANT EXOPLANETS

    Energy Technology Data Exchange (ETDEWEB)

    Kostov, Veselin [Department of Physics and Astronomy, Johns Hopkins University, 366 Bloomberg Center, 3400 North Charles Street, Baltimore, MD 21218 (United States); Apai, Daniel, E-mail: vkostov@pha.jhu.edu [Department of Astronomy, The University of Arizona, 933 North Cherry Avenue, Tucson, AZ 85718 (United States)

    2013-01-01

    With the increasing number of directly imaged giant exoplanets, the current atmosphere models are often not capable of fully explaining the spectra and luminosity of the sources. A particularly challenging component of the atmosphere models is the formation and properties of condensate cloud layers, which fundamentally impact the energetics, opacity, and evolution of the planets. Here we present a suite of techniques that can be used to estimate the level of rotational modulations these planets may show. We propose that the time-resolved observations of such periodic photometric and spectroscopic variations of extrasolar planets due to their rotation can be used as a powerful tool to probe the heterogeneity of their optical surfaces. In this paper, we develop simulations to explore the capabilities of current and next-generation ground- and space-based instruments for this technique. We address and discuss the following questions: (1) what planet properties can be deduced from the light curve and/or spectra, and in particular can we determine rotation periods, spot coverage, spot colors, and spot spectra?; (2) what is the optimal configuration of instrument/wavelength/temporal sampling required for these measurements?; and (3) can principal component analysis be used to invert the light curve and deduce the surface map of the planet? Our simulations describe the expected spectral differences between homogeneous (clear or cloudy) and patchy atmospheres, outline the significance of the dominant absorption features of H{sub 2}O, CH{sub 4}, and CO, and provide a method to distinguish these two types of atmospheres. Assuming surfaces with and without clouds for most currently imaged planets the current models predict the largest variations in the J band. Simulated photometry from current and future instruments is used to estimate the level of detectable photometric variations. We conclude that future instruments will be able to recover not only the rotation periods

  14. Collective resonances of atomic xenon from the linear to the nonlinear regime

    CERN Document Server

    Chen, Yi-Jen; Santra, Robin

    2016-01-01

    We explain the origin of the two collective sub-resonances of the $4d$ giant dipole resonance of atomic Xe recently discovered by nonlinear spectroscopy. In the case of one-photon absorption, while a change in the resonant-like feature in the cross section upon the inclusion of electronic correlations has been commonly attributed to a change of the resonance parameters of a single resonance state, we show that this modification is a result of switching between the relative visibilities of the underlying resonance states. In addition, we predict hitherto undiscovered collective $4d$ resonance states in Xe that can only be accessed through multiphoton absorption. Unlike any known collective feature in atoms, these resonances are exceptionally long-lived (more than 100 attoseconds), thus opening up possibilities to probe new collective effects in atoms with modern XUV light sources.

  15. The Role of CYP2E1 in the Drug Metabolism or Bioactivation in the Brain

    Science.gov (United States)

    García-Suástegui, W. A.; Ramos-Chávez, L. A.; Rubio-Osornio, M.; Calvillo-Velasco, M.; Atzin-Méndez, J. A.; Guevara, J.

    2017-01-01

    Organisms have metabolic pathways that are responsible for removing toxic agents. We always associate the liver as the major organ responsible for detoxification of the body; however this process occurs in many tissues. In the same way, as in the liver, the brain expresses metabolic pathways associated with the elimination of xenobiotics. Besides the detoxifying role of CYP2E1 for compounds such as electrophilic agents, reactive oxygen species, free radical products, and the bioactivation of xenobiotics, CYP2E1 is also related in several diseases and pathophysiological conditions. In this review, we describe the presence of phase I monooxygenase CYP2E1 in regions of the brain. We also explore the conditions where protein, mRNA, and the activity of CYP2E1 are induced. Finally, we describe the relation of CYP2E1 in brain disorders, including the behavioral relations for alcohol consumption via CYP2E1 metabolism. PMID:28163821

  16. The Role of CYP2E1 in the Drug Metabolism or Bioactivation in the Brain

    Directory of Open Access Journals (Sweden)

    W. A. García-Suástegui

    2017-01-01

    Full Text Available Organisms have metabolic pathways that are responsible for removing toxic agents. We always associate the liver as the major organ responsible for detoxification of the body; however this process occurs in many tissues. In the same way, as in the liver, the brain expresses metabolic pathways associated with the elimination of xenobiotics. Besides the detoxifying role of CYP2E1 for compounds such as electrophilic agents, reactive oxygen species, free radical products, and the bioactivation of xenobiotics, CYP2E1 is also related in several diseases and pathophysiological conditions. In this review, we describe the presence of phase I monooxygenase CYP2E1 in regions of the brain. We also explore the conditions where protein, mRNA, and the activity of CYP2E1 are induced. Finally, we describe the relation of CYP2E1 in brain disorders, including the behavioral relations for alcohol consumption via CYP2E1 metabolism.

  17. Giant Panda habitat selection in the Foping Nature Reserve, China

    NARCIS (Netherlands)

    Liu, X.; Toxopeus, A.G.; Skidmore, A.K.; Shao, X.; Dang, D.; Wang, T.; Prins, H.H.T.

    2005-01-01

    Little is known about habitat selection of the giant panda (Ailuropoda melanoleuca), especially about the relationship between giant panda presence and bamboo and tree structures. We presented data on giant panda habitat use and selection in Foping Nature Reserve (NR), China. We used 1,066

  18. Observing giant panda habitat and forage abundance from space

    NARCIS (Netherlands)

    Wang, T.

    2009-01-01

    Giant pandas are obligate bamboo grazers. The bamboos favoured by giant pandas are typical forest understorey plants. Therefore, the availability and abundance of understorey bamboo is a key factor in determining the quantity and quality of giant panda food resources. However, there is little or

  19. Giant Panda habitat selection in the Foping Nature Reserve, China

    NARCIS (Netherlands)

    Liu, X.; Toxopeus, A.G.; Skidmore, A.K.; Shao, X.; Dang, D.; Wang, T.; Prins, H.H.T.

    2005-01-01

    Little is known about habitat selection of the giant panda (Ailuropoda melanoleuca), especially about the relationship between giant panda presence and bamboo and tree structures. We presented data on giant panda habitat use and selection in Foping Nature Reserve (NR), China. We used 1,066 radiotrac

  20. The Mass-Metallicity Relation for Giant Planets

    CERN Document Server

    Thorngren, Daniel P; Lopez, Eric D

    2015-01-01

    Exoplanet discoveries of recent years have provided a great deal of new data for studying the bulk compositions of giant planets. Here we identify 38 transiting giant planets ($20 M_\\oplus 50 M_\\oplus$) suggest significant amounts of heavy elements in H/He envelopes, rather than cores, such that metal-enriched giant planet atmospheres should be the rule.

  1. Normalized spectra of 82 Kepler red giants (Thygesen+, 2012)

    NARCIS (Netherlands)

    A.O. Thygesen; S. Frandsen; H. Bruntt; T. Kallinger; M.F. Andersen; Y.E. Elsworth; S. Hekker; C. Karoff; D. Stello; K. Brogaard; C. Bruke; D.A. Caldwell; J.L. Christiansen

    2012-01-01

    Normalized spectra of 82 red giants in the Kepler Field. Target names are as found in the Kepler Input Catalogue (Kepler Mission Team 2009) Also included spectra of 10 well-studied bright giants observed for reference. 9 of the reference giants were chosen from the PASTEL catalogue (Soubiran et al.,

  2. Normalized spectra of 82 Kepler red giants (Thygesen+, 2012) [Dataset

    NARCIS (Netherlands)

    Thygesen, A.O.; Frandsen, S.; Bruntt, H.; Kallinger, T.; Andersen, M.F.; Elsworth, Y.E.; Hekker, S.; Karoff, C.; Stello, D.; Brogaard, K.; Bruke, C.; Caldwell, D.A.; Christiansen, J.L.

    2012-01-01

    Normalized spectra of 82 red giants in the Kepler Field. Target names are as found in the Kepler Input Catalogue (Kepler Mission Team 2009) Also included spectra of 10 well-studied bright giants observed for reference. 9 of the reference giants were chosen from the PASTEL catalogue (Soubiran et al.,

  3. Inhibitory Potency of 4-Carbon Alkanes and Alkenes toward CYP2E1 Activity

    OpenAIRE

    2014-01-01

    CYP2E1 has been implicated in the bioactivation of many small molecules into reactive metabolites which form adducts with proteins and DNA, and thus a better understanding of the molecular determinants of its selectivity are critical for accurate toxicological predictions. In this study, we determined the potency of inhibition of human CYP2E1 for various 4-carbon alkanes, alkenes and alcohols. In addition, known CYP2E1 substrates and inhibitors including 4-methylpyrazole, aniline, and dimethy...

  4. CYP2E1 mediated isoniazid-induced hepatotoxicity in rats

    Institute of Scientific and Technical Information of China (English)

    Jiang YUE; Ren-xiu PENG; Jing YANG; Rui KONG; Juan LIU

    2004-01-01

    AIM: To investigate the role of CYP2E1 in isoniazid (INH)-induced hepatotoxicity and the influence of rifampicin (RFP) on INH-induced liver injury. METHODS: Rats were treated with INH alone (100 mg/kg, ip) or co-administered with RFP (100 mg/kg, ig) for 10 d and 21 d. Hepatotoxicity was assayed by plasma enzymes (sALT, sAST) and histopathological examinations. Hepatic CYP2E1 activity was measured by aniline hydroxylase (ANH), and CYP2E1 mRNA expression was determined by RT-PCR. Plasma hydrazine concentration was determined by RP-HPLC.RESULTS: For a 10 d INH-treatment, hepatic CYP2E1 level was increased to 3.7-fold over the control; liver impairment appeared after 21 d treatment, while CYP2E1 and plasma hydrazine were, respectively, increased to 4.6-fold and 1.7-fold. However, in INH-RFP group for 10 d, CYP2E1 and plasma hydrazine were, respectively,decreased by 13 % and 18 % over INH group; similarly, hepatic injury is equal to INH group appeared after 21 d,and CYP2E1 was further decreased by 26 %. Correlation analysis showed that sALT had a positive correlation with plasma hydrazine and with CYP2E1 activity; CYP2E1 activity was also markedly correlated with plasma hydrazine.And compared with control, there is no difference in changes of CYP2E1 mRNA expression in INH and INH-RFP treatment for 21 d. CONCLUSION: The metabolite of INH, hydrazine, plays an important role in INH-induced hepatotoxicity in rats. The induction of CYP2E1 by hydrazine is involved in the hepatotoxicity of INH. RFP does not exacerbate INH-induced hepatotoxicity in short term, which relates to down-regulation of CYP2E1.

  5. 26 CFR 1.1059(e)-1 - Non-pro rata redemptions.

    Science.gov (United States)

    2010-04-01

    ... 26 Internal Revenue 11 2010-04-01 2010-04-01 true Non-pro rata redemptions. 1.1059(e)-1 Section 1... (CONTINUED) INCOME TAXES Special Rules § 1.1059(e)-1 Non-pro rata redemptions. (a) In general. Section 1059(d... 1059(e)(1). For example, if a redemption of stock is not pro rata as to all shareholders, any...

  6. Absence of NR2E1 mutations in patients with aniridia

    DEFF Research Database (Denmark)

    Corso-Díaz, Ximena; Borrie, Adrienne E; Bonaguro, Russell;

    2012-01-01

    Nuclear receptor 2E1 (NR2E1) is a transcription factor with many roles during eye development and thus may be responsible for the occurrence of certain congenital eye disorders in humans. To test this hypothesis, we screened NR2E1 for candidate mutations in patients with aniridia and other congen...... congenital ocular malformations (anterior segment dysgenesis, congenital optic nerve malformation, and microphthalmia)....

  7. CYP2E1-dependent hepatotoxicity and oxidative damage after ethanol administration in human primary hepatocytes

    Institute of Scientific and Technical Information of China (English)

    Lie-Gang Liu; Hong Yan; Ping Yao; Wen Zhang; Li-Jun Zou; Fang-Fang Song; Ke Li; Xiu-Fa Sun

    2005-01-01

    AIM: To observe the relationship between ethanol-induced oxidative damage in human primary cultured hepatocytes and cytochrome P450 2E1 (CYP2E1) activity, in order to address if inhibition of CYP2E1 could attenuate ethanol-induced cellular damage.METHODS: The dose-dependent (25-100 mmol/L) and time-dependent (0-24 h) exposures of primary human cultured hepatocytes to ethanol were carried out. CYP2E1 activity and protein expression were detected by spectrophotometer and Western blot analysis respectively.Hepatotoxicity was investigated by determination of lactate dehydrogenase (LDH) and aspartate transaminase (AST) level in hepatocyte culture supernatants, as well as the intracellular formation of malondialdehyde (MDA).RESULTS: A dose-and time-dependent response between ethanol exposure and CYP2E1 activity in human hepatocytes was demonstrated. Moreover, there was a time-dependent increase of CYP2E1 protein after 100 mmol/L ethanol exposure. Meanwhile, ethanol exposure of hepatocytes caused a time-dependent increase of ceilular MDA level, LDH, and AST activities in supernatants.Furthermore, the inhibitor of CYP2E1, diallyl sulfide (DAS) could partly attenuate the increases of MDA, LDH, and AST in human hepatocytes.CONCLUSION: A positive relationship between ethanol-induced oxidative aamage in human primary cultured hepatocytes and CYP2E1 activity was exhibited, and the inhibition of CYP2E1 could partly attenuate ethanol-induced oxidative damage.

  8. Requirements for E1A dependent transcription in the yeast Saccharomyces cerevisiae

    Directory of Open Access Journals (Sweden)

    Mymryk Joe S

    2009-04-01

    Full Text Available Abstract Background The human adenovirus type 5 early region 1A (E1A gene encodes proteins that are potent regulators of transcription. E1A does not bind DNA directly, but is recruited to target promoters by the interaction with sequence specific DNA binding proteins. In mammalian systems, E1A has been shown to contain two regions that can independently induce transcription when fused to a heterologous DNA binding domain. When expressed in Saccharomyces cerevisiae, each of these regions of E1A also acts as a strong transcriptional activator. This allows yeast to be used as a model system to study mechanisms by which E1A stimulates transcription. Results Using 81 mutant yeast strains, we have evaluated the effect of deleting components of the ADA, COMPASS, CSR, INO80, ISW1, NuA3, NuA4, Mediator, PAF, RSC, SAGA, SAS, SLIK, SWI/SNF and SWR1 transcriptional regulatory complexes on E1A dependent transcription. In addition, we examined the role of histone H2B ubiquitylation by Rad6/Bre1 on transcriptional activation. Conclusion Our analysis indicates that the two activation domains of E1A function via distinct mechanisms, identify new factors regulating E1A dependent transcription and suggest that yeast can serve as a valid model system for at least some aspects of E1A function.

  9. Human CYP2E1 mediates the formation of glycidamide from acrylamide.

    Science.gov (United States)

    Settels, Eva; Bernauer, Ulrike; Palavinskas, Richard; Klaffke, Horst S; Gundert-Remy, Ursula; Appel, Klaus E

    2008-10-01

    Regarding the cancer risk assessment of acrylamide (AA) it is of basic interest to know, as to what amount of the absorbed AA is metabolized to glycidamide (GA) in humans, compared to what has been observed in laboratory animals. GA is suspected of being the ultimate carcinogenic metabolite of AA. From experiments with CYP2E1-deficient mice it can be concluded that AA is metabolized to GA primarily by CYP2E1. We therefore examined whether CYP2E1 is involved in GA formation in non-rodent species with the focus on humans by using human CYP2E1 supersomes, marmoset and human liver microsomes and in addition, genetically engineered V79 cells expressing human CYP2E1 (V79h2E1 cells). Special emphasis was placed on the analytical detection of GA, which was performed by gas chromatography/mass spectrometry. The results show that AA is metabolized to GA in human CYP2E1 supersomes, in marmoset and human liver microsomes as well as in V79h2E1 cells. The activity of GA formation is highest in supersomes; in human liver it is somewhat higher than in marmoset liver. A monoclonal CYP2E1 human selective antibody (MAB-2E1) and diethyldithiocarbamate (DDC) were used as specific inhibitors of CYP2E1. The generation of GA could be inhibited by MAB-2E1 to about 80% in V79h2E1 cells and to about 90% in human and marmoset liver microsomes. Also DDC led to an inhibition of about 95%. In conclusion, AA is metabolized to GA by human CYP2E1. Overall, the present work describes (1) the application and refinement of a sensitive methodology in order to determine low amounts of GA, (2) the applicability of genetically modified V79 cell lines in order to investigate specific questions concerning metabolism and (3) the involvement, for the first time, of human CYP2E1 in the formation of GA from AA. Further studies will compare the activities of GA formation in genetically engineered V79 cells expressing CYP2E1 from different species.

  10. Identification and characterization of multiple conserved nuclear localization signals within adenovirus E1A

    Energy Technology Data Exchange (ETDEWEB)

    Marshall, Kris S.; Cohen, Michael J.; Fonseca, Greg J.; Todorovic, Biljana; King, Cason R. [Department of Microbiology and Immunology, Western University, London Regional Cancer Program, London, ON, Canada N6A 4L6 (Canada); Yousef, Ahmed F. [Department of Chemical and Environmental Engineering, Masdar Institute, Abu Dhabi (United Arab Emirates); Zhang, Zhiying [College of Animal Science and Technologies, Northwest A and F University, Yangling, Shaanxi 712100 (China); Mymryk, Joe S., E-mail: jmymryk@uwo.ca [Department of Microbiology and Immunology, Western University, London Regional Cancer Program, London, ON, Canada N6A 4L6 (Canada); Department of Oncology, Western University, London Regional Cancer Program, London, ON, Canada N6A 4L6 (Canada)

    2014-04-15

    The human adenovirus 5 (HAdV-5) E1A protein has a well defined canonical nuclear localization signal (NLS) located at its C-terminus. We used a genetic assay in the yeast Saccharomyces cerevisiae to demonstrate that the canonical NLS is present and functional in the E1A proteins of each of the six HAdV species. This assay also detects a previously described non-canonical NLS within conserved region 3 and a novel active NLS within the N-terminal/conserved region 1 portion of HAdV-5 E1A. These activities were also present in the E1A proteins of each of the other five HAdV species. These results demonstrate that, despite substantial differences in primary sequence, HAdV E1A proteins are remarkably consistent in that they contain one canonical and two non-canonical NLSs. By utilizing independent mechanisms, these multiple NLSs ensure nuclear localization of E1A in the infected cell. - Highlights: • HAdV E1A uses multiple mechanisms for nuclear import. • We identified an additional non-canonical NLS in the N-terminal/CR1 portion of E1A. • The new NLS does not contact importin-alpha directly. • All NLSs are functionally conserved in the E1A proteins of all 6 HAdV species.

  11. Human CYP2E1 mediates the formation of glycidamide from acrylamide

    Energy Technology Data Exchange (ETDEWEB)

    Settels, Eva; Appel, Klaus E. [Federal Institute for Risk Assessment, Center for Experimental Toxicology, Berlin (Germany); Bernauer, Ulrike; Gundert-Remy, Ursula [Federal Institute for Risk Assessment, Department of Safety of Substances and Preparations, Berlin (Germany); Palavinskas, Richard; Klaffke, Horst S. [Federal Institute for Risk Assessment, Center for Analytical Chemistry, Berlin (Germany)

    2008-10-15

    Regarding the cancer risk assessment of acrylamide (AA) it is of basic interest to know, as to what amount of the absorbed AA is metabolized to glycidamide (GA) in humans, compared to what has been observed in laboratory animals. GA is suspected of being the ultimate carcinogenic metabolite of AA. From experiments with CYP2E1-deficient mice it can be concluded that AA is metabolized to GA primarily by CYP2E1. We therefore examined whether CYP2E1 is involved in GA formation in non-rodent species with the focus on humans by using human CYP2E1 supersomes trademark, marmoset and human liver microsomes and in addition, genetically engineered V79 cells expressing human CYP2E1 (V79h2E1 cells). Special emphasis was placed on the analytical detection of GA, which was performed by gas chromatography/mass spectrometry. The results show that AA is metabolized to GA in human CYP2E1 supersomes trademark, in marmoset and human liver microsomes as well as in V79h2E1 cells. The activity of GA formation is highest in supersomes trademark; in human liver it is somewhat higher than in marmoset liver. A monoclonal CYP2E1 human selective antibody (MAB-2E1) and diethyldithiocarbamate (DDC) were used as specific inhibitors of CYP2E1. The generation of GA could be inhibited by MAB-2E1 to about 80% in V79h2E1 cells and to about 90% in human and marmoset liver microsomes. Also DDC led to an inhibition of about 95%. In conclusion, AA is metabolized to GA by human CYP2E1. Overall, the present work describes (1) the application and refinement of a sensitive methodology in order to determine low amounts of GA, (2) the applicability of genetically modified V79 cell lines in order to investigate specific questions concerning metabolism and (3) the involvement, for the first time, of human CYP2E1 in the formation of GA from AA. Further studies will compare the activities of GA formation in genetically engineered V79 cells expressing CYP2E1 from different species. (orig.)

  12. Methodology to assay CYP2E1 mixed function oxidase catalytic activity and its induction

    Directory of Open Access Journals (Sweden)

    Arthur I. Cederbaum

    2014-01-01

    Full Text Available The cytochrome P450 mixed function oxidase enzymes are the major catalysts involved in drug metabolism. There are many forms of P450. CYP2E1 metabolizes many toxicologically important compounds including ethanol and is active in generating reactive oxygen species. Since several of the contributions in the common theme series “Role of CYP2E1 and Oxidative/Nitrosative Stress in the Hepatotoxic Actions of Alcohol” discuss CYP2E1, this methodology review describes assays on how CYP2E1 catalytic activity and its induction by ethanol and other inducers can be measured using substrate probes such as the oxidation of para-nitrophenol to para-nitrocatechol and the oxidation of ethanol to acetaldehyde. Approaches to validate that a particular reaction e.g. oxidation of a drug or toxin is catalyzed by CYP2E1 or that induction of that reaction is due to induction of CYP2E1 are important and specific examples using inhibitors of CYP2E1, anti-CYP2E1 IgG or CYP2E1 knockout and knockin mice will be discussed.

  13. Neuroaesthetic Resonance

    DEFF Research Database (Denmark)

    Brooks, Anthony Lewis

    2013-01-01

    Neuroaesthetic Resonance emerged from a mature body of patient- centered gesture-control research investigating non-formal rehabilitation via ICT-enhanced-Art to question ‘Aesthetic Resonance’. Motivating participation, ludic engagement, and augmenting physical motion in non-formal (fun) treatment...... tailored channeling of sensory stimulus aligned as ‘art-making’ and ‘game playing’ core experiences. Thus, affecting brain plasticity and human motoric-performance via the adaptability (plasticity) of digital medias result in closure of the human afferent-efferent neural feedback loop closure through...

  14. Microarray-based analysis and clinical validation identify ubiquitin-conjugating enzyme E2E1 (UBE2E1 as a prognostic factor in acute myeloid leukemia

    Directory of Open Access Journals (Sweden)

    Hongmei Luo

    2016-11-01

    Full Text Available Abstract Background Previous research suggested that single gene expression might be correlated with acute myeloid leukemia (AML survival. Therefore, we conducted a systematical analysis for AML prognostic gene expressions. Methods We performed a microarray-based analysis for correlations between gene expression and adult AML overall survival (OS using datasets GSE12417 and GSE8970. Positive findings were validated in an independent cohort of 50 newly diagnosed, non-acute promyelocytic leukemia (APL AML patients by quantitative RT-PCR and survival analysis. Results Microarray-based analysis suggested that expression of eight genes was each associated with 1-year and 3-year AML OS in both GSE12417 and GSE8970 datasets (p < 0.05. Next, we validated our findings in an independent cohort of AML samples collected in our hospital. We found that ubiquitin-conjugating enzyme E2E1 (UBE2E1 expression was adversely correlated with AML survival (p = 0.04. Multivariable analysis showed that UBE2E1 high patients had a significant shorter OS and shorter progression-free survival after adjusting other known prognostic factors (p = 0.03. At last, we found that UBE2E1 expression was negatively correlated with patients’ response to induction chemotherapy (p < 0.05. Conclusions In summary, we demonstrated that UBE2E1 expression was a novel prognostic factor in adult, non-APL AML patients.

  15. Abundance differences among G and K giants

    Science.gov (United States)

    Challener, Sharon Lynn Montgomery

    Effective temperatures and surface gravities were derived for 52 G and K giants using model atmosphere. Of these, 33 were called very strong-lined (or VSL) stars primarily because of their CN line strength. We find that when compared to normal stars, the VSL stars show a mean iron overabundance of 0.15 dex. Contrary to earlier suggestions, none of the heavier elements (Z greater than 10) appear selectively enhanced. Red giants are believed to undergo mixing, thereby driving the surface abundances towards those of the stellar interior. Carbon, nitrogen, and oxygen abundances are most sensitive to mixing as they are produced through nucleosynthesis at various depths beneath the star's surface. The CNO abundances (normalized to the iron abundances) of the VSLs appear on average to be normal for G and K giants. This result suggests that the strong CN absorption seen in VSLs is not the result of unusual mixing. Their general overabundance of metal appears instead to be innate, presumably reflecting the metallicity of the gaseous clouds from which they formed. This should be settled once the appropriate number of VSL dwarfs is found. The deviations from the normal population of giants are rather small, however, and certainly not of the magnitude envisioned by Spinrad and Taylor (1969). It is likely that VSLs are merely the stars lying in the tail of the normal abundance distribution.

  16. Giant Viruses of Amoebas: An Update.

    Science.gov (United States)

    Aherfi, Sarah; Colson, Philippe; La Scola, Bernard; Raoult, Didier

    2016-01-01

    During the 12 past years, five new or putative virus families encompassing several members, namely Mimiviridae, Marseilleviridae, pandoraviruses, faustoviruses, and virophages were described. In addition, Pithovirus sibericum and Mollivirus sibericum represent type strains of putative new giant virus families. All these viruses were isolated using amoebal coculture methods. These giant viruses were linked by phylogenomic analyses to other large DNA viruses. They were then proposed to be classified in a new viral order, the Megavirales, on the basis of their common origin, as shown by a set of ancestral genes encoding key viral functions, a common virion architecture, and shared major biological features including replication inside cytoplasmic factories. Megavirales is increasingly demonstrated to stand in the tree of life aside Bacteria, Archaea, and Eukarya, and the megavirus ancestor is suspected to be as ancient as cellular ancestors. In addition, giant amoebal viruses are visible under a light microscope and display many phenotypic and genomic features not found in other viruses, while they share other characteristics with parasitic microbes. Moreover, these organisms appear to be common inhabitants of our biosphere, and mimiviruses and marseilleviruses were isolated from human samples and associated to diseases. In the present review, we describe the main features and recent findings on these giant amoebal viruses and virophages.

  17. Standing on the shoulders of giants.

    Science.gov (United States)

    Romanovsky, Andrej A

    2014-01-01

    In this editorial, the author explains that the journal Temperature stands on the shoulders of giants-prominent scientists of the past and current members of the Temperature community. Temperature also uses the best tools, such as Google Scholar profiles. The editorial includes a new puzzle: why does warm water freeze faster than cold water?

  18. Giant Magnetostrictive Material Exciter for Panel Loudspeaker

    Institute of Scientific and Technical Information of China (English)

    WANG Rui; ZHANG Yong-fa

    2008-01-01

    The exciter component in a panel loudspeaker has a profound effect on the overall performance of the system.The equivalent circuit analysis of the combination of giant magnetostrictive material exciter and distributed mode panel is introduced and how exciter parameters influence panel lffudspeaker's performance is discussed.NumericaI predictions are given in order to show how these influences are manifested.

  19. Giant melanoma of the left thumb

    NARCIS (Netherlands)

    Zeebregts, CJAM; Schraffordt Koops, H.

    2000-01-01

    A 74-year-old female patient is described with a giant melanoma of the left thenar and concomitant bilateral pulmonary metastases. Palliative treatment consisted of a two-staged procedure in order to save the limb from amputation. Firstly, perfusion with gamma-interferon, tumour necrosis factor-alph

  20. Southern Africa - a giant natural photochemical reactor

    CSIR Research Space (South Africa)

    Diab, RD

    2006-04-01

    Full Text Available The analogy of a ‘giant natural photochemical reactor’ is extended in this paper to the central and southern African tropics, where tropospheric ozone enhancement occurs over a vast geographical area from the Congo to South Africa, and over a long...

  1. Tuberculosis Detection by Giant African Pouched Rats

    Science.gov (United States)

    Poling, Alan; Weetjens, Bart; Cox, Christophe; Beyene, Negussie; Durgin, Amy; Mahoney, Amanda

    2011-01-01

    In recent years, operant discrimination training procedures have been used to teach giant African pouched rats to detect tuberculosis (TB) in human sputum samples. This article summarizes how the rats are trained and used operationally, as well as their performance in studies published to date. Available data suggest that pouched rats, which can…

  2. Giant viruses of amoebas: an update

    Directory of Open Access Journals (Sweden)

    Sarah eAherfi

    2016-03-01

    Full Text Available During the 12 past years, five new or putative virus families encompassing several members, namely Mimiviridae, Marseilleviridae, pandoraviruses, faustoviruses, and virophages were described. In addition, Pithovirus sibericum and Mollivirus sibericum represent type strains of putative new giant virus families. All these viruses were isolated using amoebal coculture methods. These giant viruses were linked by phylogenomic analyses to other large DNA viruses. They were then proposed to be classified in a new viral order, the Megavirales, on the basis of their common origin, as shown by a set of ancestral genes encoding key viral functions, a common virion architecture, and shared major biological features including replication inside cytoplasmic factories. Megavirales is increasingly demonstrated to stand in the tree of life aside Bacteria, Archaea and Eukarya, and the megavirus ancestor is suspected to be as ancient as cellular ancestors. In addition, giant amoebal viruses are visible under a light microscope and display many phenotypic and genomic features not found in other viruses, while they share other characteristics with parasitic microbes. Moreoever, these organisms appear to be common inhabitants of our biosphere, and mimiviruses and marseilleviruses were isolated from human samples and associated to diseases. In the present review, we describe the main features and recent findings on these giant amoebal viruses and virophages.

  3. Insights on a Giant Aneurysm Treated Endovascularly.

    Science.gov (United States)

    Graziano, Francesca; Iacopino, Domenico Gerardo; Ulm, Arthur John

    2016-07-01

    Background Endovascular treatment with stent-assisted Guglielmi detachable coils is an accepted method for treating intracranial giant aneurysms that otherwise would require more invasive or destructive treatment or could not be treated at all. Nevertheless, there is a paucity of information concerning inner postcoiling aneurysmal changes in human subjects over the long term. We report a postmortem analysis of a patient with a giant aneurysm at the vertebrobasilar junction (VBJ) who was treated endovascularly and studied pathologically 24 months after treatment. Materials and Method The head was removed at autopsy and prefixed in a 10% neutral buffered formalin solution. The brain was gently removed from the skull base after cutting the intracranial nerves and vascular structures. The giant VBJ aneurysm and its relationship with the brainstem, cranial nerves, and vessels were captured photographically and analyzed. Afterward, under operating microscope guidance, the vertebrobasilar system with the aneurysm was gently and carefully detached from the brainstem and carefully analyzed. Results No complete fibrous obliteration of the aneurysm lumen could be detected in our case, and no endothelialization had taken place 24 months after treatment. Conclusions Our findings agree with those of previous similar reports. Coiling, in particular in large or giant aneurysms, may be burdened by the risk of coil compaction and recanalization, but it has the advantage of not affecting the flow in the perforating arteries.

  4. Giant omental lipoblastoma and CD56 expression

    Directory of Open Access Journals (Sweden)

    Go Miyano

    2013-01-01

    Full Text Available We report a case of giant omental lipoblastoma in a 13-month-old boy, which was treated successfully by total excision. Tumor cells were positive for S100, CD34 and CD56. This is the first report of lipoblastoma expressing CD56, a fact that could be used to differentiate lipoblastoma from liposarcoma.

  5. Giant cell arteritis: diagnosis and treatment.

    Science.gov (United States)

    Calvo Romero, J M

    2015-01-01

    Giant cell arteritis is the most common primary systemic vasculitis in adults. The condition is granulomatous arteritis of large and medium vessels, which occurs almost exclusively in patients aged 50 years or more. This article reviews the diagnosis and treatment of the disease. Copyright © 2015. Published by Elsevier España, S.L.U.

  6. The operation of giant incisional hernia

    DEFF Research Database (Denmark)

    Eriksson, Axelina; Krag, Christen; Jørgensen, Lars Nannestad

    2014-01-01

    Incisional hernia is a common complication to laparotomy impacting negatively on quality of life, risk of emergency surgery and cosmesis. The operation of giant incisional hernia (cross diameter of hernia defect > 20 cm) is a high risk procedure and the surgical techniques are not based on high...

  7. [A rare clinical report of giant hemangiopericytoma].

    Science.gov (United States)

    Shkarubo, A N; Shishkina, L V; Tailakov, Sh T; Dorosh, K V; Khromov, A P

    2014-01-01

    Authors show an example of a successful treatment of a patient with a giant intracranial hemangiopericytoma. Hemangiopericytoma are aggressive tumors with a high rate of recurrence and metastasis. Despite the malignant nature of these tumors often reach a large size with minor clinical signs. Surgical removal of the tumor is still the primary method of treatment.

  8. Foreign Giants Take Gas Pipeline Stake Equally

    Institute of Scientific and Technical Information of China (English)

    Xie Ye

    2002-01-01

    @@ Oil giants Royal/Dutch, ExxonMobil and Russia's Gazprom have agreed to take 15 percent stakes each in China's US$5.6 billion natural gas pipeline project,clearing away the final obstacles blocking the kickoff of the repeatedly delayed project, according to the latest reports from news media in early July.

  9. Giant Cholesteatoma : Recommendations for Follow-up

    NARCIS (Netherlands)

    Geven, Leontien I.; Mulder, Jef J. S.; Graamans, Kees

    2008-01-01

    This report presents the management of five patients who presented with giant recurrent or residual cholesteatoma after periods of 2 to 50 years. Their case histories are highly diverse, but all provide evidence of the need for long-term follow-up.

  10. Chirp-driven giant phase space vortices

    Science.gov (United States)

    Trivedi, Pallavi; Ganesh, Rajaraman

    2016-06-01

    In a collisionless, unbounded, one-dimensional plasma, modelled using periodic boundary conditions, formation of steady state phase space coherent structures or phase space vortices (PSV) is investigated. Using a high resolution one-dimensional Vlasov-Poisson solver based on piecewise-parabolic advection scheme, the formation of giant PSV is addressed numerically. For an infinitesimal external drive amplitude and wavenumber k, we demonstrate the existence of a window of chirped external drive frequency that leads to the formation of giant PSV. The linear, small amplitude, external drive, when chirped, is shown to couple effectively to the plasma and increase both streaming of "untrapped" and "trapped" particle fraction. The steady state attained after the external drive is turned off and is shown to lead to a giant PSV with multiple extrema and phase velocities, with excess density fraction, defined as the deviation from the Maxwellian background, Δ n / n 0 ≃ 20 % - 25 % . It is shown that the process depends on the chirp time duration Δt. The excess density fraction Δn/n0, which contains both trapped and untrapped particle contribution, is also seen to scale with Δt, only inhibited by the gradient of the distribution in velocity space. Both single step drive and multistep chirp processes are shown to lead to steady state giant PSV, with multiple extrema due to embedded holes and clumps, long after the external drive is turned off.

  11. Caring for the Giant Pandas' Future

    Institute of Scientific and Technical Information of China (English)

    TANG YUANKAI

    2010-01-01

    @@ A long-term partnership was formed in October by American corporation Broadcom, Broadcom Foundation,and the San Diego Zoo, together with China Wolong National Natural Reserve and the Institute of Zoology of the Chinese Academy of Sciences (CAS) to study giant panda protection and breeding.

  12. [Giant paraovarian cyst in childhood - Case report].

    Science.gov (United States)

    Torres, Janina P; Íñiguez, Rodrigo D

    2015-01-01

    Paraovarian cysts are very uncommon in children To present a case of giant paraovarian cyst case in a child and its management using a modified laparoscopic-assisted technique A 13-year-old patient with a 15 day-history of intermittent abdominal pain, located in the left hemiabdomen and associated with progressive increase in abdominal volume. Diagnostic imaging was inconclusive, describing a giant cystic formation that filled up the abdomen, but without specifying its origin. Laboratory tests and tumor markers were within normal range. Video-assisted transumbilical cystectomy, a modified laparoscopic procedure with diagnostic and therapeutic intent, was performed with a successful outcome. The histological study reported giant paraovarian cyst. Cytology results were negative for tumor cells. The patient remained asymptomatic during the postoperative follow-up. The video-assisted transumbilical cystectomy is a safe procedure and an excellent diagnostic and therapeutic alternative for the treatment of giant paraovarian cysts. Copyright © 2015. Publicado por Elsevier España, S.L.U.

  13. Polarization Spectra of Extrasolar Giant Planets

    NARCIS (Netherlands)

    Stam, D.M.

    2004-01-01

    We present simulated spectra of the flux and degree of polarization of starlight that is reflected by extrasolar giant planets (EGPs). In particular the polarization depends strongly on the structure of the planetary atmosphere, and appears to be a valuable tool for the characterization of EGPs.

  14. Giant cell tumour of distal ulna.

    Science.gov (United States)

    Archik, Shreedhar; Tripathi, Sanjay Kumar; Nanda, Saurav Narayan; Choudhari, Ashlesh

    2017-01-01

    Giant cell tumor (GCT) of distal end epiphysis ulna is a rare presentation, and only few cases are reported in the scientific literature. We report a case of GCT of distal end epiphysis ulna treated at our Tertiary Care Hospital, Mumbai.

  15. Tuberculosis Detection by Giant African Pouched Rats

    Science.gov (United States)

    Poling, Alan; Weetjens, Bart; Cox, Christophe; Beyene, Negussie; Durgin, Amy; Mahoney, Amanda

    2011-01-01

    In recent years, operant discrimination training procedures have been used to teach giant African pouched rats to detect tuberculosis (TB) in human sputum samples. This article summarizes how the rats are trained and used operationally, as well as their performance in studies published to date. Available data suggest that pouched rats, which can…

  16. Reduction of benzene metabolism and toxicity in mice that lack CYP2E1 expression.

    Science.gov (United States)

    Valentine, J L; Lee, S S; Seaton, M J; Asgharian, B; Farris, G; Corton, J C; Gonzalez, F J; Medinsky, M A

    1996-11-01

    Transgenic CYP2E1 knockout mice (cyp2e1-/-) were used to investigate the involvement of CYP2E1 in the in vivo metabolism of benzene and in the development of benzene-induced toxicity. After benzene exposure, absence of CYP2E1 protein was confirmed by Western blot analysis of mouse liver samples. For the metabolism studies, male cyp2e1-/- and wild-type control mice were exposed to 200 ppm benzene, along with a radiolabeled tracer dose of [14C]benzene (1.0 Ci/mol) by nose-only inhalation for 6 hr. Total urinary radioactivity and all radiolabeled individual metabolites were reduced in urine of cyp2e1-/- mice compared to wild-type controls during the 48-hr period after benzene exposure. In addition, a significantly greater percentage of total urinary radioactivity could be accounted for as phenylsulfate conjugates in cyp2e1-/- mice compared to wild-type mice, indicating the importance of CYP2E1 in oxidation of phenol following benzene exposure in normal mice. For the toxicity studies, male cyp2e1-/-, wild-type, and B6C3F1 mice were exposed by whole-body inhalation to 0 ppm (control) or 200 ppm benzene, 6 hr/day for 5 days. On Day 5, blood, bone marrow, thymus, and spleen were removed for evaluation of micronuclei frequencies and tissue cellularities. No benzene-induced cytotoxicity or genotoxicity was observed in cyp2e1-/- mice. In contrast, benzene exposure resulted in severe genotoxicity and cytotoxicity in both wild-type and B6C3F1 mice. These studies conclusively demonstrate that CYP2E1 is the major determinant of in vivo benzene metabolism and benzene-induced myelotoxicity in mice.

  17. Characteristics and Soft-Demodulation of Galileo E1 Signal%Galileo E1信号特征及其软件解调

    Institute of Scientific and Technical Information of China (English)

    易翔

    2009-01-01

    Galileo E1民用信号采用新的BOC(1,1)扩频调制方式.针对E1信号进行信号建模,并对其信号特征进行了详细研究,最后设计了Galileo软件解调器中的信号处理模块.通过仿真验证表明,软件解调器成功实现了对Galileo E1信号的捕获、跟踪、解扩、解调全过程处理,克服了BOC解调的错锁问题.

  18. Floret-like multinucleated giant cells in neurofibroma.

    Science.gov (United States)

    Shaktawat, Sameer Singh; Golka, Dariusz

    2007-12-08

    This short report discusses a case of neurofibroma containing floret-like multinucleated giant cells. This being the second such case in the literature. Floret-like multinucleated giant cells have been reported in gynaecomastia and neurofibroma in neurofibromatosis type 1. These cells have been reported in uncommon soft tissue tumours including pleomorphic lipoma, giant cell collagenoma, giant cell fibroblastoma and giant cell angiofibroma. We recommend these cells to be interpreted carefully keeping in mind the rare malignant change in neurofibromas. Immunohistochemistry would help in defining the nature of such cells.

  19. Floret-like multinucleated giant cells in neurofibroma

    Directory of Open Access Journals (Sweden)

    Golka Dariusz

    2007-12-01

    Full Text Available Abstract This short report discusses a case of neurofibroma containing floret-like multinucleated giant cells. This being the second such case in the literature. Floret-like multinucleated giant cells have been reported in gynaecomastia and neurofibroma in neurofibromatosis type 1. These cells have been reported in uncommon soft tissue tumours including pleomorphic lipoma, giant cell collagenoma, giant cell fibroblastoma and giant cell angiofibroma. We recommend these cells to be interpreted carefully keeping in mind the rare malignant change in neurofibromas. Immunohistochemistry would help in defining the nature of such cells.

  20. Sucrose-mediated giant cell formation in the genus Neisseria.

    Science.gov (United States)

    Johnson, K G; McDonald, I J

    1976-03-01

    Growth of Neisseria perflava, Neisseria cinerea, and Neisseria sicca strain Kirkland in media supplemented with sucrose (0.5 to 5.0% w/v) resulted in the formation of giant cells. Response to sucrose was specific in that a variety of other carbohydrates did not mediate giant cell formation. Giant cells appeared only under growth conditions and did not lyse upon transfer to medium lacking sucrose or upon resuspension in hypotonic media. Reversion of giant to normal cells occurred when giant cells were used as inocula and allowed to multiply in media lacking sucrose.

  1. Dynamo-generated magnetic fields in fast rotating single giants

    CERN Document Server

    Konstantinova-Antova, Renada; Schröder, Klaus-Peter; Petit, Pascal

    2009-01-01

    Red giants offer a good opportunity to study the interplay of magnetic fields and stellar evolution. Using the spectro-polarimeter NARVAL of the Telescope Bernard Lyot (TBL), Pic du Midi, France and the LSD technique, we began a survey of magnetic fields in single G-K-M giants. Early results include 6 MF-detections with fast rotating giants, and for the first time a magnetic field was detected directly in an evolved M-giant: EK Boo. Our results could be explained in the terms of $\\alpha$--$\\omega$ dynamo operating in these giants.

  2. Giant magnetoelectric effect in self-biased laminates under zero magnetic field

    Science.gov (United States)

    Li, Menghui; Wang, Zhiguang; Wang, Yaojin; Li, Jiefang; Viehland, D.

    2013-02-01

    A giant magnetoelectric (ME) effect in self-biased annealed Metglas/Pb(Zr,Ti)O3/Metglas laminates under zero magnetic bias is reported. The remanent magnetization was increased by annealing Metglas, which generated an internal bias field. This shifted the M-H hysteresis loops, yielding large values for the ME voltage coefficient of αME = 12 V/cm.Oe and 380 V/cm.Oe at 1 kHz and electromechanical resonance under zero magnetic bias, respectively. This self-biased laminate is shown to have a high sensitivity to ac magnetic fields.

  3. Self-induced transparency and giant nonlinearity in doped photonic crystals

    CERN Document Server

    Kurizki, G; Opatrny, T; Blaauboer, M; Malomed, B; Kurizki, Gershon; Petrosyan, David; Opatrny, Tomas; Blaauboer, Miriam; Malomed, Boris

    2002-01-01

    Photonic crystals doped with resonant atoms allow for uniquely advantageous nonlinear modes of optical propagation: (a) Self-induced transparency (SIT) solitons and multi-dimensional localized "bullets" propagating at photonic band gap frequencies. These modes can exist even at ultraweak intensities (few photons) and therefore differ substantially either from solitons in Kerr-nonlinear photonic crystals or from SIT solitons in uniform media. (b) Cross-coupling between pulses exhibiting electromagnetically induced transparency (EIT) and SIT gap solitons. We show that extremely strong correlations (giant cross-phase modulation) can be formed between the two pulses. These features may find applications in high-fidelity classical and quantum optical communications.

  4. Surgical treatment of a giant left ventricular aneurysm- A case report

    Directory of Open Access Journals (Sweden)

    Gustavo Alves Schaitza

    2014-12-01

    Full Text Available An aneurysm of the left ventricle is a complication of acute myocardial infarction. We report a case of a giant aneurysm of the left ventricle after myocardial infarction in a 59 year-old male patient. The surgery to correct the aneurysm was performed with the use of cardiopulmonary bypass under normothermia. A bovine pericardial patch was used for the geometric reconstruction of the ventricular wall affected by the aneurysm. After the procedure, echocardiography and magnetic resonance imaging revealed improvement in left ventricular ejection fraction and volume reduction.

  5. Surgical treatment of a giant left ventricular aneurysm- a case report.

    Science.gov (United States)

    Schaitza, Gustavo Alves; Faria Neto, José Rocha; Francisco, Julio Cesar; Baena, Cristiana Pellegrino; Giffhorn, Helcio; Olandoski, Bruna; Meira, Leanderson Franco de; Guarita-Souza, Luiz César

    2014-01-01

    An aneurysm of the left ventricle is a complication of acute myocardial infarction. We report a case of a giant aneurysm of the left ventricle after myocardial infarction in a 59 year-old male patient. The surgery to correct the aneurysm was performed with the use of cardiopulmonary bypass under normothermia. A bovine pericardial patch was used for the geometric reconstruction of the ventricular wall affected by the aneurysm. After the procedure, echocardiography and magnetic resonance imaging revealed improvement in left ventricular ejection fraction and volume reduction.

  6. Carpal tunnel syndrome caused by a giant cell tumour of the flexor tendon sheath.

    Science.gov (United States)

    Meek, Marcel F; Sheikh, Zahid A; Quinton, David N

    2014-02-01

    A 76-year-old woman developed right carpal tunnel syndrome after being conservatively treated for tenosynovitis of the flexor tendons with associated mild carpal tunnel syndrome. A magnetic resonance imaging scan showed a tumour in the carpal tunnel. Re-exploration showed that the median nerve was being compressed by a giant cell tumour of the flexor tendon sheaths. Appropriate imaging is advised in patients with additional findings (such as swelling) or in patients with secondary carpal tunnel syndrome and incomplete response to conservative treatment, to exclude a space-occupying lesion.

  7. Pygmy dipole resonance in stable nuclei

    Indian Academy of Sciences (India)

    P Von Neumann-Cosel

    2010-07-01

    Two examples of recent work on the structure of low-energy electric dipole modes are presented. The first part discusses the systematics of the pygmy dipole resonance (PDR) in stable tin isotopes deduced from high-resolution (, ′) experiments. These help to distinguish between microscopic QRPA calculations based on either a relativistic or a non-relativistic mean-field description, predicting significantly different properties of the PDR. The second part presents a novel approach to measure the complete electric dipole strength distribution from excitation energies starting at about 5 MeV across the giant dipole resonance (GDR) with high-resolution inelastic proton scattering under 0° at energies of a few 100 MeV/nucleon. The case of 208Pb is discussed in detail and first result from a recent experiment on 120Sn is presented.

  8. 26 CFR 1.669(e)-1A - Pro rata portion of taxes deemed distributed.

    Science.gov (United States)

    2010-04-01

    ... 26 Internal Revenue 8 2010-04-01 2010-04-01 false Pro rata portion of taxes deemed distributed. 1.669(e)-1A Section 1.669(e)-1A Internal Revenue INTERNAL REVENUE SERVICE, DEPARTMENT OF THE TREASURY (CONTINUED) INCOME TAX (CONTINUED) INCOME TAXES Treatment of Excess Distributions of Trusts Applicable to Taxable Years Beginning Before January...

  9. Expression of cytochrome P4502E1 gene in hepatocellular carcinoma

    Institute of Scientific and Technical Information of China (English)

    Xiao-Bo Man; Liang Tang; Xiu-Hua Qiu; Li-Qun Yang; Hui-Fang Cao; Meng-Chao Wu; Hong-Yang Wang

    2004-01-01

    AIM: To investigate cytpchrome P4502E1 ( CYP2E1) gene expression in occurrence and progression of hepatocellular carcinoma (HCC).METHODS: The human liver arrayed library was spotted onto the nylon membranes to make cDNA array. Hybridization of cDNA array was performed with labeled probes synthesized from RNA isolated from HCC and adjacent liver tissues.Sprague-Dawley rats were administrated diethylnitrosamine (DENA) to induce HCC. CYP2E1 expression was detected by the method of RT-PCR and Northern blot analysis.RESULTS: CYP2E1 was found by cDNA array hybridization to express differently between HCC and liver tissues. CYP2E1only expressed in liver, but did not express in HCC tissues and expressed lowly in cirrhotic tissues. In the progression of cirrhosis and HCC, the expression level of CYP2E1 was gradually decreased and hardly detected until the late stage of HCC.CONCLUSION: Using arrayed library to make cDNA arrays is an effective method to find differential expression genes.CYP2E1 is a unique gene expressing in liver but did not express in HCC. CYP2E1 expression descended along with the initiation and progression of HCC, which is noteworthy further investigations in its significance in the development of HCC.

  10. Morbidly Obese Patients Exhibit Increased CYP2E1-Mediated Oxidation of Acetaminophen

    NARCIS (Netherlands)

    A. van Rongen (Anne); P.A.J. Välitalo (Pyry A. J.); M.Y. Peeters (Mariska); D. Boerma (Djamila); F.W. Huisman (Fokko W.); B. van Ramshorst (Bert); E.H.P.A. van Dongen (Eric); J.N. van den Anker (John); C.A.J. Knibbe (Catherijne)

    2016-01-01

    textabstractIntroduction: Acetaminophen (paracetamol) is mainly metabolized via glucuronidation and sulphation, while the minor pathway through cytochrome P450 (CYP) 2E1 is held responsible for hepatotoxicity. In obese patients, CYP2E1 activity is reported to be induced, thereby potentially worsenin

  11. Morbidly Obese Patients Exhibit Increased CYP2E1-Mediated Oxidation of Acetaminophen.

    NARCIS (Netherlands)

    Rongen, van A.; Välitalo, P.A.J.; Peeters, M.Y.; Boerma, D.; Huisman, F.W.; Ramshorst, van B.; Dongen, van E.P.; Anker, van den J.N.; Knibbe, C.A.J.

    2016-01-01

    INTRODUCTION Acetaminophen (paracetamol) is mainly metabolized via glucuronidation and sulphation, while the minor pathway through cytochrome P450 (CYP) 2E1 is held responsible for hepatotoxicity. In obese patients, CYP2E1 activity is reported to be induced, thereby potentially worsening the safety

  12. CK2 phosphorylation inactivates DNA binding by the papillomavirus E1 and E2 proteins.

    Science.gov (United States)

    Schuck, Stephen; Ruse, Cristian; Stenlund, Arne

    2013-07-01

    Papillomaviruses have complex life cycles that are understood only superficially. Although it is well established that the viral E1 and E2 proteins play key roles in controlling viral transcription and DNA replication, how these factors are regulated is not well understood. Here, we demonstrate that phosphorylation by the protein kinase CK2 controls the biochemical activities of the bovine papillomavirus E1 and E2 proteins by modifying their DNA binding activity. Phosphorylation at multiple sites in the N-terminal domain in E1 results in the loss of sequence-specific DNA binding activity, a feature that is also conserved in human papillomavirus (HPV) E1 proteins. The bovine papillomavirus (BPV) E2 protein, when phosphorylated by CK2 on two specific sites in the hinge, also loses its site-specific DNA binding activity. Mutation of these sites in E2 results in greatly increased levels of latent viral DNA replication, indicating that CK2 phosphorylation of E2 is a negative regulator of viral DNA replication during latent viral replication. In contrast, mutation of the N-terminal phosphorylation sites in E1 has no effect on latent viral DNA replication. We propose that the phosphorylation of the N terminus of E1 plays a role only in vegetative viral DNA replication, and consistent with such a role, caspase 3 cleavage of E1, which has been shown to be necessary for vegetative viral DNA replication, restores the DNA binding activity to phosphorylated E1.

  13. 26 CFR 1.665(e)-1A - Preceding taxable year.

    Science.gov (United States)

    2010-04-01

    ... 26 Internal Revenue 8 2010-04-01 2010-04-01 false Preceding taxable year. 1.665(e)-1A Section 1... (CONTINUED) INCOME TAXES Treatment of Excess Distributions of Trusts Applicable to Taxable Years Beginning on Or After January 1, 1969 § 1.665(e)-1A Preceding taxable year. (a) Definition—(1) Domestic trusts—(i...

  14. 26 CFR 31.3121(e)-1 - State, United States, and citizen.

    Science.gov (United States)

    2010-04-01

    ... 26 Internal Revenue 15 2010-04-01 2010-04-01 false State, United States, and citizen. 31.3121(e)-1... § 31.3121(e)-1 State, United States, and citizen. (a) When used in the regulations in this subpart, the... is used in a geographical sense. The term “citizen of the United States” includes a citizen of the...

  15. Constructing stable 3D hydrodynamical models of giant stars

    CERN Document Server

    Ohlmann, Sebastian T; Pakmor, Rüdiger; Springel, Volker

    2016-01-01

    Hydrodynamical simulations of stellar interactions require stable models of stars as initial conditions. Such initial models, however, are difficult to construct for giant stars because of the wide range in spatial scales of the hydrostatic equilibrium and in dynamical timescales between the core and the envelope of the giant. They are needed for, e.g., modeling the common envelope phase where a giant envelope encompasses both the giant core and a companion star. Here, we present a new method of approximating and reconstructing giant profiles from a stellar evolution code to produce stable models for multi-dimensional hydrodynamical simulations. We determine typical stellar stratification profiles with the 1D stellar evolution code MESA. After an appropriate mapping, hydrodynamical simulations are conducted using the moving-mesh code AREPO. The giant profiles are approximated by replacing the core of the giant with a point mass and by constructing a suitable continuation of the profile to the center. Differen...

  16. PERIPHERAL GIANT CELL GRANULOMAS OF ORAL CAVITY: OUR EXPERIENCE

    Directory of Open Access Journals (Sweden)

    Kamal

    2015-07-01

    Full Text Available Peripheral giant cell granuloma or the so - called “giant cell epulis” is the most common oral giant cell lesion. Peripheral giant cell granuloma (PGCG is an infrequent exophytic lesion of the oral cavity, also known as giant - cell hyperplasia, osteoclastoma, or giant cell reparative granuloma. Lesions vary in appearance from smooth, regularly outlined masses to irregularly shaped, multilobulated protuberances with surface indentations. Ulcerations of the margin are occasionally seen . This lesion probably does not represent a true neoplasm, but rather may be reactive in nature, believed to be stimulated by local irritation or trauma, but the cause is not certainly known. The aim in publishing this study is to present the clinical, histopathological features and treatment of peripheral giant cell granulomas of various sizes in different age groups in jaws

  17. Modeling Impacts of Climate Change on Giant Panda Habitat

    Directory of Open Access Journals (Sweden)

    Melissa Songer

    2012-01-01

    Full Text Available Giant pandas (Ailuropoda melanoleuca are one of the most widely recognized endangered species globally. Habitat loss and fragmentation are the main threats, and climate change could significantly impact giant panda survival. We integrated giant panda habitat information with general climate models (GCMs to predict future geographic distribution and fragmentation of giant panda habitat. Results support a major general prediction of climate change—a shift of habitats towards higher elevation and higher latitudes. Our models predict climate change could reduce giant panda habitat by nearly 60% over 70 years. New areas may become suitable outside the current geographic range but much of these areas is far from the current giant panda range and only 15% fall within the current protected area system. Long-term survival of giant pandas will require the creation of new protected areas that are likely to support suitable habitat even if the climate changes.

  18. New Protein Vector ApE1 for Targeted Delivery of Anticancer Drugs

    Directory of Open Access Journals (Sweden)

    N. V. Pozdniakova

    2012-01-01

    Full Text Available A new chimeric gene ApE1 encoding the receptor-binding domain of the human alpha-fetoprotein fused to a sequence of 22 glutamic acid residues was constructed. A new bacterial producer strain E. coli SHExT7 ApE1 was selected for ApE1 production in a soluble state. A simplified method was developed to purify ApE1 from bacterial biomass. It was shown that the new vector protein selectively interacts with AFP receptors on the tumor cell surface and can be efficiently accumulated in tumor cells. In addition, ApE1 was shown to be stable in storage and during its chemical modification. An increased number of carboxyl groups in the molecule allows the production of cytotoxic compound conjugates with higher drug-loading capacity and enhanced tumor targeting potential.

  19. Comparison of osteogenic potentials of human rat BMP4 and BMP6 gene therapy using [E1-] and [E1-,E2b-] adenoviral vectors

    Directory of Open Access Journals (Sweden)

    Hongwei Li, Jin Zhong Li, Debra D. Pittman, Andy Amalfitano, Gerald R. Hankins, Gregory A. Helm

    2006-01-01

    Full Text Available Osteogenic potentials of some recombinant human bone morphogenetic protein (BMP first-generation adenoviral vectors (ADhBMPs are significantly limited in immunocompetent animals. It is unclear what role expression of viral proteins and foreign proteins transduced by adenoviral vectors play in the host immune response and in ectopic bone formation. In this study two sets of experiments were designed and performed. First, rat BMP6 cDNA were amplified, sequenced, and recombined in first-generation adenoviral vector (ADrBMP6. A comparison of human and rat BMP6 adenoviral vectors demonstrated identical osteogenic activities in both immunodeficient and immunocompetent rats. Second, the activities of recombinant human BMP6 in E1- (ADhBMP6 and [E1-,E2b-] ( [E1-,E2b-]ADGFP&hBMP6, and [E1-,E2b-]ADhBMP6 adenoviral vectors were compared in both in vitro and in vivo models. Similar activities of these two generations of BMP adenoviral vectors were found in all models. These results indicate that the amount of viral gene expression and the source of the BMP cDNA are not major factors in the interruption of osteogenic potentials of recombinant BMP6 adenoviral vectors in immunocompetent animals.

  20. The Neuro Imaging Description of Giant Pituitary Adenomas Depending on Mechanical Factor

    Directory of Open Access Journals (Sweden)

    Yu.M. Urmanova

    2016-08-01

    Full Text Available The research aim is to analyze of magnetically-resonance tomography data depending on the mechanical factor of giant pituitary adenomas. Materials and methods. Twenty-two adult patients with giant pituitary adenomas were observed during the period from 2015 to 2016 (men 50 %, aged 48.5 years old. The duration of disease varied from 2 months to 25 years. Results. Patients with endo-suprasellar growth of pituitary tumour had signs of chiasmal syndrome with bitemporal hemianopsia, initial or complete homonym hemianopsia, scotomas and others. Such variant of pituitary tumour growth was observed in 7 cases (31.8 %. 4.5 % patients with retro-sellar growth of pituitary tumour typically had violations caused by the growth of tumour into brainstem, that stipulated both the lesion of craniocerebral nerves and vegetative disorders, and also pyramid symptomatology (pathological reflexes, symptoms of oral automatism. Patients with the endo-laterosellar growth of tumour suffered from decline of sharpness of sight on one eye, one-sided headaches, lesion of oculomotorius. For 4.5 % patients with the endo-infrasellar growth of tumour violations of the nasal breathing and swallowing (odynophagia were typical. Conclusions. The most expressed neuroendocrine, ophthalmology and pillar disorders were observed in patients with the total growth of tumor. The giant pituitary adenomas are often accompanied by an invasion growth into surrounding anatomic structures (69.2 % that is a basic factor limiting radical operative intervention and increasing the number of relapses.

  1. The role of preoperative angiography in the management of giant meningiomas associated to vascular malformation

    Directory of Open Access Journals (Sweden)

    Fabio Papacci

    2015-01-01

    Full Text Available Background: The role of preoperative digital subtraction angiography (DSA in meningiomas is currently under discussion because of the introduction of noninvasive magnetic resonance imaging (MRI angiography to study vascular anatomy associated to the tumor. Preoperative DSA is mainly performed to obtain embolization of the lesion, although a number of complications have been reported after this procedure. Nonetheless, the coexistence of meningiomas with vascular malformations has previously been reported and it has been evidenced that this event could be underestimated because of neglect of preoperative DSA. Here, we report on two challenging cases of giant meningiomas associated to vascular malformations and we discuss the pertinent literature. Case Descriptions: In the first case: A large right temporal meningioma with erosion of the sphenoid greater wing and extension toward infratemporal fossa and right orbit - a large pseudoaneurysm of right middle cerebral artery branch was found end embolized during DSA. In the second case: A giant parieto-temporal meningioma - DSA permitted the full visualization of an abnormal drainage of superior sagittal sinus like a "sinus pericranii" that was respected during the following surgery. Conclusion: We think that MRI angiography is the exam of choice to study vascular anatomy in meningiomas. Nonetheless, DSA remains a useful tool in giant meningiomas not only to embolizate the lesion but also to treat tumor associated vascular malformation and to achieve the full knowledge of vascular anatomy. We think that a wide communication between interventionalist and surgeon is essential for the optimal management of these patients.

  2. A design for clock data recovery circuit of E1%一种E1时钟数据恢复电路的设计

    Institute of Scientific and Technical Information of China (English)

    李鑫; 黄海生; 张斌; 惠楠

    2012-01-01

    针对E1数据的时钟数据恢复问题,设计一种基于小数分频且有环路滤波功能的数控振荡器(DigitallyControlled Oscillator,DCO),给出一种新的全数字锁相环(All Digital Phase-Locked Loop,ADPLL)实现方案,将数字环路滤波器(Digital Loop Filter,DLF)和DCO集成到一个模块,从而实现一种E1时钟数据恢复(Clock Data Re-covery,CDR)电路。经过对比可知,新方案比传统ADPLL实现方案的电路集成度更高。理论分析显示,新方案电路性能可靠。%For the problem of E1 clock data recovery, a kind of Digitally Controlled Oscillator (DCO), which has loop filtering function based on fractional frequency dividing, is presented. Then it gives a new kind of All Digital Phase-Locked Loop(ADPLL) implemention scheme. On the basis of this scheme, a kind of E1 Clock Data Reeovery(CDR) circuit is implemented. Com- pared with traditional ADPLL implemention scheme, the scheme presented integrates Digital Loop Filter (DLF) and DCO together, thus the integration of the circuit becomes higher. The mathematical analysis to the circuit performance proves that the design can reliably recover the data and clock from E1 data received.

  3. Ultra-sharp plasmonic resonances from monopole optical nanoantenna phased arrays

    Energy Technology Data Exchange (ETDEWEB)

    Li, Shi-Qiang; Bruce Buchholz, D. [Department of Materials Science and Engineering, Northwestern University, 2220 Campus Dr., Evanston, Illinois 60208-3108 (United States); Zhou, Wei [Department of Chemistry and Chemical Biology, Harvard University, 12 Oxford St., Cambridge, Massachusetts 02138 (United States); Ketterson, John B. [Department of Physics, Northwestern University, 2145 Sheridan Rd., Evanston, Illinois 60208-3113 (United States); NU-NIMS Materials Innovation Center, 2220 Campus Dr., Evanston, Illinois 60208-3108 (United States); Ocola, Leonidas E. [Center for Nanoscale Materials, Argonne National Laboratory, 9700 S Cass Ave., Lemont, Illinois 60439 (United States); Sakoda, Kazuaki [NU-NIMS Materials Innovation Center, 2220 Campus Dr., Evanston, Illinois 60208-3108 (United States); National Institute for Materials Science, 1-2-1 Sengen, Tsukuba, Ibaraki 305-0047 (Japan); Chang, Robert P. H., E-mail: r-chang@northwestern.edu [Department of Materials Science and Engineering, Northwestern University, 2220 Campus Dr., Evanston, Illinois 60208-3108 (United States); NU-NIMS Materials Innovation Center, 2220 Campus Dr., Evanston, Illinois 60208-3108 (United States)

    2014-06-09

    Diffractively coupled plasmonic resonances possess both ultra-sharp linewidths and giant electric field enhancement around plasmonic nanostructures. They can be applied to create a new generation of sensors, detectors, and nano-optical devices. However, all current designs require stringent index-matching at the resonance condition that limits their applicability. Here, we propose and demonstrate that it is possible to relieve the index-matching requirement and to induce ultra-sharp plasmon resonances in an ordered vertically aligned optical nano-antenna phased array by transforming a dipole resonance to a monopole resonance with a mirror plane. Due to the mirror image effect, the monopole resonance not only retained the dipole features but also enhanced them. The engineered resonances strongly suppressed the radiative decay channel, resulting in a four-order of magnitude enhancement in local electric field and a Q-factor greater than 200.

  4. Isovector giant resonances in sup 6 He, sup 1 sup 2 B, sup 9 sup 0 Y, sup 1 sup 2 sup 0 In, and sup 2 sup 0 sup 8 Tl observed in the ( sup 7 Li, sup 7 Be) charge-exchange reaction

    CERN Document Server

    Annakkage, T; Winfield, J S; Berg, G P A; Brown, J A; Crawley, G; Danczyk, S; Fujiwara, M; Mercer, D J; Pham, K; Roberts, D A; Stasko, J T; Yoo, G H

    1999-01-01

    The ( sup 7 Li, sup 7 Be) and ( sup 7 Li, sup 7 Be gamma) reactions have been studied at bombarding energies of 50 A MeV on targets of sup 6 Li, sup 1 sup 2 C, sup 9 sup 0 Zr, sup 1 sup 2 sup 0 Sn, sup 2 sup 0 sup 8 Pb, and polystyrene. The detection of Doppler-shifted gamma-rays from excited sup 7 Be permits the identification of the spinflip and non-spinflip characteristics. Transitions to over 20 discrete states and resonances have been observed. Angular distributions for sup 6 Li and sup 1 sup 2 C are well described by microscopic one-step distorted-waves calculations with shell-model transition amplitudes. The transitions to the ground states of sup 6 He and sup 1 sup 2 C exhibit significant Gamow-Teller strength, but approx 7% and approx 17%, respectively, of the calculated cross sections at theta approx 0 deg. arise from the tensor interaction. A broad resonance at approx 5.6 MeV in the halo nucleus sup 6 He with J suppi = (2 sup + , 1 sup - , 0 sup +) seems to correspond to a structure predicted at th...

  5. Long-Term Prostaglandin E1 Infusion for Newborns with Critical Congenital Heart Disease.

    Science.gov (United States)

    Aykanat, Alper; Yavuz, Taner; Özalkaya, Elif; Topçuoğlu, Sevilay; Ovalı, Fahri; Karatekin, Güner

    2016-01-01

    Prostaglandin E1 is crucial for keeping the patent ductus arteriosus in critical congenital heart disease for the survival and palliation of particularly prematurely born babies until a cardiosurgical intervention is available. In this study, the side effects of prostaglandin E1 in newborns with critical congenital heart disease and clinical outcomes were evaluated. Thirty-five newborns diagnosed with critical congenital heart disease were treated with prostaglandin E1 between January 2012 and September 2014 at our hospital. Patient charts were examined for prostaglandin E1 side effects (metabolic, gastric outlet obstruction, apnea), clinical status, and prognosis. Acquired data were analyzed in the SPSS 20.0 program. Patients with birth weight under 2500 g needed more days of prostaglandin E1 infusion than ones with birthweight over 2500 g (P = 0.016). The ratio of patients with birth weight under 2500 g who received prostaglandin E1 longer than 7 days was higher than the patients with birth weight over 2500 g (P = 0.02). Eighteen side effects were encountered in 11 of 35 patients (31%). Of these side effects, 1 patient had 4, 4 patients had 2, and 6 patients had only 1 side effect. Discontinuation of the therapy was never needed. Prostaglandin E1 is an accepted therapy modality for survival and outcome in critical congenital heart disease in particularly low-birth-weight babies until a surgical intervention is available. Side effects are not less encountered but are almost always manageable, and discontinuation is not needed.

  6. Candida albicans modulates host defense by biosynthesizing the pro-resolving mediator resolvin E1.

    Directory of Open Access Journals (Sweden)

    Eric J Haas-Stapleton

    Full Text Available Candida albicans is an opportunistic fungal pathogen of humans that resides commensally on epithelial surfaces, but can cause inflammation when pathogenic. Resolvins are a class of anti-inflammatory lipids derived from omega-3 polyunsaturated fatty acids (PUFA that attenuate neutrophil migration during the resolution phase of inflammation. In this report we demonstrate that C. albicans biosynthesizes resolvins that are chemically identical to those produced by human cells. In contrast to the trans-cellular biosynthesis of human Resolvin E1 (RvE1, RvE1 biosynthesis in C. albicans occurs in the absence of other cellular partners. C. albicans biosynthesis of RvE1 is sensitive to lipoxygenase and cytochrome P450 monoxygenase inhibitors. We show that 10nM RvE1 reduces neutrophil chemotaxis in response to IL-8; 1nM RvE1 enhanced phagocytosis of Candida by human neutrophils, as well as intracellular ROS generation and killing, while having no direct affect on neutrophil motility. In a mouse model of systemic candidiasis, RvE1 stimulated clearance of the fungus from circulating blood. These results reveal an inter-species chemical signaling system that modulates host immune functions and may play a role in balancing host carriage of commensal and pathogenic C. albicans.

  7. E1DS: catalytic site prediction based on 1D signatures of concurrent conservation.

    Science.gov (United States)

    Chien, Ting-Ying; Chang, Darby Tien-Hao; Chen, Chien-Yu; Weng, Yi-Zhong; Hsu, Chen-Ming

    2008-07-01

    Large-scale automatic annotation of protein sequences remains challenging in postgenomics era. E1DS is designed for annotating enzyme sequences based on a repository of 1D signatures. The employed sequence signatures are derived using a novel pattern mining approach that discovers long motifs consisted of several sequential blocks (conserved segments). Each of the sequential blocks is considerably conserved among the protein members of an EC group. Moreover, a signature includes at least three sequential blocks that are concurrently conserved, i.e. frequently observed together in sequences. In other words, a sequence signature is consisted of residues from multiple regions of the protein sequence, which echoes the observation that an enzyme catalytic site is usually constituted of residues that are largely separated in the sequence. E1DS currently contains 5421 sequence signatures that in total cover 932 4-digital EC numbers. E1DS is evaluated based on a collection of enzymes with catalytic sites annotated in Catalytic Site Atlas. When compared to the famous pattern database PROSITE, predictions based on E1DS signatures are considered more sensitive in identifying catalytic sites and the involved residues. E1DS is available at http://e1ds.ee.ncku.edu.tw/ and a mirror site can be found at http://e1ds.csbb.ntu.edu.tw/.

  8. MRI (Magnetic Resonance Imaging)

    Science.gov (United States)

    ... and Procedures Medical Imaging MRI (Magnetic Resonance Imaging) MRI (Magnetic Resonance Imaging) Share Tweet Linkedin Pin it More sharing options ... usually given through an IV in the arm. MRI Research Programs at FDA Magnetic Resonance Imaging (MRI) ...

  9. Experiments with Helmholtz Resonators.

    Science.gov (United States)

    Greenslade, Thomas B., Jr.

    1996-01-01

    Presents experiments that use Helmholtz resonators and have been designed for a sophomore-level course in oscillations and waves. Discusses the theory of the Helmholtz resonator and resonance curves. (JRH)

  10. Enterasys Networks delivers 10-Gigabit ethernet for the enterprise with new matrix E1 switching family

    CERN Multimedia

    2001-01-01

    Enterasys Networks Inc., today announced its new Matrix E1 family of 10-Gigabit and Gigabit Ethernet switches. The Matrix E1 Optical Access Switch (OAS) enables organizations to deliver applications at 10-Gb speeds across a single fibre optic pair. Jacques Altaber, deputy leader of IT at CERN said "High-bandwith solutions are essential to leveraging more computing power, so 10-Gb Ethernet is the next logical step for us...The Matrix E1 allows us to provide the networking support that our scientists need and gives us a certain future for bandwidth and computing expansion".

  11. Inactivation of cyclin E1 inhibits chemically induced hepatocarcinogenesis in mice

    OpenAIRE

    Moro, Nives

    2011-01-01

    E-type cyclins (CcnE) control the transition of quiescent cells into the cell cycle. Two E-type cyclins, CcnE1 and CcnE2 have been described. A variety of human cancers, including hepatocellular carcinoma (HCC), overexpress CcnE and this is frequently associated with reduced patient survival. The aim of the present study was to dissect the role of CcnE1 and CcnE2 for hepatocarcinogenesis induced by the carcinogen diethylnitrosamine (DEN) using CcnE1 and CcnE2 knockout mice. The central questi...

  12. Creating an Isotopically Similar Earth and Moon from a Giant Impact with Correct Angular Momentum

    Science.gov (United States)

    Sumpter, William

    2017-01-01

    The giant-impact hypothesis is the dominant theory as to how the Earth-Moon system was formed, but angular momentum concerns have cast a shadow on its validity. Computer generated impacts have been successful in producing virtual Earth-Moon systems that possess many of the properties of the observed system, but when tasked with addressing the isotopic similarities between the Earth and Moon they result in systems with excessive angular momentum. Evection resonance between the Moon and the Sun has been put forth as a means of removing the excess angular momentum, but this reasoning was rejected by The Royal Society at a special session called to discuss the origin of the Moon. We show here how to use impactor spins to create an impact that preserves all the favorable aspects of previous simulations and produces an Earth-Moon system with the correct angular momentum. Evection resonance is not needed.

  13. Regenerative feedback resonant circuit

    Science.gov (United States)

    Jones, A. Mark; Kelly, James F.; McCloy, John S.; McMakin, Douglas L.

    2014-09-02

    A regenerative feedback resonant circuit for measuring a transient response in a loop is disclosed. The circuit includes an amplifier for generating a signal in the loop. The circuit further includes a resonator having a resonant cavity and a material located within the cavity. The signal sent into the resonator produces a resonant frequency. A variation of the resonant frequency due to perturbations in electromagnetic properties of the material is measured.

  14. The Metallicity Dependence of Giant Planet Incidence

    CERN Document Server

    Gonzalez, Guillermo

    2014-01-01

    We describe three corrections that should be applied to the observed relative incidence of nearby stars hosting giant planets. These are diffusion in the stellar atmosphere, use of the [Ref] index in place of [Fe/H] for metallicity, and correction for local sampling with the W velocity. We have applied these corrections to a subset of the SPOCS exoplanet survey with uniform giant planet detectability. Fitting the binned data to a power law of the form, $\\alpha 10^{\\beta [Fe/H]}$, we derived $\\alpha = 0.022 \\pm 0.007$ and $\\beta = 3.0 \\pm 0.5$; this value of $\\beta$ is 50\\% larger than the value determined by \\citet{fv05}. While the statistical significance of this difference is marginal, given the small number statistics, these corrections should be included in future analyses that include larger samples.

  15. Convection and Mixing in Giant Planet Evolution

    CERN Document Server

    Vazan, Allona; Kovetz, Attay; Podolak, Morris

    2015-01-01

    The primordial internal structures of gas giant planets are unknown. Often giant planets are modeled under the assumption that they are adiabatic, convective, and homogeneously mixed, but this is not necessarily correct. In this work, we present the first self-consistent calculation of convective transport of both heat and material as the planets evolve. We examine how planetary evolution depends on the initial composition and its distribution, whether the internal structure changes with time, and if so, how it affects the evolution. We consider various primordial distributions, different compositions, and different mixing efficiencies and follow the distribution of heavy elements in a Jupiter-mass planet as it evolves. We show that a heavy-element core cannot be eroded by convection if there is a sharp compositional change at the core-envelope boundary. If the heavy elements are initially distributed within the planet according to some compositional gradient, mixing occurs in the outer regions resulting in a...

  16. Giant colonic diverticulum: radiographic and MDCT characteristics.

    Science.gov (United States)

    Zeina, Abdel-Rauf; Mahamid, Ahmad; Nachtigal, Alicia; Ashkenazi, Itamar; Shapira-Rootman, Mika

    2015-12-01

    Giant colonic diverticulum (GCD), defined as a diverticulum larger than 4 cm, is a rare entity that is generally a manifestation of colonic diverticular disease. Because of its rarity and its variable and non-specific presentation, the diagnosis of GCD depends mainly on imaging findings. Knowledge of the spectrum of radiographic and CT features of the GCD is important in making the correct diagnosis and potentially preventing complications. This review focuses on imaging findings characteristic of GCD as well as its complications and radiographic mimics. Teaching points • Giant colonic diverticulum is a rare complication of diverticulosis.• The most common symptom is abdominal pain presenting in approximately 70 % of patients.• Diagnosis is based on imaging findings with plain abdominal radiographs and MDCT.• Treatment consists of en bloc resection of the diverticulum and affected adjacent colon.

  17. Fingering Convection in Red Giants Revisited

    CERN Document Server

    Wachlin, F C; Althaus, L G

    2014-01-01

    Fingering (thermohaline) convection has been invoked for several years as a possible extra-mixing which could occur in Red Giant stars due to the modification of the chemical composition induced by nuclear reactions in the hydrogen burning zone. Recent studies show however that this mixing is not sufficient to account for the needed surface abundances. A new prescription for fingering convection, based on 3D numerical simulations has recently been proposed (BGS). The resulting mixing coefficient is larger than the ones previously given in the literature. We compute models using this new coefficient and compare them to previous studies. We use the LPCODE stellar evolution code with the GNA generalized version of the mixing length theory to compute Red Giant models and we introduce fingering convection using the BGS prescription. The results show that, although the fingering zone now reaches the outer dynamical convective zone, the efficiency of the mixing is not enough to account for the observations. The fing...

  18. Giant radio galaxies and cosmic web

    Science.gov (United States)

    Heinämäki, Pekka

    2016-10-01

    Giant radio galaxies create the welldistinguishable class of sources.These sources are characterized with edge-brightened radio lobes withhighly collimated radio jets and large linear sizes which make themthe largest individual structures in the Universe. They are also knownto be hosted by elliptical/disturbed host galaxies and avoid clustersand high galaxy density regions. Because of GRG, large linear sizeslobes extend well beyond the interstellar media and host galaxyhalo the evolution of the radio lobes may depend on interactionwith this environment. Using our method to extract filamentarystructure of the galaxies in our local universe we study whetherradio lobe properties in some giant radio galaxies are determinedon an interaction of this filament ambient.

  19. Taxonomy of Indonesian giant clams (Cardiidae, Tridacninae

    Directory of Open Access Journals (Sweden)

    UDHI EKO HERNAWAN

    2012-07-01

    Full Text Available Hernawan E. 2012. Taxonomy of Indonesian giant clams (Cardiidae, Tridacninae. Biodiversitas 13: 118-123. A taxonomic study was conducted on the giant clam’s specimens deposited in Museum Zoologicum Bogoriense (MZB, Cibinong Indonesia. Taxonomic overviews of the examined specimens are given with diagnostic characters, remarks, habitat and distribution. Discussion is focused on specific characters distinguishing each species. From seven species known to distribute in Indonesian waters, there are six species, Tridacna squamosa Lamarck, 1819; T. gigas Linnaeus, 1758; T. derasa Roding, 1798; T. crocea Lamarck, 1819; T. maxima Roding,1798; and Hippopus hippopus Linnaeus, 1758. This study suggests the need for collecting specimen of H. porcellanus Rosewater, 1982. Important characters to distinguish species among Tridacninae are interlocking teeth on byssal orifice, life habits, presence of scales and inhalant siphon tentacles.

  20. Spectroscopy of late type giant stars

    Science.gov (United States)

    Spaenhauer, A.; Thevenin, F.

    1984-06-01

    An attempt to calibrate broadband RGU colors of late type giant stars in terms of the physical parameters of the objects is reported. The parameters comprise the effective temperature, surface gravity and global metal abundance with respect to the sun. A selection of 21 giant star candidates in the Basel fields Plaut 1, Centaurus III and near HD 95540 were examined to obtain a two color plot. Attention is focused on the G-R color range 1.5-2.15 mag, i.e., spectral types K0-K5. A relationship between R and the metallicity is quantified and shown to have a correlation coefficient of 0.93. No correlation is found between metallicity and gravity or R and the effective temperature.