Required characteristics of Paenibacillus polymyxa JB-0501 as potential probiotic.
Naghmouchi, Karim; Baah, John; Cudennec, Benoit; Drider, Djamel
2013-08-01
The ability of Paenibacillus polymyxa to inhibit the growth of Escherichia coli generic ATCC 25922 (Escherichia coli ATCC 25922) and to adhere to monolayers of the enterocyte-like human cell line Caco-2 was evaluated. P. polymyxa JB-0501 (P. polymyxa JB-0501), found in a livestock feed probiotic supplement, was compared to P. polymyxa reference strain ATCC 43685 and ATCC 7070 (P. polymyxa ATCC) in terms of carbohydrate utilization and resistance to lysozyme, acid, bile salts, and hydrogen peroxide. JB-0501 grew at pH 4.5 and at H2O2 concentrations less than 7.3 μg/ml and presented a higher affinity to hexadecane and decane. Bile salts at 0.2 % inhibited the growth of all three strains. P. polymyxa JB-0501 and P. polymyxa ATCC 43865 adhered to Caco-2 cell monolayers. The percentage of cells that adhered ranged from about 0.35 to 6.5 % and was partially proportional to the number applied. Contact time (from 15 min to 1 h) had little impact on adhesion. P. polymyxa JB-0501 inhibited the growth of E. coli ATCC 25922, as proven by the diffusion tests in agar. Taken together, these results suggested that P. polymyxa JB-0501 has the potential probiotic properties to justify its consideration as a livestock feed supplement.
Lifescience Database Archive (English)
Full Text Available 1JB9 トウモロコシ Corn Zea mays L. Ferredoxin-Nadp Reductase Precursor Zea Mays Molecule:...SLLYDEEFTSYLKQYPDNFRYDKALSREQKNRSGGKMYVQDKIEEYSDEIFKLLDGGAHIYFCGLKGMMPGIQDTLKKVAERRGESWDQKLAQLKKNKQWHVEVY corn_1JB9.jpg ...
JB*-Algebras of Topological Stable Rank 1
Directory of Open Access Journals (Sweden)
Akhlaq A. Siddiqui
2007-01-01
Full Text Available In 1976, Kaplansky introduced the class JB*-algebras which includes all C*-algebras as a proper subclass. The notion of topological stable rank 1 for C*-algebras was originally introduced by M. A. Rieffel and was extensively studied by various authors. In this paper, we extend this notion to general JB*-algebras. We show that the complex spin factors are of tsr 1 providing an example of special JBW*-algebras for which the enveloping von Neumann algebras may not be of tsr 1. In the sequel, we prove that every invertible element of a JB*-algebra is positive in certain isotope of ; if the algebra is finite-dimensional, then it is of tsr 1 and every element of is positive in some unitary isotope of . Further, it is established that extreme points of the unit ball sufficiently close to invertible elements in a JB*-algebra must be unitaries and that in any JB*-algebras of tsr 1, all extreme points of the unit ball are unitaries. In the end, we prove the coincidence between the λ-function and λu-function on invertibles in a JB*-algebra.
Pharmacological, neurochemical, and behavioral profile of JB-788, a new 5-HT1A agonist.
Picard, M; Morisset, S; Cloix, J F; Bizot, J C; Guerin, M; Beneteau, V; Guillaumet, G; Hevor, T K
2010-09-01
A novel pyridine derivative, 8-{4-[(6-methoxy-2,3-dihydro-[1,4]dioxino[2,3-b]pyridine-3-ylmethyl)-amino]-butyl}-8-aza-spiro[4.5]decane-7,9-dione hydrochloride, termed JB-788, was designed to selectively target 5-HT(1A) receptors. In the present study, the pharmacological profile of JB-788 was characterized in vitro using radioligands binding tests and in vivo using neurochemical and behavioural experiments. JB-788 bound tightly to human 5-HT(1A) receptor expressed in human embryonic kidney 293 (HEK-293) cells with a K(i) value of 0.8 nM. Its binding affinity is in the same range as that observed for the (+/-)8-OH-DPAT, a reference 5HT(1A) agonist compound. Notably, JB-788 only bound weakly to 5-HT(1B) or 5-HT(2A) receptors and moreover the drug displayed only weak or indetectable binding to muscarinic, alpha(2), beta(1) and beta(2) adrenergic receptors, or dopaminergic D(1) receptors. JB-788 was found to display substantial binding affinity for dopaminergic D(2) receptors and, to a lesser extend to alpha(1) adrenoreceptors. JB-788 dose-dependently decreased forskolin-induced cAMP accumulation in HEK cells expressing human 5-HT(1A), thus acting as a potent 5-HT(1A) receptor agonist (E(max.) 75%, EC(50) 3.5 nM). JB-788 did not exhibit any D(2) receptor agonism but progressively inhibited the effects of quinpirole, a D(2) receptor agonist, in the cAMP accumulation test with a K(i) value of 250 nM. JB-788 induced a weak change in cAMP levels in mouse brain but, like some antipsychotics, transiently increased glycogen contents in various brain regions. Behavioral effects were investigated in mice using the elevated plus-maze. JB-788 was found to increase the time duration spent by animals in anxiogenic situations. Locomotor hyperactivity induced by methamphetamine in mouse, a model of antipsychotic activity, was dose-dependently inhibited by JB-788. Altogether, these results suggest that JB-788 displays pharmacological properties, which could be of interest in the area
Genetic Characterization of Bacillus anthracis 17 JB strain.
Seyed-Mohamadi, Sakineh; Moradi Bidhendi, Soheila; Tadayon, Keyvan; Ghaderi, Rainak
2015-06-01
Bacillus anthracis is one of the most homogenous bacteria ever described. Some level of diversity. Bacillus anthracis 17JB is a laboratory strain It is broadly used as a challenge strain in guinea pigs for potency test of anthrax vaccine. This work describes genetic characterization of B. anthracis 17 JB strain using the SNPs and MLVA genotyping. In SNPs typing, the originally French 17JB strain represented the A.Br. 008/009 subgroup. In Levy's genotyping method, 843, 451 and 864 bp long fragments were identified at AA03, AJ03 and AA07 loci, respectively. In the vaccine manufacturer perspective these findings are much valuable on their own account, but similar research is required to extend molecular knowledge of B. anthracis epidemiology in Persia.
Pharmacology of JB-9315, a new selective histamine H2-receptor antagonist.
Palacios, B; Montero, M J; Sevilla, M A; San Román, L
1998-02-01
1. The histamine H2-receptor antagonistic activity and antisecretory and antiulcer effects of JB-9315 were studied in comparison with the standard H2 blocker ranitidine. 2. In vitro, JB-9315 is a competitive antagonist of histamine H2 receptors in the isolated, spontaneously beating guinea-pig right atrium, with a pA2 value of 7.30 relative to a value of 7.36 for ranitidine. JB-9315 was specific for the histamine H2 receptor because, at high concentration, it did not affect histamine- or acetylcholine-induced contractions in guinea-pig isolated ileum or rat isolated duodenum, respectively. 3. JB-9315 dose dependently inhibited histamine-, pentagastrin- or carbachol-stimulated acid secretion and basal secretion in the perfused stomach preparation of the anesthetized rat. In the pylorus-ligated rat after intraperitoneal administration, total acid output over 4 h was inhibited by JB-9315 with an ID50 of 32.8 mg/kg, confirming its H2-receptor antagonist properties. 4. JB-9315 showed antiulcer activity against cold stress plus indomethacin-induced lesions with an ID50 of 6.8 mg/kg. 5. JB-9315, 50 and 100 mg/kg, inhibited macroscopic gastric hemorrhagic lesions induced by ethanol. In contrast, ranitidine (50 mg/kg) failed to reduce these lesions. 6. These results indicate that JB-9315 is a new antiulcer drug that exerts a cytoprotective effect in addition to its gastric antisecretory activity.
JB-300: An advanced medium size transport for 2005
Debrouwer, Giles; Graham, Katherine; Ison, Jim; Juarez, Vince; Moskalik, Steve; Pankonin, Jon; Weinstein, Arnold
1993-01-01
In the fall of 1992, the TAC Team was presented with a Request for Proposal (PFP) for a mid-size (250-350 passenger) commercial transport. The aircraft was to be extremely competitive in the areas of passenger comfort, performance, and economic aspects. Through the use of supercritical airfoils, a technologically advanced Very High By-pass Ratio (VHBR) turbofan engine, a low overall drag configuration, a comparable interior layout, and mild use of composites, the JB-300 offers an economically viable choice to the airlines. The cents per passenger mile of the JB-300 is 1.76, which is considerably lower than current aircraft in the same range. Overall, the JB-300 is a technologically advanced aircraft, which will meet the demands of the 21st century.
Isolation of perchlorate-reducing Azospira suillum strain JB524 from tidal flats of the Yellow Sea
Directory of Open Access Journals (Sweden)
Nirmala Bardiya
2016-11-01
Full Text Available Objective: To isolate and identify perchlorate-reducing bacterium from an enriched consortium from tidal flats of the Yellow Sea. Methods: A perchlorate-enriched consortium from tidal flats of the Yellow Sea was used to isolate Azospira suillum (A. suillum strain JB524. The strain was identified based on partial 16S rDNA sequencing. Perchlorate reduction by the strain was tested with acetate as the e - donor in the presence of NaCl, nitrate and at different growth temperatures using standard anaerobic techniques. The complete enzymatic destruction of perchlorate was confirmed as evolution of O2 by chlorite dismutase in the absence of acetate. Results: Strain JB524 shared 100% 16S rDNA sequence similarity with the type strain A. suillum PST isolated from a swine waste treatment lagoon. Perchlorate reduction coincided with concomitant increase in cell density. Although, acclimatization of the strain PST at suboptimal temperature for perchlorate reduction is not reported, the newly isolated strain could rapidly reduce perchlorate at 22 °C after brief acclimatization. Conclusions: Reduction of perchlorate by A. suillum strain JB524 was negatively affected in the presence of NaCl, suboptimal temperature, presence of nitrate, and limiting amount of acetate as the e-donor.
Palacios, B; Montero, M J; Sevilla, M A; Román, L S
1995-05-01
1. JB-9322 is a selective histamine H2-receptor antagonist with gastric antisecretory activity and mucosal protective properties. 2. The affinity of JB-9322 for the guinea-pig atria histamine H2-receptor was approximately 2 times greater than that of ranitidine. 3. In vivo, the ID50 value for the inhibition of gastric acid secretion in pylorus-ligated rats was 5.28 mg kg-1 intraperitoneally. JB-9322 also dose-dependently inhibited gastric juice volume and pepsin secretion. In gastric lumen-perfused rats, intravenous injection of JB-9322 dose-dependently reduced histamine-, pentagastrin- and carbachol-stimulated gastric acid secretion. 4. JB-9322 showed antiulcer activity against aspirin and indomethacin-induced gastric lesions and was more potent than ranitidine. 5. JB-9322 effectively inhibited macroscopic gastric haemorrhagic lesions induced by ethanol. Intraperitoneal injection was effective in preventing the lesions as well as oral treatment. The oral ID50 value for these lesions was 1.33 mg kg-1. By contrast, ranitidine (50 mg kg-1) failed to reduce these lesions. In addition, the protective effect of JB-9322 was independent of prostaglandin synthesis. 6. These results indicate that JB-9322 is a new antiulcer drug that exerts a potent cytoprotective effect in addition to its gastric antisecretory activity.
Ji, Xiangyu; Xu, Jing; Ning, Shuxiang; Li, Nan; Tan, Liang; Shi, Shengnan
2017-12-01
Comamonas sp. JB was used to investigate the cometabolic degradation of dibenzofuran (DBF) and dibenzothiophene (DBT) with naphthalene as the primary substrate. Dehydrogenase and ATPase activity of the growing system with the presence of DBF and DBT were decreased when compared to only naphthalene in the growing system, indicating that the presence of DBF and DBT inhibited the metabolic activity of strain JB. The pathways and enzymes involved in the cometabolic degradation were tested. Examination of metabolites elucidated that strain JB cometabolically degraded DBF to 1,2-dihydroxydibenzofuran, subsequently to 2-hydroxy-4-(3'-oxo-3'H-benzofuran-2'-yliden)but-2-enoic acid, and finally to catechol. Meanwhile, strain JB cometabolically degraded DBT to 1,2-dihydroxydibenzothiophene and subsequently to the ring cleavage product. A series of naphthalene-degrading enzymes including naphthalene dioxygenase, 1,2-dihydroxynaphthalene dioxygenase, salicylaldehyde dehydrogenase, salicylate hydroxylase, and catechol 2,3-oxygenase have been detected, confirming that naphthalene was the real inducer of expression the degradation enzymes and metabolic pathways were controlled by naphthalene-degrading enzymes.
Perez-Burgos, Azucena; Wang, Bingxian; Mao, Yu-Kang; Mistry, Bhavik; McVey Neufeld, Karen-Anne; Bienenstock, John; Kunze, Wolfgang
2013-01-15
Mounting evidence supports the influence of the gut microbiome on the local enteric nervous system and its effects on brain chemistry and relevant behavior. Vagal afferents are involved in some of these effects. We previously showed that ingestion of the probiotic bacterium Lactobacillus rhamnosus (JB-1) caused extensive neurochemical changes in the brain and behavior that were abrogated by prior vagotomy. Because information can be transmitted to the brain via primary afferents encoded as neuronal spike trains, our goal was to record those induced by JB-1 in vagal afferents in the mesenteric nerve bundle and thus determine the nature of the signals sent to the brain. Male Swiss Webster mice jejunal segments were cannulated ex vivo, and serosal and luminal compartments were perfused separately. Bacteria were added intraluminally. We found no evidence for translocation of labeled bacteria across the epithelium during the experiment. We recorded extracellular multi- and single-unit neuronal activity with glass suction pipettes. Within minutes of application, JB-1 increased the constitutive single- and multiunit firing rate of the mesenteric nerve bundle, but Lactobacillus salivarius (a negative control) or media alone were ineffective. JB-1 significantly augmented multiunit discharge responses to an intraluminal distension pressure of 31 hPa. Prior subdiaphragmatic vagotomy abolished all of the JB-1-evoked effects. This detailed exploration of the neuronal spike firing that encodes behavioral signaling to the brain may be useful to identify effective psychoactive bacteria and thereby offer an alternative new perspective in the field of psychiatry and comorbid conditions.
Lactobacillus rhamnosus strain JB-1 reverses restraint stress-induced gut dysmotility.
West, C; Wu, R Y; Wong, A; Stanisz, A M; Yan, R; Min, K K; Pasyk, M; McVey Neufeld, K-A; Karamat, M I; Foster, J A; Bienenstock, J; Forsythe, P; Kunze, W A
2017-01-01
Environmental stress affects the gut with dysmotility being a common consequence. Although a variety of microbes or molecules may prevent the dysmotility, none reverse the dysmotility. We have used a 1 hour restraint stress mouse model to test for treatment effects of the neuroactive microbe, L. rhamnosus JB-1 ™ . Motility of fluid-filled ex vivo gut segments in a perfusion organ bath was recorded by video and migrating motor complexes measured using spatiotemporal maps of diameter changes. Stress reduced jejunal and increased colonic propagating contractile cluster velocities and frequencies, while increasing contraction amplitudes for both. Luminal application of 10E8 cfu/mL JB-1 restored motor complex variables to unstressed levels within minutes of application. L. salivarius or Na.acetate had no treatment effects, while Na.butyrate partially reversed stress effects on colonic frequency and amplitude. Na.propionate reversed the stress effects for jejunum and colon except on jejunal amplitude. Our findings demonstrate, for the first time, a potential for certain beneficial microbes as treatment of stress-induced intestinal dysmotility and that the mechanism for restoration of function occurs within the intestine via a rapid drug-like action on the enteric nervous system. © 2016 John Wiley & Sons Ltd.
Jin, Zhong Min; Sha, Wei; Zhang, Yan Fu; Zhao, Jing; Ji, Hongyang
2013-07-01
Phytoremediation combined with suitable microorganisms and biodegradable chelating agents can be a means of reclaiming lands contaminated by toxic heavy metals. We investigated the ability of a lead- and cadmium-resistant bacterial strain (JB12) and the biodegradable chelator ethylenediamine-N,N'-disuccinic acid (EDDS) to improve absorption of these metals from soil by tall fescue and red clover. Strain JB12 was isolated from contaminated soil samples, analysed for lead and cadmium resistance, and identified as Burkholderia cepacia. Tall fescue and red clover were grown in pots to which we added JB12, (S,S)-EDDS, combined JB12 and EDDS, or water only. Compared with untreated plants, the biomass of plants treated with JB12 was significantly increased. Concentrations of lead and cadmium in JB12-treated plants increased significantly, with few exceptions. Plants treated with EDDS responded variably, but in those treated with combined EDDS and JB12, heavy metal concentrations increased significantly in tall fescue and in the aboveground parts of red clover. We conclude that JB12 is resistant to lead and cadmium. Its application to the soil improved the net uptake of these heavy metals by experimental plants. The potential for viable phytoremediation of lead- and cadmium-polluted soils with tall fescue and red clover combined with JB12 was further enhanced by the addition of EDDS.
Ohtsuka, Hiromichi; Kitagawa, Madoka; Kohiruimaki, Masayuki; Tanami, Erika; Masui, Machiko; Hayashi, Tomohito; Ando, Takaaki; Watanabe, Daisaku; Koiwa, Masateru; Sato, Shigeru; Kawamura, Seiichi
2006-11-01
To compare the changes in the insulin reaction of Holstein dairy cows and Japanese Black cows (JB) during the periparturient period, the insulin resistance test in vivo and lymphocytes proliferation with insulin in vitro were performed. Ten healthy Holstein dairy cows (Holstein group) and 10 healthy JB cows (JB group) used in this study were observed on days 60, 40, and 20 before calving and days 7 and 20 after calving. In insulin resistance reaction in vivo and in vitro, a low insulin-stimulated glucose disposal rate and lymphocyte proliferation with insulin were observed in the Holstein group compared with the JB group during the experimental period. An analysis of the lymphocytes cultured with insulin showed that the percentage of CD4+CD45R- T cells in the Holstein group was significantly lower than that of the JB group before day 20. These findings indicate that T cells reaction to insulin in healthy periparturient Holstein cows is lower than that in Japanese Black.
Directory of Open Access Journals (Sweden)
Saikali Melody
2012-07-01
Full Text Available Abstract Background Sesquiterpene lactones (SL are plant secondary metabolites that are known for their anti-fungal, anti-bacterial, anti-inflammatory, and anti-tumor properties. Considering that several SL-derived drugs are currently in cancer clinical trials, we have tested two SL molecules, 3-β-methoxy-iso-seco-tanapartholide (β-tan isolated from Achillea falcata and salograviolide A (Sal A isolated from Centaurea ainetensis, for their anti-tumor properties. We used the mouse epidermal JB6P + cells as a model for tumor promotion and cellular transformation. Key players that are involved in cellular transformation and tumorigenesis are the AP-1 and NF-κB transcription factors; therefore, we assessed how β-tan and Sal A modulate their signaling pathways in JB6P + cells. Methods The effects of β-tan and Sal A on the growth of normal and neoplastic keratinocytes and on the tumor promotion-responsive JB6P + cells were determined using the MTT assay. Anchorage-independent cell growth transformation assays were used to evaluate the anti-tumor promoting properties of these SL molecules in JB6P + cells and dual luciferase reporter assays and western blot analysis were used to investigate their effects on tumor promoter-induced AP-1 and NF-κB activities and protein levels of key AP-1 and NF-кB target genes. Results β-tan and Sal A selectively inhibited tumor promoter-induced cell growth and transformation of JB6P + cells at concentrations that do not affect JB6P + and primary keratinocytes basal cell growth. In addition, both molecules reduced basal and tumor promoter-induced NF-κB transcriptional activities, differentially regulated basal and tumor promoter-induced AP-1 transcriptional activities, and modulated key players of the AP-1 and NF-κB signaling pathways. Conclusions These results highlight the anti-tumor promoting properties of β-tan and Sal A. These SL molecules isolated from two plant species native to
Saikali, Melody; Ghantous, Akram; Halawi, Racha; Talhouk, Salma N; Saliba, Najat A; Darwiche, Nadine
2012-07-09
Sesquiterpene lactones (SL) are plant secondary metabolites that are known for their anti-fungal, anti-bacterial, anti-inflammatory, and anti-tumor properties. Considering that several SL-derived drugs are currently in cancer clinical trials, we have tested two SL molecules, 3-β-methoxy-iso-seco-tanapartholide (β-tan) isolated from Achillea falcata and salograviolide A (Sal A) isolated from Centaurea ainetensis, for their anti-tumor properties. We used the mouse epidermal JB6P + cells as a model for tumor promotion and cellular transformation. Key players that are involved in cellular transformation and tumorigenesis are the AP-1 and NF-κB transcription factors; therefore, we assessed how β-tan and Sal A modulate their signaling pathways in JB6P + cells. The effects of β-tan and Sal A on the growth of normal and neoplastic keratinocytes and on the tumor promotion-responsive JB6P + cells were determined using the MTT assay. Anchorage-independent cell growth transformation assays were used to evaluate the anti-tumor promoting properties of these SL molecules in JB6P + cells and dual luciferase reporter assays and western blot analysis were used to investigate their effects on tumor promoter-induced AP-1 and NF-κB activities and protein levels of key AP-1 and NF-кB target genes. β-tan and Sal A selectively inhibited tumor promoter-induced cell growth and transformation of JB6P + cells at concentrations that do not affect JB6P + and primary keratinocytes basal cell growth. In addition, both molecules reduced basal and tumor promoter-induced NF-κB transcriptional activities, differentially regulated basal and tumor promoter-induced AP-1 transcriptional activities, and modulated key players of the AP-1 and NF-κB signaling pathways. These results highlight the anti-tumor promoting properties of β-tan and Sal A. These SL molecules isolated from two plant species native to the Middle East may provide opportunities for complementary
Loss of retrovirus production in JB/RH melanoma cells transfected with H-2Kb and TAP-1 genes.
Li, M; Xu, F; Muller, J; Huang, X; Hearing, V J; Gorelik, E
1999-01-20
JB/RH1 melanoma cells, as well as other melanomas of C57BL/6 mice (B16 and JB/MS), express a common melanoma-associated antigen (MAA) encoded by an ecotropic melanoma-associated retrovirus (MelARV). JB/RH1 cells do not express the H-2Kb molecules due to down-regulation of the H-2Kb and TAP-1 genes. When JB/RH1 cells were transfected with the H-2Kb and cotransfected with the TAP-1 gene, it resulted in the appearance of H-2Kb molecules and an increase in their immunogenicity, albeit they lost expression of retrovirus-encoded MAA recognized by MM2-9B6 mAb. Loss of MAA was found to result from a complete and stable elimination of ecotropic MelARV production in the H-2Kb/TAP-1-transfected JB/RH1 cells. Northern blot analysis showed no differences in ecotropic retroviral messages in MelARV-producing and -nonproducing melanoma cells, suggesting that loss of MelARV production was not due to down-regulation of MelARV transcription. Southern blot analysis revealed several rearrangements in the proviral DNA of H-2Kb-positive JB/RH1 melanoma cells. Sequence analysis of the ecotropic proviral DNA from these cells showed numerous nucleotide substitutions, some of which resulted in the appearance of a novel intraviral PstI restriction site and the loss of a HindIII restriction site in the pol region. PCR amplification of the proviral DNAs indicates that an ecotropic provirus found in the H-2Kb-positive cells is novel and does not preexist in the parental H-2Kb-negative melanoma cells. Conversely, the ecotropic provirus of the parental JB/RH1 cells was not amplifable from the H-2Kb-positive cells. Our data indicate that stable loss of retroviral production in the H-2Kb/TAP-1-transfected melanoma cells is probably due to the induction of recombination between a productive ecotropic MelARV and a defective nonecotropic provirus leading to the generation of a defective ecotropic provirus and the loss of MelARV production and expression of the retrovirus-encoded MAA. Copyright 1999
Embedding, serial sectioning and staining of zebrafish embryos using JB-4 resin.
Sullivan-Brown, Jessica; Bisher, Margaret E; Burdine, Rebecca D
2011-01-01
Histological techniques are critical for observing tissue and cellular morphology. In this paper, we outline our protocol for embedding, serial sectioning, staining and visualizing zebrafish embryos embedded in JB-4 plastic resin-a glycol methacrylate-based medium that results in excellent preservation of tissue morphology. In addition, we describe our procedures for staining plastic sections with toluidine blue or hematoxylin and eosin, and show how to couple these stains with whole-mount RNA in situ hybridization. We also describe how to maintain and visualize immunofluorescence and EGFP signals in JB-4 resin. The protocol we outline-from embryo preparation, embedding, sectioning and staining to visualization-can be accomplished in 3 d. Overall, we reinforce that plastic embedding can provide higher resolution of cellular details and is a valuable tool for cellular and morphological studies in zebrafish.
A novel chimeric prophage vB_LdeS-phiJB from commercial Lactobacillus delbrueckii subsp. bulgaricus.
Guo, Tingting; Zhang, Chenchen; Xin, Yongping; Xin, Min; Kong, Jian
2016-05-01
Prophage vB_LdeS-phiJB (phiJB) was induced by mitomycin C and UV radiation from the Lactobacillus delbrueckii subsp. bulgaricus SDMCC050201 isolated from a Chinese yoghurt sample. It has an isometric head and a non-contractile tail with 36,969 bp linear double-stranded DNA genome, which is classified into the group a of Lb. delbrueckii phages. The genome of phiJB is highly modular with functionally related genes clustered together. Unexpectedly, there is no similarity of its DNA replication module to any phages that have been reported, while it consists of open-reading frames homologous to the proteins of Lactobacillus strains. Comparative genomic analysis indicated that its late gene clusters, integration/lysogeny modules and DNA replication module derived from different evolutionary ancestors and integrated into a chimera. Our results revealed a novel chimeric phage of commercial Lb. delbrueckii and will broaden the knowledge of phage diversity in the dairy industry.
Directory of Open Access Journals (Sweden)
Patrycja Konieczna
Full Text Available The microbiota is required for optimal host development and ongoing immune homeostasis. Lactobacilli are common inhabitants of the mammalian large intestine and immunoregulatory effects have been described for certain, but not all, strains. The mechanisms underpinning these protective effects are beginning to be elucidated. One such protective organism is Lactobacillus rhamnosus JB-1 (Lb. rhamnosus JB-1. Lb. murinus has no such anti-inflammatory protective effects and was used as a comparator organism. Human monocyte-derived dendritic cells (MDDCs were co-incubated with bacteria and analysed over time for bacterial adhesion and intracellular processing, costimulatory molecule expression, cytokine secretion and induction of lymphocyte polarization. Neutralising antibodies were utilized to identify the responsible MDDC receptors. Lb. rhamnosus JB-1 adhered to MDDCs, but internalization and intracellular processing was significantly delayed, compared to Lb. murinus which was rapidly internalized and processed. Lb. murinus induced CD80 and CD86 expression, accompanied by high levels of cytokine secretion, while Lb. rhamnosus JB-1 was a poor inducer of costimulatory molecule expression and cytokine secretion. Lb. rhamnosus JB-1 primed MDDCs induced Foxp3 expression in autologous lymphocytes, while Lb. murinus primed MDDCs induced Foxp3, T-bet and Ror-γt expression. DC-SIGN was required for Lb. rhamnosus JB-1 adhesion and influenced IL-12 secretion, while TLR-2 influenced IL-10 and IL-12 secretion. Here we demonstrate that the delayed kinetics of bacterial processing by MDDCs correlates with MDDC activation and stimulation of lymphocytes. Thus, inhibition or delay of intracellular processing may be a novel strategy by which certain commensals may avoid the induction of proinflammatory responses.
Konieczna, Patrycja; Schiavi, Elisa; Ziegler, Mario; Groeger, David; Healy, Selena; Grant, Ray; O’Mahony, Liam
2015-01-01
The microbiota is required for optimal host development and ongoing immune homeostasis. Lactobacilli are common inhabitants of the mammalian large intestine and immunoregulatory effects have been described for certain, but not all, strains. The mechanisms underpinning these protective effects are beginning to be elucidated. One such protective organism is Lactobacillus rhamnosus JB-1 (Lb. rhamnosus JB-1). Lb. murinus has no such anti-inflammatory protective effects and was used as a comparator organism. Human monocyte-derived dendritic cells (MDDCs) were co-incubated with bacteria and analysed over time for bacterial adhesion and intracellular processing, costimulatory molecule expression, cytokine secretion and induction of lymphocyte polarization. Neutralising antibodies were utilized to identify the responsible MDDC receptors. Lb. rhamnosus JB-1 adhered to MDDCs, but internalization and intracellular processing was significantly delayed, compared to Lb. murinus which was rapidly internalized and processed. Lb. murinus induced CD80 and CD86 expression, accompanied by high levels of cytokine secretion, while Lb. rhamnosus JB-1 was a poor inducer of costimulatory molecule expression and cytokine secretion. Lb. rhamnosus JB-1 primed MDDCs induced Foxp3 expression in autologous lymphocytes, while Lb. murinus primed MDDCs induced Foxp3, T-bet and Ror-γt expression. DC-SIGN was required for Lb. rhamnosus JB-1 adhesion and influenced IL-12 secretion, while TLR-2 influenced IL-10 and IL-12 secretion. Here we demonstrate that the delayed kinetics of bacterial processing by MDDCs correlates with MDDC activation and stimulation of lymphocytes. Thus, inhibition or delay of intracellular processing may be a novel strategy by which certain commensals may avoid the induction of proinflammatory responses. PMID:25816321
Konieczna, Patrycja; Schiavi, Elisa; Ziegler, Mario; Groeger, David; Healy, Selena; Grant, Ray; O'Mahony, Liam
2015-01-01
The microbiota is required for optimal host development and ongoing immune homeostasis. Lactobacilli are common inhabitants of the mammalian large intestine and immunoregulatory effects have been described for certain, but not all, strains. The mechanisms underpinning these protective effects are beginning to be elucidated. One such protective organism is Lactobacillus rhamnosus JB-1 (Lb. rhamnosus JB-1). Lb. murinus has no such anti-inflammatory protective effects and was used as a comparator organism. Human monocyte-derived dendritic cells (MDDCs) were co-incubated with bacteria and analysed over time for bacterial adhesion and intracellular processing, costimulatory molecule expression, cytokine secretion and induction of lymphocyte polarization. Neutralising antibodies were utilized to identify the responsible MDDC receptors. Lb. rhamnosus JB-1 adhered to MDDCs, but internalization and intracellular processing was significantly delayed, compared to Lb. murinus which was rapidly internalized and processed. Lb. murinus induced CD80 and CD86 expression, accompanied by high levels of cytokine secretion, while Lb. rhamnosus JB-1 was a poor inducer of costimulatory molecule expression and cytokine secretion. Lb. rhamnosus JB-1 primed MDDCs induced Foxp3 expression in autologous lymphocytes, while Lb. murinus primed MDDCs induced Foxp3, T-bet and Ror-γt expression. DC-SIGN was required for Lb. rhamnosus JB-1 adhesion and influenced IL-12 secretion, while TLR-2 influenced IL-10 and IL-12 secretion. Here we demonstrate that the delayed kinetics of bacterial processing by MDDCs correlates with MDDC activation and stimulation of lymphocytes. Thus, inhibition or delay of intracellular processing may be a novel strategy by which certain commensals may avoid the induction of proinflammatory responses.
Reactive flow modeling of initial density effect on divergence JB-9014 detonation driving
Yu, Xin; Huang, Kuibang; Zheng, Miao
2016-06-01
A serious of experiments were designed and the results were represented in this paper, in which 2mm thickness cooper shells were impacted by explosives named JB-9014 with different densities, and the surface velocities of the OFHC shells were measured. The comparison of experimental data shows the free surface velocity of the OFHC shell increase with the IHE density. Numerical modeling, which occupied phenomenological reactive flow rate model using the two-dimensional Lagrange hydrodynamic code, were carried out to simulate the above experiments, and empirical adjustments on detonation velocity and pressure and Pier Tang's adjustments on EOS of detonation products were both introduced in our numerical simulation work. The computational results agree well with that of experiments, and the numerical results with original parameters of products and the adjusted ones of JB-9014 could describe the density effect distinctly.
Kim, Su Young; Jin, Mi Ra; Chung, Chang Ho; Yun, Yeoung-Sang; Jahng, Kwang Yeop; Yu, Kang-Yeol
2015-04-01
Biosorption of heavy metals and dyes is a promising technology that involves the removal of toxic metals from industrial wastes. The present study aims to screen the bacterial strains isolated from soils and polluted pond for their potential biosorption of both cationic dye and cadmium. Bacillus catenulatus JB-022 strain removed 58% and 66% of cationic basic blue 3 (BB3) and cadmium (Cd(II)) at the respective concentrations of 2000 mg/L and 150 mg/L. The biosorption equilibrium data were well fitted by the Langmuir adsorption isotherm, and the kinetic studies indicated that the biosorption followed the pseudo-second-order model. The biosorption kinetics showed that the equilibrium was reached within 10 min and 5 min for BB3 and Cd(II), respectively. According to the Langmuir model, the maximum uptakes of BB3 and Cd(II) by the JB-022 biomass were estimated to be 139.74 and 64.28 mg/g, respectively. To confirm the surface morphology and functional groups, field emission scanning electron microscope, energy-dispersive X-ray spectrometer, X-ray diffraction, and Fourier transform infrared spectroscopy analyses were carried out, and the results revealed that the biomass of JB-022 has carboxyl and phosphonate groups as potential surface functional groups capable of binding to cationic pollutants. In conclusion, B. catenulatus JB-022 is proposed as an excellent biosorbent with potentially important applications in removal of cationic pollutants from wastewaters. Copyright © 2014 The Society for Biotechnology, Japan. Published by Elsevier B.V. All rights reserved.
Jiang, Bei; Zhou, Zunchun; Dong, Ying; Tao, Wei; Wang, Bai; Jiang, Jingwei; Guan, Xiaoyan
2015-07-01
A bacterium designated strain JB, able to degrade six benzene, toluene, ethylbenzene, and o-, m-, and p-xylene (BTEX) compounds, was isolated from petroleum-contaminated soil. Taxonomic analyses showed that the isolate belonged to Comamonas, and until now, the genus Comamonas has not included any known BTEX degraders. The BTEX biodegradation rate was slightly low on the mineral salt medium (MSM), but adding a small amount of yeast extract greatly enhanced the biodegradation. The relationship between specific degradation rate and individual BTEX was described well by Michaelis-Menten kinetics. The treatment of petrochemical wastewater containing BTEX mixture and phenol was shown to be highly efficient by BTEX-grown JB. In addition, toxicity assessment indicated the treatment of the petrochemical wastewater by BTEX-grown JB led to less toxicity than untreated wastewater.
Draft genome sequences of Streptococcus bovis strains ATCC 33317 and JB1
We report the draft genome sequences of Streptococcus bovis type strain ATTC 33317 (CVM42251) isolated from cow dung and strain JB1 (CVM42252) isolated from a cow rumen in 1977. Strains were subjected to Next Generation sequencing and the genome sizes are approximately 2 MB and 2.2 MB, respectively....
Copper and dyes enhance laccase production in gamma-proteobacterium JB.
Malhotra, Kanam; Sharma, Prince; Capalash, Neena
2004-07-01
Laccase production in gamma-proteobacterium JB was enhanced 13-fold by adding 0.1 mM CuSO(4) 24 h after the onset of growth. Ethidium bromide (2.5 microM), Malachite Green, Phenol Red and Thymol Blue (10 microM each) enhanced laccase production 17-, 19-, 4- and 2-fold, respectively. Among the fourteen aromatic/organic compounds tried, p-aminobenzoic acid and an industrial effluent, from where the organism was isolated, showed 1.2- and 1.26-fold increases in production.
Xenobiotics enhance laccase activity in alkali-tolerant γ-proteobacterium JB.
Singh, Gursharan; Batish, Mona; Sharma, Prince; Capalash, Neena
2009-01-01
Various genotoxic textile dyes, xenobiotics, substrates (10 µM) and agrochemicals (100 µg/ml) were tested for enhancement of alkalophilic laccase activity in γ-proteobacterium JB. Neutral Red, Indigo Carmine, Naphthol Base Bordears and Sulphast Ruby dyes increased the activity by 3.7, 2.7, 2.6 and 2.3 fold respectively. Xenobiotics/substrates like p-toluidine, 8-hydroxyquinoline and anthracine increased it by 3.4, 2.8 and 2.3 fold respectively. Atrazine and trycyclozole pesticides enhanced the activity by 1.95 and 1.5 fold respectively.
Jiang, Bei; Zhou, Zunchun; Dong, Ying; Wang, Bai; Jiang, Jingwei; Guan, Xiaoyan; Gao, Shan; Yang, Aifu; Chen, Zhong; Sun, Hongjuan
2015-05-01
In this study, we investigated the bioremediation of petrochemical wastewater containing BTEX compounds by immobilized Comamonas sp. JB cells. Three kinds of magnetic nanoparticles were evaluated as immobilization supports for strain JB. After comparison with Fe3O4 and a-Fe2O3 nanoparticles, r-Fe2O3 nanoparticle was selected as the optimal immobilization support. The highest biodegradation activity of r-Fe2O3-magnetically immobilized cells was obtained when the concentration of r-Fe2O3 nanoparticle was 120 mg L(-1). Additionally, the recycling experiments demonstrated that the degradation activity of r-Fe2O3-magnetically immobilized cells was still high and led to less toxicity than untreated wastewater during the eight recycles. qPCR suggested the concentration of strain JB in r-Fe2O3-magnetically immobilized cells was evidently increased after eight cycles of degradation experiments. These results supported developing efficient biocatalysts using r-Fe2O3-magnetically immobilized cells and provided a promising technique for improving biocatalysts used in the bioremediation of not only petrochemical wastewater but also other hazardous wastewater.
Paavst Johannes Paulus II läkitus kunstirahvale / Hendrik Lindepuu
Lindepuu, Hendrik
1999-01-01
Johannes Paulus II 1999. a. 4. aprilli kirjast 'Nendele, kes kirglikult ja pühendunult otsivad ilu uusi 'ilmutusi', et kinkida need maailmale kunstilise loomena'. Kunstnik kui sõnumi kuulutaja. Kas kirik vajab kunsti ja kunst kirikut.Czeslaw Milosz, Wojciech Kilar, Stefan Chwin paavsti kirjast
Han, Sang-Min; Lee, Jong-Soo
2017-09-01
This study was done to produce γ-aminobutyric acid (GABA) from wild yeast as well as investigate its anti-hyperglycemic effects. Among ten GABA-producing yeast strains, Pichia silvicola UL6-1 and Sporobolomyces carnicolor 402-JB-1 produced high GABA concentration of 134.4 µg/mL and 179.2 µg/mL, respectively. P. silvicola UL6-1 showed a maximum GABA yield of 136.5 µg/mL and 200.8 µg/mL from S. carnicolor 402-JB-1 when they were cultured for 30 hr at 30℃ in yeast extract-peptone-dextrose medium. The cell-free extract from P. silvicola UL6-1 and S. carnicolor 402-JB-1 showed very high anti-hyperglycemic α-glucosidase inhibitory activity of 72.3% and 69.9%, respectively. Additionally, their cell-free extract-containing GABA showed the anti-hyperglycemic effect in streptozotocin-induced diabetic Sprague-Dawley rats.
McVey Neufeld, Karen-Anne; Kay, Sebastian; Bienenstock, John
2018-01-01
Currently, there is keen interest in the development of alternative therapies in the treatment of depression. Given the explosion of research focused on the microbiota-gut-brain axis, consideration has turned to the potential of certain probiotics to improve patient outcomes for those suffering from mood disorders. Here we examine the abilities of a known antidepressant, fluoxetine, and the probiotic Lactobacillus rhamnosus JB-1™, to attenuate responses to two established criteria for depressive-like behavior in animal models, the tail suspension test (TST) and the corticosterone response to an acute restraint stressor. We examine two different strains of mice known to differ in the extent to which they express both anxiety-like behavior and measures of despair-BALB/c and Swiss Webster-with respectively high and normal behavioral phenotypes for each. While adult male BALB/c mice responded with increased antidepressive-like behavior to both fluoxetine and L. rhamnosus JB-1 in both the TST and the corticosterone stress response, SW mice did not respond to either treatment as compared to controls. These findings highlight the importance of investigating putative antidepressants in mouse strains known to express face validity for some markers of depression. Clinical studies examining the activity of L. rhamnosus JB-1 in patients suffering from mood disorders are warranted, as well as further pre-clinical work examining how interactions between host genotype and intestinal microbial alterations may impact behavioral responses. This study adds to the literature supporting the possibility that modifying the intestinal microbiota via probiotics represents a promising potential therapeutic breakthrough in the treatment of psychiatric disease.
International Nuclear Information System (INIS)
Zhang Dongyun; Li Jingxia; Gao Jimin; Huang Chuanshu
2009-01-01
Arsenic is a well-documented human carcinogen associated with skin carcinogenesis. Our previous work reveals that arsenite exposure is able to induce cell transformation in mouse epidermal cell JB6 Cl41 through the activation of ERK, rather than JNK pathway. Our current studies further evaluate downstream pathway in low dose arsenite-induced cell transformation in JB6 Cl41 cells. Our results showed that treatment of cells with low dose arsenite induced activation of c-Jun/AP-1 pathway, and ectopic expression of dominant negative mutant of c-Jun (TAM67) blocked arsenite-induced transformation. Furthermore, our data indicated that cyclin D1 was an important downstream molecule involved in c-Jun/AP-1-mediated cell transformation upon low dose arsenite exposure, because inhibition of cyclin D1 expression by its specific siRNA in the JB6 Cl41 cells resulted in impairment of anchorage-independent growth of cells induced by low dose arsenite. Collectively, our results demonstrate that c-Jun/AP-1-mediated cyclin D1 expression is at least one of the key events implicated in cell transformation upon low dose arsenite exposure
Directory of Open Access Journals (Sweden)
Castranova Vincent
2009-04-01
Full Text Available Abstract Background Carcinogenicity of nickel compounds has been well documented. However, the carcinogenic effect of metallic nickel is still unclear. The present study investigates metallic nickel nano- and fine particle-induced apoptosis and the signal pathways involved in this process in JB6 cells. The data obtained from this study will be of benefit for elucidating the pathological and carcinogenic potential of metallic nickel particles. Results Using 3-(4,5-dimethylthiazol-2-yl-2,5-diphenyltetrazolium bromide (MTT assay, we found that metallic nickel nanoparticles exhibited higher cytotoxicity than fine particles. Both metallic nickel nano- and fine particles induced JB6 cell apoptosis. Metallic nickel nanoparticles produced higher apoptotic induction than fine particles. Western-blot analysis showed an activation of proapoptotic factors including Fas (CD95, Fas-associated protein with death domain (FADD, caspase-8, death receptor 3 (DR3 and BID in apoptotic cells induced by metallic nickel particles. Immunoprecipitation (IP western blot analysis demonstrated the formation of the Fas-related death-inducing signaling complex (DISC in the apoptotic process. Furthermore, lamin A and beta-actin were cleaved. Moreover, we found that apoptosis-inducing factor (AIF was up-regulated and released from mitochondria to cytoplasm. Interestingly, although an up-regulation of cytochrome c was detected in the mitochondria of metallic nickel particle-treated cells, no cytochrome c release from mitochondria to cytoplasm was found. In addition, activation of antiapoptotic factors including phospho-Akt (protein kinase B and Bcl-2 was detected. Further studies demonstrated that metallic nickel particles caused no significant changes in the mitochondrial membrane permeability after 24 h treatment. Conclusion In this study, metallic nickel nanoparticles caused higher cytotoxicity and apoptotic induction than fine particles in JB6 cells. Apoptotic cell death
Directory of Open Access Journals (Sweden)
Karen-Anne McVey Neufeld
2018-05-01
Full Text Available Currently, there is keen interest in the development of alternative therapies in the treatment of depression. Given the explosion of research focused on the microbiota-gut-brain axis, consideration has turned to the potential of certain probiotics to improve patient outcomes for those suffering from mood disorders. Here we examine the abilities of a known antidepressant, fluoxetine, and the probiotic Lactobacillus rhamnosus JB-1™, to attenuate responses to two established criteria for depressive-like behavior in animal models, the tail suspension test (TST and the corticosterone response to an acute restraint stressor. We examine two different strains of mice known to differ in the extent to which they express both anxiety-like behavior and measures of despair—BALB/c and Swiss Webster—with respectively high and normal behavioral phenotypes for each. While adult male BALB/c mice responded with increased antidepressive-like behavior to both fluoxetine and L. rhamnosus JB-1 in both the TST and the corticosterone stress response, SW mice did not respond to either treatment as compared to controls. These findings highlight the importance of investigating putative antidepressants in mouse strains known to express face validity for some markers of depression. Clinical studies examining the activity of L. rhamnosus JB-1 in patients suffering from mood disorders are warranted, as well as further pre-clinical work examining how interactions between host genotype and intestinal microbial alterations may impact behavioral responses. This study adds to the literature supporting the possibility that modifying the intestinal microbiota via probiotics represents a promising potential therapeutic breakthrough in the treatment of psychiatric disease.
SN 2008jb: A 'LOST' CORE-COLLAPSE SUPERNOVA IN A STAR-FORMING DWARF GALAXY AT ∼10 Mpc
International Nuclear Information System (INIS)
Prieto, J. L.; Lee, J. C.; Drake, A. J.; Djorgovski, S. G.; McNaught, R.; Garradd, G.; Beacom, J. F.; Beshore, E.; Catelan, M.; Pojmanski, G.; Stanek, K. Z.; Szczygieł, D. M.
2012-01-01
We present the discovery and follow-up observations of SN 2008jb, a core-collapse supernova in the southern dwarf irregular galaxy ESO 302–14 (M B = –15.3 mag) at 9.6 Mpc. This nearby transient was missed by galaxy-targeted surveys and was only found in archival optical images obtained by the Catalina Real-time Transient Survey and the All-Sky Automated Survey. The well-sampled archival photometry shows that SN 2008jb was detected shortly after explosion and reached a bright optical maximum, V max ≅ 13.6 mag (M V,max ≅ –16.5). The shape of the light curve shows a plateau of ∼100 days, followed by a drop of ∼1.4 mag in the V band to a slow decline with an approximate 56 Co decay slope. The late-time light curve is consistent with 0.04 ± 0.01 M ☉ of 56 Ni synthesized in the explosion. A spectrum of the supernova obtained two years after explosion shows a broad, boxy Hα emission line, which is unusual for normal Type II-Plateau supernovae at late times. We detect the supernova in archival Spitzer and WISE images obtained 8-14 months after explosion, which show clear signs of warm (600-700 K) dust emission. The dwarf irregular host galaxy, ESO 302–14, has a low gas-phase oxygen abundance, 12 + log(O/H) = 8.2 (∼1/5 Z ☉ ), similar to those of the Small Magellanic Cloud and the hosts of long gamma-ray bursts and luminous core-collapse supernovae. This metallicity is one of the lowest among local (∼ 5 M ☉ for the star formation complex, assuming a single-age starburst. These properties are consistent with the expanding Hα supershells observed in many well-studied nearby dwarf galaxies, which are tell-tale signs of feedback from the cumulative effect of massive star winds and supernovae. The age estimated for the star-forming region where SN 2008jb exploded suggests a relatively high-mass progenitor star with an initial mass M ∼ 20 M ☉ and warrants further study. We discuss the implications of these findings in the study of core
Energy Technology Data Exchange (ETDEWEB)
Weber, Thomas J.; Shankaran, Harish; Wiley, H. S.; Opresko, Lee K.; Chrisler, William B.; Quesenberry, Ryan D.
2010-05-02
basic fibroblast growth factor (bFGF or FGF2) plays an important role in epidermal wound healing in vivo and is associated with a persistent increased in the extracellular signal-regulated kinase (ERK) pathway in vitro. Here we have examined whether bFGF induces the closure of an experimental scratch wound in JB6 mouse epidermal cells and have explored the regulation of the ERK pathway by bFGF in the context of kinase oscillations. bFGF stimulation is associated with increases in cellular phospho-ERK and phospho-c-Jun levels. In addition, bFGF increases cell proliferation and a change in cell morphology (stellate appearance) in a dose-dependent fashion (0.1 – 100 ng/ml). bFGF treatment also promoted the closure of an experimental scratch wound in vitro. JB6 cells were stably transfected with an ERK1-GFP chimera to follow temporal ERK subcellular distribution patterns. We observe a persistent upregulation of the ERK pathway, as evidenced by a significant increase in nuclear ERK1-GFP levels at time points up to 24 hr after bFGF treatment. Interestingly, at the single cell level, ERK is observed to oscillate between nuclear and cytosolic compartments in response to bFGF treatment. Because this oscillatory behavior is asynchronous in the cell population, it is only clearly resolved at the single cell level. Collectively, data presented here are consistent with an important role for bFGF in wound healing and suggest a more complex regulation of the ERK pathway by bFGF than has previously been appreciated.
USA ja Iraak mängivad ÜROs kassi ja hiirt / Kadri Liik
Liik, Kadri, 1970-
2002-01-01
Arengutest USA-Iraagi konfliktis: ÜRO-sse saadetud Iraagi kirjast kutsuda relvastusinspektorid Iraaki tagasi; USA soovist võtta ÜRO-s vastu uus resolutsioon, mis lubaks relvastusinspektorid ka Saddam Husseini paleedesse, kaasaks sõjaväe, annaks õiguse Iraagi rünnata. Skeem: Iraaki puudutavad ÜRO resolutsioonid. Vt. samas kommenteerib Jüri Luik
Lang tahab Eestist peletada maailma transiidigigandi / Raimo Poom
Poom, Raimo
2009-01-01
Eesti suurima naftaterminali Vopak E.O.S-i Hollandi omaniku Royal Vopaki kirjast peaminister Andrus Ansipile ja neljale ministrile, milles märgitakse, et plaanitav Tallinna vangla asuks ohtlikke kaupu käitlevate rajatiste suhtes väga suure riskiga tsoonis ning kui vanglale teist asukohta ei leita, lubab firma siia tehtavad investeeringud üle vaadata
Shrinivas, Dengeti; Savitha, Gunashekaran; Raviranjan, Kumar; Naik, Gajanan Ramchandra
2010-11-01
A highly thermostable alkaline xylanase was purified to homogeneity from culture supernatant of Bacillus sp. JB 99 using DEAE-Sepharose and Sephadex G-100 gel filtration with 25.7-fold increase in activity and 43.5% recovery. The molecular weight of the purified xylanase was found to be 20 kDA by SDS-PAGE and zymogram analysis. The enzyme was optimally active at 70 °C, pH 8.0 and stable over pH range of 6.0-10.0.The relative activity at 9.0 and 10.0 were 90% and 85% of that of pH 8.0, respectively. The enzyme showed high thermal stability at 60 °C with 95% of its activity after 5 h. The K (m) and V (max) of enzyme for oat spelt xylan were 4.8 mg/ml and 218.6 µM min(-1) mg(-1), respectively. Analysis of N-terminal amino acid sequence revealed that the xylanase belongs to glycosyl hydrolase family 11 from thermoalkalophilic Bacillus sp. with basic pI. Substrate specificity showed a high activity on xylan-containing substrate and cellulase-free nature. The hydrolyzed product pattern of oat spelt xylan on thin-layer chromatography suggested xylanase as an endoxylanase. Due to these properties, xylanase from Bacillus sp. JB 99 was found to be highly compatible for paper and pulp industry.
Directory of Open Access Journals (Sweden)
Aline Diniz Cabral
2009-12-01
Full Text Available Neospora caninum, a cause of abortion and stillbirth in cattle, was studied by histology, immunohistochemistry, and nested-PCR, using primers from the Nc5 region of the genomic DNA (PCR PLUS and primers from the ITS1 region of the ribosomal DNA (PCR JB. A total of 105 fetal samples sent to the Centro de Pesquisa e Desenvolvimento de Sanidade Animal do Instituto Biológico from January 2006 to May 2008 were examined for evidence of N. caninum. Histological examination revealed 71.4% with non-suppurative inflammation in the heart, lung, liver, kidney, placenta, and brain. Immunohistochemistry detected infections in 8.6% of the samples, mainly in the brain, placenta, and heart. Nested-PCR JB revealed 6.7% with infections, while nested-PCR PLUS returned 20.9% positive results, mainly in brain and placenta, and in the pooled liver and heart. Kappa statistics demonstrated little agreement among the three techniques. The three methods are complementary, since they have distinct diagnostic characteristics and were combined to give a positivity rate of 24.8%.Pesquisou-se Neospora caninum como causador de abortamento e natimortalidade em bovinos, por meio de exame histopatológico (hematoxilina-eosina, imunoistoquímica (IHQ e nested-PCR, utilizando primers da região Nc5 do DNA genômico (PCR PLUS e primers da região ITS1 do DNA ribossomal (PCR JB. Foram avaliadas 105 amostras de abortamento bovino entre janeiro de 2006 a maio de 2008, encaminhadas ao Centro de Pesquisa e Desenvolvimento de Sanidade Animal do Instituto Biológico para diagnóstico diferencial de causas infecciosas. Observou-se em 71,4% das amostras lesões histológicas (HE caracterizadas pela presença de células inflamatórias mononucleares no coração, pulmão, fígado, rim, placenta e cérebro. A IHQ detectou 8,57% de positividade, sendo maior no cérebro, placenta e coração. A nested-PCR JB revelou 6,66% de casos positivos, enquanto que a nested-PCR PLUS apresentou maior taxa
Measurements of current density distribution in shaped e-beam writers
Czech Academy of Sciences Publication Activity Database
Bok, Jan; Horáček, Miroslav; Kolařík, Vladimír; Urbánek, Michal; Matějka, Milan; Krzyžánek, Vladislav
2016-01-01
Roč. 149, JAN 5 (2016), s. 117-124 ISSN 0167-9317 R&D Projects: GA ČR(CZ) GA14-20012S; GA MŠk(CZ) LO1212; GA MŠk ED0017/01/01 Institutional support: RVO:68081731 Keywords : shaped e-beam writer * electron beam * current density Subject RIV: JB - Sensors, Measurment, Regulation Impact factor: 1.806, year: 2016
Johnvesly, B; Manjunath, B R; Naik, G R
2002-03-01
Thermoalkaliphilic Bacillus sp. JB-99 was grown in a 250 ml Erlenmeyer flask containing 50 ml medium containing (g/l) Pigeon pea waste 10; NaNO3, 5.0; K2HPO4, 5.0; MgSO4 x 2H2O, 0.2 and Na2CO3, 10.0. Incubations were carried out at 50 degrees C on a rotary incubator shaker for 15 h. A high level of extra cellular thermostable protease activity was observed after 24 h incubation. The optimum temperature and pH for activity were 70 degrees C and 11, respectively, so this enzyme showed stable activity at high temperature and under alkaline conditions.
Kättemaks Vene keskpangale / Sulev Vedler
Vedler, Sulev, 1970-
2007-01-01
Venemaa keskpanga asepresidendi Andrei Kozlovi tapmise tellimise eest vahistatud ekspankur Aleksei Frenkel väidab, et Vene keskpanga ametnikud on seotud pistisevõtmisega. A. Frenkeli kahest avalikust kirjast
2008-01-01
Tšehhi inimõiguste ühenduse People in Need Kuuba sektsiooni juhi kirjast IFLA presidendile, kus juhitakse tähelepanu Kuubas toimuvatele repressioonidele nii raamatukoguhoidjate kui raamatukogude suhtes
Ragn-Sells: Reformierakond kandib prügiraha! / Mihkel Kärmas
Kärmas, Mihkel, 1974-
2010-01-01
Firma Ragn-Sells kahtlustab, et Reformierakonda rahastati prügiärist kanditud miljonitega. Ragn-Sellsi kirjast riigikontrollile, õiguskantslerile ja siseministrile. Konkureeriva firma Veolia juhataja Argo Luude seisukoht
Kirja teekond rahvusliku vormi otsinguil / Ivar Sakk
Sakk, Ivar, 1962-
2010-01-01
Kunstnikud kirja joonistamas. Trükikojad kujundavad Eesti kirjapilti. Art deco kui rahvuslikkuse manifestatsioon. Kirjandus räägib kirjast. Ruunikiri : Eesti oma kiri. Natsi-šrift ja Eesti traditsioon.
Эстонские ученые против строительства Nord Stream
2009-01-01
Eesti Teaduste Akadeemia kirjast president Toomas Hendrik Ilvesele ja peaminister Andrus Ansipile sooviga moodustada professionaalne komisjon, mis töötaks läbi Nord Streami gaasijuhtme keskkonnamõju hindamise materjalid
Haravee, Juhan, 1957-
2017-01-01
Tallinna vangla kinnipeetavate kirjast valitsusele, kus nõutakse vangistusseaduses olevate vastuolude tõttu tekkinud moraalse kahju hüvitamist ja kolm aastat varem avaldatud Eesti Õiguskantsleri vangistusseaduse analüüsist
Keelatud "Magnus" läheb täismajale / Tiit Tuumalu
Tuumalu, Tiit, 1971-
2008-01-01
Harju maakohtu poolt esinemiskeelu alla pandud K. Kõusaare mängufilmi "Magnus" näitamise kohta Kinoliidu poolt Eesti filmi päevadel. Ka loomeliitude poolt avalikkusele suunatud kirjast selles küsimuses
(Euph tion an ega vi horbiac nd anti irosa R ceae) sicklin Roxb. e ng
African Journals Online (AJOL)
SAM
serve as ant profile as we aluation of th macromorph yed in phytoc dium metabi atients who normal salin stomataarra tannins, fla e aqueous m s were signi are sugges candidate fo cell disorders onal medical are. ..... Strouse JJ, Lanzkron S, Beach MC, Haywood C, Park H, Witkop C,. Wilson RF, Bass EB, Segal JB (2008).
Die Baltikum-Charta vom 23. August 1979 und der KGB: Sieger und Verlierer / Ritvars Jansons
Jansons, Ritvars
2010-01-01
23. augustil 1979 avalikustatud 45 Eesti, Läti ja Leedu kodaniku avalikust kirjast, milles nõuti Molotovi-Ribbentropi pakti salajaste lisaprotokollide avalikustamist ning õigustühiseks kuulutamist allakirjutamise hetkest. Märgukirja hilisem nimetus Balti Apell
Briti valitsus usub USA mõjutamise võimalusse / Maris Lillak
Lillak, Maris, 1970-
2004-01-01
Suurbritannia endiste kõrgete diplomaatide kirjast, milles nad kritiseerivad peaminister Tony Blairi lähedasi suhteid USA presidendi George W. Bushiga seoses Iraagi ja Iisraeli poliitikaga. Briti välisministeeriumi ministri Mike O'Brien'i vastusest
Ritter, Joachim
1996-01-01
Loodus kui esteetiliselt vahendatud maastik: uusaja maailma kuulub loodus maastikuna, kusjuures luule ja kunst kordavad teaduse kaudu vahendatud 'objektiivset' loodust esteetiliselt. Ka Francesco Petrarca kirjast Francesco Dioginile Borgo San Sepolcrost ja Friedrich Schilleri luuletusest 'Jalutuskäik'
Lotmani kõne ajas erakonnad tülli / Tuuli Koch
Koch, Tuuli
2005-01-01
SDE ja Res Publica konfliktist seoses Mihhail Lotmani kõnega vanemahüvitise seaduseelnõu arutelul Riigikogus. Res Publica esimehe Juhan Partsi kirjast SDE esimehele Ivari Padarile, I. Padari vastusest. Lisa: Nestor: kõige tavalisem fašism
Oluline mälestis Narva bastion laguneb üha kiiremas tempos / Dannar Leitmaa
Leitmaa, Dannar, 1982-
2011-01-01
Narva laguneva bastioni pärast kultuuriministeeriumi saabunud Narva linnapea Tarmo Tammiste, linnaarhitekti Peeter Tambu ja Narva Muuseumi direktori Andres Toode kirjast. Ministeeriumi kantsleri Anton Pärna sõnul ei ole riigil praegu võimalust Narva bastioni taastamist rahastada
Singh, Gursharan; Sharma, Prince; Capalash, Neena
2009-08-01
An alkalophilic and halotolerant laccase from gamma-proteobacterium JB catalyzed in high concentrations of organic solvents and various salts. The enzyme retained 80-100% activity in 10% concentration of dimethylsulfoxide (DMSO), ethanol, acetone or methanol; 100, 85 and 50% activity in 20 mM MgCl(2), 5.0 mM MnCl(2) and 0.1 mM CuCl(2); 140, 120 and 110% activity in 5.0 mM MnSO(4), 10 mM MgSO(4) and 1mM CaSO(4), respectively. Sodium halides inhibited the enzyme in the order: F(-)> Br(-)> I(-)> Cl(-). In 0.5 M NaCl, pH 6.0, laccase was approximately 60% active. Decolorization of indigo carmine by laccase at pH 9.0 was not inhibited even in the presence of 0.5 M NaCl. Release of chromophoric, reducing and hydrophobic compounds during biobleaching of straw rich-soda pulp by laccase was not inhibited when the enzyme was applied in the presence of 1 M NaCl at pH 8.0. Laccase retained 50% residual activity even when incubated with 5% calcium hypochlorite for 30 min.
Ajaleht Pravda ja 40 keisri hullu : "40 kiri" sündis siis, kui teisiti enam ei saanud / Lauri Vahtre
Vahtre, Lauri, 1960-
2005-01-01
Eesti kultuuritegelaste kirjutatud "40 kirjast" 1980. aastal, kus tunti muret Eesti ühiskonna ja kultuuri tuleviku pärast. Artikkel sisaldab kirjale allakirjutanute nimesid. Ilmunud ka rmt.: Vahtre, Lauri. Ajaloo pööripäevad. Tallinn, 2006, lk. 190-194
Igor Gräzin predlagajet suditsja s glavoi PASE
2007-01-01
Riigikogu liige Igor Gräzin arvab, et Eesti võiks kaaluda võimalust anda kohtusse ENPA president Rene van der Linden, kes on laimanud Eesti riiki. Riigikogu esimehe Ene Ergma kirjast ENPA presidendile Rene van Lindenile ja tema vastusest
Genetics Home Reference: FG syndrome
... MJ, Hoo JJ, Jones KL, McKeown C, Moeschler JB, Raymond FL, Rogers RC, Schwartz CE, Battaglia A, ... E, Huddleston L, Clark RD, Jones KL, Moeschler JB, Opitz JM, Morford J, Simensen R, Rogers RC, ...
Shrinivas, Dengeti; Kumar, Raghwendra; Naik, G R
2012-01-01
The thermoalkalophilic Bacillus halodurans JB 99 cells known for production of novel thermostable alkaline keratinolytic protease were immobilized in calcium alginate matrix. Batch and repeated batch cultivation using calcium alginate immobilized cells were studied for alkaline protease production in submerged fermentation. Immobilized cells with 2.5% alginate and 350 beads/flask of initial cell loading showed enhanced production of alkaline protease by 23.2% (5,275 ± 39.4 U/ml) as compared to free cells (4,280 ± 35.4 U/ml) after 24 h. In the semicontinuous mode of cultivation, immobilized cells under optimized conditions produced an appreciable level of alkaline protease in up to nine cycles and reached a maximal value of 5,975 U/ml after the seventh cycle. The enzyme produced from immobilized cells efficiently degraded chicken feathers in the presence of a reducing agent which can help the poultry industry in the management of keratin-rich waste and obtaining value-added products.
Mick Jagger ihaldas peaosa "Kellavärgiga apelsinis"
2008-01-01
Avalikkuse ette tulnud produtsent Si Litvinoffi kirjast režissöör John Schlesingerile selgus tema soov filmida A. Burgessi romaani "Kellavärgiga apelsin" juba enne S. Kubricku kuulsat filmi. Filmis soovis Alexit mängida Mick Jagger. J. Schlesinger keeldus selle filmi lavastamisest
Lõhe Res Publicas / Eve Heinla
Heinla, Eve, 1966-
2005-01-01
Tallinna linnapea Tõnis Palts on vastu Tallinna volikogu Res Publica fraktsiooni esimehe Toomas Tautsi abikaasa Kristina Tautsi tööleasumisele Lääne-Tallinna keskhaigla haldusjuhina. T. Paltsi kirjast Res Publica Tallinna piirkonna juhatusele. Lisa: Kuidas lahvatas pealinna võimutüli. Kommenteerivad: Maret Maripuu, Tõnis Palts, Vladimir Maslov
Volinik Tajani: saadik ei saanud luba ähvardada / Raimo Poom
Poom, Raimo
2011-01-01
Euroopa Komisjoni asepresidendi Antonio Tajani kõneisiku Carlo Corazza vastus Eesti Päevalehe küsimusele, mis puudutas majandus- ja kommunikatsiooniministeeriumi asekantslerile Ahti Kuningale kui komisjoni väike- ja keskmiste ettevõtete saadikule Eestis antud mandaati. Küsimus oli ajendatud Kuninga kirjast, mille ta saatis Tallinna Vee aktsionäridele
Directory of Open Access Journals (Sweden)
Solomon Umukoro
2013-02-01
Full Text Available Introduction: Amnesia or loss of memory is the cardinal hallmark of Alzheimer’s disease (AD, a progressive neurodegenerative disorder associated with ageing process. Although, AD had been discovered over a century ago, drugs which could cure or halt the progression of the disease are yet to see the light of the day. However, there has been a growing interest in the use of phytomedicines with multipronged mechanisms of action that could target various aspects of the pathologies of AD. Jobelyn (JB is a potent antioxidant African polyherbal formulation with active components that have been acclaimed to show neuroprotection. This investigation was carried out to evaluate whether JB has anti-amnesic and antioxidant activities. Methods: The alteration of alternation behavior in the Y-maze paradigm was utilized as the test for memory function in mice. The effect of JB on acetylcholinesterase (AChE activity, malondialdehyde (MDA level and the concentrations of glutathione (GSH in the frontal cortex and hippocampus were assessed in rats as means of providing insight into the mechanism underlying its anti-amnesic activity. The animals were given JB (1, 2.5 or 5mg/kg, i.p. daily for 7 days before the biochemical assays or test for memory functions were carried out. Results: JB was found to produce a signi.cant increase in the level of alternation behavior compared with the control, suggesting anti-amnesic activity. Also, JB reversed the memory impairment induced by scopolamine, which further indicates anti-amnesic property. Furthermore, JB demonstrated a signi.cant inhibition of MDA formation in the frontal cortex and hippocampus of rats, indicating antioxidant property. In addition, it increased the defense armory of the brain tissues, as it signi.cantly increased the concentrations of GSH in the frontal cortex and hippocampus of rats. However, JB did not demonstrate any inhibitory effect against AChE activity in the frontal cortex and hippocampus
Directory of Open Access Journals (Sweden)
Celso Luis Cardoso
2003-04-01
Full Text Available Neste estudo foi investigado o perfil de susceptibilidade antimicrobiana e avaliação molecular de amostras de Enterococcus spp, isoladas de urina, secreção purulenta, sangue e ferida cirúrgica de pacientes do Hospital Universitário de Maringá, estado do Paraná, no período entre 1998 e 2000. As amostras foram avaliadas quanto à susceptibilidade a drogas, tipificadas através de JB1-PCR e investigadas quanto à presença de gene Van A e Van B. Das 58 amostras, 98,3% foram classificadas como Enterococcus faecalis. Todas as amostras foram sensíveis à nitrofurantoína e vancomicina, 96,6% sensíveis à ampicilina, 32,8% foram resistentes à estreptomicina, 10,3% resistentes à gentamicina e ciprofloxacina e 6,9% resistentes a norfloxacina. Por meio do teste de CIM, para vancomicina, observou-se crescimento bacteriano até a concentração de 4μg/ml. Não foi detectada a presença de gene Van A e Van B. A amplificação por JB1-PCR proporcionou padrões de bandas com até 7 fragmentos sendo as amostras divididas em 6 grupos distintos. Não houve prevalência de algum padrão de bandeamento que denotasse a presença de um clone e não foi possível estabelecer correlação entre genótipo com resistência antimicrobiana.The aim of this study was to investigate the prevalency of Enterococcus spp, isolated from different clinical materials. The strains were evaluated for drugs susceptibility, typing by JB1-PCR and screened to the presence of Van A and Van B gene. From the 58 strains, 98.3% were classified as Enterococcus faecalis. All strains were sensible to nitrofurantoin and vancomycin, 96.6% were sensible to ampicilin, 32.8% were resistant to streptomycin, 10.3% were resistant to gentamicin and ciprofloxacin and 6.9% were resistant to norfloxacin. Using CIM test to check vancomycin susceptibility was observed bacterial growth until 4μg/ml. The presence of Van A e Van B gene was not detected. The amplification by JB1-PCR provided band
"Jutustus Liivimaast" - vähetuntud teos Liivimaa ajaloost / Janet Laidla
Laidla, Janet, 1982-
2008-01-01
Teose "An Account of Livonia : with a Relation of the Rise, Progress, and Decay of the Marian Teutonick Order" (London : Peter Buck, 1701) kirjeldus. Ülevaade seitsmeteistkümnest kirjast koosnevast ajalooteemalisest raamatust. Teose autorlusest. Olulisemad on teoses Kuramaad kirjeldavad osad, kuna tõenäoliselt oli autor Kuramaa vabahärra Karl Johann von Blomberg
Antioxidant Property of Jobelyn as the Possible Mechanism Underlying
Directory of Open Access Journals (Sweden)
Solomon Umukoro
2013-01-01
Full Text Available Introduction: Amnesia or loss of memory is the cardinal hallmark of Alzheimer’s disease (AD, a progressive neurodegenerative disorder associated with ageing process. Although, AD had been discovered over a century ago, drugs which could cure or halt the progression of the disease are yet to see the light of the day. However, there has been a growing interest in the use of phytomedicines with multipronged mechanisms of action that could target various aspects of the pathologies of AD. Jobelyn (JB is a potent antioxidant African polyherbal formulation with active components that have been acclaimed to show neuroprotection. T his investigation was carried out to evaluate whether JB has anti-amnesic and antioxidant activities. Methods: The alteration of alternation behavior in the Y-maze paradigm was utilized as the test for memory function in mice. The effect of JB on a cetylcholinesterase (AChE activity, malondialdehyde (MDA level and the concentrations of glutathione (GSH in the frontal cortex and hippocampus were assessed in rats as means of providing insight into the mechanism underlying its anti-amnesic activity. The animals were given JB (1, 2.5 or 5mg/kg, i.p. daily for 7 days before the biochemical assays or test for memory functions were carried out. Results: JB was found to produce a significant increase in the level of alternation behavior compared with the control, suggesting anti-amnesic activity. Also, JB reversed the memory impairment induced by scopolamine, which further indicates anti-amnesic property. Furthermore, JB demonstrated a significant inhibition of MDA formation in the frontal cortex and hippocampus of rats, indicating antioxidant property. In addition, it increased the defense armory of the brain tissues, as it significantly increased the concentrations of GSH in the frontal cortex and hippocampus of rats. However, JB did not demonstrate any inhibitory effect against AChE activity in the frontal cortex and
Technique of measuring and evaluating the R3E dia. 112 experimental fuel element
International Nuclear Information System (INIS)
Stanc, S.; Badiar, S.
1974-10-01
The charging is considered of the R3E experimental fuel element having a diameter of 112 mm which will serve the simultaneous temperature measurement on 15 sites and neutron flux measurement on 7 sites aimed at verifying the improved R3-type fuel element with extended cladding and a new toroidal spacing. The temperature will be measured using jacket thermocouples while neutron flux will be measured by self-powered detectors. The methods are described of checking the measuring chain by determining the loop resistance of the thermocouples and SPN detectors in order to verify the correctness of the measured data. (J.B.)
Memento ettepanek president Ilvesele ja välisminister Paetile
2010-01-01
Eesti Memento Liidu juhatuse esimehe Enn Tarto kirjast president Toomas Hendrik Ilvesele ja välisminister Urmas Paetile seoses nende sõiduga Moskvasse Suure Isamaasõja võidu aastapäeva tähistamise pidustustele. Ilmunud ka: Vaba Eesti Sõna 6. mai 2010, lk. 3, pealk.: Enn Tarto annab Moskvasse sõitvale presidendile nõu. Töövisiit Moskvasse 8.-9.05.2010
Filippov, Madis
2009-01-01
Teadlastes tekitavad ärevust Vene-Saksa ühisfirma Nord-Streami poolt Läänemerre kavandatava gaasitoru keskkonnamõjud. Artiklis on juttu ka Eesti Teaduste Akadeemia kirjast president Toomas Hendrik Ilvesele ja peaminister Andrus Ansipile sooviga moodustada professionaalne komisjon, mis töötaks läbi Nord Streami gaasijuhtme keskkonnamõju hindamise materjalid. Vt. samas: Dioksiinide kontsentratsioon setetes; Nord Streami gaasijuhe
Balti Apellist möödus 30 aastat
2009-01-01
45 Eesti, Läti ja Leedu kodaniku märgukirjast 23. augustil 1979. a. nõudega avalikustada Molotovi-Ribbentropi pakt koos oma salaprotokollidega, kuulutada pakt kehtetuks ja taastada Balti riikide iseseisvus. Juttu on ka Virge Loskiti kirjast president Toomas Hendrik Ilvesele (http://www.syndikaat.ee/news.php?uID=3219&lang=est), milles kutsutakse üles tunnustama Balti Apellile alla kirjutanud eestlasi
Directory of Open Access Journals (Sweden)
Michel Cardoso de Angelis Pereira
2010-04-01
Full Text Available This work had as an objective, to analyze, both physically and chemically, five olive tree varieties kept in the EPAMIG Germplasm Bank at the Experimental Farm, in the town of Maria da Fé, MG. Physical characteristics of the fruits and seeds (weight, diameter and length and some chemical characteritics of the oils extracted from five varieties (acidity, iodine, saponification, peroxide indices and the fatty acid profile were evaluated. The Negroa variety presented an average percent of lipids (28.2% significantly higher than the others (p Este trabalho teve por objetivo analisar, física e quimicamente, cinco variedades de oliveiras mantidas no banco de germoplasma pela EPAMIG, na Fazenda Experimental no município de Maria da Fé, MG. Foram avaliadas características físicas dos frutos e sementes (peso, diâmetro e comprimento e algumas características químicas dos azeites extraídos de cinco variedades (índice de acidez, iodo, saponificação, peróxidos e perfil de ácidos graxos. A variedade Negroa apresentou percentual médio de lipideos (28,2% significativamente maior que as demais (p < 0,05. Dentre as variedades estudadas a Negroa e JB1 apresentaram maior produtividade e valores de acidez, índice de saponificação, iodo e peróxidos mais compatíveis com as normas da ANVISA (2005 e o Codex Alimentarius (2003. Todas as variedades cultivadas em Maria da Fé apresentaram conteúdos de ácido oléico dentro do recomendado pelo Codex alimentarius e significativamente maior que o teor de ácido oléico do azeite comercial extra virgem analisado (p < 0,05. O perfil de ácidos graxos encontrado demonstrou que todas as variedades (JB1, Negroa, Ascolano 315, 0025 e 0004 estão com seus valores adequados para os principais grupos de ácidos graxos, quando comparados com a legislação. Os resultados indicam que das variedades analisadas a Negroa e JB1 apresentam melhor potencial para utilização na produção de azeite de oliva.
Cohen, Jonathan; Bar-Shalom, Shaouly; Eilam, Gad; Soni, Amarjit
2018-03-01
We suggest that the exclusive Higgs +light (or b)-jet production at the LHC, p p →h +j (jb), is a rather sensitive probe of the light-quarks Yukawa couplings and of other forms of new physics (NP) in the Higgs-gluon h g g and quark-gluon q q g interactions. We study the Higgs pT-distribution in p p →h +j (jb)→γ γ +j (jb), i.e., in h +j (jb) production followed by the Higgs decay h →γ γ , employing the (pT-dependent) signal strength formalism to probe various types of NP which are relevant to these processes and which we parametrize either as scaled Standard Model (SM) couplings (the kappa-framework) and/or through new higher dimensional effective operators (the SMEFT framework). We find that the exclusive h +j (jb) production at the 13 TeV LHC is sensitive to various NP scenarios, with typical scales ranging from a few TeV to O (10 ) TeV , depending on the flavor, chirality and Lorentz structure of the underlying physics.
Kremlis tõstab pead tsaristlik võimuideoloogia / John Hulsman ; interv. Kaarel Kaas
Hulsman, John
2004-01-01
USA uurimiskeskuse Heritage Foundation analüütiku hinnangul võtab Venemaa üha enam tsaaririigi näo ning Washington vajab Moskvaga äripartnerlusega sarnanevat suhet. Nn saja kirjast, sellega kaasneda võivatest muutustest, Ameerika varasemast Vene-poliitikast. Vt. samas: "Saja kiri" lööb häirekella Vene pärast; Kommenteerib Strateegiliste ja Rahvusvaheliste uuringute Keskuse vanemanalüütik Simon Serfaty.
AR42J-B-13 cell: An expandable progenitor to generate an unlimited supply of functional hepatocytes
International Nuclear Information System (INIS)
Wallace, Karen; Fairhall, Emma A.; Charlton, Keith A.; Wright, Matthew C.
2010-01-01
Hepatocytes are the preparation of choice for Toxicological research in vitro. However, despite the fact that hepatocytes proliferate in vivo during liver regeneration, they are resistant to proliferation in vitro, do not tolerate sub-culture and tend to enter a de-differentiation program that results in a loss of hepatic function. These limitations have resulted in the search for expandable rodent and human cells capable of being directed to differentiate into functional hepatocytes. Research with stem cells suggests that it may be possible to provide the research community with hepatocytes in vitro although to date, significant challenges remain, notably generating a sufficiently pure population of hepatocytes with a quantitative functionality comparable with hepatocytes. This paper reviews work with the AR42J-B-13 (B-13) cell line. The B-13 cell was cloned from the rodent AR42J pancreatic cell line, express genes associated with pancreatic acinar cells and readily proliferates in simple culture media. When exposed to glucocorticoid, 75-85% of the cells trans-differentiate into hepatocyte-like (B-13/H) cells functioning at a level quantitatively similar to freshly isolated rat hepatocytes (with the remaining cells retaining the B-13 phenotype). Trans-differentiation of pancreatic acinar cells also appears to occur in vivo in rats treated with glucocorticoid; in mice with elevated circulating glucocorticoid and in humans treated for long periods with glucocorticoid. The B-13 response to glucocorticoid therefore appears to be related to a real pathophysiological response of a pancreatic cell to glucocorticoid. An understanding of how this process occurs and if it can be generated or engineered in human cells would result in a cell line with the ability to generate an unlimited supply of functional human hepatocytes in a cost effective manner.
CONTROLE DE Staphylococcus aureus EM CHARQUES (JERKED BEEF POR CULTURAS INICIADORAS
Directory of Open Access Journals (Sweden)
Marcos Franke PINTO
1998-05-01
Full Text Available Jerked beef - JB - é um produto cárneo curado, salgado e seco ao sol, derivado de um típico produto cárneo brasileiro - o charque. Ambos carecem de estudos que orientem seu aprimoramento. Staphylococcus spp. têm sido reportado como o gênero predominante na microbiota do produto, o que evidencia o risco de desenvolvimento de linhagens enterotoxigênicas de S. aureus. Foram empregadas duas linhagens inócuas de estafilococos na elaboração de JB, a fim de avaliar sua influência sobre o desenvolvimento de S. aureus por mecanismo competitivo ou pela produção de bacteriocinas. Os resultados demonstraram que ambas inibiram o desenvolvimento do patógeno tanto in vitro como durante o processamento do produto. Não se observou produção de compostos inibitórios pelas linhagens iniciadoras, ficando a explicação para a inibição observada restrita ao mecanismo competitivo. Este trabalho permitiu demonstrar a possibilidade de aumentar a segurança e padronização de JB pelo emprego de culturas bacterianas selecionadas.Jerked beef - JB - is a sun-dried, salted and cured meat product, derived from charqui. There are few studies about JB in the literature, as in charqui. Staphylococcus spp has been reported to be the predominant microrganism present in JB. The presence of this genus reveals a possible hazard for S. aureus growth. Two staphilococci strains commonly used as starter in fermented meat products have been employed with the purpose to inhibiting S. aureus either through competitive action or through the production of bacteriocins. The results demonstrated the inhibition S. aureus growth, probably through a competitive action, as they grow better in the medium. These starters have not produced any inhibitory compound. These informations led us to conclude that it is possible to improve the safety and quality standardization of JB through appropriate starter cultures.
Singh, Gursharan; Ahuja, Naveen; Batish, Mona; Capalash, Neena; Sharma, Prince
2008-11-01
An alkalophilic laccase from gamma-proteobacterium JB was applied to wheat straw-rich soda pulp to check its bleaching potential by using response surface methodology based on central composite design. The design was employed by selecting laccase units, ABTS (2,2'-azino-bis (3-ethylbenzothiazoline-6-sulfonic acid)) concentration and pH as model factors. The results of second order factorial design experiments showed that all three independent variables had significant effect on brightness and kappa number of laccase-treated pulp. Optimum conditions for biobleaching of pulp with laccase preparation (specific activity, 65 nkat mg(-1) protein) were 20 nkat g(-1) of pulp, 2mM ABTS and pH 8.0 which enhanced brightness by 5.89% and reduced kappa number by 21.1% within 4h of incubation at 55 degrees C, without further alkaline extraction of pulp. Tear index (8%) and burst index (18%) also improved for laccase-treated pulp as compared to control raw pulp. Treatment of chemically (CEH1H2) bleached pulp with laccase showed significant effect on release of chromophores, hydrophobic and reducing compounds. Laccase-prebleaching of raw pulp reduced the use of hypochlorite by 10% to achieve brightness of resultant hand sheets similar to the fully chemically bleached pulp.
Middle Eastern Geographies of World War I
2010-05-21
and ill-equipped forces. Within this atmosphere of persecution and economic depression caused by the war’s stoppage of religious pilgrimages...St. J.B. Armitage, "T.E. Lawrence: a centennial lecture," Asian Affairs 20, no. 1 (1989): 14. This Turkish offensive severely threatened the...British invade Syria. The Arabs working from Akaba became virtually the 163 St. J.B. Armitage, “Lawrence: a centennial lecture,” 18. 164 Wavell
Wistinghausen, Henning von
2004-01-01
H. Keyserlingi artiklite "Sõja mõttest" ja "Mõningaid vaatepunkte päevaküsimusele" seisukohtadest ja teesidest, mis käsitlesid kultuurifilosoofilisi vaateid Esimesele maailmasõja ja tuleviku olukorra kohta ning Saksamaa rolli antud ajalooetapil. Eestimaa baltisakslaste etteheidetele vastuseks kirjutatud H. Keyserlingi kirjast Eduard Dellingshausenile, kus on ära toodud artiklite kirjutamise motiivid. Vt. ka: Undusk, Jaan. "Viimane baltlane Hermann Keyserling." (Tuna 2003/2). Järg. nr. 4, lk. 66-81
Czech Academy of Sciences Publication Activity Database
Plíhal, Jiří; Šucha, M.
2014-01-01
Roč. 2014, č. 1 (2014), s. 29-32 ISSN 1801-8890 Grant - others:ŠKODA AUTO a.s.(CZ) 6002 Source of funding: N - neverejné zdroje Keywords : Advanced Driver Assistance Systems * Electronic Vehicle Systems * Vehicle Safety Subject RIV: JB - Sensors, Measurment, Regulation http://library.utia.cas.cz/separaty/2014/AS/plihal-0429121.pdf
Urfer, Matthias; Bogdanovic, Jasmina; Lo Monte, Fabio; Moehle, Kerstin; Zerbe, Katja; Omasits, Ulrich; Ahrens, Christian H; Pessi, Gabriella; Eberl, Leo; Robinson, John A
2016-01-22
Increasing antibacterial resistance presents a major challenge in antibiotic discovery. One attractive target in Gram-negative bacteria is the unique asymmetric outer membrane (OM), which acts as a permeability barrier that protects the cell from external stresses, such as the presence of antibiotics. We describe a novel β-hairpin macrocyclic peptide JB-95 with potent antimicrobial activity against Escherichia coli. This peptide exhibits no cellular lytic activity, but electron microscopy and fluorescence studies reveal an ability to selectively disrupt the OM but not the inner membrane of E. coli. The selective targeting of the OM probably occurs through interactions of JB-95 with selected β-barrel OM proteins, including BamA and LptD as shown by photolabeling experiments. Membrane proteomic studies reveal rapid depletion of many β-barrel OM proteins from JB-95-treated E. coli, consistent with induction of a membrane stress response and/or direct inhibition of the Bam folding machine. The results suggest that lethal disruption of the OM by JB-95 occurs through a novel mechanism of action at key interaction sites within clusters of β-barrel proteins in the OM. These findings open new avenues for developing antibiotics that specifically target β-barrel proteins and the integrity of the Gram-negative OM. © 2016 by The American Society for Biochemistry and Molecular Biology, Inc.
Zhang, Jing; Wang, Yang; Zhou, Ye; He, Qing-Yu
2017-10-31
Colorectal carcinoma (CRC) remains one of the leading causes of death in cancer-related diseases. In this study, we aimed to investigate the anticancer effect of Jolkinolide B (JB), a bioactive diterpenoid component isolated from the dried roots of Euphorbia fischeriana Steud, on CRC cells and its underlying mechanisms. We found that JB suppressed the cell viability and colony formation of CRC cells, HT29 and SW620. Annexin V/PI assay revealed that JB induced apoptosis in CRC cells, which was further confirmed by the increased expression of cleaved-caspase3 and cleaved-PARP. iTRAQ-based quantitative proteomics was performed to identify JB-regulated proteins in CRC cells. Gene Ontology (GO) analysis revealed that these JB-regulated proteins were mainly involved in ER stress response, which was evidenced by the expression of ER stress marker proteins, HSP90, Bip and PDI. Moreover, we found that JB provoked the generation of reactive oxygen species (ROS), and that inhibition of the ROS generation with N-acetyl L-cysteine could reverse the JB-induced apoptosis. Confocal microscopy and flow cytometry showed that JB treatment enhanced intracellular and mitochondrial Ca 2+ level and JC-1 assay revealed a loss of mitochondrial membrane potential in CRC after JB treatment. The mitochondrial Ca 2+ uptake and depolarization can be blocked by Ruthenium Red (RuRed), an inhibitor of mitochondrial Ca 2+ uniporter. Taken together, we demonstrated that JB exerts its anticancer effect by ER stress-Ca 2+ -mitochondria signaling, suggesting the promising chemotherapeutic potential of JB for the treatment of CRC.
International Nuclear Information System (INIS)
Son, Young-Ok; Hitron, J. Andrew; Wang Xin; Chang Qingshan; Pan Jingju; Zhang Zhuo; Liu Jiankang; Wang Shuxia; Lee, Jeong-Chae; Shi Xianglin
2010-01-01
Cr(VI) compounds are known to cause serious toxic and carcinogenic effects. Cr(VI) exposure can lead to a severe damage to the skin, but the mechanisms involved in the Cr(VI)-mediated toxicity in the skin are unclear. The present study examined whether Cr(VI) induces cell death by apoptosis or necrosis using mouse skin epidermal cell line, JB6 Cl41 cells. We also investigated the cellular mechanisms of Cr(VI)-induced cell death. This study showed that Cr(VI) induced apoptotic cell death in a dose-dependent manner, as demonstrated by the appearance of cell shrinkage, the migration of cells into the sub-G1 phase, the increase of Annexin V positively stained cells, and the formation of nuclear DNA ladders. Cr(VI) treatment resulted in the increases of mitochondrial membrane depolarization and caspases activation. Electron spin resonance (ESR) and fluorescence analysis revealed that Cr(VI) increased intracellular levels of reactive oxygen species (ROS) such as hydrogen peroxide and superoxide anion radical in dose-dependent manner. Blockage of p53 by si-RNA transfection suppressed mitochondrial changes of Bcl-2 family composition, mitochondrial membrane depolarization, caspase activation and PARP cleavage, leading to the inhibition of Cr(VI)-induced apoptosis. Further, catalase treatment prevented p53 phosphorylation stimulated by Cr(VI) with the concomitant inhibition of caspase activation. These results suggest that Cr(VI) induced a mitochondrial-mediated and caspase-dependent apoptosis in skin epidermal cells through activation of p53, which are mainly mediated by reactive oxidants generated by the chemical.
Gao, Xiang; Han, Han
2018-06-01
Jolkinolide B (JB), a bioactive compound isolated from herbal medicine, has been found to inhibit tumor growth by altering glycolysis. However, whether glycolysis is influenced by JB in non-small cell lung cancer (NSCLC) cells and the mechanism remain unknown. The aim of the present study was to evaluate the effect of JB on the glycolysis in NSCLC cells and the underlying molecular mechanism. The results showed that JB treatment inhibited cell viability of A549 and H1299 cells in a concentration-dependent manner. JB reduced the glucose consumption, lactate production, and HK2 expression. The expressions of p-Akt and p-mTOR were also decreased by JB treatment. Knockdown of HK2 reduced glucose consumption and lactate production. Inhibition of the Akt/mTOR pathway decreased HK2 expression and inhibited glycolysis. In conclusion, the results indicated that JB inhibits glycolysis by down-regulating HK2 expression through inactivating the Akt/mTOR pathway in NSCLC cells, suggesting that JB might be a potential therapeutic agent for the treatment of NSCLC. © 2018 Wiley Periodicals, Inc.
African Journals Online (AJOL)
Barr, J.B.; Wallon, S.B. J. Appl. Polym. Sci. 1971, 15, 1079. Chuang, I-S; Maciel, G.E. Macromolecules 1984, 17, 1087. Gandini, A. Comprehensive Polymer Science, Pergamon Press: Oxford; 1992. Choura, M. Doctoral Thesis, National Polytechnic Institute, Grenoble, France, 1991. Wewerka, E.M.; Loughran, E.D.; Walters, ...
International Nuclear Information System (INIS)
Yanagi, Takeru
1990-01-01
A new method of accurate determination of isotopic composition and concentration of a strontium-84 spike solution was devised for simultaneous determination of strontium contents and isotopic compositions in rocks and minerals by measuring strontium isotopic ratios in spiked samples. In this method, the isotopic composition of strontium in the spike were determined so as to minimize the sum of squares of deviations of spike strontium-84 concentrations which were calculated from measured isotopic ratios of strontium in five different mixtures of the spike and the standard solution. The method can eliminate all mass discriminations occurred during the measurements on a surface ionization mass spectrometer. The results were tested by measuring 87 Sr/ 86 Sr ratios of Eimer and Amend SrCO 3 and JB-1 geochemical reference material, and by determining the strontium content in JB-1. The measurements of strontium isotope ratios in spiked samples give average values of 0.708007±0.000052 and 0.70417±0.00004 for 87 Sr/ 86 Sr ratios of E and A SrCO 3 and JB-1, respectively. The strontium content in JB-1 was estimated at 457.1±1.3 ppm. These values are very close to reported respective values. (author)
Effect of insecticide treated nets fence in protect- ing cattle against ...
African Journals Online (AJOL)
. Negl. Trop. Dis., 5(10), e1343. Byford, R.L., Craig, M.E., and Crosby, B.L. 1982. A Review of on Ectoparasites and. Their Cattle Production' Effect. J. Anim. Sci., 70, 597– 602. Catangui, M.A., Campbell, J.B., Thomas, G.D., Boxler, D.J. 1993.
Indian Academy of Sciences (India)
Jian Zeng and Shunv Cai. J. Biosci. 42(1), March 2017 © Indian Academy of Sciences. Supplementary material. Supplementary figure 1. Overexpression of miR-7 enhanced A549 cell apoptosis in response to BVP (100 µM). A TUNEL assay was performed according to the manufacturer's instructions (Promega Corporation, ...
Indian Academy of Sciences (India)
121
(A) Subcellular localization of CFP-AtMBD6 along with YFP protein was performed in onion epidermal cells. YFP was present in both cytoplasm and nucleus. It did not show a pattern of localization in the nucleus, which was similar to that of the interacting partners. The energy transfer between CFP-AtMBD6 and YFP was ...
Indian Academy of Sciences (India)
Sushila
Paraffin sections hybridized with antisense probe are shown. Purple staining indicates a positive reaction only in the corpus luteum but not in the corpus (B) and cauda (C). Supplementary figure 2. Determining specificity of amplicons of Ovgp1 (A) and Gapdh (B) by melt curve analysis. Melt peak for Ovgp1 PCR fragment is ...
A novel method to determine new potent angiotensin inhibitor ...
African Journals Online (AJOL)
that inhibit the action of angiotensin II by binding directly to the ..... Relatively high plasma protein binding of AZL (>99 .... Ghasemi JB, Zolfonoun E. Application of principal component analysis–multivariate adaptive regression splines for the ...
Genetics Home Reference: Pallister-Hall syndrome
... Manchester DK, Marcelis C, Mazzanti L, McCann E, McDonald MT, Mendelsohn NJ, Moeschler JB, Moghaddam B, Neri ... 10 All Bulletins Features What is direct-to-consumer genetic testing? What are genome editing and CRISPR- ...
Genetics Home Reference: Greig cephalopolysyndactyly syndrome
... Manchester DK, Marcelis C, Mazzanti L, McCann E, McDonald MT, Mendelsohn NJ, Moeschler JB, Moghaddam B, Neri ... 10 All Bulletins Features What is direct-to-consumer genetic testing? What are genome editing and CRISPR- ...
2009-09-01
2002). Rubin JB, Kung AL, Klein RS, Chan JA, Sun Y, Schmidt K, Kieran MW, Luster AD, Segal RA.A small-molecule antagonist of CXCR4 inhibits... Melanie H. Howell, Michelle Lacey, Betty Y. Shih, Carol Carter-Wientjes, Thomas E. Cleveland, John A. McLachlan, Thomas E. Wiese, Barbara S. Beckman
Kelly, John R; Allen, Andrew P; Temko, Andriy; Hutch, William; Kennedy, Paul J; Farid, Niloufar; Murphy, Eileen; Boylan, Geraldine; Bienenstock, John; Cryan, John F; Clarke, Gerard; Dinan, Timothy G
2017-03-01
Preclinical studies have identified certain probiotics as psychobiotics - live microorganisms with a potential mental health benefit. Lactobacillus rhamnosus (JB-1) has been shown to reduce stress-related behaviour, corticosterone release and alter central expression of GABA receptors in an anxious mouse strain. However, it is unclear if this single putative psychobiotic strain has psychotropic activity in humans. Consequently, we aimed to examine if these promising preclinical findings could be translated to healthy human volunteers. To determine the impact of L. rhamnosus on stress-related behaviours, physiology, inflammatory response, cognitive performance and brain activity patterns in healthy male participants. An 8week, randomized, placebo-controlled, cross-over design was employed. Twenty-nine healthy male volunteers participated. Participants completed self-report stress measures, cognitive assessments and resting electroencephalography (EEG). Plasma IL10, IL1β, IL6, IL8 and TNFα levels and whole blood Toll-like 4 (TLR-4) agonist-induced cytokine release were determined by multiplex ELISA. Salivary cortisol was determined by ELISA and subjective stress measures were assessed before, during and after a socially evaluated cold pressor test (SECPT). There was no overall effect of probiotic treatment on measures of mood, anxiety, stress or sleep quality and no significant effect of probiotic over placebo on subjective stress measures, or the HPA response to the SECPT. Visuospatial memory performance, attention switching, rapid visual information processing, emotion recognition and associated EEG measures did not show improvement over placebo. No significant anti-inflammatory effects were seen as assessed by basal and stimulated cytokine levels. L. rhamnosus was not superior to placebo in modifying stress-related measures, HPA response, inflammation or cognitive performance in healthy male participants. These findings highlight the challenges associated with
The Battle of Algiers: A War of Liberation
Carter, Margaret
1971-01-01
The author describes the film, The Battle of Algiers," and suggests discussion ideas for a classroom analysis: emotional response; labels, e.g., enemy; responsibility; alternatives; justice; warfare and crime. Learning activities and resources are also suggested. (Author/JB)
Cingolani, Francesca; Simbari, Fabio; Abad, Jose Luis; Casasampere, Mireia; Fabrias, Gemma; Futerman, Anthony H; Casas, Josefina
2017-08-01
Sphingolipids (SLs) have been extensively investigated in biomedical research due to their role as bioactive molecules in cells. Here, we describe the effect of a SL analog, jaspine B (JB), a cyclic anhydrophytosphingosine found in marine sponges, on the gastric cancer cell line, HGC-27. JB induced alterations in the sphingolipidome, mainly the accumulation of dihydrosphingosine, sphingosine, and their phosphorylated forms due to inhibition of ceramide synthases. Moreover, JB provoked atypical cell death in HGC-27 cells, characterized by the formation of cytoplasmic vacuoles in a time and dose-dependent manner. Vacuoles appeared to originate from macropinocytosis and triggered cytoplasmic disruption. The pan-caspase inhibitor, z-VAD, did not alter either cytotoxicity or vacuole formation, suggesting that JB activates a caspase-independent cell death mechanism. The autophagy inhibitor, wortmannin, did not decrease JB-stimulated LC3-II accumulation. In addition, cell vacuolation induced by JB was characterized by single-membrane vacuoles, which are different from double-membrane autophagosomes. These findings suggest that JB-induced cell vacuolation is not related to autophagy and it is also independent of its action on SL metabolism. Copyright © 2017 by the American Society for Biochemistry and Molecular Biology, Inc.
Advanced Oxygen Systems for Aircraft (Systemes d’Oxygene Avances)
1996-04-01
Oxygen Generating System (NAOGS), SAM-TR-80-12, Brooks AFB TX 78235, 1980. 11. Horch TC, Miller RL, Bomar JB, Tedor JB, Holden RD, Ikels KG, and...sieve oxygen generation sys- tem. Data from Horch et al (15). cabin altitude. The minimum and maximum oxygen concen- tration lines depict the...an AV-8A Aircraft; Naval Air Test Center Report No. SY-136R-81, 1981. 15. Horch TC, Miller RL, Bomar JB Jr, Tedor JB, Holden RD, Ikels KG, and
Central African Journal of Medicine - Vol 60, No 3 (2014)
African Journals Online (AJOL)
Prevalence of HIV among people with physical disabilities in Rwanda · EMAIL FULL TEXT EMAIL FULL TEXT DOWNLOAD FULL TEXT DOWNLOAD FULL TEXT. JB Munymana, VRP M'Kumbuzi, HT Mapira, I Nzabanterura, I Uwamariya, E Shema, 62-69 ...
Genetics Home Reference: Shprintzen-Goldberg syndrome
... Carmignac V, Thevenon J, Adès L, Callewaert B, Julia S, Thauvin-Robinet C, Gueneau L, Courcet JB, Lopez E, Holman K, Renard M, Plauchu H, Plessis G, De Backer J, Child A, Arno G, Duplomb L, Callier P, Aral ...
International Nuclear Information System (INIS)
Palash, S.M.; Kalam, M.A.; Masjuki, H.H.; Arbab, M.I.; Masum, B.M.; Sanjid, A.
2014-01-01
Highlights: • Environmental benefits of JB blends were found but adverse impact on NO x . • Addition of 0.15% (m) DPPD in JB20, average reduction in NO up to 16.54%. • In some cases, engine power is reduced with DPPD additive. • Emissions of HC and CO for JB blends with DPPD were lower compared to diesel. • Addition of DPPD in JB blends reduction of EGT was found. - Abstract: Energy requirements are increasing rapidly due to fast industrialization and the increased number of vehicles on the road. The use of biodiesel in diesel engines instead of diesel results in the proven reduction of harmful exhaust emissions. However, most researchers have reported that they produce higher NO x emissions compared to diesel, which is a deterrent to the expansion of the market for these fuels. Several proposed pathways try to account for NO x formation during the combustion process. Among them, the Fenimore mechanism explains that fuel radicals formed during the combustion process react with nitrogen from the air to form NO x . It could be proposed that if these radical reactions could be terminated, the NO x formation rate for biodiesel combustion would decrease. An experimental study was conducted on a four-cylinder diesel engine to evaluate the performance and emission characteristics of Jatropha biodiesel blends (JB5, JB10, JB15 and JB20) with and without the addition of N,N′-diphenyl-1,4-phenylenediamine (DPPD) antioxidant. For each tested fuel, the engine performance and emissions were measured at engine speeds 1000–4000 rpm at an interval of 500 rpm under the full throttle condition. The results showed that this antioxidant additive could reduce NO x emissions significantly with a slight penalty in terms of engine power and Brake Specific Fuel Consumption (BSFC) as well as CO and HC emissions. However, when compared to diesel combustion, the emissions of HC and CO with the addition of the DPPD additive were found to be nearly the same or lower. By the
Cone-guided fast ignition with no imposed magnetic fields
Directory of Open Access Journals (Sweden)
Strozzi D.
2013-11-01
Full Text Available Simulations are presented of ignition-scale fast ignition targets with the integrated Zuma-Hydra PIC-hydrodynamic capability. We consider a spherical DT fuel assembly with a carbon cone, and an artificially-collimated fast electron source. We study the role of E and B fields and the fast electron energy spectrum. For mono-energetic 1.5 MeV fast electrons, without E and B fields, ignition can be achieved with fast electron energy Efig = 30kJ. This is 3.5× the minimal deposited ignition energy of 8.7 kJ for our fuel density of 450 g/cm3. Including E and B fields with the resistive Ohm's law E = ηJb gives Efig = 20kJ, while using the full Ohm's law gives Efig > 40 kJ. This is due to magnetic self-guiding in the former case, and ∇n ×∇T magnetic fields in the latter. Using a realistic, quasi two-temperature energy spectrum derived from PIC laser-plasma simulations increases Efig to (102, 81, 162 kJ for (no E/B, E = ηJb, full Ohm's law. Such electrons are too energetic to stop in the optimal hot spot depth.
Fragakis, Nikolaos; Krexi, Lydia; Kyriakou, Panagiota; Sotiriadou, Melani; Lazaridis, Charalambos; Karamanolis, Athanasios; Dalampyras, Panagiotis; Tsakiroglou, Stelios; Skeberis, Vassilios; Tsalikakis, Dimitrios; Vassilikos, Vassilios
2018-01-01
Radiofrequency (RF) ablation of the slow pathway (SP) in atrioventricular nodal reentry tachycardia (AVNRT) is occasionally complicated with atrioventricular block (AVB) often predicted by junctional beats (JB) with loss of ventriculo-atrial (VA) conduction. We analyzed retrospectively 153 patients undergoing ablation of SP for typical AVNRT. Patients were divided into two age groups: 127 ≤ 70 years and 26 > 70 years. We analyzed the interval between the atrial electrogram in the His-bundle position and the distal ablation catheter [A(H)-A(RFd)] and between the distal ablation catheter and the proximal coronary sinus catheter [A(RFd)-A(CS)] before RF applications with and without JB. We evaluated if these intervals can be used as predictors of JB incidence and also of JB with loss of VA conduction. We also assessed if age influences the risk of loss of VA conduction. The A(H)-A(RFd) and A(RFd)-A(CS) intervals were significantly shorter in RF applications causing JB than those without JB (33 ± 11 ms vs 39 ± 9 ms, P JB with VA block than those with VA conduction (29 ± 11 ms vs 35 ± 11 ms, P 70 years had shorter intervals (36 ± 11 ms vs 29 ± 8 ms, P = 0.012, 17 ± 8 ms vs 13 ± 7 ms, P = 0.027, respectively), while VA block was more common in this age group. The A(H)-A(RFd) and A(RFd)-A(CS) intervals can be used as markers for predicting JB occurrence as well as impending AVB. JB with loss of VA conduction occur more often in older patients possibly due to a higher position of SP. © 2017 Wiley Periodicals, Inc.
A Mechanistic Study of Hydroboration of 1-Octene with 1,3,2 ...
African Journals Online (AJOL)
NJD
2009-02-09
Feb 9, 2009 ... Petersson, H. Nakatsuji, M. Hada, M. Ehara, K. Toyota, R. Fukuda, J. Hasegawa, M. Ishida, T. Nakajima, Y. Honda, O. Kitao, H. Nakai, M. Klene, X. Li, J.E. Knox, H.P. Hratchian, J.B. Cross, C. Adamo, J. Jaramillo, R. Gomperts, R.E. Stratmann, O. Yazyev, A.J. Austin, R. Cammi, C. Pomelli, J.W. Ochterski, P.Y. ...
Learning and judgment can be affected by predisposed fearfulness in laying hens
Haas, de Elske N.; Lee, Caroline; Rodenburg, Bas
2017-01-01
High fearfulness could disrupt learning and likely affects judgment in animals, especially when it is part of an animals' personality, i.e., trait anxiety. Here, we tested whether high fearfulness affects discrimination learning and judgment bias (JB) in laying hens. Based on the response to an open
International Nuclear Information System (INIS)
Chame, A.M.N.; Tsallis, C.
1988-01-01
The behaviour of the spontaneous surface and bulk magnetizations as function of the temperature for the Ising ferromagnet in a semi-infinitre cubic lattice for various ratios JS/JB (JS and JB are the surface and bulk coupling constants, respectively), is studied. The extraordinary transition where the surface maintains its magnetization as the bulk disorders, was study, in particular; a discontinuity on the first derivative of the surface magnetization at the bulk transition temperature was found. The criticality of the system (universality classes, critical exponents and amplitudes) is discussed. An unexpected slight lack of monotonicity of the surface magnetization as a function of JS/JB for JS/JB [pt
Граф Людвиг Август Меллин — друг крестьян и эстофил / Индрек Юрьо
Юрьо, Индрек, 1956-2009
2006-01-01
Mellini haridusteest ja Euroopa-reisist, tema reformaatorlikust aktiivsusest ja suhtumisest talupoegadesse. Mellini isikukirjeldus. Tuntud kartograafina oli tal ka huvi arheoloogia vastu. Mellini eestlaste kui rahvuse kirjeldusest ja nende tuleviku nägemusest. Mellini kirjast eestlaste ja lätlaste saksastamise kohta ja tema täiendustest krahv de Brai raamatule Baltimaade ajaloost. Mellini suhtumisest hernhuutlusesse. Krahv Mellin oli aastatel 1783-1786 Riia kreisi kreisipeamees ja -kohtunik, 1797-1818 osales aktiivselt 19. sajandi esimeste kümnendite agraarreformides, tema isa Carl Johann von Mellin oli esimene mõisnik Läänemere provintsides, kes umbes 18. sajandi keskpaiku andis oma Tuhala mõisa talupoegadele välja eraõiguse
Czech Academy of Sciences Publication Activity Database
Taylor, A. D.; Yu, Q.; Chen, S.; Homola, Jiří; Jiang, S.
2005-01-01
Roč. 107, č. 1 (2005), s. 202-208 ISSN 0925-4005. [European Conference on Optical Chemical Sensors and Biosensors EUROPT(R)ODE /7./. Madrid, 04.04.2004-07.04.2004] Grant - others:US FDA(US) FD-U-002250 Institutional research plan: CEZ:AV0Z20670512 Keywords : biosensors * surface plasmon resonance * optical sensors Subject RIV: JB - Sensors, Measurment, Regulation Impact factor: 2.646, year: 2005
JB_054_Supplementary_Tables.docx
Indian Academy of Sciences (India)
LENOVO
TRI 10032, T. aestivum L. var. aestivum, Mexico, Spring, Q4 ... TRI 10311, T. aestivum L. var. aestivum, Japan, Spring, Q2 ..... precursor (sucrose export defective 1), dihydrolipoamide dehydrogenase precursor, disulfide-isomerase precursor.
JB_054_Supplementary_Tables.docx
Indian Academy of Sciences (India)
LENOVO
TRI 3569, T. aestivum L. var. lutescens, Uruguay, Spring, Q4 ..... putative resistance complex protein, putative disease resistance protein, cold shock protein, barley stem rust resistance protein, seven transmembrane protein, cytochrome P450, glutamate dehydrogenase, pyruvate decarboxylase, peroxidase and chaperonin.
Adherence of Enterohemorrhagic Escherichia coli to Human Epithelial Cells: The Role of Intimin
1995-04-28
mucosa (e.g., enterotoxigenic E. coli, Vibrio cholerae , and Boroetella pertussis); ii) damage to the epithelial cell microvilli induced by the...diarrhea in Mayan childm in Mexico . J. Infect. Dis. 163, 507-513. G6mez-Ouarte, O.G. and Kaper, J.B. (1995). A plasmid-encoded regulartory region...de la Cabaca, F., and Garibay, E.V. (1987). Enteroadherent Escherichia coli as a cause of diarrhea among children in Mexico . J . Clin. Microbiol. 25
DEFF Research Database (Denmark)
Abdulmawjood, A.; Bulte, M.; Cook, N.
2003-01-01
As part of a major European research project, a diagnostic PCR assay, including an internal amplification control, was developed and validated in a collaborative trial for the detection of Escherichia coli O157. The assay is based on amplification of sequences of the rJbE O157 gene. The collabora...
Cancer of the cervix: The Uganda guidelines | Kiguli-Malwadde ...
African Journals Online (AJOL)
E Kiguli-Malwadde, AM Gakwaya, AJ Robinson, JB Kigula Mugambe, AK Luwaga. Abstract. No Abstract. Full Text: EMAIL FREE FULL TEXT EMAIL FREE FULL TEXT · DOWNLOAD FULL TEXT DOWNLOAD FULL TEXT · AJOL African Journals Online. HOW TO USE AJOL... for Researchers · for Librarians · for Authors ...
Impact of biodiesel blend on injector deposit formation
International Nuclear Information System (INIS)
Liaquat, A.M.; Masjuki, H.H.; Kalam, M.A.; Rizwanul Fattah, I.M.
2014-01-01
Continued legislative pressure to reduce exhaust emissions from CI (compression ignition) has resulted in the development of advanced fuel injection equipment. This advanced injection system produces higher temperatures and pressures at the injector tip, where deposit formation is initiated. In this research, an endurance test was carried out for 250 h on 2 fuel samples; DF (diesel fuel) as baseline fuel and JB20 (20% jatropha biodiesel and 80% DF) in a single-cylinder CI engine. The effects of JB20 on injector nozzle deposits, engine lubricating oil, and fuel economy and exhaust emissions were investigated during the endurance test. According to the results of the investigation, visual inspection showed some deposit accumulation on injectors for both fuel samples. SEM (scanning electron microscopy) and EDX (energy dispersive X-ray spectroscopy) analysis showed greater carbon deposits on and around the injector tip for JB20 compared to the engine running with DF. Similarly, lubricating oil analysis presented excessive wear metal concentrations and decreased viscosity values when the engine was fueled with JB20. Finally, fuel economy and emission results during the endurance test showed higher BSFC (brake specific fuel consumption) and NO x emissions, and lower HC (hydrocarbons) and CO (carbon monoxide) emissions, for the JB20 blend compared to DF. - Highlights: • Endurance test for 250 h on 2 fuel samples; diesel fuel and JB20. • Investigation on effects of JB20 on the injector deposits and exhaust emissions. • Lubricating oil analysis during endurance test. • SEM (scanning electron microscopy) analysis. • EDX (energy dispersive X-ray spectroscopy) analysis
New hematological key for bovine leukemia virus-infected Japanese Black cattle.
Mekata, Hirohisa; Yamamoto, Mari; Kirino, Yumi; Sekiguchi, Satoshi; Konnai, Satoru; Horii, Yoichiro; Norimine, Junzo
2018-02-20
The European Community's (EC) Key, which is also called Bendixen's Key, is a well-established bovine leukemia virus (BLV) diagnostic method that classifies cattle according to the absolute lymphocyte count and age. The EC Key was originally designed for dairy cattle and is not necessarily suitable for Japanese Black (JB) beef cattle. This study revealed the lymphocyte counts in the BLV-free and -infected JB cattle were significantly lower than those in the Holstein cattle. Therefore, applying the EC Key to JB cattle could result in a large number of undetected BLV-infected cattle. Our proposed hematological key, which was designed for JB cattle, improves the detection of BLV-infected cattle by approximately 20%. We believe that this study could help promote BLV control.
E-cigarettes in patients with COPD: current perspectives
Directory of Open Access Journals (Sweden)
Morjaria JB
2017-11-01
Full Text Available JB Morjaria,1,2 E Mondati,3,4 R Polosa3–5 1Department of Respiratory Medicine, Royal Brompton and Harefield Hospital Foundation Trust, Harefield Hospital, Harefield, 2Department of Respiratory Medicine, Imperial College, London, UK; 3Department of Clinical and Experimental Medicine, 4Department of Internal and Emergency Medicine, 5Centro per la Prevenzione e Cura del Tabagismo (CPCT, “Policlinico-V. Emanuele,” University of Catania, Catania, Italy Abstract: Conventional cigarette smoking is known to result in significant COPD morbidity and mortality. Strategies to reduce and/or stop smoking in this highly vulnerable patient group are key public health priorities to reduce COPD morbidity and mortality. Unfortunately, smoking cessation efforts in patients with COPD are poor and there is a compelling need for more efficient approaches to cessation for patients with COPD. Electronic cigarettes (ECs are devices that use batteries to vaporize nicotine. They may facilitate quit attempts and cessation in many smokers. Although they are not risk free, ECs are much less harmful than tobacco smoking. Hence, the use of ECs in vulnerable groups and in patients with challenges to abstain or multiple relapses to this habit may be promising. To date, little is known about health consequences of EC use among COPD smokers and whether their regular use has any effects on subjective and objective COPD outcomes. In the current review, we discuss the current perspectives and literature on the role of ECs in abstaining from conventional smoking and the effects of ECs on the respiratory tract in patients with COPD. Keywords: smoking cessation, electronic cigarette, COPD, tobacco harm reduction
Purcell, A.; Tregoning, P.; Dehecq, A.
2018-02-01
The empirical approximation of Purcell et al. (2011, https://doi.org/10.1029/2011GL048624) has been validated by Peltier et al. (2018, https://doi.org/10.1002/2016JB013844). In their Comment they introduced new results derived from the same ice/rheology models of ICE6G_C (VM5a) but using a different model for Antarctic bathymetry. This has greatly reduced the differences in predicted Antarctic uplift rates relative to those of Purcell et al. (2016, https://doi.org/10.1002/2015JB012742). In fact, with a ˜50% reduction in uplift rate in the Weddell Sea, the results of Peltier et al. (2018, https://doi.org/10.1002/2016JB013844) now agree more closely with the predictions of Purcell et al. (2016, https://doi.org/10.1002/2015JB012742) than with the original ICE6G_C values. Peltier et al. (2018, https://doi.org/10.1002/2016JB013844) state that the high power in their high-frequency spherical harmonic coefficients remains in their new calculations. They also claim that Purcell et al. (2016, https://doi.org/10.1002/2015JB012742) used an inaccurate loading history in deriving their velocity field. In fact, the ice load history was unchanged; to remove any ambiguity, the ice and water load histories used in the CALSEA calculations are provided in the supporting information.
International Nuclear Information System (INIS)
El-Seesy, Ahmed I.; Abdel-Rahman, Ali K.; Bady, Mahmoud; Ookawara, S.
2017-01-01
Highlights: • Considerable improvements in the combustion of JB20D50MWCNTs compared to pure JB20D. • p_m_a_x, dp/dθ_m_a_x and dQg/dθ_m_a_x increased by 7%, 4% and 4%, respectively. • Brake specific fuel consumption decreased by 15%. • NO_x, CO, and UHC reduced by 35%, 50%, and 60%, respectively. • Significant enhancement in all engine performance was achieved at a concentration of 40 mg/l. - Abstract: In this work, the effects of adding Multi-Walled Carbon nanotubes (MWCNTs) to Jojoba methyl ester-diesel blended fuel (JB20D) on performance, combustion and emissions characteristics of a compression-ignition engine were experimentally investigated. The JB20D with 10, 20, 30, 40 and 50 mg/l of MWCNTs were examined at different engine loads and speeds. Compared to pure diesel, the use of JB20D without MWCNTs caused a slight decrease in the engine performance and an increase in the engine emissions at most examined conditions. The MWCNTs–B20D blended fuel attained a maximum increase of 16% in the brake thermal efficiency and a decrease of 15% in the brake specific fuel consumption at the dose level of 50 mg/l compared to JB20D. The MWCNTs-JB20D blended fuel also brought about an enhancement in combustion characteristics where the peak cylinder pressure, the maximum rate of pressure rise and the peak heat release rate were increased by 7%, 4%, and 4%, respectively, at the same dose level. According to the measured emissions, a significant reduction of engine emissions was achieved at the dose level of 20 mg/l, where NO_x, CO, and UHC were reduced by 35%, 50%, and 60%, respectively. According to the obtained results, the recommended concentration of MWCNTs in JB20D was concluded to be 40 mg/l, which could give significant improvements in overall the parameters of engine performance and emissions with a good balance between them.
O(α2L2) radiative corrections to deep inelastic ep scattering for different kinematical variables
International Nuclear Information System (INIS)
Bluemlein, J.
1994-03-01
The QED radiative corrections are calculated in the leading log approximation up to O(α 2 ) for different definitions of the kinematical variables using jet measurement, the 'mixed' variables, the double angle method, and a measurement based on θ e and y JB . Higher order contributions due to exponentiation of soft radiation are included. (orig.)
International Nuclear Information System (INIS)
Soliman, N.F.; EL-Shershaby, A.; EL-Bahi, S.; Walley El-Dine, N.; Abd El-Halim, E.S.; Afifi, S.
2012-01-01
A marble sample was taken from Hatnub area near Asyot, where a high pollution is expected. The sample was specially treated and prepared for elemental analysis using the k 0 -based internal mono standard neutron activation analysis . The irradiation facility of the first Egyptian Training Research Reactor (ETRR-1) was used to irradiate the sample together with gold and zirconium monitor samples. The pneumatic irradiation rabbit system (PIRS) built in the vertical thermal column of the second Egyptian Training Research Reactor (ETRR-2) was used to irradiate another weight of the marble sample and a sample from a certificated reference material JB-1 for short time irradiation. A new method was developed to measure the thermal to epithermal neutron flux ratio and the deviation in the real epithermal neutron spectrum ( 1/E 1±a lpha ) from the ideal (1/E ). The elemental analysis was carried out by high-resolution gamma-ray spectrometry. The accuracy of the internal mono standard method has been evaluated by analyzing the JB-1 certified reference material
2014-10-01
1063-70. PMC2783430. 2. Zhang J, Jima DD, Jacobs C, Fischer R, Gottwein E, Huang G, Lugar PL, Lagoo AS, Rizzieri DA, Friedman DR, Weinberg JB...Khoury, Thomas R Klumpp, Hillard M Lazarus, Victor A Lewis, Philip L McCarthy, David A Rizzieri, Mitchell Sabloff, Jeff Szer, Martin S Tallman, and...malignant human B cells identifies hundreds of novel microRNAs. Blood. 2010;116(23):e118-27 5. Zhang J, Jima DD, Jacobs C, Fischer R, Gottwein E, Huang G
1999-05-01
2l.SU -Wf6e:uJfr-02tSU -V 69E ;W 9-2l IS« 0VS9 v 6se :w e"g(HSH ttWS:uJB-86SU ¥0l-8:uJ9"fr6SUOVW WW2 :lug-98SU U68l-:ujg-,£SSH — —VZL-VU61ZSU...and JAYCOR conducted infrared window material optical properties experiments; Lawrence Livermore National Laboratory (LLNL) conducted 146 device
Outsourcing Introduction in Production Enterprises
Mikhail N. Dudin; Oleg B. Korolev; Nikolai V. Lyasnikov
2013-01-01
In the modern period of competition size and nature change, becoming international in nature, the sustainable development of Russia is of high priority. The most important factor in ensuring sustainable development of the country is the increase of economic entities efficiency and competitiveness through the use of innovative management tools.Aaldersom R., E. Andersonom, S. Wilson, M. Donnellan, E. Jordan, B. Trinkl, JB Heywood and a number of other foreign theorists and practitioners conside...
Czech Academy of Sciences Publication Activity Database
Poplová, Michaela; Sovka, P.; Cifra, Michal
2017-01-01
Roč. 12, č. 12 (2017), č. článku e0188622. E-ISSN 1932-6203 R&D Projects: GA ČR(CZ) GA13-29294S Grant - others:AV ČR(CZ) SAV-15-22 Program:Bilaterální spolupráce Institutional support: RVO:67985882 Keywords : Poisson distribution * Photons * Neutrophils Subject RIV: JB - Sensors, Measurment, Regulation OBOR OECD: Electrical and electronic engineering Impact factor: 2.806, year: 2016
Coexistent duodenal ulcer among patients with gastric carcinoma
African Journals Online (AJOL)
logic est. 1987; of s, 1987. 210: 990. 1980. ) 1960; ression. 0-year l fusion ontrolled of. Hong. Anterior. 64: one Joint hia: JB r hanical one Joint for the in the e study ... Antrum. Diffuse. Borrmann type. I. 11. III. IV. Early cancer. Metastasis. Successful resection. Diffuse tumour·involving both body and antrum; NS: not significant.
Involvement of the TonB system in tolerance to solvents and drugs in Pseudomonas putida DOT-T1E.
Godoy, P; Ramos-González, M I; Ramos, J L
2001-09-01
Pseudomonas putida DOT-T1E is able to grow with glucose as the carbon source in liquid medium with 1% (vol/vol) toluene or 17 g of (123 mM) p-hydroxybenzoate (4HBA) per liter. After random mini-Tn5'phoA-Km mutagenesis, we isolated the mutant DOT-T1E-PhoA5, which was more sensitive than the wild type to 4HBA (growth was prevented at 6 g/liter) and toluene (the mutant did not withstand sudden toluene shock). Susceptibility to toluene and 4HBA resulted from the reduced efflux of these compounds from the cell, as revealed by accumulation assays with (14)C-labeled substrates. The mutant was also more susceptible to a number of antibiotics, and its growth in iron-deficient minimal medium was inhibited in the presence of ethylenediamine-di(o-hydroxyphenylacetic acid (EDDHA). Cloning the mutation in the PhoA5 strain and sequencing the region adjacent showed that the mini-Tn5 transposor interrupted the exbD gene, which forms part of the exbBD tonB operon. Complementation by the exbBD and tonB genes cloned in pJB3-Tc restored the wild-type characteristics to the PhoA5 strain.
Regulation of TRAIL-Medicated Apoptosis in Prostate Cancer by Overexpression of XIAP
2005-01-01
to a composite element, and YY1 and E1A cooperate to amplify p53 promoter activity. Mol Cell Biol 1996, 16:5933-5945 41. Guo J, Casolaro V, Seto E...Lian JB, Bushmeyer S, Seto E, Atchison ML, Penman S, van Wijnen AJ, Stein GS: Targeting of the YY1 transcription factor to the nucleolus and the...Multiple Cell Types and Tissues. The Journal of Biological Chemistry . 277: 9637-9640. 12. Lorch AS, Foust III R, Gow A, Arkoviz A, Salzman AL, Szabo
2012-10-01
neurodegenerative disorders, including schizophrenia [45, 46], bipolar disorder [47], Parkinson’s disease and Alzheimer’s disease [18, 48]. Extensive...Prostaglandins Leukot Essent Fatty Acids 67:341–343 36. Adams JB, Audhya T, McDonough-Means S, Rubin RA, Quig D , Geis E, Gehn E, Loresto M, Mitchell J, Atwood S...Barnhouse S, Lee W (2011) Effect of a vitamin /mineral supplement on children and adults with autism. BMC Pediatr 11:111 37. Al Gadani Y, El Ansary A
Cook, Jesse D; Prairie, Michael L; Plante, David T
2018-04-30
To evaluate the ability of a multisensory fitness tracker, the Jawbone UP3 (JB3), to quantify and classify sleep in patients with suspected central disorders of hypersomnolence. This study included 43 patients who completed polysomnography (PSG) and a Multiple Sleep Latency Test (MSLT) with concurrent wrist-worn JB3 and Actiwatch 2 (AW2) recordings for comparison. Mean differences in nocturnal sleep architecture variables were compared using Bland-Altman analysis. Sensitivity, specificity, and accuracy were derived for both devices relative to PSG. Ability of the JB3 to detect sleep onset rapid eye movement periods (SOREMPs) during MSLT naps was also quantified. JB3 demonstrated a significant overestimation of total sleep time (39.6 min, P device cannot be used as a surrogate for PSG or MSLT in the assessment of patients with suspected central disorders of hypersomnolence. Copyright © 2018 American Academy of Sleep Medicine. All rights reserved.
Energy Technology Data Exchange (ETDEWEB)
Frank, D.
1999-07-01
This social history and biography of James Bryson McLaughlin (1869-1916) describes McLaughlin's leadership as an educator and instigator in organizing Nova Scotia's coal miners during the labour wars in the 1920s. McLaughlin's background and childhood, education, reputation, religion, family life, health, and death are described. Included are descriptions of the life of coal miners in Cape Breton, radical left politics in Canada and the organizers involved, the political economy of the coal industry, child labour, churches, coal markets and prices, company towns and housing, mining disasters and fatalities, elections, First World War efforts, the depression, immigrants, and strikes. The labour organizations, companies, churches, and politicians involved in the struggles for union acceptance are discussed. 872 refs., 7 figs., 24 photos.
Prevention and management of vascular complications in middle ear and cochlear implant surgery.
Di Lella, Filippo; Falcioni, Maurizio; Piccinini, Silvia; Iaccarino, Ilaria; Bacciu, Andrea; Pasanisi, Enrico; Cerasti, Davide; Vincenti, Vincenzo
2017-11-01
The objective of this study is to illustrate prevention strategies and management of vascular complications from the jugular bulb (JB) and internal carotid artery (ICA) during middle ear surgery or cochlear implantation. The study design is retrospective case series. The setting is tertiary referral university hospital. Patients were included if presented pre- or intraoperative evidence of high-risk anatomical anomalies of ICA or JB during middle ear or cochlear implant surgery, intraoperative vascular injury, or revision surgery after the previous iatrogenic vascular lesions. The main outcome measures are surgical outcomes and complications rate. Ten subjects were identified: three underwent cochlear implant surgery and seven underwent middle ear surgery. Among the cochlear implant patients, two presented with anomalies of the JB impeding access to the cochlear lumen and one underwent revision surgery for incorrect positioning of the array in the carotid canal. Subtotal petrosectomy was performed in all cases. Anomalies of the JB were preoperatively identified in two patients with attic and external auditory canal cholesteatoma, respectively. In a patient, a high and dehiscent JB was found during myringoplasty, while another underwent revision surgery after iatrogenic injury of the JB. A dehiscent ICA complicated middle ear effusion in one case, while in another case, a carotid aneurysm determined a cholesterol granuloma. Rupture of a pseudoaneurysm of the ICA occurred in a child during second-stage surgery and required permanent balloon occlusion without neurological complications. Knowledge of normal anatomy and its variants and preoperative imaging are the basis for prevention of vascular complications during middle ear or cochlear implant surgery.
Autistic Spectrum Disorder and Assistive Technology: Action Research Case Study of Reading Supports
Lindsey, Pam
2012-01-01
This descriptive action research experience with case study procedures examined the use of best practices paired with assistive technologies as interventions to individualize fiction reading instruction for a high-functioning elementary student, JB (pseudonym), diagnosed with autistic spectrum disorder. JB's instructional, reading goals were to…
African Journals Online (AJOL)
abp
2016-04-20
Apr 20, 2016 ... Dis. 005 Oct; 11(10):1642–1644. PubMed | Google Scholar. 5. Ogbu O, Ajuluchukwu E and Uneke CJ. Lassa fever in West. Africa sub-region: an overview. J Vect Borne Dis. 2007;44(1):1-11. PubMed | Google Scholar. 6. McCormick JB, Webb PA, Krebs JW, Johnson KM, Smith ES. A prospective study of the ...
MARSnet: Mission-aware Autonomous Radar Sensor Network for Future Combat Systems
2009-03-23
in the set is: = R,lv(TmodN] )RbJb’ (rmodN2) IEN2, ifr = 0,i=j 0, if 0 < \\T\\ < Ni - l,i = j (10) 0, if* 9* J According to Definition 3...Telecommunications Engineering University of Texas at Arlington Beijing University of Posts and Tele. AArlington. TX 76010. USA Beijing 100876, China E-mail
Modeling the Carbon Implications of Ecologically-Based Forest Management
2015-08-01
Fule, P.Z., Moore, M.M., Hart, S.C., Kolb , T.E., Mast, J.N., Sackett, S.S., Wagner, M.R., 1997. Restoring ecosystem health in ponderosa pine forests of...Botanical Society 129, 289-297. Dore, S., Kolb , T.E., Montes-Helu, M., Sullivan, B.W., Winslow, W.D., Hart, S.C., Kaye, J.P., Koch, G.W...Dore, S., M. Montes-Helu, S.C. Hart, B.A. Hungate, G.W. Koch, J.B. Moon, A.J. Finkral, T.E. Kolb . 2012. Recovery of ponderosa pine ecosystem carbon and
Modeling the Carbon Implications of Ecologically Based Forest Management
2015-08-20
Fule, P.Z., Moore, M.M., Hart, S.C., Kolb , T.E., Mast, J.N., Sackett, S.S., Wagner, M.R., 1997. Restoring ecosystem health in ponderosa pine forests of...Botanical Society 129, 289-297. Dore, S., Kolb , T.E., Montes-Helu, M., Sullivan, B.W., Winslow, W.D., Hart, S.C., Kaye, J.P., Koch, G.W...Dore, S., M. Montes-Helu, S.C. Hart, B.A. Hungate, G.W. Koch, J.B. Moon, A.J. Finkral, T.E. Kolb . 2012. Recovery of ponderosa pine ecosystem carbon and
Effect of salt on color and warmed over flavor in charqui meat processing
Directory of Open Access Journals (Sweden)
Youssef Elza Y.
2003-01-01
Full Text Available A combination of salt (NaCl high concentration and curing salt was investigated for their role in warmed-over flavor (WOF and color changes during charqui meats processing. WOF was measured by TBARS method in uncured charqui meat (CH and in cured charqui known in Brazil as Jerked beef (JB. WOF occurred substantially in CH and sodium nitrite was able to inhibit 40-45% (p<0.05 in JB samples stored for 30 days. Color parameters also changed as evaluated by CIELAB system. The a*/b* ratio showed that CH samples presented brown color indicating the formation of metmyoglobin (Fe3+ whilst JB samples presented deep red color an indication of nitrosylmyoglobin (Fe2+ formation. Under cooking, a*/b* ratio indicated the presence of denatured metmyoglobin (Fe3+ in CH and formation of nitrosylmyochromogen (Fe2+ in JB samples. The actual iron state influenced the color of charqui meat and apparently nitrite was able to chelate Fe ions, thus inhibiting development of WOF.
1989-10-01
Fig. I A-I). Cerebro ~.iscular 4. and svsternic hcmodsnarmc to!- ’. -lowing resuscitation ’from hem- orrhagic shock in the presence S2- / 4 of a...intratranial mass in dogs Cerebro - %uscular effects of resuscitation fluid choices Ancsth Analg 6’ 259 763 2tW ?%5..Cg -- ’ 384 CRITICAL CARE MEDICINE...184, 1967 8. Prior PF, Maynard DE, Brierley JB: E.E.G. monitoring for the control of anaesthesia produced by the infusion of althesin in primates . Br
Lifescience Database Archive (English)
Full Text Available H01313 Escherichia coli meningitis; Neonatal meningitis-associated Escherichia col...i (NMEC) infection Escherichia coli meningitis is a bacterial meningitis caused by Escherichia coli, and is ...common in the newborn within the first month of life (neonatal meningitis). Neonatal meningitis-associated E...e genome sequence of the neonatal-meningitis-associated Escherichia coli strain CE10. ... JOURNAL ... J Bacteriol 193:7005 (2011) DOI:10.1128/JB.06284-11 ...ngitis. Infectious disease ... Escherichia coli (NMEC) [GN:eoc ecz eih] ... ICD-10: G
Subduction of the Rivera plate beneath the Jalisco block as imaged by magnetotelluric data
Corbo-Camargo, Fernando; Arzate-Flores, Jorge Arturo; Álvarez-Béjar, Román; Aranda-Gómez, José Jorge; Yutsis, Vsevolod
2013-01-01
Two magnetotelluric (MT) profiles perpendicular to the trench provide information on the subduction of the Rivera plate under the Jalisco block (JB). The geometry of the subducting slab is inferred by the anomalous conductor on the top of the profile in the central part of the JB. High conductivity zones (
8.3 Microbiology and Biodegradation: A New Bacterial Communication System
2014-04-09
Approved for Public Release; Distribution Unlimited 8.3 Microbiology and Biodegradation: A new bacterial communication system The views, opinions and...JB.01479-10 Federico E. Rey, Caroline S. Harwood. FixK, a global regulator of microaerobic growth, controls photosynthesis in Rhodopseudomonas...Quorum sensing is a term used to describe bacterial cell-to-cell communication that allows cell-density-dependent gene expression. There are many
International Nuclear Information System (INIS)
El Abd, A.
2009-01-01
Threshold reactions induced by reactor fast neutrons are well recognized. The concentration of Fe and Ni were determined in nine geological samples by activation analysis with reactor fast neutrons using the threshold reactions 5 4F e( n,p) 54 Mn and 58 Ni ( n, p )'5 8 Co respectively. The fast neutron flux was determined using the reactions 92 Mo(n, 2n) 92 mNb and 95 Mo(n,p) 95 Nb. The determined concentration of Fe and Ni in the samples were checked by determining them in the GSJ JB-1 reference material using the same , ( p, n) reactions. There are a good agreement between the measured and recommended values. The concentrations of Fe were also determined by the ) , ( n, γ) capture reactions in the geological samples and the JB-1 reference material using the K θ - NAA method. There are good agreements between the determined concentrations from the ) , ( p, n) and the ( γ, n) reactions.
Flux creep and fishtail in melt-textured and single-crystalline YBa2Cu3O7
International Nuclear Information System (INIS)
Kuepfer, H.; Wolf, T.; Kresse, R.; Meier-Hirmer, R.; Salama, K.; Lee, D.; Selvamanickam, V.
1994-01-01
Time-dependent decay of the magnetic moment and magnetization measurements were used to study pinning and flux creep in two samples with and without a j(B) maximum in nonzero field (fishtail effect). From both measurements the E(j) relation was reconstructed for B | c and the characteristic current exponent μ was obtained. At high j and low B μ values are between 1 and 4; with increasing B μ passes a maximum and approaches negative values. At low j μ is below 0.5 and not dependent on B or j. This behavior, which is qualitatively the same in both samples, is compared with proposed phase diagrams of the vortex lattice. Large μ values are correlated with the plateau of the normalized creep rate S ∼ 0.025; both observations indicate low relaxation and are found in that low B region for which j(B) has its minimum. This observation rejects a dominating influence of relaxation on the fishtail effect. 13 refs., 3 figs
Directory of Open Access Journals (Sweden)
Anderson de Moura Zanine
2016-01-01
Full Text Available This study aimed to evaluate the effects of Streptococcus bovis on the fermentation characteristics and nutritive value of Tanzania grass silage. Tanzania grass was chopped and left untreated (U or treated with Streptococcus bovis JB1 at 1 × 106 colony-forming units per gram (cfu/g of fresh forage or Streptococcus bovis HC5 at 1 × 106 cfu/g of fresh forage and packed into sixtuplicate laboratory silos. The largest number of enterobacteria, molds and yeast (M&Y occurred in untreated silages and the smallest populations of enterobacteria and M&Y and the largest numbers of lactic acid bacteria (LAB, at 9.81 and 9.87 log cfu/g, were observed in Streptococcus bovis JB1 and HC5, respectively (P<0.05. Silages treated with JB1 and HC5 had lower (P<0.05 silage pHs and concentrations of ammoniacal nitrogen (NH3-N than untreated silages. The application of Streptococcus bovis JB1 and HC5 resulted in fewer losses through gases and effluents (P<0.05, which resulted in greater dry matter recovery (DMR and crude protein recovery (CPR (P<0.05. Streptococcus bovis JB1 and HC5 improved the fermentative profile and increased the concentration of crude protein and DMR and CPR in Tanzania grass silage.
Modified jailed balloon technique for bifurcation lesions.
Saito, Shigeru; Shishido, Koki; Moriyama, Noriaki; Ochiai, Tomoki; Mizuno, Shingo; Yamanaka, Futoshi; Sugitatsu, Kazuya; Tobita, Kazuki; Matsumi, Junya; Tanaka, Yutaka; Murakami, Masato
2017-12-04
We propose a new systematic approach in bifurcation lesions, modified jailed balloon technique (M-JBT), and report the first clinical experience. Side branch occlusion brings with a serious complication and occurs in more than 7.0% of cases during bifurcation stenting. A jailed balloon (JB) is introduced into the side branch (SB), while a stent is placed in the main branch (MB) as crossing SB. The size of the JB is half of the MB stent size. While the proximal end of JB attaching to MB stent, both stent and JB are simultaneously inflated with same pressure. JB is removed and then guidewires are recrossed. Kissing balloon dilatation (KBD) and/or T and protrusion (TAP) stenting are applied as needed. Between February 2015 and February 2016, 233 patients (254 bifurcation lesions including 54 left main trunk disease) underwent percutaneous coronary intervention (PCI) using this technique. Procedure success was achieved in all cases. KBD was performed for 183 lesions and TAP stenting was employed for 31 lesions. Occlusion of SV was not observed in any of the patients. Bench test confirmed less deformity of MB stent in M-JBT compared with conventional-JBT. This is the first report for clinical experiences by using modified jailed balloon technique. This novel M-JBT is safe and effective in the preservation of SB patency during bifurcation stenting. © 2017 Wiley Periodicals, Inc.
Bibliography on Cold Regions Science and Technology. Volume 43. Part 2
1989-12-01
North. Larionov, V.P.. ed. USA. Bates, R.E.. Cit3, (I988, pI07-II7, cog1 See talso): Logistica (1987, 91p, rus5 43-112 43-602 Military transportation ...Abbrsszzene, F. Achamal, E.M. de Current status and prospects for automatin of snow ava- Draining deicing pavings for bridge stabs (1989, p.14-19...engj 43.3732 Assilar, J.B., de Abdakarlmov, A.T. Development of sea ice in the Weddell Sea (1989, p.92-96, Elasticity solutions for semi-infinite ice
Omorogbe, Osarume; Ajayi, Abayomi M; Ben-Azu, Benneth; Oghwere, Ejiroghene E; Adebesin, Adaeze; Aderibigbe, Adegbuyi O; Okubena, Olajuwon; Umukoro, Solomon
2018-02-01
Rheumatoid arthritis (RA) is a chronic inflammatory disease that affects the physical and psychosocial wellbeing of the patients and a major cause of work disability. Current drugs for its treatment only provide palliative effect, as cure for the disease still remains elusive. Jobelyn ® (JB), a potent anti-oxidant and anti-inflammatory dietary supplement obtained from Sorghum bicolor, has been claimed to relieve arthritic pain. Thus, this study was designed to evaluate its effect on inflammatory and biochemical changes as well as neurobehavioural deficits associated with complete Freund-adjuvant (CFA)-induced arthritis in mice. The effect of JB (50, 100 and 200 mg/kg) on inflammatory oedema, neurobehavioural deficits, levels of biomarkers of oxidative stress and inflammatory cytokines (tumor necrosis factor-alpha and interleukin-6) induced by 0.1 mL of CFA (10 mg/mL) was evaluated in male Swiss mice. Oral administration of JB (100 and 200 mg/kg) reduced inflammatory paw volume and reversed sensorimotor deficits induced by CFA. JB also reduced pain episodes, anxiety and depressive-like symptoms in CFA-mice. The increased level of oxidative stress in the joint and brain tissues of CFA-mice was reduced by JB. It also decreased tumor necrosis factor-alpha and interleukin-6 levels induced by CFA in the joint tissue of mice. These findings suggest that Jobelyn ® attenuates inflammatory responses induced by CFA in mice via inhibition of oxidative stress and release of inflammatory cytokines. The ability of JB to attenuate CFA-induced nociception, sensorimotor deficits and depressive-like symptom suggests it might improve the quality of life of patients with arthritic conditions. Copyright © 2017 Elsevier Masson SAS. All rights reserved.
Extraction of ecdysterone from roots of Brazilian ginseng
Flores, Rejane; Nicoloso, Fernando Teixeira; Brondani, Daniela; Maldaner, Joseila; Cezarotto, Verciane; Giacomelli, Sandro Rogério
2009-01-01
Este estudo teve como objetivo otimizar a extração de ecdisterona em raízes de ginseng brasileiro. Primeiramente, para se avaliar a eficiência do solvente extrator, amostras de raízes dois acessos (BRA e JB-UFSM) de P. glomerata foram extraídas em Soxhlet com metanol e clorofórmio, separadamente, durante 4 horas. No segundo ensaio, com o intuito de se escolher o método extrator, a extração foi conduzida em Soxhlet e em ultrassom, utilizando metanol como solvente. Em P. tuberosa, as amostras f...
Extração de ecdisterona em raízes de ginseng brasileiro
Flores,Rejane; Nicoloso,Fernando Teixeira; Brondani,Daniela; Maldaner,Joseila; Cezarotto,Verciane; Giacomelli,Sandro Rogério
2009-01-01
Este estudo teve como objetivo otimizar a extração de ecdisterona em raízes de ginseng brasileiro. Primeiramente, para se avaliar a eficiência do solvente extrator, amostras de raízes dois acessos (BRA e JB-UFSM) de P. glomerata foram extraídas em Soxhlet com metanol e clorofórmio, separadamente, durante 4 horas. No segundo ensaio, com o intuito de se escolher o método extrator, a extração foi conduzida em Soxhlet e em ultrassom, utilizando metanol como solvente. Em P. tuberosa, as amostras f...
NCBI nr-aa BLAST: CBRC-OCUN-01-0782 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-OCUN-01-0782 ref|YP_797515.1| Prolipoprotein diacylglyceryltransferase [Leptospira borgpeter...senii serovar Hardjo-bovis L550] ref|YP_801264.1| Prolipoprotein diacylglyceryltransferase [Leptospira borgpeter...senii serovar Hardjo-bovis JB197] gb|ABJ78582.1| Prolipoprotein diacylglyceryltransferase [Leptospira borgpeter...in diacylglyceryltransferase [Leptospira borgpetersenii serovar Hardjo-bovis JB197] YP_797515.1 3.3 35% ...
CXCR4 Antagonist as an Adjuvant in Immunotherapy of Epithelial Ovarian Cancer
2017-07-01
oncogene activation in human tumors by chromosomal translocation. Subsequently, as an independent investigator, I expanded my research to virology by...activation (abl and myc) by chromosomal translocation in leukemia and solid tumors. Kozbor, D., Finan, J., Nowell, P.C., and Croce, C.M. The gene...encoding the T4 antigen maps to human chromosome 12. J. Immunol., 136: 1141-1143, 1986. Kozbor, D., Giallongo, A., Sierzega, M.E., Konopka, J.B
Manufacturing Methods and Technology Measure for Fabrication of Silicon Transcalent Rectifier.
1980-09-01
development and manufacturing as well as quality and reliability assurance of the 1 product. Marketing and Applications Engineering are responsible for...Prod Test/Eval’, z HA Kotler a Patent- Power & E 1 RM Roderick Env. Eng. & Test 1 JB Grosh Iron Mouptain - .l TUBE PARTS MFG. 5 RL SPALDING...Engineering Specification Request endorsed by authorized approvers from both Operations and Marketing . At this time, controlling Engineering Specifications
Varga, Marian; Pantůček, Roman; Růžičková, Vladislava; Doškař, Jirˇí
2016-01-01
In Staphylococcus aureus, generalized transduction mediated by temperate bacteriophages represents a highly efficient way of transferring antibiotic resistance genes between strains. In the present study, we identified and characterized in detail a new efficiently transducing bacteriophage of the family Siphoviridae, designated ϕJB, which resides as a prophage in the meticillin-resistant S. aureus (MRSA) strain Jevons B. Whole-genome sequencing followed by detailed in silico analysis uncovered a linear dsDNA genome consisting of 43 ,12 bp and comprising 70 ORFs, of which ∼40 encoded proteins with unknown function. A global genome alignment of ϕJB and other efficiently transducing phages ϕ11, ϕ53, ϕ80, ϕ80α and ϕNM4 showed a high degree of homology with ϕNM4 and substantial differences with regard to other phages. Using a model transduction system with a well-defined donor and recipient, ϕJB transferred the tetracycline resistance plasmid pT181 and a penicillinase plasmid with outstanding frequencies, beating most of the above-mentioned phages by an order of magnitude. Moreover, ϕJB demonstrated high frequencies of transferring antibiotic resistance plasmids even upon induction from a lysogenic donor strain. Considering such transducing potential, ϕJB and related bacteriophages may serve as a suitable tool for elucidating the nature of transduction and its contribution to the spread of antibiotic resistance genes in naturally occurring MRSA populations.
Afriani, S. R.; Pujiastuti, Y.; Irsan, C.; Damiri, N.; Nugraha, S.; Sembiring, E. R.
2018-01-01
This study aimed to obtain bacterial isolates B. thuringiensis potential as a biological control against pests Spodoptera litura. The research was conducted at the Laboratory of Pest and Disease Department, Agricultural Faculty of Sriwijaya University, Campus Inderalaya Ogan Ilir, South Sumatera, from March to June 2017. The study was conducted with survey method and laboratory trial. The results showed that of the 50 soil samples from three villages selected through morphological observation, reaction staining, KOH test, catalase test, producing 13 bacterial isolates. Screening of the 13th toxicity of the isolates suspected B. thuringiensis against S. litura larvae was investigated. Based on the toxicity screening test the following facts were obtained: five isolates ie KJ2M2, KJ3E1, KJ3JB1, KJ3D3 and KJ3D5 were lower toxicity than Dipel, two isolates ie KJ3K4 and KJ3D3 which had the same toxicity to Dipel. Five isolates the KJ3E3, KJ3BW5, KJ3JB5, KJ3D1 and LC2, LC3 known to have effectiveness until the seventh day reached 40%. There was one isolate that is KJ3BW5 which was more effective compared to Dipel as comparison.
Computer-Based Training Methods for Surgical Training
2009-10-07
said surgical procedure. 32. The rm:thod of daim 30. whcn.:in st~id linul dm ;~.: dimcnsional model is used to evaluate pcrKwmancc charac...of Environmental Aging Upon the Load Bearing Properties and Polyurethane Foams. Noble PC; Goode B; Krouskop TA; and Crisp B. Journal Rehab. Res. and...Surgery 77A: 513-523, 1995. 32. Partial Tears of the Anterior Cruciate Ligament. Are They Clinically Detectable? Lintner DM , Kamaric E, Moseley JB
1991-04-01
J.B., MCGANDY R.B. and KENNEDY A.R. (1978). Interactions Between Polonium - 210 Alpha-Radiation, Benzo(a)pyrene, and 0.9% NaCl Solution Instillations in...J.A. 1985 Changes in the collagen pathway in fibrosis. Fundam. Appl. Toxicol. 5: 210 -218. LAST, J.A., GERRIETS. J.E., ARMSTRONG, L.G.. GELZLEICHTER...Development (OECD) standard measurements such as body weight, food consumption, biochemical and Key words: Lung, retention, alveolar clearance, insoluble
Evaluation of the Effect of Jobelyn® on Chemoconvulsants- Induced Seizure in Mice
Directory of Open Access Journals (Sweden)
Solomon Umukoro
2013-04-01
Full Text Available Introduction: Epilepsy is a common central nervous system (CNS disorder characterized by seizures resulting from episodic neuronal discharges. The incidence of toxicity and refractoriness has compromised the clinical efficacy of the drugs currently used for the treatment of convulsions. Thus, there is a need to search for new medicines from plant origin that are readily available and safer for the control of seizures. Jobelyn® (JB is a unique African polyherbal preparation used by the natives to treat seizures in children. This investigation was carried out to evaluate whether JB has anti-seizure property in mice. Methods: The animals received JB (5, 10 and 20 mg/kg, p.o 30 min before induction of convulsions with intraperitoneal (i.p. injection of picrotoxin (6 mg/kg, strychnine (2 mg/ kg and pentylenetetrazole (85 mg/kg respectively. Diazepam (2 mg/kg, p.o. was used as the reference drug. Anti-seizure activities were assessed based on the ability of test drugs to prevent convulsions, death or to delay the onset of seizures in mice. Results: JB (5, 10 and 20 mg/kg, p.o could only delay the onset of seizures induced by pentylenetetrazole (85 mg/kg, i.p. in mice. However, it did not offer any protection against seizure episodes, as it failed to prevent the animals, from exhibiting tonic-clonic convulsions caused by pentylenetetrazole (85 mg/kg, i.p., strychnine (2 mg/kg or picrotoxin (6 mg/kg, i.p.. On the other hand, diazepam (2 mg/kg, p.o., offered 100% protection against convulsive seizures, induced by pentylenetetrazole (85 mg/kg, i.p.. However, it failed to prevent seizures produced by strychnine (2 mg/kg, i.p. or picrotoxin (6 mg/kg, i.p.. Discussion: Our results suggest that JB could not prevent the examined chemoconvulsants-induced convulsions. However, its ability to delay the latency to seizures induced by pentylenetetrazole suggests that JB might be effective in the control of the seizure spread in epileptic brains.
Unipolar Electric Machines with Liquid-Metal Current Pickup,
1984-03-08
A new homopolar motor , e4ournal of the Franklin Institute*. 1954, v. 258, Ne 1. %4 144093, Bjo.1.leTeJb H3o6peTeHxA. 1962,. 14 1. 30. X oao p o a...VIII. Motor Mode of Unipolar Electrical Machine ............... 301 Chapter IX. Bases of Theory and Calculation of Nonpolar Dynamos without...unipolar electric motors . Are examined questions of the classification of acyclic machines, their electromagnetic field, calculation of magnetic circuit
Exercise and Osteoporosis: A Dose-Response Meta-Analysis
2013-05-01
ground reaction force topic (701) Petersen T. The booming boomer market . American Fitness 2008 May;26(3):48-50. Not a BMD and/or ground reaction...K, Grunfeld C, Daar ES, LaMarca A, Kotler DP, Wang J, Bozzette SA, Breitmeyer JB. Recombinant human growth hormone in patients with HIV-associated...Skerry, “e response of bone to mechanical load- ing and disuse� fundamental principles and in�uences on osteoblast/osteocyte homeostasis,”Archives of
Ecosystem Management: Synthesis and Findings
2009-04-29
Imperata cylindrica, in the United States. Weed Technology 7:1005-1009. Faircloth, W.H. M.G. Patterson, J.H. Miller, and D.H. Teem. 2005. Wanted dead or...S.E., and J.B. Grace. 2000. The Effects of Gap Size and Disturbance Type on Invasion of wet pine savanna by Cogongrass, Imperata cylindrica (Poaceae...American Journal of Botany, Vol. 87, No. 9. (Sep., 2000), pp. 1279-1286. Lippincott, C.L. 2000. Effects of Imperata cylindrica (L.) Beauv
Žukovič, Milan; Tomita, Yusuke; Kamiya, Y.
2017-07-01
We study critical and magnetic properties of a bilayer Ising system consisting of two triangular planes A and B, with the antiferromagnetic (AF) coupling JA and the ferromagnetic (FM) one JB for the respective layers, which are coupled by the interlayer interaction JAB by using Monte Carlo simulations. When JA and JB are of the same order, the unfrustrated FM plane orders first at a high temperature Tc 1˜JB . The spontaneous FM order then exerts influence on the other frustrated AF plane as an effective magnetic field, which subsequently induces a ferrimagnetic order in this plane at low temperatures below Tc 2. When short-range order is developed in the AF plane while the influence of the FM plane is still small, there appears a preemptive Berezinskii-Kosterlitz-Thouless-type pseudocritical crossover regime just above the ferrimagnetic phase transition point, where the short-distance behavior up to a rather large length scale exponentially diverging in ∝JA/T is controlled by a line of Gaussian fixed points at T =0 . In the crossover region, a continuous variation in the effective critical exponent 4/9 ≲ηeff≲1/2 is observed. The phase diagram by changing the ratio JA/JB is also investigated.
Directory of Open Access Journals (Sweden)
Joh. Nobel
1953-01-01
Full Text Available - J. Wils, P. Drabbe, Spraakkunst van het Ekagi, Wisselmeren Ned. N. Guinea, XXI + 90 pag., ‘s-Gravenhage, M. Nijhoff 1952. - A. Teeuw, C. Hooykaas, Literatuur in Maleis en Indonesisch, J.B. Wolters, Groningen-Djakarta 1952, 406 ppg. - A. Teeuw, C. Hooykaas, Perintis sastera, terdjemahan Raihoel Amar gl. Datoek Besar; J.B. Wolters, Groningen-Djakarta 1951, 406 pgg. - A. Teeuw, C. Hooykaas, Penjedar sastera, terdjemahan Raihoel Amar gl. Datoek Besar; J.B. Wolters, Groningen-Djakarta 1952, 245 pgg. - C. Hooykaas, Sedjarah Melaju, menurut terbitan Abdullah (ibn Abdulkadir Munsji diselenggarakan kembali dan diberi anotasi oleh T.D. Situmorang dan Prof. Dr A. Teeuw dengan bantuan Amal Hamzah. Penerbit Djambatan. Djakarta/Amsterdam 1952. - J. Gonda, Joh. Nobel, Central Asia: The connecting link between east and west, and other lectures delivered at The International Academy of Indian Culture, Nagpur 1952.
NCBI nr-aa BLAST: CBRC-HSAP-07-0021 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-HSAP-07-0021 ref|YP_798483.1| hypothetical protein LBL_2137 [Leptospira borgpeter...senii serovar Hardjo-bovis L550] ref|YP_801392.1| hypothetical protein LBJ_2143 [Leptospira borgpeterseni...i serovar Hardjo-bovis JB197] gb|ABJ79550.1| Conserved hypothetical protein [Leptospira borgpetersenii serov...ar Hardjo-bovis L550] gb|ABJ76634.1| Conserved hypothetical protein [Leptospira borgpetersenii serovar Hardjo-bovis JB197] YP_798483.1 0.026 28% ...
NCBI nr-aa BLAST: CBRC-OCUN-01-1280 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-OCUN-01-1280 ref|YP_798310.1| hypothetical protein LBL_1947 [Leptospira borgpeter...senii serovar Hardjo-bovis L550] ref|YP_801037.1| hypothetical protein LBJ_1728 [Leptospira borgpeterseni...i serovar Hardjo-bovis JB197] gb|ABJ79377.1| Conserved hypothetical protein [Leptospira borgpetersenii serov...ar Hardjo-bovis L550] gb|ABJ76279.1| Conserved hypothetical protein [Leptospira borgpetersenii serovar Hardjo-bovis JB197] YP_798310.1 4.1 31% ...
1983-11-23
listed as P.1. because of University regulations.) The Ohio State Canine Research Funds, "Immunoprevention of Parvovirus -Induced Diarrhea of the Dog ...Rice, J.B., and Winters, K.A.: Canine parvovirus infection potentiates canine distemper encephalitis attributable to modified live virus vaccine . J...Am. Vet. Med. Assoc., 180:137-139, 1982. Rice, J.B., Krakowka, S., Winters, K.A., and Olsen, R.G.: Comparison of systematic and local immunity in dogs
African Journals Online (AJOL)
FOBUR
Juu·t.,mml qf On hope die. A.ddressas.· ctnd Tramm• . . los Univf!rsU)' TeachirtR Ho.'t.pilaf, Jos. "WI.- Divij,'J()rt o('!r.aumn. --'J,,.~ery T>e.pwtmenJ. los. U:niver.~ity ...... 161 mi"'~ ~ ~"'~ ~l\\. Nt,tdK1'1\\ Irclood 1. ~7o-84: tht'! HMtile Aa;oo. C;;b!tt.al.ly Sy~cm . .Or J Surg, 19&9;16: Hl-06-. lO. 17) Hull JB. (]()per GJ. Pattern and.
2009-06-01
Japanese men. Cancer Sci 95, 65-71 (2004). 85. Goetzl, M.A., Van Veldhuizen , P.J. & Thrasher, J.B. Effects of soy phytoestrogens on the prostate...radical prostatectomy. Am J Surg Pathol 28, 928-34 (2004). 63. Noordzij, M.A., Bogdanowicz, J.F., van Krimpen, C., van der Kwast, T.H. & van ...accumulation in prostatic fluid in caucasian men. J Nutr 135, 1400-6 (2005). 118. Hedlund, T.E., van Bokhoven, A., Johannes, W.U., Nordeen, S.K. & Ogden, L.G
The Effects of rhBMP-2 Used for Spinal Fusion on Spinal Cord Pathology After Traumatic Injury
2009-07-29
1219-1224; discussion 1225. Basso DM , Beattie MS, Bresnahan JC (1995) A sensitive and reliable locomotor rating scale for open field testing in rats...usage of rhBMP-2 in the anterior cervical spine. Spine 31:2813-2819. Stuesse SL, Crisp T, McBurney DL, Schechter JB, Lovell JA, Cruce WL (2001...250-256. Stuesse SL, Crisp T, McBurney DL, Schechter JB, Lovell JA, Cruce WL (2001) Neuropathic pain in aged rats: behavioral responses and
NCBI nr-aa BLAST: CBRC-TSYR-01-0989 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-TSYR-01-0989 ref|YP_796828.1| hypothetical protein LBL_0283 [Leptospira borgpeter...senii serovar Hardjo-bovis L550] ref|YP_801953.1| hypothetical protein LBJ_2788 [Leptospira borgpeterseni...i serovar Hardjo-bovis JB197] gb|ABJ77895.1| Hypothetical protein LBL_0283 [Leptospira borgpetersenii serova...r Hardjo-bovis L550] gb|ABJ77195.1| Hypothetical protein LBJ_2788 [Leptospira borgpetersenii serovar Hardjo-bovis JB197] YP_796828.1 4.4 38% ...
Chemical Characterization of Tribological and Biomaterial Surfaces With Nanoscale Spatial Resolution
2011-02-28
of Diamond-Like Carbon Film. Springer, New York, 2008. 2. Erdemir A. Eryilmaz O.L. Fenske G., Synthesis of diamondlike carbon films with superlow...and oxidizing environments, Wear 265 (2008) 244-254. 16. J.A. Johnson, J.B. Woodford, X.D. Chen, J. Andersson, A. Erdemir, G.R. Fenske , Insights...Mehta, S. Roy, J.A. Johnson, J.B. Woodford, A. Zinovev, Z. Islam, A. Erdemir, S. Sinha, G.R. Fenske , B. Prorok, X-Ray studies of near-frictionless
Hemorrhage Control for Major Traumatic Vascular Injuries
2017-10-01
TJ, Eastridge BJ, Gilani R, Chung KK, DeSantis SM, DuBose JJ , Tomasek TS, Fortuna GR, Sames VG, Todd SR, Podbielski JM, Wade CE, Holcomb JB and the...Eastridge BJ, Gilani R, Chung KK, DeSantis SM, DuBose JJ , Tomasek JS, Fortuna GR, Sams VG, Todd SR, Podbielski JM, Wade CE, Holcomb JB. Multicenter...Kisat M, Morrison JJ , Hashmi ZG, Efron DT, Rasmussen TE, Haider AH. Epidemiology and outcomes of non-compressible torso hemorrhage. J Surg Res. 2013;184
Re-evaluation of Cr concentration in some geostandard rocks by INAA
International Nuclear Information System (INIS)
Togashi, Shigeko; Kamioka, Hikari; Tanaka, Tsuyoshi; Ando, Atsushi
1990-01-01
Chromium in geological standard igneous rocks is precisely determined with a fully automated non-destructive neutron activation analysis. Samples are GSJ standard rocks (JP-1, JB-1, JB-1a, JA-3, JGb-1, JB-2, JA-1) and USGS ones (BCR-1 and G-2). Chromium concentration is determined relative to a chemical standard instead of a natural rock standard. Multiple aliquots of a slightly large amount of (200-300 mg) sample powder are analyzed to examine the heterogeneity in chromium concentration. The results agree with the consensus values within the errors of consensus values which have large coefficients of variation. The precise analysis and the examination on the distribution of reported values reveal the heterogeneity in chromium concentration of the sample powder. In particular, basaltic samples have heterogeneity in chromium concentration because of a small amount of chromite with extremely high chromium content. A chemical standard is useful to get high accuracy of chromium determination rather than natural standard materials. (author)
Computer-Aided Software Evolution Based on Inferred Dependencies
1999-12-01
of Technology, Taoyuan, Taiwan, 1980 M.B.A., National Defense Management College, Taipei, Taiwan, 1986 Submitted in partial fulfillment of the...JGuoJiang £3 Program Rles 1] PRCCaption.txt ^3 host-news ■BEH3JB1EH1 gpshcd98. pdf i_]Jlip E3 Video *) PSHCD98.ps _JJws20 Ü ~PDTS874.tmp ljlQuickTime30.exe...115 O’Keefe Building Georgia Institute of Technology Atlanta, GA 30332-0800 4. Dr. David Hislop Army Research Office 4300 S. Miami Blvd. Research
Raney copper catalysts for the water-gas shift reaction: I. Preparation, activity and stability
CSIR Research Space (South Africa)
Mellor, JR
1997-12-23
Full Text Available , T Haltchev, V Kafedjiiski, B. Kunev, M. Kalchev, I. Orizarski, D. Shopov, Proceedings ofthe Sixth International Symposium, Heterogeneous Catalysis, Part 1, Sofia, 1987, p. 235. \\[18\\] W.L. Marsden, M.S. Wainwright, J.B. Friedrich, Ind. Eng. Chem, Prod... and Testing of Catalysts, Academic Press, New York, 1985. \\[33\\] J.M. Thomas, J.W. Thomas, Introduction to the Principles of Heterogeneous Catalysis, Academic Press, New York, 1975, p. 16. \\[34\\] A.D. Tomsett, H.E. Curry-Hyde, M.S. Wainwright. D.J. Young...
Digital Repository Service at National Institute of Oceanography (India)
Iyer, S.D; Mascarenhas-Pereira, M.B.L.; Nath, B.N
. Conference report. J. Geol. Soc. Am., 136, 621-626. Das, P., Iyer, S.D., Kodagali, V.N., Krishna, K.S., 2005. A new insight into the distribution and origin of seamounts in the Central Indian Ocean Basin. Mar. Geod., 28, 259-269. Davydov, M... Ridge, 26o N): Space trotter, guest from mantle, or a widespread mineral, connected with serpentinization? J. Geophys. Res., 111, B05103, doi:10.1029/ 2005JB003955. Dekov, V.M., Mandova, E.D., Dimitrov, K.C., Rekkalov, K.N., 1995. Native aluminium...
Directory of Open Access Journals (Sweden)
Rejane Flores
2009-07-01
Full Text Available Este estudo teve como objetivo otimizar a extração de ecdisterona em raízes de ginseng brasileiro. Primeiramente, para se avaliar a eficiência do solvente extrator, amostras de raízes dois acessos (BRA e JB-UFSM de P. glomerata foram extraídas em Soxhlet com metanol e clorofórmio, separadamente, durante 4 horas. No segundo ensaio, com o intuito de se escolher o método extrator, a extração foi conduzida em Soxhlet e em ultrassom, utilizando metanol como solvente. Em P. tuberosa, as amostras foram extraídas com metanol, e a extração foi conduzida em Soxhlet e em banho ultrasônico. O conteúdo de ecdisterona foi determinado em Cromatógrafo Líquido de Alta Eficiência (CLAE. Em ambas as espécies, um maior conteúdo de ecdisterona foi detectado nas amostras extraídas com metanol e em Soxhlet. A metodologia proposta mostrou-se eficaz para a quantificação da ecdisterona a partir das raízes de P. glomerata e P. tuberosa, podendo ser aplicada no controle de qualidade de drogas vegetais e/ou fitoterápicos.This study aimed at optimizing the extraction method from ecdysterone of Brazilian ginseng. Root samples of two accessions (BRA and JB-UFSM of P. glomerata were extracted in a Soxhlet with methanol or chloroform for 4h. In the second trial, the extration was conduced in a Soxhlet or ultrasonic using metanol as a solvent. In P. tuberosa, the roots samples were extracted with methanol in a Soxhlet or in ultrasonic. The ecdysterone content was determinated using high efficiency liquid chromatography methods. In both studied species, the highest ecdisterone content was detected from samples extracted in a Soxhlet and using methanol as a solvent. This extration method has been successfully applied for determination of ecdysterone content from roots of Brazilian ginseng, and could be useful for the quality control of drugs and pharmaceutical formulations.
Faust. Pühendus : [luuletused] / Johann Wolfgang von Goethe ; tlk. Marie Under, August Sang
Goethe, Johann Wolfgang von, 1749-1832
2006-01-01
Sisu: Faust. Pühendus ; Aardekaevur ; Cophta laul ; Hall sompus hommik ; Thule kuningas ; Kohtumine ja hüvastijätt ; Mailaul ; "Ma koltund väljadele rühin ; Retsensent ; Kannike ; Christel ; Kunstniku õhtulaul ; Uus armastus, uus elu ; Lottchenile ; Järvel ; Mäelt ; Amulett ; Ränduri öölaul : "Kes sa tead, oh taevane..." ; Meresõit ; Julgustus ; Kirjast Auguste zu Stolbergile ; Kuule ; Manitsus ; Inimsoo piirid ; Vaimude laul vete kohal ; Ränduri öölaul : "Harjadel püha..." ; Öömõtted ; Metsavaim ; Kandlemängija : "Kes pole leiba söönud, silmad vees..." ; Reisivarustus ; Jumalik ; Mignon : "Kas maad sa tead, kus apelsinipuul..." ; Pühendus ; Charlotte von Steinile ; Esimene kaotus ; Külaskäik ; Ketraja ; Mignon : "Miks vastust nõuad? Vaikida mul lase..." ; Kandlemängija : "Uste taha hiilin sala..." ; Armastatu lähedus ; Mignon : "Et ükskord olla, pean ma näima..." ; Lahkumine ; Kestvus vahelduses ; Aastad ; Õnnis igatsus ; Märts ; Rännulaul ; Parabaas ; Üks ja kõik ; Testament
UAV Communication Management and Coordination for Multitarget Tracking
2009-02-26
6.3 Weighted Trace Penalty 16 6.4 Results with WTP for ECTG 17 7 Multiple UAV Case 20 7.1 Extension of WTP 20 7.2 Coordinated sensor motion...growth by a weighted trace penalty ( WTP ) term, which is a product of the current covariancc trace and the minimum distance to observability (MDO) for a...Specifically, the terminal cost or ECTG term using the WTP has the form J(b) = JWTP(b) := iD(s, e) Tfc P\\ (6.1) where 7 is a positive constant, i is the
CSIR Research Space (South Africa)
Berruet, M
2013-10-01
Full Text Available . Vazquez a, R.E. Marotti b a División Electroquímica y Corrosión, INTEMA, Facultad de Ingeniería, CONICET- Universidad Nacional de Mar del Plata, J.B. Justo 4302, B7608FDQ Mar del Plata, Argentina b Instituto de Física and CINQUIFIMA, Facultad de... Ingeniería, Universidad de la República, Herrera y Reissig 565, C.C. 30, 11000 Montevideo, Uruguay c National Centre for Nano-Structured Materials, Council for Scientific and Industrial Research, 1-Meiring Naude Road, Brummeria, P.O. Box 395, Pretoria...
High sensitivity of a carbon nanowall-based sensor for detection of organic vapours
Czech Academy of Sciences Publication Activity Database
Slobodian, P.; Cvelbar, U.; Říha, Pavel; Olejník, R.; Matyáš, J.; Filipič, G.; Watanabe, H.; Tajima, S.; Kondo, H.; Sekine, M.; Hori, M.
2015-01-01
Roč. 110, č. 5 (2015), s. 90515-90520 ISSN 2046-2069 Grant - others:Ministerstvo školství, mládeže a tělovýchovy (MŠMT)(CZ) LO1504; Slovenian Research Agency(SI) L2-6769; Slovenian Research Agency(SI) Bi-JAP-2015-2017-3; JSPS Grant-in-Aid for Exploratory Research(JP) 25600123 Institutional research plan: CEZ:AV0Z20600510 Institutional support: RVO:67985874 Keywords : carbon nanowalls * sensing properties * volatile organic vapours Subject RIV: JB - Sensors, Measurment, Regulation Impact factor: 3.289, year: 2015
Foulis, David J.; Pulmannov, Sylvia
2018-04-01
Using a representation theorem of Erik Alfsen, Frederic Schultz, and Erling Størmer for special JB-algebras, we prove that a synaptic algebra is norm complete (i.e., Banach) if and only if it is isomorphic to the self-adjoint part of a Rickart C∗-algebra. Also, we give conditions on a Banach synaptic algebra that are equivalent to the condition that it is isomorphic to the self-adjoint part of an AW∗-algebra. Moreover, we study some relationships between synaptic algebras and so-called generalized Hermitian algebras.
International Nuclear Information System (INIS)
Ding, M.; Kisin, E.R.; Zhao, J.; Bowman, L.; Lu, Y.; Jiang, B.; Leonard, S.; Vallyathan, V.; Castranova, V.; Murray, A.R.; Fadeel, B.; Shvedova, A.A.
2009-01-01
Hard metal or cemented carbide consists of a mixture of tungsten carbide (WC) (85%) and metallic cobalt (Co) (5-15%). WC-Co is considered to be potentially carcinogenic to humans. However, no comparison of the adverse effects of nano-sized WC-Co particles is available to date. In the present study, we compared the ability of nano- and fine-sized WC-Co particles to form free radicals and propensity to activate the transcription factors, AP-1 and NF-κB, along with stimulation of mitogen-activated protein kinase (MAPK) signaling pathways in a mouse epidermal cell line (JB6 P + ). Our results demonstrated that nano-WC-Co generated a higher level of hydroxyl radicals, induced greater oxidative stress, as evidenced by a decrease of GSH levels, and caused faster JB6 P + cell growth/proliferation than observed after exposure of cells to fine WC-Co. In addition, nano-WC-Co activated AP-1 and NF-κB more efficiently in JB6 +/+ cells as compared to fine WC-Co. Experiments using AP-1-luciferase reporter transgenic mice confirmed the activation of AP-1 by nano-WC-Co. Nano- and fine-sized WC-Co particles also stimulated MAPKs, including ERKs, p38, and JNKs with significantly higher potency of nano-WC-Co. Finally, co-incubation of the JB6 +/+ cells with N-acetyl-cysteine decreased AP-1 activation and phosphorylation of ERKs, p38 kinase, and JNKs, thus suggesting that oxidative stress is involved in WC-Co-induced toxicity and AP-1 activation.
Kishida, Kazuki; Ohkusu-Tsukada, Kozo; Hori, Makito; Konnai, Masaki; Abiko, Chieko; Suzuki, Yoshikazu; Yamanome, Yukito; Yoshimura, Hisashi; Michishita, Masaki; Takahashi, Kimimasa
2013-05-01
Intrahepatic eosinophilic proliferative pylephlebitis (EPP) in Japanese Black (JB) cattle generally has been considered to be an atypical form of fascioliasis. However, there are many cases of EPP in which no Fasciola spp. have been detected in the livers of affected cattle. The aims of this study were to ascertain the relationship between EPP and hepatic fascioliasis and to investigate the role of food allergy in the disease. Histologically, EPP lesions were characterised by severe endothelial proliferation of the interlobular veins, accompanied by varying degrees of fibrosis and eosinophilic infiltration in portal areas, which could be differentiated from chronic cholangiohepatitis, the typical lesion of hepatic fascioliasis. In addition to hepatic lesions, all cases of EPP had varying degrees of eosinophilic infiltration in the perilymphoid red pulp of the spleen, whereas both affected and unaffected animals had eosinophilic infiltrates in the mucosa of the small intestine. Antibodies against Fasciola spp. were detected in 1/14 EPP cases by ELISA; the seropositive case had EPP in combination with chronic cholangitis. There was no significant difference in total concentration of IgE between cases of EPP and unaffected cattle. Serum IgE levels specific to curly dock (Rumex crispus) and oats (Avena sativa) were higher in EPP cases than in unaffected cattle by allergen profiling screening testing and ELISA. The results of this study suggest that hepatic fascioliasis is unlikely to be the cause of EPP in JB cattle and that food allergens should be investigated as possible aetiological agents. Copyright © 2012 Elsevier Ltd. All rights reserved.
Antidepressant-like property of Jobelyn®, an African unique herbal formulation, in mice.
Umukoro, S; Eduviere, A T; Aladeokin, A C; Olugbemide, A S
2014-03-01
The purpose of this investigation was to evaluate whether Jobelyn® (JB) possesses anti-depressant-like property in the mouse forced swimming test (FST), tail suspension test (TST) and yohimbine-induced lethality test (YLT) in aggregated mice. Mice were given JB (10-100 mg/kg, p.o.) daily for 7 days and then subjected to FST, TST, YLT and open field test. The parameters assessed in both FST and TST were the time (s) spent in active movement (struggling time), first occurrence of immobility (s) and the duration of immobility (s). In the YLT, the mortality rate was recorded 24 h after yohimbine (35 mg/kg, i.p.) administration. In the open field test, the number of line crosses and total distance travelled (m) were measured for 10 min in the open field chamber. JB significantly (popen-field test. Jobelyn® has antidepressant-like activity, which may be related to the stimulation of serotonergic and noradrenergic pathways. The ability of Jobelyn® to delay the onset of immobility and to prolong the struggling time support its use as energizer in general body weakness or exhaustion. © Georg Thieme Verlag KG Stuttgart · New York.
Sampaio, Edson E. S.; Barbosa, Johildo S. F.; Correa-Gomes, Luiz C.
2017-07-01
The Archean-Paleoproterozoic Jequié (JB) and Itabuna-Salvador-Curaçá (ISCB) blocks and their tectonic transition zone in the Valença region, Bahia, Brazil are potentially important for ore deposits, but the geological knowledge of the area is still meager. The paucity of geological information restricts the knowledge of the position and of the field characteristics of the tectonic suture zone between these two crustal segments JB and ISCB. Therefore, interpretation of geophysical data is necessary to supplement the regional structural and petrological knowledge of the area as well as to assist mining exploration programs. The analysis of the airborne radiometric and magnetic data of the region has established, respectively, five radiometric domains and five magnetic zones. Modeling of a gravity profile has defined the major density contrasts of the deep structures. The integrated interpretation of the geophysical data fitted to the known geological information substantially improved the suture zone (lower plate JB versus upper plate ISCB) delimitation, the geological map of the area and allowed to estimate the thicknesses of these two blocks, and raised key questions about the São Francisco Craton tectonic evolution.
Directory of Open Access Journals (Sweden)
Astrid Ardiyanti
2012-08-01
Full Text Available Two SNPs, i.e. L127V and T172M, of bovine growth hormone (GH causing the presence of GH gene haplotypes A, B, and C was previously shown to alter intramuscular fatty acid (FA composition in Japanese Black (JB heifers. To determine the SNP effect on somatotropic hormone concentration and lipogenesis, we measured plasma GH, insulin, and insulin-like growth factor-1 (IGF-1 concentrations. We also measured mRNA levels of fatty acid synthase (FASN, stearoyl-coA desaturase (SCD, and sterol regulatory element binding proteins-1 (SREBP-1 and FA composition in diaphragm tissues. Heifers with genotype CC had the lowest plasma insulin concentration and FASN and SCD mRNA levels among genotypes. FASN mRNA levels in haplotype A tended to positively correlate with saturated FA (SFA content and negatively correlated with C18:2 and unsaturated FA (USFA contents. SCD mRNA levels in haplotype A positively correlated with monounsaturated FA (MUFA contents and negatively correlated with C18:0 content. They also tended to positively correlate with C16:1, C18:1, and USFA contents and USFA/SFA ratio and negatively correlate with SFA content. Taken together, GH gene polymorphism affects the lipogenic genes expression levels and their relationships with fatty acid compositions in diaphragm tissues of JB heifers at 31 months of age.
Directory of Open Access Journals (Sweden)
Bruna da Nóbrega Germano
2010-09-01
Full Text Available O artigo identifica os custos de oportunidade da alocação de efluentes nas áreas plantadas de cana, distantes mais de 2 Km da agroindústria JB, nos meses de safra em que isso não ocorre. Esses custos são obtidos por meio dos valores marginais das variáveis de decisão, provenientes do problema de maximização de benefícios econômicos, resolvido por meio do General Algebraic Modeling System (GAMS e da análise do dual do problema linearizado. Além disso, simulam-se diferentes coeficientes para os custos de transporte e de tratamento de efluentes para verificação dos efeitos sobre sua alocação e os benefícios associados à mesma. Desta forma, pode-se subsidiar a identificação de taxas e/ou subsídios que favoreçam a alocação dos efluentes em áreas plantadas de cana mais distantes das agroindústrias, proporcionando não só ganhos de produtividade mais disseminados, como também o respeito aos limites de qualidade do rio.This paper identifies the opportunity costs in effluent allocation over sugarcane crop acres located more than 2Km away from the agroindustry plant JB, during the harvest season. The optimization problem described herein explains why these opportunity costs are usually missed. Actually, these costs derive from the marginal values associated to the decision-making variables concerning an economic benefit maximization problem resolved using the General Algebraic Modeling System (GAMS and from the dual analysis of the linearized problem therein. Besides, different effluent transportation and effluent treatment cost coefficients were considered in simulating possible impacts and benefits regarding effluent allocation. This approach supports the optimal definition of charging and/or subsidizing schemes best suited to allocate effluents over sugarcane crops located farther away from hub agroindustry plants, not just for more disseminated productivity gains, but also for best compliance with river water quality
Systematic analysis of hot Yb{sup *} isotopes using the energy density formalism
Energy Technology Data Exchange (ETDEWEB)
Jain, Deepika; Sharma, Manoj K.; Rajni [Thapar University, School of Physics and Materials Science, Patiala (India); Kumar, Raj [University of Padova, Department of Physics and Astronomy, Padova (Italy); Gupta, Raj K. [Panjab University, Department of Physics, Chandigarh (India)
2014-10-15
A systematic study of the spin-orbit density interaction potential is carried out, with spherical as well as deformed choices of nuclei, for a variety of near-symmetric and asymmetric colliding nuclei leading to various isotopes of the compound nucleus Yb{sup *}, using the semiclassical extended Thomas-Fermi formulation (ETF) of the Skyrme energy density formalism (SEDF). We observe that the spin-orbit density interaction barrier height (V{sub JB}) and barrier position (R{sub JB}) increase systematically with the increase in number of neutrons in both the projectile and target, for spherical systems. On allowing deformation effects with optimum orientations, the barrier-height increases by a large order of magnitude, as compared to the spherical case, in going from {sup 156}Yb{sup *} to {sup 172}Yb{sup *} nuclear systems formed via near-symmetric Ni+Mo or asymmetric O+Sm colliding nuclei, except that for the oblate-shaped nuclei, the V{sub JB} is the highest and R{sub JB} shifts towards a smaller (compact) interaction radius. The temperature does not change the behavior of spin-orbit density dependent (V{sub J}) and independent (V{sub P}) interaction potentials, except for some minor changes in the magnitude. The orientation degree of freedom also plays an important role in modifying the barrier characteristics and hence produces a large effect on the fusion cross section. The fusion excitation function of the compound nuclei {sup 160,} {sup 164}Yb{sup *} formed in different incoming channels, show clearly that the new forces GSkI and KDE0v1 respond better than the old SIII force. Among the first two, KDE0v1 seems to perform better. The fusion cross-sections are also predicted for a few other isotopes of Yb{sup *}. (orig.)
Competition Between Self-birth and Catalyzed Death in Aggregation Growth with Catalysis Injection
International Nuclear Information System (INIS)
Chen Dan; Lin Zhenquan; Sun Yunfei; Ke Jianhong
2009-01-01
We propose two irreversible aggregation growth models of aggregates of two distinct species (A and B) to study the interactions between virus aggregates and medicine efficacy aggregates in the virus-medicine cooperative evolution system. The A-species aggregates evolve driven by self monomer birth and B-species aggregate-catalyzed monomer death in model I and by self birth, catalyzed death, and self monomer exchange reactions in model II, while the catalyst B-species aggregates are assumed to be injected into the system sustainedly or at a periodic time-dependent rate. The kinetic behaviors of the A-species aggregates are investigated by the rate equation approach based on the mean-field theory with the self birth rate kernel I A (k) = Ik, catalyzed death rate kernel J AB (k) = Jk and self exchange rate kernel K A (k, l) = Kkl. The kinetic behaviors of the A-species aggregates are mainly dominated by the competition between the two effects of the self birth (with the effective rate I) and the catalyzed death (with the effective rate JB 0 ), while the effects of the self exchanges of the A-species aggregates which appear in an effective rate KA 0 play important roles in the cases of I > JB 0 and I = JB 0 . The evolution behaviors of the total mass M A 1 (t) and the total aggregate number M A 0 (t) are obtained, and the aggregate size distribution α k (t) of species A is found to approach a generalized scaling form in the case of I ≥ JB 0 and a special modified scaling form in the case of I 0 . The periodical evolution of the B-monomers concentration plays an exponential form of the periodic modulation. (interdisciplinary physics and related areas of science and technology)
International Nuclear Information System (INIS)
Tlalka, R.
1977-01-01
Brief characteristics are given of solar radiation and of its spectral range. The relation is derived for the gas pressure in the centre of the Sun and the mechanism is described of particle interactions in the Sun. Using the Eddington model the basic nuclear reactions in the Sun are described, namely the proton-proton chain and the C-N cycle. The energy transfer is discussed from the Sun to the boundaries of the Earth atmosphere and inside the atmosphere. The measurement of solar energy is conducted with actinometers, i.e., pyrheliometers, pyranometers and combinations thereof. The results of solar radiation measurement in different weather conditions are graphically represented. (J.B.)
Effect of the Ionosphere on Radiowave Systems (Based on Ionospheric Effects Symposium)
1981-04-30
expressed as + 2 K(i) 7 e V 3 where the + and - signs correspond to the polarization of the ordinary (0) and extra -ordinary (X) mode, and we is Zhe plasma...and 0 represent the extra - ordinary and ordinary modes of propagation. k 20 - "t t I t ? .& I % • I " r"V0N,/, I V, / ’ :• O •’ •~~ .. . 4’~"r’t...Luhmann, W.A. Kolasinski, and J.B. Blake, J. Ceophys. Res., 83, 5573, 1978. Renda , G. and J. Lowrence, JPL SP43-21, 91, 0975. Rugge, H.R., D.L
1980-01-01
CO (5 <H ■H (8 o fttH fH a) Ü -H •H y 4J 0) M XI C8 Q. ö 0 05 i-( •H 4J e-g bj Vl <: p., 00 CM w O V) a o ’ a u 41 ri...H CO 21 H r-l «at!tlJ|iUO> 3 s B Cd «4H 3 6 II £ JB H s O as 4-1 JO O B ftth )ärlH« I-* u £ ft z H ca GO Ř-1 «J U o O
Hypoxia in Korean Coastal Waters: A Case Study of the Natural Jinhae Bay and Artificial Shihwa Bay
Directory of Open Access Journals (Sweden)
Jiyoung Lee
2018-03-01
Full Text Available Several coastal regions in Korea have suffered from hypoxia since the 1970s. We present the first review of Korean coastal hypoxia, focusing on its spatiotemporal variation, controlling factors, and effects on marine ecosystems. The review considers the two hotspots of the natural Jinhae Bay (JB and artificial Shihwa Bay (SB, which are referred to as “Korean dead zones.” The hypoxia in the JB is attributed to eutrophication due to domestic and land-used waste input and thermal stratification based on the naturally sluggish water circulation, whereas the hypoxia in the SB is due to eutrophication resulting from domestic, land-used, and industrial waste input and haline stratification as a consequence of the artificially created water stagnation. The bottom-water hypoxia and stratification has led to an imbalance in nitrogen:phosphorus ratio between surface and bottom waters. Hypoxia has also created undesirable benthic community changes in the both bays: (1 mass mortality of large species and recolonization with elevated abundances of opportunists in JB, and (2 decrease of the number of species, abundance, and diversity of benthic communities in SB. Therefore, it behooves us to pay attention to these environmental changes. This review will be helpful in determining the direction of future studies of Korean coastal hypoxia.
Caffeine inhibits cell proliferation by G0/G1 phase arrest in JB6 cells.
Hashimoto, Takashi; He, Zhiwei; Ma, Wei-Ya; Schmid, Patricia C; Bode, Ann M; Yang, Chung S; Dong, Zigang
2004-05-01
Caffeine is a major biologically active constituent in coffee and tea. Because caffeine has been reported to inhibit carcinogenesis in UVB-exposed mice, the cancer-preventing effect of caffeine has attracted considerable attention. In the present study, the effect of caffeine in quiescent (G0 phase) cells was investigated. Pretreatment with caffeine suppressed cell proliferation in a dose-dependent manner 36 h after addition of fetal bovine serum as a cell growth stimulator. Analysis by flow cytometry showed that caffeine suppressed cell cycle progression at the G0/G1 phase, i.e., 18 h after addition of fetal bovine serum, the percentages of cells in G0/G1 phase in 1 mM caffeine-treated cells and in caffeine-untreated cells were 61.7 and 29.0, respectively. The percentage of cells in G0/G1 phase at 0 h was 75.5. Caffeine inhibited phosphorylation of retinoblastoma protein at Ser780 and Ser807/Ser811, the sites where retinoblastoma protein has been reported to be phosphorylated by cyclin-dependent kinase 4 (cdk4). Furthermore, caffeine inhibited the activation of the cyclin D1-cdk4 complex in a dose-dependent manner. However this compound did not directly inhibit the activity of this complex. In addition, caffeine did not affect p16INK4 or p27Kip1 protein levels, but inhibited the phosphorylation of protein kinase B (Akt) and glycogen synthase kinase 3beta. Our results showed that caffeine suppressed the progression of quiescent cells into the cell cycle. The inhibitory mechanism may be due to the inhibition of cell growth signal-induced activation of cdk4, which may be involved in the inhibition of carcinogenesis in vivo.
Lifescience Database Archive (English)
Full Text Available H00301 Klebsiella infection Klebsiella is a gram-negative bacterium of Enterobacteriaceae...pta N, Limbago BM, Patel JB, Kallen AJ ... TITLE ... Carbapenem-resistant Enterobacteriaceae: epidemiology and
JB 204.pdf | forthcoming | jbsc | Volumes | public | Indian Academy of ...
Indian Academy of Sciences (India)
error. The page your are looking for can not be found! Please check the link or use the navigation bar at the top. YouTube; Twitter; Facebook; Blog. Academy News. IAS Logo. 29th Mid-year meeting. Posted on 19 January 2018. The 29th Mid-year meeting of the Academy will be held from 29–30 June 2018 in Infosys, Mysuru ...
JB 536.pdf | forthcoming | jbsc | Volumes | public | Indian Academy of ...
Indian Academy of Sciences (India)
error. The page your are looking for can not be found! Please check the link or use the navigation bar at the top. YouTube; Twitter; Facebook; Blog. Academy News. IAS Logo. 28th Mid Year Meeting. Posted on 26 May 2017. [30 June – 1 July 2017 at Faculty Hall, Indian Institute of Science]. 83rd Annual Meeting. Posted on ...
JB 480.pdf | forthcoming | jbsc | Volumes | public | Indian Academy of ...
Indian Academy of Sciences (India)
Ethical Guidelines and Procedures document. Posted on 17 January 2017. A revised version of the document 'Scientific Values: Ethical Guidelines and Procedures' has been produced by the Academy's Panel on Scientific Values. For more details, see the Academy Committee on Scientific Values page.
JB 660.pdf | forthcoming | jbsc | Volumes | public | Indian Academy of ...
Indian Academy of Sciences (India)
Ethical Guidelines and Procedures document. Posted on 17 January 2017. A revised version of the document 'Scientific Values: Ethical Guidelines and Procedures' has been produced by the Academy's Panel on Scientific Values. For more details, see the Academy Committee on Scientific Values page.
JB 742.pdf | forthcoming | jbsc | Volumes | public | Indian Academy of ...
Indian Academy of Sciences (India)
error. The page your are looking for can not be found! Please check the link or use the navigation bar at the top. YouTube; Twitter; Facebook; Blog. Academy News. IAS Logo. 29th Mid-year meeting. Posted on 19 January 2018. The 29th Mid-year meeting of the Academy will be held from 29–30 June 2018 in Infosys, Mysuru ...
JB 92.pdf | forthcoming | jbsc | Volumes | public | Indian Academy of ...
Indian Academy of Sciences (India)
error. The page your are looking for can not be found! Please check the link or use the navigation bar at the top. YouTube; Twitter; Facebook; Blog. Academy News. IAS Logo. 29th Mid-year meeting. Posted on 19 January 2018. The 29th Mid-year meeting of the Academy will be held from 29–30 June 2018 in Infosys, Mysuru ...
JB 230.pdf | forthcoming | jbsc | Volumes | public | Indian Academy of ...
Indian Academy of Sciences (India)
error. The page your are looking for can not be found! Please check the link or use the navigation bar at the top. YouTube; Twitter; Facebook; Blog. Academy News. IAS Logo. 29th Mid-year meeting. Posted on 19 January 2018. The 29th Mid-year meeting of the Academy will be held from 29–30 June 2018 in Infosys, Mysuru ...
Manuscript Click here to download Manuscript JB_209_Edited.docx ...
Indian Academy of Sciences (India)
43
nitric oxide measurement, real-time PCR and immunohistochemistry analysis were employed to assess ..... The amount of NO is an important factor in analysing certain endothelial cell behaviours such as ..... Smitha B, Sridhar S and Khan A 2005 Chitosan–sodium alginate polyion complexes as fuel cell membranes. Eur.
The deep-sea hub of the ANTARES neutrino telescope
Energy Technology Data Exchange (ETDEWEB)
Anghinolfi, M. [INFN Sezione di Genova, Via Dodecaneso 33, I-16146 Genova (Italy); Calzas, A. [Centre de Physique des Particules de Marseille (CNRS/IN2P3), Universite de la Mediterranee, 13288 Marseille (France); Dinkespiler, B. [Centre de Physique des Particules de Marseille (CNRS/IN2P3), Universite de la Mediterranee, 13288 Marseille (France); Cuneo, S. [INFN Laboratori Nazionali del Sud, Via S. Sofia 44, I-95123 Catania (Italy); Favard, S. [Centre de Physique des Particules de Marseille (CNRS/IN2P3), Universite de la Mediterranee, 13288 Marseille (France); Hallewell, G. [Centre de Physique des Particules de Marseille (CNRS/IN2P3), Universite de la Mediterranee, 13288 Marseille (France)]. E-mail: gregh@cppm.in2p3.fr; Jaquet, M. [Centre de Physique des Particules de Marseille (CNRS/IN2P3), Universite de la Mediterranee, 13288 Marseille (France); Musumeci, M. [INFN Laboratori Nazionali del Sud, Via S. Sofia 44, I-95123 Catania (Italy); Papaleo, R. [INFN Laboratori Nazionali del Sud, Via S. Sofia 44, I-95123 Catania (Italy); Raia, G. [INFN Laboratori Nazionali del Sud, Via S. Sofia 44, I-95123 Catania (Italy); Valdy, P. [IFREMER - Institut francais de recherche pour l' exploitation de la mer, Centre de La Seyne, 83500 La Seyne sur mer (France); Vernin, P. [DSM-DAPNIA, CEA SACLAY, 91191 Gif sur Yvette Cedex (France)
2006-11-15
The ANTARES neutrino telescope, currently under construction at 2500 m depth off the French Mediterranean coast, will contain 12 detection lines, powered and read out through a deep-sea junction box (JB) hub. Electrical energy from the shore station is distributed through a transformer with multiple secondary windings and a plugboard with 16 deep sea-mateable electro-optic connectors. Connections are made to the JB outputs using manned or remotely operated submersible vehicles. The triply redundant power management and slow control system is based on two identical AC-powered systems, communicating with the shore through 160 Mb/s fibre G-links and a third battery-powered system using a slower link. We describe the power and slow control systems of the underwater hub.
The deep-sea hub of the ANTARES neutrino telescope
International Nuclear Information System (INIS)
Anghinolfi, M.; Calzas, A.; Dinkespiler, B.; Cuneo, S.; Favard, S.; Hallewell, G.; Jaquet, M.; Musumeci, M.; Papaleo, R.; Raia, G.; Valdy, P.; Vernin, P.
2006-01-01
The ANTARES neutrino telescope, currently under construction at 2500 m depth off the French Mediterranean coast, will contain 12 detection lines, powered and read out through a deep-sea junction box (JB) hub. Electrical energy from the shore station is distributed through a transformer with multiple secondary windings and a plugboard with 16 deep sea-mateable electro-optic connectors. Connections are made to the JB outputs using manned or remotely operated submersible vehicles. The triply redundant power management and slow control system is based on two identical AC-powered systems, communicating with the shore through 160 Mb/s fibre G-links and a third battery-powered system using a slower link. We describe the power and slow control systems of the underwater hub
Club d'orientation
2014-01-01
Course d'orientation C’est sous un beau soleil samedi 4 octobre que s’est déroulée la 6e étape de la Coupe genevoise d’automne organisée par le club. Plus d’une centaine de concurrents provenant de 7 clubs de CO avaient fait le déplacement pour courir sur un des cinq parcours proposés dans les bois de Trélex-Génolier (VD). Le podium est le suivant : Technique long (5,9 km, 19 postes) : 1er Jurg Niggli, O’Jura (1:00:02); 2e Berni Wehrle, CO CERN (1:06:44); 3e Konrad Ehrbar, COLJ (1:07:08) Technique moyen (4,8 km, 18 postes) : 1er Christophe Vuitton, CO CERN (54:25); 2e J.B. Zosso, CO CERN (1:01:19); 3e Jeremy Wichoud, COLJ (1:06:21) Technique court (3,8 km, 14 postes) : 1er Julien Vuitton, CO CERN (36:19); 2e Vladimir Kuznetsov, COLJ (48:47); 3e Natalia Niggli, O’Jura (50:38) Facile moyen (3,2 km, 11 postes) : 1ère Alina Niggli, O&...
Education Reform and Career Education--Deja Vu.
Stock, Barbara
1984-01-01
The current outcry for educational reform raises issues that have already long concerned career education. This situation gives career educators the opportunity to provide leadership in attaining common educational goals. (JB)
The Komsomol and the Schools in the Lenin Year
Kutsenko, T.
1970-01-01
Describes the cooperative relationship between the Komsomol (All-Union Leninist Communist League of Youth), the Pioneers, and the schools, with specific reference to their mutual responsibilities in the Lenin Year. (JB)
Prescott, James W.
1972-01-01
The effects of sensory deprivation in humans is discussed as well as the need for developing a moral education curriculum designed to rear children in an affectional environment of positive reinforcements. (JB)
Elson, E. C.
2017-12-01
This paper investigates the relationship between specific baryon angular momentum jb and baryon mass Mb for a sample of nearby late-type galaxies with resolved H I kinematics. This work roughly doubles the number of galaxies with Mb ≲ 1010 M⊙ used to study the jb-Mb relation. Most of the galaxies in the sample have their baryon mass dominated by their gas content, thereby offering jb and Mb measures that are relatively unaffected by uncertainties arising from the stellar mass-to-light ratio. Measured H I surface density radial profiles together with optical and rotation curve data from the literature are used to derive a best-fitting relation given by j_b=qM_b^{α }, with α = 0.62 ± 0.02 and log10 q = -3.35 ± 0.25. This result is consistent with the j_b∝ M_b^{2/3} relation that is theoretically expected and also measured by Obreschkow & Glazebrook for their full sample of THINGS spiral galaxies, yet differs to their steeper relation found for subsets with fixed bulge fraction. The 30 arcsec spatial resolution of the H I imaging used in this study is significantly lower than that of the THINGS imaging used by Obreschkow & Glazebrook, yet the results presented in this work are clearly shown to contain no significant systematic errors due to the low-resolution imaging.
Improving the Work of the School Lenin Museums
Sarafannikova, G. P.
1970-01-01
A number of exemplary compositions and uses of School Lenin Museums are mentioned in this article which brings out the important function of these museums in the political-ideological education of youth. (JB)
Reference Ranges & What They Mean
... htm. Accessed August 2015. Sources Used in Previous Reviews Books: Clinical Diagnosis and Management by Laboratory Methods. 20th ed. Henry JB, ed. New York: Saunders: 2001. Laboratory Medicine: Test Selection and Interpretation. ...
Use of label-free protein chips for proteomics of oncohematological diseases
Czech Academy of Sciences Publication Activity Database
Pimková, K.; Suttnar, J.; Bocková, Markéta; Homola, Jiří; Dyr, J. E.
2012-01-01
Roč. 58, SUPPL. 2 (2012), 2S84-2S89 ISSN 0042-773X Institutional support: RVO:67985882 Keywords : Oncohematological diseases * Surface plasmon resonance * Proteomics Subject RIV: JB - Sensors, Measurment, Regulation
Directory of Open Access Journals (Sweden)
T.S. Poonen
1952-04-01
Full Text Available - F.D.K. Bosch, J.G. de Casparis, Prasasti Indonesia diterbitkan oleh Djawatan Purbakala Republik Indonesia I. - J.G. de Casparis: Inscripties uit de Cailendra-Tijd, A.C. Nix & Co. Bandung, 1950, 204 blz. - C. Tj. Bertling, P.J. Zoetmulder, Cultuur oost en west, 183 blz. Uitg. C.P.J. van der Peet, Amsterdam 1951. - K.A.H. Hidding, G.J. Held, Magie, Hekserij en Toverij. J.B. Wolters, Groningen 1950. - W. Ph. Coolhaas, T.S. Poonen, A survey of the rise of the Dutch power in Malabar (1603-1678. University of Travancore, Trichinopoly, 1948. 303 blz. - E.M. Uhlenbeck, D.W.N. de Boer, Beknopte Indonesische Grammatica, van Klassiek naar modern Maleis. Brill, Leiden 1951.
Constitutive equations for Zr1Nb. II
International Nuclear Information System (INIS)
Novak, J.
1986-01-01
Based on existing knowledge and constitutive equations for non-irradiated material, constitutive equations were written for Zr1Nb irradiated at 573 K at deformation in the direction of forming. Constitutive equations express the following material characteristics: dependence of shear strength on fast neutron fluence, superposition of deformation hardening and subsequent radiation hardening, the effect of stress on deformation rate, and for fluences above ca. 10 24 n.m -2 (E>1 MeV) the course of the deformation curve for various fluence levels. The values apply for temperatures and rates of deformation which are characteristic of transient processes during changes in the power output of fuel elements of pressurized water reactors. (J.B.)
Energy consumption and GHG emissions of six biofuel pathways by LCA in China
Energy Technology Data Exchange (ETDEWEB)
Ou, Xunmin [School of Public Policy and Management (SPPM), Tsinghua University, Beijing 100084 (China); China Automotive Energy Research Center (CAERC), Tsinghua University, Beijing 100084 (China); Institute of Energy, Environment and Economy (3E), Tsinghua University, Beijing 100084 (China); Zhang, Xiliang; Chang, Shiyan; Guo, Qingfang [China Automotive Energy Research Center (CAERC), Tsinghua University, Beijing 100084 (China); Institute of Energy, Environment and Economy (3E), Tsinghua University, Beijing 100084 (China)
2009-11-15
This paper presents life-cycle-analysis (LCA) energy consumption (EC) and greenhouse gas (GHG) emissions of China's current six biofuel pathways, which are: corn-derived ethanol (CE); cassava-derived ethanol (KE); sweet sorghum-derived ethanol (SE); soybean-derived bio-diesel (SB); jatropha fruit-derived bio-diesel (JB); and used cooking oil (UCO)-derived bio-diesel (UB). The tool utilized here is the WTW (Well-to-Wheels) module of Tsinghua-CA3EM model covering the entire lifecycle including: raw materials cultivation (or feedstock collection); fuel production; transportation and distribution; and application in automobile engines, compared with Conventional Petroleum-based gasoline and diesel Pathways (CPP). The results indicate: (1) the fossil energy inputs are about 1.0-1.5 times the energy contained in the fuel for the CE, SE and SB pathways, but 0.5-0.9 times for the KE, UB and JB pathways; (2) compared with CPP, the JB, KE and UB pathways can reduce both fossil fuel consumption and GHG emissions; the CE and SB pathways can only reduce fossil fuel consumption, but increase GHG emission; the SE pathway increases not only fossil fuel consumption but also GHG emission; and (3) the main factors inducing high EC and GHG emission levels include: high EC levels during the fuel production stage and high fertilizer application rates during the planting of raw feedstocks. Conclusions are that of the aforementioned biofuel pathways in China: (1) only the JB, KE and UB pathways have energy-saving merits as indicated by the LCA energy inputs and outputs; (2) compared with CPP, all but the SE pathway reduces fossil fuel consumption. However, the SB and CE pathway increase GHG emission; (3) all six displace petroleum by utilizing more coal; and (4) feedstock productivity levels must be increased, and there must be a reduction in fertilizer utilization and EC consumption during the cultivation and transportation stages in order to achieve the goals of energy balance and
Energy consumption and GHG emissions of six biofuel pathways by LCA in China
International Nuclear Information System (INIS)
Ou Xunmin; Zhang Xiliang; Chang Shiyan; Guo Qingfang
2009-01-01
This paper presents life-cycle-analysis (LCA) energy consumption (EC) and greenhouse gas (GHG) emissions of China's current six biofuel pathways, which are: corn-derived ethanol (CE); cassava-derived ethanol (KE); sweet sorghum-derived ethanol (SE); soybean-derived bio-diesel (SB); jatropha fruit-derived bio-diesel (JB); and used cooking oil (UCO)-derived bio-diesel (UB). The tool utilized here is the WTW (Well-to-Wheels) module of Tsinghua-CA3EM model covering the entire lifecycle including: raw materials cultivation (or feedstock collection); fuel production; transportation and distribution; and application in automobile engines, compared with Conventional Petroleum-based gasoline and diesel Pathways (CPP). The results indicate: (1) the fossil energy inputs are about 1.0-1.5 times the energy contained in the fuel for the CE, SE and SB pathways, but 0.5-0.9 times for the KE, UB and JB pathways; (2) compared with CPP, the JB, KE and UB pathways can reduce both fossil fuel consumption and GHG emissions; the CE and SB pathways can only reduce fossil fuel consumption, but increase GHG emission; the SE pathway increases not only fossil fuel consumption but also GHG emission; and (3) the main factors inducing high EC and GHG emission levels include: high EC levels during the fuel production stage and high fertilizer application rates during the planting of raw feedstocks. Conclusions are that of the aforementioned biofuel pathways in China: (1) only the JB, KE and UB pathways have energy-saving merits as indicated by the LCA energy inputs and outputs; (2) compared with CPP, all but the SE pathway reduces fossil fuel consumption. However, the SB and CE pathway increase GHG emission; (3) all six displace petroleum by utilizing more coal; and (4) feedstock productivity levels must be increased, and there must be a reduction in fertilizer utilization and EC consumption during the cultivation and transportation stages in order to achieve the goals of energy balance and GHG
... nih.gov/pubmed/24571756 . Prince JB, Wilens TE, Spencer TJ, Biederman J. Pharmacotherapy of attention-deficit/hyperactivity ... reviewed by David Zieve, MD, MHA, Medical Director, Brenda Conaway, Editorial Director, and the A.D.A. ...
Huston, James A.
1971-01-01
Recounts the history and problems of European Economic Integration from the first post World War II organization, the OEEC, to the EEC (Common Market) and the EFTA. Suggestions for further reading are included. (JB)
North Carolinians Volunteer for Knee Pain Study
... is the director of the J.B. Snow Biomechanics Laboratory at Wake Forest University. Addressing a Rising ... people I work with are getting up the stairs better, or they are better able to play ...
Czech Academy of Sciences Publication Activity Database
Kodet, J.; Pánek, Petr; Procházka, I.
2015-01-01
Roč. 53, č. 1 (2015), s. 18-26 ISSN 0026-1394 Institutional support: RVO:67985882 Keywords : optical fiber * time transfer * TWOTT Subject RIV: JB - Sensors, Measurment, Regulation Impact factor: 2.500, year: 2015
Observations on the Study of Crime Causation
Gibbons, Don C.
1971-01-01
Although both genetic and situational factors are implicated in criminality, the thesis here is that the latter may well be more important and more frequently encountered than many criminologists have acknowledged to date. (JB)
Effect of carrageenan addition on the yield and functional properties of charqui (Jerked Beef
Directory of Open Access Journals (Sweden)
Carlos Eduardo Rocha Garcia
2013-04-01
Full Text Available The objective of this work was to evaluate the application of carrageenan (CAR to improve the functional properties of the jerked beef (JF and to increase its processing yield. JB produced from Vastus lateralis with CAR (1.0% at 25ºC and NaCl (15.0% had approximately 15.0% higher moisture and a 32.0% higher processing yield in comparison to the control samples.JB-CAR presented shear force approximately 5.0 and 20% lower in the samples uncooked salted and desalted cooked, respectively, and sensorial acceptance above 80%. The results demonstrated the possibility of applying carrageenan to jerked beef in order to obtain an increase in the processing yield and a tender product while maintaining the sensorial quality and its intermediate-moisture meat product nature.
Genetics Home Reference: vitiligo
... SA, Fain PR, Ferrara TM, Ben S, Riccardi SL, Cole JB, Gowan K, Holland PJ, Bennett DC, Luiten ... medicine? What is newborn screening? New Pages Lyme disease Fibromyalgia White-Sutton syndrome All New & Updated Pages ...
South African Medical Journal - Vol 94, No 8 (2004)
African Journals Online (AJOL)
Imiglucerase low-dose therapy for paediatric Gaucher disease - a long-term cohort study · EMAIL FREE FULL TEXT EMAIL FREE FULL TEXT DOWNLOAD FULL TEXT DOWNLOAD FULL TEXT. R Heitner, S Arndt, JB Levin ...
The Sphinx's Riddle: Life and Career Cycles.
Burack, Elmer H.
1984-01-01
Career cycles should be considered apart from life cycles, even though the two are interrelated. This essay examines five theories about life and career cycles, and offers insights into their limitations and potential uses. (JB)
Simple Models for Process Control
Czech Academy of Sciences Publication Activity Database
Gorez, R.; Klán, Petr
2011-01-01
Roč. 22, č. 2 (2011), s. 58-62 ISSN 0929-2268 Institutional research plan: CEZ:AV0Z10300504 Keywords : process model s * PID control * second order dynamics Subject RIV: JB - Sensors, Measurment, Regulation
Genetics Home Reference: hepatic veno-occlusive disease with immunodeficiency
... Donald JA, Kirk EP, Ziegler JB, Salzer U, McDonald GB, Wong M, Lindeman R, Buckley MF. Mutations ... 10 All Bulletins Features What is direct-to-consumer genetic testing? What are genome editing and CRISPR- ...
Global Journal of Educational Research - Vol 11, No 1 (2012)
African Journals Online (AJOL)
Teachers' Competence and Students' Academic Performance in Senior Secondary Schools Chemistry: Is There Any Relationship? EMAIL FREE FULL TEXT EMAIL FREE FULL TEXT · DOWNLOAD FULL TEXT DOWNLOAD FULL TEXT. JB Nbina, 15-18 ...
Signals for compositeness in e-e+→e-e+ and e-e+→μ-μ+
International Nuclear Information System (INIS)
Bars, I.; Gunion, J.F.; Kwan, M.
1986-01-01
Theories in which leptons are composite lead to additional contributions (beyond those from the standard model) to the amplitudes for e - e + →e - e + and e - e + →μ - μ + . Detailed models, constructed by analogy between QCD and compositeness/precolor interactions lead to specific forms for these extra terms. We demonstrate that compositeness scales M as high as 4--7 TeV may be probed using e - e + collision machines currently available and planned for the near future. Sensitivity to the type of composite model and its parity-violation structure is demonstrated. In particular we point out that there are no standard-model contributions to the scattering e - e + →μ - μ + when the incoming e - and e + both have the same helicity. Observation of a nonzero cross section in such a helicity scattering state is prima facie evidence of flavor-changing vector currents in the t channel or scalar currents connecting the e and μ lepton sectors in the s channel
Inclusive (e,e'N), (e,e'NN), (e,e'π),... reactions in nuclei
International Nuclear Information System (INIS)
Gil, A.; Oset, E.
1997-01-01
We study the inclusive (e,e'N), (e,e'NN), (e,e'π), (e,e'πN) reactions in nuclei using a Monte Carlo simulation method to treat the multichannel problem of the final state. The input consists of reaction probabilities for the different steps evaluated using microscopical many body methods. We obtain a good agreement with experiment in some channels where there is data and make predictions for other channels which are presently under investigation in several electron laboratories. The comparison of the theoretical results with experiment for several kinematical conditions and diverse channels can serve to learn about different physical processes occurring in the reaction. The potential of this theoretical tool to make prospections for possible experiments, aiming at pinning down certain reaction probabilities, is also emphasized. (orig.)
Getting Around. Unit I: Public Transportation. Student Lesson #4. English for Living.
New York State Education Dept., Albany. Bureau of Bilingual Education.
To assist the youthful learner of English as a second language in dealing with handling urban public transportation, a series of dialogs, comprehension questions, readings, and points of discussion are presented. The text is illustrated. (JB)
Household Density and Infant Care in an East African Society
Munroe, Ruth H.; Munroe, Robert L.
1971-01-01
A cross-cultural relationship between household density and infant indulgence was investigated among Logoli infants in East Africa. Findings were taken as supportive of the view that socialization practices are influenced by ecological variables. (Author/JB)
Influence of plant growth regulators on axillary shoot multiplication ...
African Journals Online (AJOL)
STORAGESEVER
2008-12-17
Dec 17, 2008 ... The iron concentration had a significant effect on chlorophyll content of the leaves. .... developed precociously, which proliferated to form secon- dary and tertiary ..... Thomas P, Mythili JB, Shivashankara KS (2000). Effects of ...
Fiber-Optic Chemical Sensors and Fiber-Optic Bio-Sensors
Czech Academy of Sciences Publication Activity Database
Pospíšilová, M.; Kuncová, Gabriela; Trögl, J.
2015-01-01
Roč. 15, č. 10 (2015), s. 25208-25259 ISSN 1424-8220 Institutional support: RVO:67985858 Keywords : fiber-optic sensor * chemical sensors * enzymatic sensor Subject RIV: JB - Sensors, Measurment, Regulation Impact factor: 2.033, year: 2015
An introduction to the revised food-based dietary guidelines for ...
African Journals Online (AJOL)
2013-04-08
Apr 8, 2013 ... called upon to provide evidence-based advice to the ... Vorster HH, DSc, Research Professor; Badham JB, MSc, Research Scientist; Venter CS, DSc, Extraordinary ..... At six months, start giving your baby small amounts of.
The Relationship between Expansion in Higher Education and the Labour Market in Norway.
Aamodt, Per O.; Arnesen, Clara A.
1995-01-01
This article describes quantitative growth in higher education and overall trends in the Norwegian economy and argues that the policy of expanding the capacity of higher education is being used as a buffer against youth unemployment. (JB)
International Nuclear Information System (INIS)
1994-02-01
The remote sensing method was employed to obtain complete photographic documentation of the planned route for the Ingolstadt-Kralupy-Litvinov pipeline; sites of potentially hazardous sources of soil or water pollution were identified. (J.B.). 83 figs
Digital bedrock geologic map of the Mount Holly and Ludlow quadrangles, Vermont
Vermont Center for Geographic Information — Digital Data from VG94-229A Walsh, G.J., Ratcliffe, N.M., Dudley, J.B., and Merrifield, T., 1994,�Digital bedrock geologic map of the Mount Holly and Ludlow...
Czech Academy of Sciences Publication Activity Database
Havelková, Martina; Hiklová, Helena
2013-01-01
Roč. 58, č. 4 (2013), s. 114-116 ISSN 0447-6441 R&D Projects: GA TA ČR TA01010517 Institutional support: RVO:68378271 Keywords : contact profilometer * solid surfaces topography Subject RIV: JB - Sensors, Measurment, Regulation
Lenin's Concern for the Growing Generation
Bibanov, T. P.
1970-01-01
Lenin demonstrated his concern for youth and their education by exposing tsarism, initiating numerous plans and programs for improving the system of upbringing and education, and by emphasizing the importance of youth in the revolutionary struggle. (JB)
Energy Technology Data Exchange (ETDEWEB)
Waters, Katrina M.; Tan, Ruimin; Opresko, Lee K.; Quesenberry, Ryan D.; Bandyopadhyay, Somnath; Chrisler, William B.; Weber, Thomas J.
2009-11-01
We have investigated gene expression patterns underlying reversible and irreversible anchorage-independent growth (AIG) phenotypes to identify more sensitive markers of cell transformation for studies directed at interrogating carcinogenesis responses. In JB6 mouse epidermal cells, basic fibroblast growth factor (bFGF) induces an unusually efficient and reversible AIG response, relative to 12-O-tetradecanoyl phorbol-13-acetate (TPA)-induced AIG which is irreversible. The reversible and irreversible AIG phenotypes are characterized by largely non-overlapping global gene expression profiles. However, a subset of differentially expressed genes were identified as common to reversible and irreversible AIG phenotypes, including genes regulated in a reciprocal fashion. Hepatic leukemia factor (HLF) and D-site albumin promoter-binding protein (DBP) were increased in both bFGF and TPA soft agar colonies and selected for functional validation. Ectopic expression of human HLF and DBP in JB6 cells resulted in a marked increase in TPA- and bFGF-regulated AIG responses. HLF and DBP expression were increased in soft agar colonies arising from JB6 cells exposed to gamma radiation and in a human basal cell carcinoma tumor tissue, relative to paired non-tumor tissue. Subsequent biological network analysis suggests that many of the differentially expressed genes that are common to bFGF- and TPA-dependent AIG are regulated by c-Myc, SP-1 and HNF-4 transcription factors. Collectively, we have identified a potential molecular switch that mediates the transition from reversible to irreversible AIG.
Effect of ADH on rubidium transport in isolated perfused rat cortical collecting tubules
International Nuclear Information System (INIS)
Schafer, J.A.; Troutman, S.L.
1986-01-01
Unidirectional fluxes of 86Rb+ were measured as an indicator of potassium transport in isolated rat cortical collecting tubules perfused and bathed at 38 degrees C with isotonic solutions in which Rb+ replaced K+. Under control conditions the lumen-to-bath flux (Jl----b) was significantly less than the bath-to-lumen flux (Jb----l), indicating net Rb+ secretion. Net secretion increased approximately 180% after addition of 100 microU/ml of arginine vasopressin (ADH) to the bathing solution, due to a rapid and reversible increase in Jb----l from 4.6 +/- 0.8 to 9.0 +/- 1.9 pmol X min-1 X mm-1 with no significant change in Jl----b. The ADH effect was completely inhibited by 2 mM luminal Ba2+. The average transepithelial voltage (Ve) was not significantly different from zero in the control period but became lumen negative (-5 to -10 mV) after ADH. With 10(-5) M amiloride in the lumen Ve was lumen positive (+2 to +4 mV) and was unaltered by ADH or Ba2+, yet ADH produced a significant but attentuated increase in Jb----l with no change in Jl----b. The results indicate that ADH augments net K+ secretion either by an increase in the Ba2+-sensitive conductance of the apical membrane or by an increase in the electrochemical potential driving force for net Rb+ secretion through this pathway
Directory of Open Access Journals (Sweden)
K. BERNARDY
Full Text Available ABSTRACT Zinc (Zn participates of numerous metabolic processes in plants. However, it can become toxic to plants in excessive concentrations in the soil. Pfaffia glomerata is a Brazilian medicinal species that has stood out because of its numerous chemical and functional properties, mainly by the triterpene saponins and ecdysteroids accumulated in its roots. This study aimed to evaluate the effects of zinc excess on many root morphological parameters of Pfaffia glomerata. A 4 x 3 factorial design was employed in a completely randomized scheme with 3 replicates. The treatments consisted of four concentrations of Zn (2, 100, 200, and 300 µM and three accessions of P. glomerata (BRA, GD, and JB grown in a hydroponic system for 7 and 14 days. Differences in root morphology and dry mass production were observed among the three accessions in response to excessive Zn. Some growth parameters of GD accession increased with the addition of Zn, ranging from 36 to 79 µM. However, the GD and JB accessions presented reduction in dry mass production, root area, length, and volume with increasing Zn levels. The BRA accession, which had the lowest growth among accessions, presented chlorotic leaves. The shoot/root dry mass ratio and root diameter increased linearly for BRA and GD accessions at 7 days. Based on the evaluated parameters, we observed the following order of Zn excess tolerance in P. glomerata accessions: GD> JB> BRA.
African Journals Online (AJOL)
abp
2013-05-08
5. PubMed | Google Scholar. 3. Bacal DA, Nelson LB, Zackai EH, Lavrich JB, Kousseff BG,. McDonald-McGinn D. Ankyloblepharon filiforme adnatum in trisomy 18. J Pediatr Ophthalmol Strabismus. 1993 Sep-. Oct;30(5):337-9.
Research Article (New England Journal of Medicine) Effect of ...
African Journals Online (AJOL)
2010-01-28
Jan 28, 2010 ... assess the efficacy, safety, and immunogenicity of Rotarix. ..... statistical analysis; Y. Guerra and the safety team for management of safety information and C. .... Page NA, de Beer MC, Seheri LM, Dewar JB, Steele AD. The.
Model comparisons and genetic and environmental parameter ...
African Journals Online (AJOL)
arc
Model comparisons and genetic and environmental parameter estimates of growth and the ... breeding strategies and for accurate breeding value estimation. The objectives ...... Sci. 23, 72-76. Van Wyk, J.B., Fair, M.D. & Cloete, S.W.P., 2003.
Asynchronous electromotor controlled tuned through CARLA method
Czech Academy of Sciences Publication Activity Database
Březina, Tomáš; Turek, M.
2004-01-01
Roč. 2004, 8-9 (2004), s. 27-30 ISSN 0033-2089. [Mechatronics 2004. Warsaw, 23.09.2004-25.09.2004] Institutional research plan: CEZ:AV0Z2076919 Keywords : CARLA * control Subject RIV: JB - Sensors, Measurment, Regulation
Renaissance Paideia: Some Ideals in Italian Humanism and Their Relevance Today
Weakland, John E.
1973-01-01
The humanists of the Renaissance developed a philosophy of education which stated that education must always be connected with the active life, must lead to the development of humanity, must be for the benefit of the community. (JB)
Prevalence and antimicrobial sensitivity of Shiga-toxin-producing ...
African Journals Online (AJOL)
Nyambura
provision of safe water, health education together with improvements in ... available using a sterile well mouthed dry, leak proofs-plastic container .... Esrey, S.A., Potash, J.B., Roberts, L. & Shiff, C. (1991) Effects of improved water supply and.
Evaluation of poultry processing practices, related public health laws ...
African Journals Online (AJOL)
ADEYEYE
2015-02-16
Feb 16, 2015 ... the Meat Law (1968), Food and Drug Act (1974) and Animal Diseases (Control) ... production and processing are coordinated for the benefits and health of the ..... Pp 191-210. ... Ouedraogo JB, Maikano I, Mbah PO, Kremer.
International Nuclear Information System (INIS)
1988-04-01
The proceedings has four chapters: Processes and apparatus of low-temperature installations, Superconductors and magnets, Gas separators, Helium liquefiers and cryostats. It contains a total of 56 papers of which 4 belong in the INIS scope. (J.B.)
Certain Forms of Lexical and Stylistic Analysis in Studying Literary Works on Lenin in the School
Podgaetskaia, I. M.
1970-01-01
Classroom comparison of the works on Lenin, that are part of the school program, with other literature on him that can play a specific role in heightening student interest and intensifying awareness of words, language and style. (JB)
Phosphorylation of stress protein pp80 is related to promotion of transformation
International Nuclear Information System (INIS)
Smith, B.M.; Gindhart, T.D.; Hirano, K.; Colburn, N.H.
1986-01-01
The JB6 mouse epidermal cell system is an in vitro model of late stage promotion, and includes cell lines sensitive (P+) or resistant (P-) to phorbol ester-induced anchorage independent transformation, and transformed (T/sub x/) lines. Certain promoter-induced changes in phosphoproteins, identified by gel electrophoresis, are unique to cells of one phenotype, and occur only with specific promoters. An 80Kd protein is inversely correlated with phenotype: P- cells have a constitutively higher level (p 35 S-methionine. pp80 shares properties with the 80Kd heat stress protein: molecular weight relative abundance, and isoelectric point (4.5). Pharmacological analogs of calcium, the lanthanides, promote transformation of JB6 cells, but have no effect on phosphorylation of the 80Kd protein. If pp80 is on the promotion pathway, it is limited to a specific subset of transformation promoters
J.B. van Wyk,* G.J. Erasmus and K.V. Konstantinov
African Journals Online (AJOL)
closed population of finite size. ... separately identified throughout the course of the project. Individual ... analysis, records of stillborn lambs and of years 1941 and ... djj is the diagonal element of the ith animal in Wright's num- .... The first step.
Mining Pribram in science and technology. Proceedings of Session U - Mineral raw materials treatment
International Nuclear Information System (INIS)
Tomasek, J.; Vetejska, K.
1987-01-01
The proceedings of session ''Mineral raw materials treatment'' contain 27 papers of which only one deals with the application of nuclear technology, namely, the effect of fast electrons on the magnetic properties of the polymetallic Rudniany ore. (J.B.)
Czech Academy of Sciences Publication Activity Database
Matějíček, Jiří; Brand, P. C.; Drews, A. R.; Krause, A.; Lowe-Ma, C.
2004-01-01
Roč. 367, 1-2 (2004), s. 306-311 ISSN 0921-5093 Institutional research plan: CEZ:AV0Z2043910 Keywords : residual stress, automotive springs, neutron diffraction Subject RIV: JB - Sensors, Measurment, Regulation Impact factor: 1.445, year: 2004
Mitochondrial Metabolism - Neglected Link of CancerTransformation and Treatment
Czech Academy of Sciences Publication Activity Database
Pokorný, Jiří; Jandová, Anna; Nedbalová, M.; Jelínek, František; Cifra, Michal; Kučera, Ondřej; Havelka, Daniel; Vrba, J.; Vrba, J.; Čoček, A.; Kobilková, J.
2012-01-01
Roč. 113, č. 2 (2012), s. 81-94 ISSN 1214-6994 R&D Projects: GA ČR(CZ) GAP102/11/0649 Institutional support: RVO:67985882 Keywords : Electromagnetic fields * Cellular biophysics * Cancer Subject RIV: JB - Sensors, Measurment, Regulation
Jones, Clive
1972-01-01
A look at the latest package from a British managment training organization, which explains and demonstrates creative thinking techniques, including brainstorming. The package, designed for groups of twelve or more, consists of tapes, visuals, and associated exercises. (Editor/JB)
Psychiatry in primary care using the three-stage assessment
African Journals Online (AJOL)
psychiatrists working in psychiatric institutions. Therefore, the ... may be less dramatic, it would be a mistake to assume that assessing a patient with .... JB feels that the stress in .... flexible and adaptable to the unique needs of each patient.
Kotz, Arnold; Redondo, Rory
Presented is the user's manual for the Educational Manpower Information Sources Project (EMAP), an information file containing approximately 325 document abstracts related to the field of educational planning. (The EMAP file is described in document SP 006 747.) (JB)
Slade, R.M.; Buszka, P.M.
1994-01-01
The upper Colorado River and some of its tributaries between Lake J.B. Thomas and O.H. Ivie Reservoir contain saline water (defined as water having dissolved-solids concentrations greater than 1,000 milligrams per liter). Dissolved-solids loads at nine streamflow water-quality stations increased from 1986 to 1988. The largest increases were in Beals Creek and in the Colorado River downstream from Beals Creek as a result of outflow of saline water from Natural Dam Salt Lake. The outflow contained 654,000 tons of dissolved solids and had a mean dissolved-solids concentration of 7,900 milligrams per liter. This amount represents about 51 percent of the dissolved-solids load to E.V. Spence Reservoir during 1986-88.
Southern Forests: a Journal of Forest Science - Vol 199 (2003)
African Journals Online (AJOL)
African sandalwood (Osyris lanceolata): resource assessment and quality variation among populations in Tanzania: research note · EMAIL FULL TEXT EMAIL FULL TEXT · DOWNLOAD FULL TEXT DOWNLOAD FULL TEXT. PL Mwang'ingo, Z Teklehaimanot, JB Hall, LLL Lulandala, 77-88 ...
Bozhovich, L. I.; Chudnovsky, V. E.
1973-01-01
The task of educational psychology is to create flexible but scientifically substantiated methods of determining personality traits and the degree of their development. Emphasis here is on the need for self discipline as a major objective in child rearing. (JB)
Czech Academy of Sciences Publication Activity Database
van Deursen, A.P.J.; Stelmashuk, Vitaliy
2011-01-01
Roč. 11, č. 1 (2011), s. 199-204 ISSN 1530-437X Institutional research plan: CEZ:AV0Z20430508 Keywords : Lightning * inductive sensor * aircraft * window * viewport Subject RIV: JB - Sensors , Measurment, Regulation Impact factor: 1.520, year: 2011
Future developments and applications of nitrogen-bearing steels ...
Indian Academy of Sciences (India)
M. Senthilkumar (Newgen Imaging) 1461 1996 Oct 15 13:05:22
society in the field of materials and some recalling of basic properties and principles ... Environment-friendly technologies (safety in oil pipelines, oil exploration . ..... Vogt J-B, Ait Saadi B, Foct J 1999 Analysis of the fatigue structures in a duplex ...
Surface plasmon resonance sensing of nucleic acids: A review
Czech Academy of Sciences Publication Activity Database
Šípová, Hana; Homola, Jiří
-, č. 773 (2013), s. 9-23 ISSN 0003-2670 R&D Projects: GA MŠk(CZ) LH11102 Institutional support: RVO:67985882 Keywords : Surface plasmon resonance * Nucleic acid * Biosensor Subject RIV: JB - Sensors, Measurment, Regulation Impact factor: 4.517, year: 2013
Volumetric Changes in the Components of Left Ventricle ...
African Journals Online (AJOL)
Samuel B. Olaleye
ISSN 1119 – 5096 © Ibadan Biomedical Communications Group. Available online at .... This tissue face was embedded in JB4 resin and six 1.5 µm ... IBM personal computer. All data was .... mediated via the influence of exercise on collagen ...
The Enigmatic Nature of the Israeli Legal System
African Journals Online (AJOL)
RV
independent and shall not be subject to the control or direction of any person or authority". 11 ...... JSC should have a central role in the removal of judges. The JSC ...... Thomas JB Judicial Ethics in Australia (Law Book Company Sydney 1988).
Association of expression levels in skeletal muscle and a SNP in the ...
Indian Academy of Sciences (India)
dicted breeding value for rib eye area in two experiments using 100 sires (P ... In the real-time PCR-based analysis, we used skeletal muscle tissues of eight JB .... mediates recruitment of muscle-type creatine kinase (CK) to myosin. Biochem.
Neutron activation analysis in geological samples containing rare earths, uranium and thorium
International Nuclear Information System (INIS)
Vasconcellos, M.B.A.; Figueiredo, A.M.G.; Berretta, J.R.; Soares, J.C.A.C.R.; Fratin, L.; Goncales, O.L.; Botelho, S.
1990-01-01
The neutron activation analysis method was used for determination of rare earths, uranium, thorium and other tracks in geological samples, under the geological standard JB-1 (Geological Survey of Japan) and S-8 and S-13 (IAEA). (L.C.J.A.)
Czech Academy of Sciences Publication Activity Database
Žďánský, Karel; Dickerson, J.H.
-, č. 184 (2013), s. 295-300 ISSN 0925-4005 R&D Projects: GA MŠk(CZ) OC10021 Institutional support: RVO:67985882 Keywords : Metal nanoparticles * Keyed electrophoresis * Hydrogen sensors Subject RIV: JB - Sensors, Measurment, Regulation Impact factor: 3.840, year: 2013
Nuclear medicine. Czech special bulletin. No. 2
International Nuclear Information System (INIS)
1991-09-01
The bulletin contains the article on the first experience with the CERTEC preparation in examination of brain perfusion and the article on the potential for the development and manufacture of radiopharmaceutical kits. Both articles are inputted into INIS. (J.B.)
International Nuclear Information System (INIS)
Kolar, J.; Bernatik, O.
1987-01-01
The proceedings contain 30 papers of which two deal with uranium mine problems, viz.: ''Current and prospective orientation of mechanized driving of mines and underground infrastructures'' and ''The operation of rail-less mine mechanization in the Hamr area''. (J.B.)
Czech Academy of Sciences Publication Activity Database
Stádník, Bohumil; Jirásková, M.
2000-01-01
Roč. 45, č. 3 (2000), s. 241-249 ISSN 0001-7043 R&D Projects: GA ČR GA102/99/0548 Institutional research plan: CEZ:AV0Z2067918 Keywords : cancer * fluorescence * patient diagnosis Subject RIV: JB - Sensors, Measurment, Regulation
African Journal of Environmental Science and Technology - Vol 7 ...
African Journals Online (AJOL)
Ecosystem services and drivers of change in Nyando floodplain wetland, Kenya · EMAIL FREE FULL TEXT EMAIL FREE FULL TEXT · DOWNLOAD FULL TEXT DOWNLOAD FULL TEXT. PJK Rongoei, J Kipkemboi, JB Okeyo-Owuor, AA van Dam, 274-291 ...
Holografické konturování a jeho limit při měření slabě difúzně reflexivních povrchů
Czech Academy of Sciences Publication Activity Database
Lédl, Vít; Psota, Pavel; Vojtíšek, Petr; Doleček, Roman; Mokrý, Pavel
2015-01-01
Roč. 60, č. 2 (2015), s. 77-80 ISSN 0447-6441 R&D Projects: GA MŠk(CZ) LO1206 Institutional support: RVO:61389021 Keywords : Specular * Holographic contouring * Multiwavelength * Microroughness Subject RIV: JB - Sensors, Measurment, Regulation http://jmo.fzu.cz/
Indian Academy of Sciences (India)
2016-05-06
May 6, 2016 ... genes act upon one another to carry the information from primary signal ... loops can amplify and extend the response of a weak initial signal, and ...... Duffy JB and Gergen JP 1991 The Drosophila segmentation gene runt acts ...
Fietzke, J.; Liebetrau, V.; Guenther, D.; Frische, M.; Zumholz, K.; Hansteen, T. H.; Eisenhauer, A.
2008-12-01
An alternative approach for the evaluation of isotope ratio data using LA-MC-ICP-MS will be presented. In contrast to previously applied methods it is based on the simultaneous responses of all analyte isotopes of interest and the relevant interferences without performing a conventional background correction. Significant improvements in precision and accuracy can be achieved when applying this new method and will be discussed based on the results of two first methodical applications: a) radiogenic and stable Sr isotopes in carbonates b) stable chlorine isotopes of pyrohydrolytic extracts. In carbonates an external reproducibility of the 87Sr/86Sr ratios of about 19 ppm (RSD) was achieved, an improvement of about a factor of 5. For recent and sub-recent marine carbonates a mean radiogenic strontium isotope ratio 87Sr/86Sr of 0.709170±0.000007 (2SE) was determined, which agrees well with the value of 0.7091741±0.0000024 (2SE) reported for modern sea water [1,2]. Stable chlorine isotope ratios were determined ablating pyrohydrolytic extracts with a reproducibility of about 0.05‰ (RSD). For basaltic reference material JB1a and JB2 chlorine isotope ratios were determined relative to SMOC (standard mean ocean chlorinity) δ37ClJB-1a = (-0.99±0.06) ‰ and δ37ClJB-1a = (-0.60±0.03) ‰ (SD), respectively, in accordance with published data [3]. The described strategies for data reduction are considered to be generally applicable for all isotope ratio measurements using LA-MC-ICP-MS. [1] J.M. McArthur, D. Rio, F. Massari, D. Castradori, T.R. Bailey, M. Thirlwall, S. Houghton, Palaeogeo. Palaeoclim. Palaeoeco., 2006, 242 (126), doi: 10.1016/j.palaeo.2006.06.004 [2] J. Fietzke, V. Liebetrau, D. Guenther, K. Guers, K. Hametner, K. Zumholz, T.H. Hansteen and A. Eisenhauer, J. Anal. At. Spectrom., 2008, 23, 955-961, doi:10.1039/B717706B [3] J. Fietzke, M. Frische, T.H. Hansteen and A. Eisenhauer, J. Anal. At. Spectrom., 2008, 23, 769-772, doi:10.1039/B718597A
Electric Motors: Technical Terminology Bulletin. Terminotech, Vol. 1, No. 2.
General Electric Co. of Canada, Ltd., Montreal, Quebec.
This issue of a bulletin of technological terminology is devoted to electric motors. A brief narrative on the subject is included in both French and English. An English-French dictionary of terms comprises the bulk of the document. Explanatory illustrations are appended (JB).
Label-Free Biosensing in Complex Media: A Referencing Approach
Czech Academy of Sciences Publication Activity Database
Špringer, Tomáš; Bocková, Markéta; Homola, Jiří
2013-01-01
Roč. 85, č. 12 (2013), s. 5637-5640 ISSN 0003-2700 R&D Projects: GA MŠk(CZ) LH11102 Institutional support: RVO:67985882 Keywords : BLOOD-PLASMA * BIOMARKER * PROTEIN Subject RIV: JB - Sensors, Measurment, Regulation Impact factor: 5.825, year: 2013
Hitler's Reich Viewed from 1984
Ward, James E.
1971-01-01
Viewed within a context of Orwell's 1984," the author's visit to East Germany, and particularly to the Museum for German History, revealed the efforts of an authoritarian regime to manipulate the thoughts and directions of that society to its own advantage. (JB)
Long-period gratings inscribed in photonic crystal fiber by symmetric CO2 laser irradiation
Czech Academy of Sciences Publication Activity Database
Tian, F.; Kaňka, Jiří; Zou, B.; Chiang, K.S.; Du, H.
2013-01-01
Roč. 21, č. 11 (2013), s. 13208-13218 ISSN 1094-4087 R&D Projects: GA MŠk(CZ) LH11038 Institutional support: RVO:67985882 Keywords : REFRACTIVE-INDEX * FABRICATION * SENSORS Subject RIV: JB - Sensors, Measurment, Regulation Impact factor: 3.525, year: 2013
South African Journal of Animal Science - Vol 45, No 2 (2015)
African Journals Online (AJOL)
Genetic Prediction Models and Heritability Estimates for Functional Longevity in Dairy Cattle · EMAIL FREE FULL TEXT EMAIL FREE FULL TEXT DOWNLOAD FULL TEXT DOWNLOAD FULL TEXT. VE Imbayarwo-Chikosi, K Dzama, TE Halimani, JB van Wyk, A Maiwashe, CB Banga, 105-121.
Rules, Models, and Self-Reinforcement in Children
Hildebrandt, David E.; And Others
1973-01-01
The study found that concordance between a rule and a recent model's behavior was most effective in leading to acceptance of the rule, despite a tendency for the subject's to adopt lenient self-reinforcement criteria when given an opportunity to do so. (JB)
Animal Production Research Advances - Vol 6, No 3 (2010)
African Journals Online (AJOL)
Environmental Impact and Hazards Analysis Critical Control Point (Haccp) Concept in the Production of Tsire at Zaria, Nigeria · EMAIL FULL TEXT EMAIL FULL TEXT DOWNLOAD FULL TEXT DOWNLOAD FULL TEXT. IO Abdullahi, VJ Umoh, JB Ameh, M Galadima, 220-225 ...
Power Transformers: Technical Terminology Bulletin. Terminotech, Vol.2, No. 6.
General Electric Co. of Canada, Ltd., Montreal, Quebec.
This issue of a bulletin of technological terminology is devoted to power transformers. A brief narrative on the subject is presented in both French and English. An English-French dictionary of terms comprises the bulk of the document. Explanatory illustrations are appended. (JB)
Iron Metallurgy: Technical Terminology Bulletin. Terminotech, Vol. 2, No. 7.
General Electric Co. of Canada, Ltd., Montreal, Quebec.
This issue of a bulletin of technological terminology is devoted to iron metallurgy. Various aspects of iron production are described in both French and English. An English-French dictionary of terms comprises the bulk of the document. Explanatory illustrations are appended. (JB)
The Reluctant Professor: Implications for University Management
Schein, Edgar H.
1973-01-01
Stating the belief that most analyses of the university fail to deal realistically with the role of the professor, the author's purpose is to show why it is difficult and possible undesirable to involve professors deeply in issues of university government. (Author/JB)
African Journals Online (AJOL)
2011-10-25
Oct 25, 2011 ... Ingeniería, Universidad Nacional de Mar del Plata, J.B. Justo 4302,. 7600 Mar del Plata, ..... de Mar del Plata, the Consejo Nacional de Investigaciones. Científicas y Técnicas (CONICET) 2010-2011 PIP 00082, the Agencia ...
South African Journal of Animal Science - Vol 23, No 3 (1993)
African Journals Online (AJOL)
Non-genetic factors influencing early growth traits in the Elsenburg Dormer sheep stud · EMAIL FREE FULL TEXT EMAIL FREE FULL TEXT · DOWNLOAD FULL TEXT DOWNLOAD FULL TEXT. J.B. van Wyk, G.J. Erasmus, K.V. Konstantinov, 67-71 ...
Measurement of the dynamo effect in a plasma
International Nuclear Information System (INIS)
Ji, H.; Prager, S.C.; Almagri, A.F.; Sarff, J.S.; Hirano, Y.; Toyama, H.
1995-11-01
A series of the detailed experiments has been conducted in three laboratory plasma devices to measure the dynamo electric field along the equilibrium field line (the α effect) arising from the correlation between the fluctuating flow velocity and magnetic field. The fluctuating flow velocity is obtained from probe measurement of the fluctuating E x B drift and electron diamagnetic drift. The three major findings are (1) the α effect accounts for the dynamo current generation, even in the time dependence through a ''sawtooth'' cycle; (2) at low collisionality the dynamo is explained primarily by the widely studied pressureless Magnetohydrodynamic (MHD) model, i.e., the fluctuating velocity is dominated by the E x B drift; (3) at high collisionality, a new ''electron diamagnetic dynamo'' is observed, in which the fluctuating velocity is dominated by the diamagnetic drift. In addition, direct measurements of the helicity flux indicate that the dynamo activity transports magnetic helicity from one part of the plasma to another, but the total helicity is roughly conserved, verifying J.B. Taylor's conjecture
Building a new TSO organization and its competences in the Czech Republic
International Nuclear Information System (INIS)
Hrehor, Miroslav; Kynčl, Miloš; Mazzini, Guido; Ruščák, Marek; Musa, Alis
2017-01-01
This paper contains a proposal for establishing an independent technical and expert nuclear safety team within the National Radiation Protection Institute (SÚRO) in support of the State Office for Nuclear Safety (SÚJB). The team’s competences should be gradual improved so that starting 2021, SÚRO could perform as a fully functional TSO for SÚJB in all key areas of SÚJB’s responsibilities (as far as feasible), covering specifically nuclear safety, technical safety, radiation protection, emergency preparedness and security (physical protection). This objective requires, in addition to personal and material resources, gradual building of expertise as regards existing as well as future nuclear facilities. Preparing a team of TSO workers for future ''professional competences'' is already taking place by addressing research projects focusing on new generation reactors and innovative cooling media. Examples of current activities and applications in these areas are presented.
Fitting the e+e- → e+e- lineshape
International Nuclear Information System (INIS)
Martinez, M.; Miquel, R.
1992-01-01
The implications of different treatments of the e + e - →e + e - cross sections in the context of Z parameter fitting are discussed. We show that fitting with a complete description of the process might become important for an accurate determination of the Z parameters. A fitting formula describing the integrated cross section in terms of the Z parameters is presented. This formula agrees with the most accurate calculations in the Standard Model to within 1 per mil. (orig.)
International Nuclear Information System (INIS)
Lehner, D.
1993-01-01
In this thesis results are presented, which are based on data, which were taken up with the detector of the ALEPH collaboration at the e + e - storage ring LEP in Geneva in the years 1990 and 1991. At c.m. energies between 88.25 GeV and 94.25 GeV the three reactions e + e - →μ + μ - μ + μ - , e + e - → e + e - μ + μ - and e + e - → e + e - e + e - were studied. After subtraction of the background from the ALEPH date the following N exp / μ +μ - μ + μ - = 4.88 ± (2.24) stat N exp / e + e - μ + μ - 24.1 (5.1) stat ± (0.16) sys and N exp / e + e - e + e - = 10.4 ± (4.1 stat) ± (0.44) sys results, while the event numbers expected according to the standard model are given by N theo / μ + μ - μ + μ - = 3.46 (0.04) stat ± (0.42) sys N theo / e + e - μ + μ - = 14.48 ± (0.19) stat ± (1.97) sys and N theo / e + e - e + e - = 12.24 ± (0.21) stat ± (1.46) sys. An X 2 test shows a confidence level of 30% for the hypothesis of the description of the data by the standard model of the electroweak interactions. Furthermore the invariant masses of the lepton pairs of the three final states studied were analyzed and a test of the universality of the photoproduction of electron and muon pairs was performed. The each measured data are in accordance with the predictions of the standard model. (orig./HSI) [de
Role of Pin1 in UVA-induced cell proliferation and malignant transformation in epidermal cells
International Nuclear Information System (INIS)
Han, Chang Yeob; Hien, Tran Thi; Lim, Sung Chul; Kang, Keon Wook
2011-01-01
Highlights: → Pin1 expression is enhanced by low energy UVA irradiation in both skin tissues of hairless mice and JB6 C141 epidermal cells. → UVA irradiation increases activator protein-1 activity and cyclin D1 in a Pin1-dependent manner. → UVA potentiates EGF-inducible, anchorage-independent growth of epidermal cells, and this is suppressed by Pin1 inhibition or by anti-oxidant. -- Abstract: Ultraviolet A (UVA) radiation (λ = 320-400 nm) is considered a major cause of human skin cancer. Pin1, a peptidyl prolyl isomerase, is overexpressed in most types of cancer tissues and plays an important role in cell proliferation and transformation. Here, we demonstrated that Pin1 expression was enhanced by low energy UVA (300-900 mJ/cm 2 ) irradiation in both skin tissues of hairless mice and JB6 C141 epidermal cells. Exposure of epidermal cells to UVA radiation increased cell proliferation and cyclin D1 expression, and these changes were blocked by Pin1 inhibition. UVA irradiation also increased activator protein-1 (AP-1) minimal reporter activity and nuclear levels of c-Jun, but not c-Fos, in a Pin1-dependent manner. The increases in Pin1 expression and in AP-1 reporter activity in response to UVA were abolished by N-acetylcysteine (NAC) treatment. Finally, we found that pre-exposure of JB6 C141 cells to UVA potentiated EGF-inducible, anchorage-independent growth, and this effect was significantly suppressed by Pin1inhibition or by NAC.
High-momentum components in 3He(e,e') and (e,e'p)
International Nuclear Information System (INIS)
Sick, I.
1984-01-01
In this talk, the author discusses the properties of the 3 He spectral function S(K,E) at large momentum K and large separation energy E. He deals in particular with the question how to measure S, and how to understand the physics connected to it. As experimental input he uses (e,e') data. He starts by discussing how to understand (e,e') in terms of properties of S(K,E). For this purpose, an extensive discussion of the scaling function F(y) is needed. When once it is found out how to exploit inclusive scattering, he comes back to exclusive reactions and discusses the relative merits of (e,e'p) and (e,e') in order to investigate how these tools can best complement each other. Some conclusions on the properties of S(K,E) at large K and E, together with some suggestions for future activities follows. (Auth.)
Control of eIF4E cellular localization by eIF4E-binding proteins, 4E-BPs.
Rong, Liwei; Livingstone, Mark; Sukarieh, Rami; Petroulakis, Emmanuel; Gingras, Anne-Claude; Crosby, Katherine; Smith, Bradley; Polakiewicz, Roberto D; Pelletier, Jerry; Ferraiuolo, Maria A; Sonenberg, Nahum
2008-07-01
Eukaryotic initiation factor (eIF) 4E, the mRNA 5'-cap-binding protein, mediates the association of eIF4F with the mRNA 5'-cap structure to stimulate cap-dependent translation initiation in the cytoplasm. The assembly of eIF4E into the eIF4F complex is negatively regulated through a family of repressor proteins, called the eIF4E-binding proteins (4E-BPs). eIF4E is also present in the nucleus, where it is thought to stimulate nuclear-cytoplasmic transport of certain mRNAs. eIF4E is transported to the nucleus via its interaction with 4E-T (4E-transporter), but it is unclear how it is retained in the nucleus. Here we show that a sizable fraction (approximately 30%) of 4E-BP1 is localized to the nucleus, where it binds eIF4E. In mouse embryo fibroblasts (MEFs) subjected to serum starvation and/or rapamycin treatment, nuclear 4E-BPs sequester eIF4E in the nucleus. A dramatic loss of nuclear 4E-BP1 occurs in c-Ha-Ras-expressing MEFs, which fail to show starvation-induced nuclear accumulation of eIF4E. Therefore, 4E-BP1 is a regulator of eIF4E cellular localization.
Measurement of the $K_{L} \\to e^{+}e^{-}e^{+} e^{-}$ Decay Rate
Lai, A; Marras, D; Batley, J Richard; Dosanjh, R S; Gershon, T J; Kalmus, George Ernest; Lazzeroni, C; Munday, D J; Olaiya, E; Parker, M A; White, T O; Wotton, S A; Arcidiacono, R; Barr, G; Bocquet, G; Ceccucci, Augusto; Çuhadar-Dönszelmann, T; Cundy, Donald C; Doble, Niels T; Falaleev, V P; Gatignon, L; Gonidec, A; Gorini, B; Grafström, P; Kubischta, Werner; Lacourt, A; Norton, A; Panzer-Steindel, B; Tatishvili, G T; Wahl, H; Cheshkov, C; Khristov, P Z; Kekelidze, V D; Madigozhin, D T; Molokanova, N A; Potrebenikov, Yu K; Zinchenko, A I; Martin, V; Rubin, P; Sacco, R; Walker, A; Contalbrigo, M; Dalpiaz, Pietro; Duclos, J; Frabetti, P L; Gianoli, A; Martini, M; Petrucci, F; Savrié, M; Bizzeti, A; Calvetti, M; Collazuol, G; Graziani, G; Iacopini, E; Lenti, M; Martelli, F; Veltri, M; Eppard, M; Hirstius, A; Holtz, K; Kleinknecht, K; Koch, U; Köpke, L; Lopes da Silva, P; Marouelli, P; Mestvirishvili, I; Pellmann, I A; Peters, A; Schmidt, S A; Schönharting, V; Schué, Yu; Wanke, R; Winhart, A; Wittgen, M; Chollet, J C; Fayard, Louis; Iconomidou-Fayard, L; Unal, G; Wingerter-Seez, I; Anzivino, Giuseppina; Cenci, P; Imbergamo, E; Lubrano, P; Mestvirishvili, A; Nappi, A; Pepé, M; Piccini, M; Casali, R; Cerri, C; Cirilli, M; Costantini, F; Fantechi, R; Fiorini, Luca; Giudici, Sergio; Mannelli, I; Pierazzini, G M; Sozzi, M; Chèze, J B; De Beer, M; Debu, P; Derue, F; Formica, A; Granier de Cassagnac, R; Gouge, G; Marel, Gérard; Mazzucato, E; Peyaud, B; Turlay, René; Vallage, B; Holder, M; Maier, A; Ziolkowski, M; Biino, C; Cartiglia, N; Marchetto, F; Menichetti, E; Pastrone, N; Nassalski, J P; Rondio, Ewa; Szleper, M; Wislicki, W; Wronka, S; Dibon, Heinz; Jeitler, Manfred; Markytan, Manfred; Mikulec, I; Neuhofer, Günther; Pernicka, Manfred; Taurok, Anton; Widhalm, L; Beavis, D; Besliu, C; Budick, B; Bøggild, H; Chasman, C; Christensen, C H; Christiansen, P; Cibor, J; Debbe, R; Enger, E; Gaardhøje, J J; Germinario, M; Hagel, K; Ito, H; Jipa, A; Jundt, F; Jordre, J I; Jorgensen, C E; Karabowicz, R; Kim, E J; Kozik, T; Larsen, T M; Lee, J H; Lee, Y K; Lindal, S; Lystad, R; Løvhøiden, G; Majka, Z; Makeev, A; Mikelsen, M; Murray, M; Natowitz, J B; Neumann, B; Nielsen, B S; Ouerdane, D; Planeta, R; Rami, F; Ristea, C; Ristea, O; Röhrich, D; Samset, B H; Sandberg, D; Sanders, S J; Scheetz, R A; Staszel, P; Tveter, T S; Videbaek, F; Wada, R; Yin, Z; Zgura, I S
2005-01-01
The decay rate of the long-lived neutral K meson into the e^+ e^- e^+ e^- final state has been measured with the NA48 detector at the CERN SPS. Using data collected in 1998 and 1999, a total of 200 events has been observed with negligible background. This observation corresponds to a branching ratio of Br(K_L -> e^+ e^- e^+ e^-) = (3.30 + - 0.24_stat + - 0.23_sys + - 0.10_norm) x 10^-8.
International Nuclear Information System (INIS)
Domogatskij, G.
1984-01-01
For recording cosmic neutrinos the installation is considered of a detector in the depths of the Baikal lake with a capacity of up to 10 6 m 3 in the shape of a crystalline lattice with photoelectron multipliers placed in its nodes. (J.B.)
Kanter, Rosabeth Moss
1984-01-01
The change masters are identified as corporate managers who have the resources and the vision to effect an economic renaissance in the United States. Strategies for change should emphasize horizontal as well as vertical communication, and should reward enterprise and innovation at all levels. (JB)
Combining surface waves and common methods for shallow geophysical survey
Czech Academy of Sciences Publication Activity Database
Gaždová, Renata; Kolínský, Petr; Vilhelm, J.; Valenta, Jan
2015-01-01
Roč. 13, č. 1 (2015), s. 19-32 ISSN 1569-4445 R&D Projects: GA SÚJB JC_1/2009 Institutional support: RVO:67985891 Keywords : attenuation curves * inversion * dispersion * velocity * faults Subject RIV: DC - Siesmology, Volcanology, Earth Structure Impact factor: 1.232, year: 2015
Czech Academy of Sciences Publication Activity Database
Krištofíková, Z.; Řípová, D.; Bartoš, A.; Bocková, Markéta; Hegnerová, Kateřina; Říčný, J.; Čechová, L.; Vrajová, M.; Homola, Jiří
2013-01-01
Roč. 10, č. 2 (2013), s. 165-173 ISSN 1567-2050 R&D Projects: GA MZd(CZ) NT11225 Institutional support: RVO:67985882 Keywords : Amyloid beta * mitochondrial enzyme * Alzheimer 's disease Subject RIV: JB - Sensors, Measurment, Regulation Impact factor: 3.796, year: 2013
Czech Academy of Sciences Publication Activity Database
Krylova, G.; Spanhel, L.; Brioude, A.; Soraya, A.G.; Mrázek, Jan
2010-01-01
Roč. 12, č. 45 (2010), s. 15101-15110 ISSN 1463-9076 R&D Projects: GA MŠk OC08023 Institutional research plan: CEZ:AV0Z20670512 Keywords : nanomaterial * photocatalyze * optical properties Subject RIV: JB - Sensors, Measurment, Regulation Impact factor: 3.454, year: 2010
International Nuclear Information System (INIS)
Singh, M.; Pradeep Kumar; Singh, Y.; Varshney, A.K.; Gupta, D.K.
2014-01-01
We undertake the present work to treat 232 Th with a soft rotor formula used recently by C. Bihari et. al for γ-band and modified by J.B. Gupta et. al. It describes energy in terms of moment of inertia and softness parameter
Czech Academy of Sciences Publication Activity Database
Šrobár, Fedor
2013-01-01
Roč. 32, č. 3 (2013), s. 401-408 ISSN 1536-8378 R&D Projects: GA ČR(CZ) GAP102/11/0649 Institutional support: RVO:67985882 Keywords : bioelectromagnetism * cancer transformation * energy condensation Subject RIV: JB - Sensors, Measurment, Regulation Impact factor: 0.769, year: 2013
Czech Academy of Sciences Publication Activity Database
Chen, S.; Yu, Q.; Li, L.; Boozer, C. L.; Homola, Jiří; Yee, S. S.; Jiang, S.
2002-01-01
Roč. 124, č. 13 (2002), s. 3395-3401 ISSN 0002-7863 Grant - others:National Science Foundation(US) CTS-0092699; National Science Foundation(US) CTS-9983895 Keywords : biosensors * surface plasmon resonance * optical sensors Subject RIV: JB - Sensors, Measurment, Regulation Impact factor: 6.201, year: 2002
Research of human factor in nuclear power plants
International Nuclear Information System (INIS)
Nopp, I.
1983-01-01
The question is discussed of the study of the human factor with regard to the reliability of nuclear power plant operation. The reliability of the human factor is the result of the functional fitness, motivation, working conditions and working regime of personnel. (J.B.)
Digitaria Effusa (Gramineae), a new species from Vietnam
Veldkamp, J.F.
1999-01-01
During an agrostological survey in the Lam Dong Province, Vietnam, Mr. J.B. Hacker (St. Lucia, Queensland, Australia) collected a remarkable undescribed species of Digitaria. Among the Asian taxa it is peculiar because of its montane provenance coupled with a combination of an inflorescence with
Hydraulic Turbines: The Francis Turbine. Technical Terminology Bulletin. Terminotech, Vol. 2, No. 2.
General Electric Co. of Canada, Ltd., Montreal, Quebec.
This issue of a bulletin of technological terminology is devoted to the Francis turbine. A brief narrative on the subject is presented in both French and English. An English-French dictionary of terms comprises the bulk of the document. An explanatory illustration is appended. (JB)
Hydraulic Turbines: The Pelton Turbine. Technical Terminology Bulletin. Terminotech, Vol. 2, No. 3.
General Electric Co. of Canada, Ltd., Montreal, Quebec.
This issue of a bulletin of technological terminology is devoted to the Pelton turbine. A brief narrative on the subject is presented in both French and English. An English-French dictionary of terms comprises the bulk of the document. Explanatory illustrations are appended. (JB)
An Approach to Reduce the Sample Consumption for LIBS based Identification of Explosive Materials
Czech Academy of Sciences Publication Activity Database
Anubham, S.K.; Junjuri, R.; Myakalwar, A.K.; Gundawar, M.K.
2017-01-01
Roč. 67, č. 3 (2017), s. 254-259 ISSN 0011-748X Institutional support: RVO:67985882 Keywords : Laser induced breakdown spectroscopy * K - Nearest neighbour * Synthetic spectra Subject RIV: JB - Sensors, Measurment, Regulation OBOR OECD: Electrical and electronic engineering Impact factor: 0.500, year: 2016
Water SA - Vol 38, No 2 (2012)
African Journals Online (AJOL)
DOWNLOAD FULL TEXT DOWNLOAD FULL TEXT. D Kotsedi, JB Adams, GC Snow, 177-190 ... Monetary valuation of salinity impacts and microbial pollution in the Olifants Water Management Area, South Africa · EMAIL FREE FULL TEXT EMAIL FREE FULL TEXT DOWNLOAD FULL TEXT DOWNLOAD FULL TEXT.
Comparative Experience Factors among Black, Asian, and Hispanic Americans: Coalitions or Conflicts?
Anderson, Talmadge
1992-01-01
Compares the culture, sociology, politics, and economics of African Americans, Hispanic Americans, and Asian Americans in the United States. Describes increased racial-ethnic national pluralism, the increased possibility of conflict between groups, and the need for dialogue and work toward coalition among these groups. (JB)
Czech Academy of Sciences Publication Activity Database
Podrazký, Ondřej; Mrázek, Jan; Proboštová, Jana; Kašík, Ivan; Pitrová, Š.; Pavlíčková, K.
2017-01-01
Roč. 62, 11-12 (2017), s. 310-312 ISSN 0447-6441 R&D Projects: GA TA ČR(CZ) TA04011400 Institutional support: RVO:67985882 Keywords : optic al sensors * pH * cataract Subject RIV: JB - Sensors, Measurment, Regulation OBOR OECD: Electrical and electronic engineering
Control of eIF4E cellular localization by eIF4E-binding proteins, 4E-BPs
Rong, Liwei; Livingstone, Mark; Sukarieh, Rami; Petroulakis, Emmanuel; Gingras, Anne-Claude; Crosby, Katherine; Smith, Bradley; Polakiewicz, Roberto D.; Pelletier, Jerry; Ferraiuolo, Maria A.; Sonenberg, Nahum
2008-01-01
Eukaryotic initiation factor (eIF) 4E, the mRNA 5′-cap-binding protein, mediates the association of eIF4F with the mRNA 5′-cap structure to stimulate cap-dependent translation initiation in the cytoplasm. The assembly of eIF4E into the eIF4F complex is negatively regulated through a family of repressor proteins, called the eIF4E-binding proteins (4E-BPs). eIF4E is also present in the nucleus, where it is thought to stimulate nuclear-cytoplasmic transport of certain mRNAs. eIF4E is transported...
The NLC IR and e+e-/e- e- Compatibility Issues
Energy Technology Data Exchange (ETDEWEB)
Markiewicz, Thomas W
2003-01-29
This paper collects and summarizes information presented at previous e- e- workshops. Firstly, the various options for reconfiguring magnets and power sources to convert the NLC to e- e- operation are discussed. Secondly, the expected backgrounds from pair creation at the interaction point are presented. Lastly, beam loss in the extraction line is discussed.
Solar Environmental Disturbances
2007-11-02
Astronomische Nachrichten 324, 303-304: Design and Development of the Advanced Technology Solar Telescope Keller, C.U., Rimmele, T.R., Hill, F...Keil, S.L., Oschmann, J.M., and the ATST Team 2002, Astronomische Nachrichten 323, 294-298: The Advanced Technology Solar Telescope Mozer, J.B
Effect of dietary vitamin D3 supplementation on meat quality of ...
African Journals Online (AJOL)
student
Karges K, Brooks JC, Gill DR, Breazile JE, Owens FN and Morgan JB. (2001). Effect of ... Vitamin D3 and papaya leaf on meat quality of spent laying hens. Agric. J. 6(4): 197-200 ... Edn. SAS Institute, Inc., North Caroline, USA. Savell JW, Smith ...
African Journal of Marine Science - Vol 40, No 1 (2018)
African Journals Online (AJOL)
Overview and status of estuarine microphytobenthos ecological research in South Africa · EMAIL FULL TEXT EMAIL FULL TEXT DOWNLOAD FULL TEXT DOWNLOAD FULL TEXT. T Dalu, J.B. Adams, J.C. Taylor, G.C. Bate, M Nunes, P.W. Froneman, R.J. Wasserman, 1-12 ...
Proceedings of the international symposium on safety and reliability systems of PWRs and BWRs
Energy Technology Data Exchange (ETDEWEB)
NONE
1996-05-01
Out of 33 contributions presented at the conference, 30 were submitted to INIS. The conference programme was divided into three sections: (i) Diagnostics and in-service inspection; (ii) Safety and reliability of NPP operation; (iii) Experience of NPP operation and new approaches to nuclear safety. (J.B.).
Czech Academy of Sciences Publication Activity Database
Matějíček, Jiří; Sampath, S.
2003-01-01
Roč. 51, č. 3 (2003), s. 863-872 ISSN 1359-6454 Grant - others:NSF(US) DMR9632570 Institutional research plan: CEZ:AV0Z2043910 Keywords : coatings plasma spraying, mechanical properties testing, elastic modulus Subject RIV: JB - Sensors, Measurment, Regulation Impact factor: 3.059, year: 2003
Continuity and Discontinuity in the Contemporary Crisis of Meanings
Etzioni, Amitai
1972-01-01
A discussion of the main historical roots and the key features of the contemporary crisis of the erosion of legitimation and the loss of meaning. Author traces the course of capitalism from a puritan to a hedonistic ethos and discusses postmodern alternatives of social philosophy. (Author/JB)
DNA-directed protein immobilization on mixed self-assembled monolayers via a streptavidin bringe
Czech Academy of Sciences Publication Activity Database
Ladd, J.; Boozer, C.; Yu, Q.; Chen, S.; Homola, Jiří; Jiang, S.
2004-01-01
Roč. 20, č. 19 (2004), s. 8090-8095 ISSN 0743-7463 Grant - others:US FDA(US) FD-U-002250 Institutional research plan: CEZ:AV0Z2067918 Keywords : biosensors * surface plasmon resonance * optical sensors Subject RIV: JB - Sensors, Measurment, Regulation Impact factor: 3.295, year: 2004
Czech Academy of Sciences Publication Activity Database
Boozer, C.; Ladd, J.; Chen, S.; Yu, Q.; Homola, Jiří; Jiang, S. Y.
2004-01-01
Roč. 76, č. 23 (2004), s. 6967-6972 ISSN 0003-2700 Grant - others:US FDA(US) FD-U-002250 Institutional research plan: CEZ:AV0Z2067918 Keywords : arrays * biosensors * surface plasmon resonance * gold Subject RIV: JB - Sensors, Measurment, Regulation Impact factor: 5.450, year: 2004
Evoked Brain Activity and Personnel Performance
1987-10-01
Shucard and Horn (1972), Galbraith, Gliddon, and Busk (1970), and Callaway (1975), the latter using Navy recruits. Callaway’s own work was reported at...G.C., Gliddon, J.B., & Busk , J. (1970). Visual evoked responses in mentally retarded and nonretarded subjects. American Journal of Mental Deficiency
Czech Academy of Sciences Publication Activity Database
Shubhra, Q. T. H.; Feczkó, T.; Kardos, A. F.; Tóth, J.; Macková, Hana; Horák, Daniel; Dósa, G.; Gyenis, J.
2014-01-01
Roč. 31, č. 2 (2014), s. 156-165 ISSN 0265-2048 R&D Projects: GA AV ČR(CZ) KAN401220801 Institutional support: RVO:61389013 Keywords : encapsulation efficiency * experimental design * human serum albumin Subject RIV: JB - Sensors, Measurment, Regulation Impact factor: 1.585, year: 2014
Czech Academy of Sciences Publication Activity Database
Hradecká, L.; Lobitzer, H.; Svobodová, Marcela; Švábenická, L.
2006-01-01
Roč. 146, 1-2 (2006), s. 132-133 ISSN 0016-7800 Institutional research plan: CEZ:AV0Z30130516 Keywords : sedimentology * paleontology * Gosau Fm., * Northern Calcareous Alps, * Austria Subject RIV: DB - Geology ; Mineralogy http://www.geologie.ac.at/filestore/download/JB1461_132_A.pdf
Synthesis and characterization of some metal complexes of a Schiff ...
African Journals Online (AJOL)
The chemistry of the reaction of ninhydrin with amino acids has been ..... at 1600 – 1590 cm-1 and a weaker symmetric stretching peak at ~1400 cm-1 [35-38]. ..... Lambert, J.B; Shruvell, H.F.; Verbit, L.; Cooks, R.G.; Stout, G.H. Organic Structural.
Self-referencing SPR imaging for most demanding high-throughput screening applications
Czech Academy of Sciences Publication Activity Database
Piliarik, Marek; Homola, Jiří
2008-01-01
Roč. 134, č. 2 (2008), s. 353-355 ISSN 0925-4005 R&D Projects: GA AV ČR KAN200670701 Institutional research plan: CEZ:AV0Z20670512 Keywords : surface plasmons * biosensors * detection Subject RIV: JB - Sensors, Measurment, Regulation Impact factor: 3.122, year: 2008
A Novel Swine Model for Evaluation of Potential Intravascular Hemostatic Agents
2007-06-01
bovine polymerized hemoglobin on coagulation in controlled hemorrhagic shock in swine. Shock 24:145–152. 2. Bellamy RF. 1984. The causes of death in...WZ, Pusateri AE, Uscilowicz JM, Delgado AV, Holcomb JB. 2005. Independent contributions of hypothermia and acidosis to coagulopathy in swine. J
African Americans: Race as a Self-Schema Affecting Physical Activity Choices.
Harrison, Louis Jr.
1995-01-01
This paper examines theoretical and empirical contributions to racial differences in spot performance and describes a framework for viewing race as a movement self-schema. The roles of television, modeling, expectation theory, and sociological influences are discussed as possible activators of racial movement self-schemata. (JB)
The impact of acute preoperative beta-blockade on perioperative ...
African Journals Online (AJOL)
To determine the impact of acute preoperative β-blockade on the incidence of perioperative cardiovascular morbidity and all- ... Our findings suggest that acute preoperative β-blockade is associated with an increased risk of perioperative cardiac ..... Shammash JB, Trost JC, Gold JM, Berlin JA, Golden MA, Kimmel SE.
Czech Academy of Sciences Publication Activity Database
Podrazký, Ondřej; Mrázek, Jan; Proboštová, Jana; Kašík, Ivan; Pitrová, Š.; Pavlíčková, K.
2017-01-01
Roč. 62, 11-12 (2017), s. 310-312 ISSN 0447-6441 R&D Projects: GA TA ČR(CZ) TA04011400 Institutional support: RVO:67985882 Keywords : optical sensor s * pH * cataract Subject RIV: JB - Sensor s, Measurment, Regulation OBOR OECD: Electrical and electronic engineering
Standoff Detection of Explosives at 1 m using Laser Induced Breakdown Spectroscopy
Czech Academy of Sciences Publication Activity Database
Junjuri, R.; Myakalwar, A.K.; Gundawar, M.K.
2017-01-01
Roč. 67, č. 6 (2017), s. 623-630 ISSN 0011-748X Institutional support: RVO:67985882 Keywords : Laser induced breakdown spectroscopy * Multivariate analysis * Principal component analysis * Explosive detection Subject RIV: JB - Sensors, Measurment, Regulation OBOR OECD: Electrical and electronic engineering Impact factor: 0.500, year: 2016
Ise Ni Ounise, Mura Si Ise Ore Mi
African Journals Online (AJOL)
OHUN TI A BA FARA SISE FUN Whatever we gain one does not work hard to earn. SI KI LO TOJO ... J.B Yeats' (1956) reality: “things fall apart”, the gradual calamitous collapse and tragedy of “the ..... IJA, therefore, asserts that the right thing to.
Czech Academy of Sciences Publication Activity Database
Taylor, A. D.; Ladd, J.; Yu, Q.; Chen, S.; Homola, Jiří; Jiang, S.
2006-01-01
Roč. 22, č. 5 (2006), s. 752-758 ISSN 0956-5663 Grant - others:US FDA(US) FD-U-002250 Institutional research plan: CEZ:AV0Z20670512 Keywords : surface plasmon resonance * biosensors * optical sensors Subject RIV: JB - Sensors, Measurment, Regulation Impact factor: 4.132, year: 2006
Proceedings of the international symposium on safety and reliability systems of PWRs and BWRs
International Nuclear Information System (INIS)
1996-02-01
Out of 33 contributions presented at the conference, 30 were submitted to INIS. The conference programme was divided into three sections: (i) Diagnostics and in-service inspection; (ii) Safety and reliability of NPP operation; (iii) Experience of NPP operation and new approaches to nuclear safety. (J.B.)
Czech Academy of Sciences Publication Activity Database
Schejbal, V.; Bezoušek, P.; Čermák, D.; NĚMEC, Z.; Fišer, Ondřej; Hájek, M.
2006-01-01
Roč. 15, č. 1 (2006), s. 17-24 ISSN 1210-2512 R&D Projects: GA MPO(CZ) FT-TA2/030 Institutional research plan: CEZ:AV0Z30420517 Keywords : Ultra wide band * UWB antennas * UWB propagation * multipath effects Subject RIV: JB - Sensors, Measurment, Regulation
Molnar, P.; Chen, W.-P.
1984-01-01
S-P wave travel time residuals were measured in earthquakes in Tibet and the Himalaya in order to study lateral inhomogeneities in the earth's mantle. Average S-P residuals, measured with respect to Jeffrey-Bullen (J-B) tables for 11 earthquakes in the Himalaya are less than +1 second. Average J-B S-P from 10 of 11 earthquakes in Tibet, however, are greater than +1 second even when corrected for local crustal thickness. The largest values, ranging between 2.5 and 4.9 seconds are for five events in central and northern Tibet, and they imply that the average velocities in the crust and upper mantle in this part of Tibet are 4 to 10 percent lower than those beneath the Himalaya. On the basis of the data, it is concluded that it is unlikely that a shield structure lies beneath north central Tibet unless the S-P residuals are due to structural variations occurring deeper than 250 km.
DEFF Research Database (Denmark)
Manevski, Kiril
The agriculture in both China and Denmark needs to reduce nitrogen (N) leaching from the crop root zone in order to maintain high-quality groundwater for drinking purposes and to reduce eutrophication of surface waters. However, N leaching is a process that is concurrent and interacting with many...... others in the agro-ecosystem, such as crop growth and N uptake, mineralization of soil organic N and field management practices. Thus, the aim of the Ph.D. study was to investigate, with the use of the physically-based DAISY agro-ecosystem model, crop growth, soil N and leaching processes from (i) maize......-winter wheat annual systems at different fertilizer N rates in the North China Plain (NCP, silty loam soil), China, and (ii) maize for silage systems differing in past cropping, intercropping and fertilizer N levels in central Jutland (sandy loam soil, JB4) and southern Jutland (coarse sandy soil JB1, Jyndevad...
African Journals Online (AJOL)
Items 1 - 50 of 506 ... PL Mwang'ingo, Z Teklehaimanot, JB Hall, LLL Lulandala. Vol 206 (2006), Age determination of miombo species Brachystegia spiciformis (Leguminosae – Caesalpinoideae) in Zimbabwe using growth rings, Abstract. IM Grundy. Vol 73, No 2 (2011), Air layering and its potential in propagating Uapaca ...
Results of Summer Enrichment Program to Promote High School Students' Interest in Engineering
Hart, Brenda; McAnulty, Kate
2014-01-01
For more than thirty years, personnel from the University of Louisville J.B. Speed School of Engineering have presented a summer program targeting high school students historically underrepresented in engineering fields. INSPIRE provides these students with an introduction to careers in engineering and assists the students in planning their…
The Question of Our Professional Identity: Reactions to the Barth/Shermis Article
Barr, Robert D.
1970-01-01
Discusses the positive value and usefullness of the Barth and Shermis definition of social studies and points out that in spite of circumstances which wmay limit its classroom influence, it should serve to focus attention on the important question of professional identity. Related article SO 500 188. (JB)
From Homer to Hoke: A Small Step for African American Mankind.
Turner, Patricia A.
1991-01-01
Explores links between two films, "Lilies of the Field" (1962) and "Driving Miss Daisy" (1987), their portrayal of African-American men in relationships with White women, and audience and critic responses to the films. Little has changed in the Hollywood perceptions since the earlier film was made. (JB)
Nigerian Veterinary Journal - Vol 36, No 1 (2015)
African Journals Online (AJOL)
Evaluation of Healing Intervals of Incisional Skin Wounds of Goats Closed with Three Suture Patterns · EMAIL FREE FULL TEXT EMAIL FREE FULL TEXT DOWNLOAD FULL TEXT DOWNLOAD FULL TEXT. AA Abubakar, U Adamu, JB Adeyanju, ROC Kene, ML Sonfada, AS Yakubu, SM Sahabi, AA Umar, HM Ibrahim, ...
Multi-wall carbon nanotube networks as potential resistive gas sensors for organic vapor detection
Czech Academy of Sciences Publication Activity Database
Slobodian, P.; Říha, Pavel; Lengálová, A.; Svoboda, P.; Sáha, P.
2011-01-01
Roč. 49, č. 7 (2011), s. 2499-2507 ISSN 0008-6223 Institutional research plan: CEZ:AV0Z20600510 Keywords : carbon nanotube network * KMnO 4 oxidation * electrical resistance * organic vapor detection * adsorption /desorption cycles Subject RIV: JB - Sensors, Measurment, Regulation Impact factor: 5.378, year: 2011
Antonacopoulou, Elena P.
2016-01-01
In "Identifying Research Topic Development in Business and Management Education Research Using Legitimation Code Theory," authors J.B. Arbaugh, Charles J. Fornaciari, and Alvin Hwang ("Journal of Management Education," December 2016 vol. 40 no. 6 p654-691, see EJ1118407) used citation analysis to track the development of…
East and Central African Journal of Surgery Volume 10 Number 2 ...
African Journals Online (AJOL)
user
2005-12-02
Dec 2, 2005 ... Correspondences to: Dr Mchembe MD, Lecturer, Department of Surgery Muhimbili University College ... general or spinal anesthesia, patient was placed .... surgery textbook. J.B. Lippincott. Company Philadelphia 1984; 6-7. 2. Abrams JS: A hard look at colonoscopy. Am J Surg 1977; 133: 111-115. 3.
Communicatie-architectuur PLC’s en Unity
J.L. Scholte
2017-01-01
Voor het afronden van de studie Technische Informatica aan de Haagse Hogeschool te Delft is het noodzakelijk om een afstudeeropdracht uit te voeren. In de loop van zeventien weken is deze opdracht uitgevoerd bij het bedrijf JB Systems te Vlaardingen en Delft door de afstudeerder Jordy Scholte. Dit
Nonlinear wave propagation through a ferromagnet with damping in ...
Indian Academy of Sciences (India)
magnetic waves in a ferromagnet can be reduced to an integro-differential equation. Keywords. Solitons; integro-differential equations; reductive perturbation method. PACS Nos 41.20 Jb; 05.45 Yv; 03.50 De; 78.20 Ls. 1. Introduction. The phenomenon of propagation of electromagnetic waves in ferromagnets are not only.
Czech Academy of Sciences Publication Activity Database
Fernández, F.; Hegnerová, Kateřina; Piliarik, Marek; Sanchez-Baeza, F.; Homola, Jiří; Marko, M.P.
2010-01-01
Roč. 26, č. 4 (2010), s. 1231-1238 ISSN 0956-5663 R&D Projects: GA AV ČR KAN200670701 Institutional research plan: CEZ:AV0Z20670512 Keywords : surface plasmon resonance * antibiotic s * milk Subject RIV: JB - Sensors, Measurment, Regulation Impact factor: 5.361, year: 2010
Czech Academy of Sciences Publication Activity Database
Krištofíková, Z.; Bocková, Markéta; Hegnerová, Kateřina; Bartoš, A.; Klaschka, J.; Říčný, J.; Řípová, D.; Homola, Jiří
2009-01-01
Roč. 10, č. 5 (2009), s. 1174-1179 ISSN 1742-206X R&D Projects: GA MZd NR9322 Institutional research plan: CEZ:AV0Z20670512 Keywords : 17beta-HSD 10 * Alzheimer disease * SPR sensor Subject RIV: JB - Sensors, Measurment, Regulation Impact factor: 4.015, year: 2009
Czech Academy of Sciences Publication Activity Database
Shubhra, Q. T. H.; Kardos, A. F.; Feczkó, T.; Macková, Hana; Horák, Daniel; Tóth, J.; Dósa, G.; Gyenis, J.
2014-01-01
Roč. 31, č. 2 (2014), s. 147-155 ISSN 0265-2048 R&D Projects: GA AV ČR(CZ) KAN401220801 Institutional support: RVO:61389013 Keywords : albumin * encapsulation * PLGA (poly d,l-lactic-co-glycolic acid Subject RIV: JB - Sensors, Measurment, Regulation Impact factor: 1.585, year: 2014
Effective Surface Area of Electrochemical Sensors
Czech Academy of Sciences Publication Activity Database
Krejčí, J.; Sajdlová, Z.; Neděla, Vilém; Flodrová, Eva; Šejnohová, R.; Vránová, H.; Plička, R.
2014-01-01
Roč. 161, č. 6 (2014), B147-B150 ISSN 0013-4651 R&D Projects: GA MPO FR-TI1/118 Institutional support: RVO:68081731 Keywords : scanning electron microscopy * glassy-carbon electrode * gold electrodes * biosensors Subject RIV: JB - Sensors, Measurment, Regulation Impact factor: 3.266, year: 2014
Czech Academy of Sciences Publication Activity Database
Jang, H.Y.; Chung, K.; Quan, L.N.; Špačková, Barbora; Šípová, Hana; Moon, S.; Cho, W. J.; Shin, H.; Jang, Y.J.; Lee, J.; Kochuveedu, S.T.; Yoon, M.J.; Kim, J.; Yoon, S.; Kim, J. K.; Kim, D.; Homola, Jiří; Kim, D.H.
2013-01-01
Roč. 5, č. 24 (2013), s. 1261-1271 ISSN 2040-3364 R&D Projects: GA ČR GBP205/12/G118; GA MŠk(CZ) LH11102 Institutional support: RVO:67985882 Keywords : Surface plasmons * Biosensors Subject RIV: JB - Sensors, Measurment, Regulation Impact factor: 6.739, year: 2013
Czech Academy of Sciences Publication Activity Database
Špringer, Tomáš; Piliarik, Marek; Homola, Jiří
2010-01-01
Roč. 145, č. 1 (2010), s. 588-591 ISSN 0925-4005 R&D Projects: GA AV ČR KAN200670701 Institutional research plan: CEZ:AV0Z20670512 Keywords : microfluidics * surface plasmon resonance * DNA detection Subject RIV: JB - Sensors, Measurment, Regulation Impact factor: 3.368, year: 2010
Natural Frequency of Oscillating Gaseous Bubbles in Ventilated Cavitation
Zhang, Yu-Ning
2017-07-01
Not Available Supported by the National Natural Science Foundation of China under Grant No 51506051, the Fundamental Research Funds for the Central Universities under Grant No JB2015RCY04, and the Incubation Project for Young Talents of Chinese Society for Electrical Engineering under Grant No JLB-2016-68.
Czech Academy of Sciences Publication Activity Database
Rosendahl, S.; Brown, E.; Cristescu, I.; Fieguth, A.; Huhmann, C.; Lebeda, Ondřej; Murra, M.; Weinheimer, C.
2015-01-01
Roč. 86, č. 11 (2015), s. 115104 ISSN 0034-6748 R&D Projects: GA ČR(CZ) GAP203/12/1896; GA MŠk LM2011019 Institutional support: RVO:61389005 Keywords : Kr-83 * cryogenic destillation * detectors Subject RIV: JB - Sensors, Measurment, Regulation Impact factor: 1.336, year: 2015
From Ivy League to NBA: A Great Urban High School Falls through the Hoop.
Carlson, Tucker
1993-01-01
Describes the history of education at Dunbar High School in Washington, D.C., the country's first African-American high school founded by ex-slaves in 1870. Argues that today the school emphasizes athletics over academics and that the source of decline has been holding students to lower standards. (JB)
Přehledný kalkul uzavřených regulačních obvodů
Czech Academy of Sciences Publication Activity Database
Klán, Petr
-, č. 12 (2011), s. 53-55 ISSN 1210-9592 Institutional research plan: CEZ:AV0Z10300504 Keywords : automatické řízení * tříparametrový model * přenos * Laplaceova transformace Subject RIV: JB - Sensors, Measurment, Regulation http://www.odbornecasopisy.cz/res/pdf/45426.pdf
International Nuclear Information System (INIS)
Fosenbauer, T.
1994-01-01
A brief account is given of regulations governing the use of gas in power plants, of emission limits for some substances such as SO 2 , NO x and dust, and of regulations concerning existing and newly built facilities, specifying the highest permissible emissions of environmental pollutants. (J.B.)
Czech Academy of Sciences Publication Activity Database
Šípová, Hana; Ševců, Veronika; Kuchař, Milan; Ahmad, Jawid Nazir; Mikulecký, Pavel; Osičková, Adriana; Malý, Petr; Homola, Jiří
2012-01-01
Roč. 174, č. 11 (2012), s. 306-311 ISSN 0925-4005 R&D Projects: GA AV ČR KAN200670701 Institutional support: RVO:67985882 ; RVO:61388971 ; RVO:86652036 Keywords : Interferon gamma * Surface plasmon resonance * Biosensor Subject RIV: JB - Sensors, Measurment, Regulation Impact factor: 3.535, year: 2012
A Community of Friends and Classmates.
Casanave, Suki
1991-01-01
The experience of one handicapped boy and his family at a Concord (New Hampshire) elementary school that practices inclusive education highlights obstacles the parents met with regard to placing their son at the local school, early successes, social and academic progress for the student, and changing attitudes. (JB)
... U.S. national physical activity plan. J Phys Act Health 6(suppl 2):S211–9. 2009. Weidinger KA, Lovegreen SL, Elliott MB, Hagood L, Haire-Joshu D, Mcgill JB, Brownson RC. How to make exercise counseling more effective: Lessons from rural America. J Fam Pract 57( ...
Revue de Médecine et de Pharmacie - Vol 3, No 1 (2013)
African Journals Online (AJOL)
La corticothérapie dans la prise en charge hospitalière de l'asthme à Yaoundé : Connaissances, Attitudes et Pratiques · EMAIL FULL TEXT EMAIL FULL TEXT DOWNLOAD FULL TEXT DOWNLOAD FULL TEXT. EA Ze, AAM Kamgueng, G Nguefack-Tsague, J-B Bogne, 254-261 ...
Calculation of Source and Strucutral Parameters at Regional and Teleseismic Distances
1987-02-28
Plateau is supported by 500,000 km» of these Late Cretaceous to Paleocene age volcanics ( Auden ,1975). The basalts are believed to be the thickest...191. Auden , J.B. (1975). Seismicity associated with the Koyna Reservoir, Maharashtra, Prepared for the Government of India by the United Nations
Navot Pikkel, Dvora
2017-01-01
The study, which was guided by Prof.dr J.b. Rijsman as promotor and by Dr. Y.T. Tal as co- promotor, was a comparative interventional study that was designed to evaluate the effectiveness of different teaching & educational strategies of risk management and patient's safety in medicine. Eventually,
Czech Academy of Sciences Publication Activity Database
Lutsyk, P.; Janus, K.; Sworakowski, J.; Kochalska, Anna; Nešpůrek, Stanislav
2012-01-01
Roč. 404, 24 August (2012), s. 22-27 ISSN 0301-0104 R&D Projects: GA MPO FR-TI1/144 Institutional research plan: CEZ:AV0Z40500505 Institutional support: RVO:61389013 Keywords : OFET * switching * photochromism Subject RIV: JB - Sensors, Measurment, Regulation Impact factor: 1.957, year: 2012
Hornbeck, Frederick W.
1971-01-01
After a review of theoretical work on cognitive dissonance, the present study on Junior High School students is discussed. From the results, it is suggested that attitude change may result from a form of self-persuasion during the process of counterattitudinal role playing under certain experimental conditions. (Author/JB)
GERRITSE, J; GOTTSCHAL, JC
1992-01-01
Bacteria from an anaerobic enrichment reductively removed chlorine from the ortho- position of 2,3,6-trichlorobenzoic acid (2,3,6-TBA) producing 2,5-dichlorobenzoate (2,5-DBA). The strictly aerobic bacterium Pseudomonas aeruginosa JB2 subsequently used 2,5-DBA as a growth substrate in the presence
African Journals Online (AJOL)
Cruveilhier J. Anatomie pathologique du corps humain. Paris: JB Balliere, 1835. 3. Goldman RL. Hamartomatous polyp of Brunner's gland. Gastroenterology. 1963;44:57-62. 4. Kellogg EL. Intussusception of the duodenum caused by adenoma originating in Brunner's glands. Med J Record. 1931;134:440-2. 5. Lempke RE.
77 FR 45647 - Notice of Cancellation of Customs Broker Licenses
2012-08-01
... Ferrara International Logistics 11930 New York. J.B. Fong & Co., Inc 06461 San Francisco. Air 7 Seas Transport Logistics, Inc 23081 San Francisco. Liberty Port Broker, Inc 20911 New York. Sky Sea Forwarding Corp 13261 New York. Contact Customs Clearance, Inc 13467 New York. Legacy Worldwide Logistics, Inc...
'Re-storying' Africa: The harvest festival in Chadian writer, J.B. Seid ...
African Journals Online (AJOL)
This article reads the harvest festival in the preface to Joseph Brahim Seid's 1962 Au Tchad sous les étoiles (Told by starlight in Chad) as 're-storying' Africa. The coming together at harvest-time as well as the exchange of produce, evidence of social cohesion is read as reflective of the communal nature of African societies.
Directory of Open Access Journals (Sweden)
Carla Aparecida Cielo
2013-01-01
Full Text Available OBJETIVO: correlacionar os tempos máximos de fonação (TMF e as relações entre os fricativos /s/ e /z/ (s/z e entre /e/ não vozeado e a vogal /e/ (ė/e de mulheres sem afecções laríngeas. MÉTODO: participaram 60 mulheres com média de 21,56 anos de idade. Coletaram-se os TMF/ė/, /e/, /s/ e /z/ e calcularam-se a relação s/z e a relação ė/e, com padrão de normalidade para as relações de 0,8 a 1,2; para os TMF/s/ e /z/, entre 15,57 e 34,17s; para o TMF/ė/, entre 16 a 18s; e para o TMF/e/, entre 14,04 e 26,96s. Testes de Lilliefords, Spearmann, Binomial e Mann-Whitney com nível de significância de 5%. RESULTADOS: correlação positiva entre TMF/s/ e TMF/ė/, TMF/z/ e TMF/e/, TMF/s/ e TMF/z/, e TMF/ė/ e TMF/e/. Não houve correlação entre as relações s/z e ė/e, nem diferenças entre a relação ė/e, enquanto a relação s/z foi significantemente normal. TMF/ė/ e TMF/e/ significantemente diminuídos; TMF/s/ e TMF/z/ significantemente normais. TMF/ė/ significantemente menor do que TMF/s/; TMF/e/ significantemente menor do que TMF/z/. CONCLUSÃO: os fonemas /s/ e /z/ isolados e sua relação ficaram dentro da normalidade e as relações s/z e ė/e não apresentaram correlação. Os TMF/ė/ e TMF/e/ mostraram-se diminuídos em relação à normalidade. O TMF/ė/ foi menor do que TMF/s/ e o TMF/e/ foi menor do que TMF/z/, possivelmente devido ao modo articulatório dos fricativos ter aumentado o tempo de emissão, independentemente do controle do nível glótico e respiratório.PURPOSE: correlate the maximum phonation time (MPT and the relations between the fricative /s/ and /z/ (s/z and between the vowels /ė/ and /e/ (ė/e of women without laryngeal disorders. METHOD: participants were 60 women with a mean of 21.56 years old. Were collected MPT/ė/, /e/, /s/ and /z/ and calculated the relations ė/e and s/z, with normal pattern for the relationship from 0.8 to 1.2; for MPT/s/ and MPT/z/, between 15.57 and 34.17s; for the
Nelson, Britta S.; Springer, Rachel C.; Daniel, Jill M.
2013-01-01
Rationale Treatment with estradiol, the primary estrogen produced by the ovaries, enhances hippocampus-dependent spatial memory and increases levels of hippocampal synaptic proteins in ovariectomized rats. Increasing evidence indicates that the ability of estradiol to impact the brain and behavior is dependent upon its interaction with insulin-like growth factor-1 (IGF-1). Objectives The goal of the current experiment was to test the hypothesis that the ability of estradiol to impact hippocampus-dependent memory and levels of hippocampal synaptic proteins is dependent on its interaction with IGF-1. Methods Adult rats were ovariectomized and implanted with estradiol or control capsules and trained on a radial-maze spatial memory task. After training, rats were implanted with intracerebroventricular cannulae attached to osmotic minipumps (flow rate 0.15 μl/hr). Half of each hormone treatment group received continuous delivery of JB1 (300 μg/ml), an IGF-1 receptor antagonist, and half received delivery of aCSF vehicle. Rats were tested on trials in the radial-arm maze during which delays were imposed between the 4th and 5th arm choices. Hippocampal levels of synaptic proteins were measured by western blotting. Results Estradiol treatment resulted in significantly enhanced memory. JB1 blocked that enhancement. Estradiol treatment resulted in significantly increased hippocampal levels of postsynaptic density protein 95 (PSD-95), spinophilin, and synaptophysin. JB1 blocked the estradiol-induced increase of PSD-95 and spinophilin and attenuated the increase of synaptophysin. Conclusions Results support a role for IGF-1 receptor activity in estradiol-induced enhancement of spatial memory that may be dependent on changes in synapse structure in the hippocampus brought upon by estradiol/IGF-1 interactions. PMID:24146138
Study of the decay η→e+e-e+e- with WASA-at-COSY
International Nuclear Information System (INIS)
Yurev, Leonid Sergeewitsch
2011-01-01
This work is dedicated to the study of the double Dalitz decay η→e + e - e + e - . For this rare decay of the η meson only an experimental upper limit for the branching ratio is known. The theoretical prediction is based on Quantum Electrodynamics for the branching ratio is about 2.5 x 10 -5 , which is a factor of three below the experimental upper limit. One of the main points of interest to study this decay is the possibility to measure the transition form factor, which describes the electromagnetic structure of the decaying neutral meson at the η→γ * γ * vertex. In the final state of the decay η→e + e - e + e - there are two lepton pairs, whose squared invariant mass equals the four momenta squared of the virtual photons. The knowledge about the structure of the transition form factor can indicate whether double vector meson dominance is realized in nature, which has important implications for kaon decays and the μ anomalous magnetic moment. Using the WASA at COSY facility it is possible for the first time to determine the branching ratio of the η→e + e - e + e - decay. The data analyzed in this work were taken in the reaction pd→ 3 Heη at 1 GeV kinetic energy and contain ∝10 x 10 6 events of η-mesons. A sample of (30±10) η→e + e - e + e - . event candidates has been extracted, corresponding to a branching ratio of 2.9 x 10 -5 .
South African Journal of Animal Science - Vol 39, No 3 (2009)
African Journals Online (AJOL)
Genetic parameters for subjectively assessed wool and conformation traits in the Tygerhoek Merino flock · EMAIL FREE FULL TEXT EMAIL FREE FULL TEXT · DOWNLOAD FULL TEXT DOWNLOAD FULL TEXT. PA Matebesi, JB van Wyk, SW Cloete. http://dx.doi.org/10.4314/sajas.v39i3.49148 ...
Quartz crystal microbalance gas sensor with nanocrystalline diamond sensitive layer
Czech Academy of Sciences Publication Activity Database
Varga, Marián; Laposa, A.; Kulha, Pavel; Kroutil, J.; Husák, M.; Kromka, Alexander
2015-01-01
Roč. 252, č. 11 (2015), s. 2591-2597 ISSN 0370-1972 R&D Projects: GA ČR(CZ) GBP108/12/G108 Institutional support: RVO:68378271 Keywords : gas sensor * nanocrystalline diamond * quartz resonator * thickness shear mode Subject RIV: JB - Sensor s, Measurment, Regulation Impact factor: 1.522, year: 2015
Spatial Resolution of the Medipix-2 as Neutron Pixel Detector
Czech Academy of Sciences Publication Activity Database
Jakůbek, J.; Holý, T.; Lehmann, E.; Pospíšil, S.; Uher, J.; Vacík, J.; Vavřík, Daniel
2005-01-01
Roč. 546, - (2005), s. 164-169 ISSN 0168-9002. [International Workshop on Radiation Imaging Detectors /6./. Glasgow, Scotland, 25.07.2004-29.07.2004] Institutional research plan: CEZ:AV0Z20710524 Keywords : neutron detection * neutronography * X-ray Subject RIV: JB - Sensors, Measurment, Regulation Impact factor: 1.224, year: 2005
Plumage and ecology of cormorants | Siegfried | African Zoology
African Journals Online (AJOL)
Plumage and ecology of cormorants. W.R. Siegfried, A.J. Williams, P.G.H. Frost, J.B. Kinahan. Abstract. The paper draws on data attending the etho-ecology of four species of cormorants (Phalacrocoracidae) in support of an hypothesis for the adaptive significance of the predominantly dark plumage of these birds.
6th symposium on photochemical and thermal reactions of coordination compounds (SOPTROCC 6)
International Nuclear Information System (INIS)
Sykora, J.; Sima, J.
1988-01-01
The proceedings contain 53 papers of which two deal with nuclear topics, viz.: Quenching of Excited States of Lanthanide Complexes by Electron and Energy Transfer Processes and Spin Trapping in the Radiolysis of Phosphate Esters. Some 70 specialists from 12 countries including Japan and the USA attended the conference. (J.B.)
Aeromagnetic imaging of the basement morphology in part of the ...
African Journals Online (AJOL)
Aeromagnetic imaging of the basement morphology in part of the middle Benue trough, Nigeria. GC Onyedim, MO Awoyemi, EA Ariyibi, JB Arubayi. Abstract. No Abstract. Journal of Mining and Geology Vol. 42 (2) 2006: pp. 157-163. Full Text: EMAIL FULL TEXT EMAIL FULL TEXT · DOWNLOAD FULL TEXT DOWNLOAD ...
Pharmacognostic evaluation of the leaves of Dissotis rotundifolia ...
African Journals Online (AJOL)
STORAGESEVER
2009-01-05
Jan 5, 2009 ... Romania, pp.17-25. Evans WC (1996). Trease and Evans Pharmacognosy. WB Saunders. Ltd. London. 14th Ed. 119-159. Harborne JB (1992). Phytochemical methods. A guide to modern technique of plant analysis. Chapman and Hill, London, p. 279. Kokwaro JC (1976). Medicinal plants of East Africa.
Armageddon’s Lost Lessons: Combined Arms Operations in Allenby’s Palestine Campaign
2005-02-01
followed closely behind, allowing air assets to keep pace with the fast-moving cavalry. By 1 October, Dam- ascus was occupied in force, and Allenby yet...Cyril B. Falls, Armageddon: 1918 (Philadelphia; New York: J.B. Lippincott Company, 1964), 62; Sav- age , Allenby of Armageddon, 210–11. 36. Earl Wavell
DEFF Research Database (Denmark)
Breinbjerg, O.
2012-01-01
This paper reviews research in the Geometrical Theory of Diffraction (GTD) and the Physical Theory of Diffraction (PTD) at the Technical University of Denmark (DTU). The year 2012 celebrates the 50th anniversary of the seminal works of J.B. Keller on GTD and P. Ya Ufimtsev on PTD - two closely...
Czech Academy of Sciences Publication Activity Database
Krištofíková, Z.; Hegnerová, Kateřina; Bocková, Markéta; Vaisocherová, Hana; Bartoš, A.; Říčný, J.; Řípová, D.; Homola, J.
2008-01-01
Roč. 275, podzim (2008), s. 249-249 ISSN 1742-464X. [EUROPTRODE /9./. Dublin, 30.03.2008-02.04.2008] Institutional research plan: CEZ:AV0Z20670512 Keywords : surface plasmon resonance * alzheimer disease * 17beta-HSD10 Subject RIV: JB - Sensors, Measurment, Regulation Impact factor: 3.139, year: 2008
Someone to Count On: Homeless, Male Drug Users and Their Friendship Relations.
Sterk-Elifson, Claire; Elifson, Kirk W.
1992-01-01
A study exploring friendship relations of homeless, male drug users (aged between 21 and 50 years) through 27 in-depth interviews in Atlanta (Georgia) found that subjects were engaged in friendship networks that offered social support and that there was a relationship between friendships and patterns of crack cocaine use. (JB)
Surface plasmon resonance sensor for detection of bisphenol A in drinking water
Czech Academy of Sciences Publication Activity Database
Hegnerová, Kateřina; Homola, Jiří
2010-01-01
Roč. 151, č. 1 (2010), s. 177-179 ISSN 0925-4005 R&D Projects: GA AV ČR KAN200670701 Institutional research plan: CEZ:AV0Z20670512 Keywords : surface plasmon resonance biosensor * bisphenol A * drinking water Subject RIV: JB - Sensors, Measurment, Regulation Impact factor: 3.368, year: 2010
Impedance spectroscopy on xerogel layer for chemical sensing
Czech Academy of Sciences Publication Activity Database
Abdelghani, A.; Cherif, K.; Jaffrezic-Renault, N.; Matějec, Vlastimil
2006-01-01
Roč. 26, 2/3 (2006), s. 542-545 ISSN 0928-4931. [MADICA 2004. Tunis, 29.11.2004-01.12.2004] Institutional research plan: CEZ:AV0Z2067918 Keywords : demodulation * chemical sensors * aerogels * spectroscopy * sol-gel processing Subject RIV: JB - Sensors, Measurment, Regulation Impact factor: 1.325, year: 2006
Water SA - Vol 28, No 3 (2002)
African Journals Online (AJOL)
The importance of the river-estuary interface (REI) zone in estuaries · EMAIL FREE FULL TEXT EMAIL FREE FULL TEXT DOWNLOAD FULL TEXT DOWNLOAD FULL TEXT. GC Bate, AK Whitfield, JB Adams, P Huizinga, TH Wooldridge, 271-280. http://dx.doi.org/10.4314/wsa.v28i3.4894 ...
QA Programme for Radon and its Short-Lived Progeny Measuring Instruments in NRPI Prague
Czech Academy of Sciences Publication Activity Database
Jílek, K.; Thomas, J.; Brabec, Marek
2008-01-01
Roč. 130, č. 1 (2008), s. 43-47 ISSN 0144-8420 Grant - others:GA SÚJB(CZ) JC_11/2006 Institutional research plan: CEZ:AV0Z10300504 Keywords : calibration * quality assurance * radon daughter products * uncertainty estimation Subject RIV: DI - Air Pollution ; Quality Impact factor: 0.951, year: 2008
Czech Academy of Sciences Publication Activity Database
Homola, Jiří; Piliarik, Marek; Ladd, J.; Taylor, A.; Shaoyi, J.
2008-01-01
Roč. 80, č. 11 (2008), s. 4231-4236 ISSN 0003-2700 R&D Projects: GA AV ČR KAN200670701 Institutional research plan: CEZ:AV0Z20670512 Keywords : Surface plasmon resonance imaging * DNA-directed immobilization * protein array Subject RIV: JB - Sensors, Measurment, Regulation Impact factor: 5.712, year: 2008
Magnetic Barkhausen noise at different magnetization conditions
Czech Academy of Sciences Publication Activity Database
Stupakov, Alexandr; Perevertov, Oleksiy; Neslušan, M.
2015-01-01
Roč. 66, č. 7 (2015), s. 10-13 ISSN 1335-3632 R&D Projects: GA ČR GA13-18993S Institutional support: RVO:68378271 Keywords : Barkhausen noise * surface magnetic field * magnetization control * magnetic hysteresis * digital feedback loop Subject RIV: JB - Sensors, Measurment, Regulation Impact factor: 0.407, year: 2015
Sommers, Christina Hoff
1993-01-01
Recommends an approach to the teaching of ethics from the perspective of the philosophy of virtue that begins with the work of the ancient Greek philosopher, Aristotle. Offers guidance on how to prepare and teach such a course based on the author's and other teachers' experiences in the classroom. (JB)
African Journals Online (AJOL)
Chibani, JB. Vol 1, No 5 (2012) - Articles Origins and spreads of Alpha 1 antitrypsin variants in world human populations: a synthetic review. Abstract PDF · Vol 1, No 5 (2012) - Articles Synthetic review on the different anthropological aspects of hemoglobinopathies in Tunisia Abstract PDF. ISSN: 1737-8176. AJOL African ...
Lenin and Problems of Typification of the Personality
Smirnov, G. I.
1970-01-01
Explores the Leninist conception of ways in which individual characteristics can be viewed in terms of general laws of social development; how scientific typologies of the individual offer means for discovering the essence of social phenomena; and how a change in human nature involves a modification of social relationships. (JB)
Inkanyiso: Journal of Humanities and Social Sciences - Vol 4, No 1 ...
African Journals Online (AJOL)
The effects of alcohol consumption on student life at a rural campus · EMAIL FREE FULL TEXT EMAIL FREE FULL TEXT · DOWNLOAD FULL TEXT DOWNLOAD FULL TEXT. JB Dlamini, H Rugbeer, GM Naidoo, RM Metso, P Moodley, 49-57. The stuttering implementation of language policies in the South African education ...
78 FR 14556 - Cheng Yi Liang: Debarment Order
2013-03-06
.... 1001 and securities fraud, a Federal felony offense under 15 U.S.C. 78j(b) and 78ff. FDA's finding that debarment is appropriate is based on the felony conviction for securities fraud referenced herein for... execution of trades on national securities exchanges, resulting in total profits and losses avoided of $3...
Etude linguistique chez les Baráshi/Banyaambo du Rwanda ...
African Journals Online (AJOL)
Among the main African Languages spoken in Rwanda besides Kinyarwaanda: amashí in the South, olucigá in the North and ikiráshi/ikinyaambo in the East, only olucigá has been particularly described: J.-B. Murekezi (1984), F.-X. Bangamwabo (1989); others are just mentioned in global sociolinguistic studies: B.
Biisofraxidin on Apoptosis of Human Gastric Cancer BGC-823 Cells
African Journals Online (AJOL)
Wu et al. Trop J Pharm Res, October 2015; 14(10): 1803. Tropical Journal of Pharmaceutical Research ... Jian-Tao Wu1,2*, She-Min Lv1, Chun-Hui Lu1, Jun Gong1 and Jian-Bo An3 ..... Zhu AK, Zhou H, Xia JZ, Jin HC, Wang K, Yan J, Zuo JB,.
Accuracy of tracer stimulus response experiments in laminar flows
Czech Academy of Sciences Publication Activity Database
Chlup, Hynek; Novotný, Pavel; Žitný, R.
2012-01-01
Roč. 55, 23-24 (2012), s. 6458-6462 ISSN 0017-9310 Institutional research plan: CEZ:AV0Z20760514 Keywords : residence time distribution * tracer injection * laminar convective dominated flow Subject RIV: JB - Sensors, Measurment, Regulation Impact factor: 2.315, year: 2012 http://www.sciencedirect.com/science/article/pii/S001793101200470X
International Nuclear Information System (INIS)
1995-01-01
Some provisions of the Decree of the Czech Labor Safety Office No. 76/1989 on ensuring safety of technical facilities in the nuclear power sector are amended, particularly in the field of construction activities, assembling, reconstruction and repair of nuclear power facilities. The Decree entered into force on 28 June 1991. (J.B.)
Mikroradiografie v materiálovém výzkumu
Czech Academy of Sciences Publication Activity Database
Vavřík, Daniel; Jakůbek, J.; Jakůbek, M.; Holý, T.
2008-01-01
Roč. 58, č. 1 (2008), s. 53-57 ISSN 0009-0700 R&D Projects: GA MŠk(CZ) LC06041; GA MŠk(CZ) 1P04LA211 Institutional research plan: CEZ:AV0Z20710524 Keywords : digital radiography * digital image correlation * ductile fracture mechanics Subject RIV: JB - Sensors, Measurment, Regulation
Training Officer, 1975
1975-01-01
A discussion with James Crowley of British Steel Corporation on the changing face of ergonomics in practice today and yesterday examines the influence of experimental psychology on the method of study and data collection. The broadening scope of ergonomics from only safety concerns to cost effectiveness and the computer are analyzed. (Author/JB)
Soviet supplies of enriched uranium to capitalist countries
International Nuclear Information System (INIS)
Valvoda, Z.
1977-01-01
The Soviet supplies of enriched uranium to the following capitalist countries are surveyed: Belgium, Finland, France, FRG, Austria, Spain, Sweden, and the United Kingdom. The time period, total supplies, average annual supplies, estimated average price per separation work unit, and the date of the conclusion of the contract are reported. (J.B.)
Sensing properties of lattice resonances of 2D metal nanoparticle arrays: An analytical model
Czech Academy of Sciences Publication Activity Database
Špačková, Barbora; Homola, Jiří
2013-01-01
Roč. 21, č. 22 (2013), s. 27490-27502 ISSN 1094-4087 R&D Projects: GA ČR GBP205/12/G118; GA MŠk(CZ) LH11102 Institutional support: RVO:67985882 Keywords : Gold Nanoparticles * Sensing performance * Localized surface plasmon Subject RIV: JB - Sensors, Measurment, Regulation Impact factor: 3.525, year: 2013
A Fortunate Story of an Unusual AK-47 Bullet Trajectory: Always Keep a Smartphone in Your Pocket.
Thabouillot, Oscar; Perrier, Pierre; Roche, Nicolas-Charles; Agard, David; Barbier, Olivier; Martin, Guillaume; Viant, Eric; Leclere, Jean-Baptiste
2016-06-01
This is a report of a fortunate story of an unusual AK-47 bullet trajectory which took place during the Paris (France) attack of November 13th, 2015. A young man, trying to protect his girlfriend, interfered between her and a shooter. He had been wounded in the posterior compartment of the thigh. The bullet penetrated him and, instead of exiting, rebound against his Smartphone, which was in the front pocket of his pants. Thanks to that, the missile bullet did not injure his girlfriend but ended its trajectory in the fat tissue of his thigh. Thabouillot O , Perrier P , Roche NC , Agard D , Barbier O , Martin G , Viant E , Leclere JB . A fortunate story of an unusual AK-47 bullet trajectory: always keep a Smartphone in your pocket. Prehosp Disaster Med, 2016;31(3):343-345.
International Nuclear Information System (INIS)
Ali, A.
1981-04-01
The promise of e + e - annihilation as an ideal laboratory to test Quantum Chromodynamics, QCD, has been the dominating theme in elementary particle physics during the last several years. An attempt is made to partially survey the subject in deep perturbative region in e + e - annihilation where theoretical ambiguities are minimal. Topics discussed include a review of the renormalization group methods relevant for e + e - annihilation, total hadronic cross section, jets and large-psub(T) phenomena, non-perturbative quark and gluon fragmentation effects and analysis of the jet distributions measured at DORIS, SPEAR and PETRA. My hope is to review realistic tests of QCD in e + e - annihilation - as opposed to the ultimate tests, which abound in literature. (orig.)
Analysis of Earthquake Source Spectra in Salton Trough
Chen, X.; Shearer, P. M.
2009-12-01
Previous studies of the source spectra of small earthquakes in southern California show that average Brune-type stress drops vary among different regions, with particularly low stress drops observed in the Salton Trough (Shearer et al., 2006). The Salton Trough marks the southern end of the San Andreas Fault and is prone to earthquake swarms, some of which are driven by aseismic creep events (Lohman and McGuire, 2007). In order to learn the stress state and understand the physical mechanisms of swarms and slow slip events, we analyze the source spectra of earthquakes in this region. We obtain Southern California Seismic Network (SCSN) waveforms for earthquakes from 1977 to 2009 archived at the Southern California Earthquake Center (SCEC) data center, which includes over 17,000 events. After resampling the data to a uniform 100 Hz sample rate, we compute spectra for both signal and noise windows for each seismogram, and select traces with a P-wave signal-to-noise ratio greater than 5 between 5 Hz and 15 Hz. Using selected displacement spectra, we isolate the source spectra from station terms and path effects using an empirical Green’s function approach. From the corrected source spectra, we compute corner frequencies and estimate moments and stress drops. Finally we analyze spatial and temporal variations in stress drop in the Salton Trough and compare them with studies of swarms and creep events to assess the evolution of faulting and stress in the region. References: Lohman, R. B., and J. J. McGuire (2007), Earthquake swarms driven by aseismic creep in the Salton Trough, California, J. Geophys. Res., 112, B04405, doi:10.1029/2006JB004596 Shearer, P. M., G. A. Prieto, and E. Hauksson (2006), Comprehensive analysis of earthquake source spectra in southern California, J. Geophys. Res., 111, B06303, doi:10.1029/2005JB003979.
Considerazioni sui lettori di Montesquieu (XVIII-XX secolo
Directory of Open Access Journals (Sweden)
Piero Venturelli
2009-05-01
Full Text Available This article in meant to bring a contribution to the study of the penetration of Montesquieu’s ideas and theories starting from Montesquieu e i suoi interpreti (a cura di D. Felice, 2 tt., Pisa, ETS, 2005. The most relevant interpretations or uses of the philosopher’s work of the last two hundred and fifty years will be put together with particular reference to the Esprit des Lois (1748. We consider France, Great Britain, North America, Germany and Italy as the linguistic and cultural areas where Montesquieu’s thought is stronger and more lasting. Over forty authors have been taken into consideration: J.-B. le Rond d’Alembert, D. Hume, J.-J. Rousseau, C. Beccaria, A. Genovesi, E. Personè, D. Diderot, L. de Jaucourt, E. Gibbon, J.G. Herder, G. Filangieri, Th. Jefferson, A. Hamilton, J.-A.-N. Caritat de Condorcet, L. Saint-Just, B. Constant, G.W.F. Hegel, A. de Tocqueville, H. Taine, F. Sclopis di Salerano, É.-R. Lefebvre de Laboulaye, F. Meinecke, Ch. Eisenmann, J. Starobinski, L. Althusser, H. Arendt, R. Aron, R. Shackleton etc. In this article, Voltaire, E. Burke, L.-C. Destutt de Tracy, A. Comte, É. Durkheim and S. Cotta have been considered more in detail.
Yang, Peng; Han, Jinfeng; Huang, Jinling
2014-01-01
Cytoplasmic male sterility (CMS) is the failure to produce functional pollen, which is inherited maternally. And it is known that anther development is modulated through complicated interactions between nuclear and mitochondrial genes in sporophytic and gametophytic tissues. However, an unbiased transcriptome sequencing analysis of CMS in cotton is currently lacking in the literature. This study compared differentially expressed (DE) genes of floral buds at the sporogenous cells stage (SS) and microsporocyte stage (MS) (the two most important stages for pollen abortion in JA-CMS) between JA-CMS and its fertile maintainer line JB cotton plants, using the Illumina HiSeq 2000 sequencing platform. A total of 709 (1.8%) DE genes including 293 up-regulated and 416 down-regulated genes were identified in JA-CMS line comparing with its maintainer line at the SS stage, and 644 (1.6%) DE genes with 263 up-regulated and 381 down-regulated genes were detected at the MS stage. By comparing the two stages in the same material, there were 8 up-regulated and 9 down-regulated DE genes in JA-CMS line and 29 up-regulated and 9 down-regulated DE genes in JB maintainer line at the MS stage. Quantitative RT-PCR was used to validate 7 randomly selected DE genes. Bioinformatics analysis revealed that genes involved in reduction-oxidation reactions and alpha-linolenic acid metabolism were down-regulated, while genes pertaining to photosynthesis and flavonoid biosynthesis were up-regulated in JA-CMS floral buds compared with their JB counterparts at the SS and/or MS stages. All these four biological processes play important roles in reactive oxygen species (ROS) homeostasis, which may be an important factor contributing to the sterile trait of JA-CMS. Further experiments are warranted to elucidate molecular mechanisms of these genes that lead to CMS.
Factors related to job burnout among nurses in the Razi Psychiatric Hospital, Iran.
Rezaei, Omid; Habibi, Kamelia; Arab Ghahestany, Davood; Sayadnasiri, Mohammad; Armoon, Bahram; Khan, Vida; Fattah Moghadam, Ladan
2018-03-03
Background One of the most prevalent problems in work places that is considered as an important risk factor for the health of the employee is job burnout (JB). JB could be harmful to employees, their families and society. Therefore, decreasing JB among individuals and determining factors associated with it is important to improve the working environment and prevent its negative outcomes. This study aims to elicit the conditions and factors that cause job burnout among nurses of the Razi Psychiatric Hospital, Iran. Methods This study was a descriptive correlational and cross-sectional survey which the demographic and occupational burnout variables of nurses were measured. The study was conducted from January to April 2016. Accordingly, with a type I error probability of 0.05 and a power of 0.80, the sample size was determined to be 100 nurses for each group (men and women). Then, 200 were selected in the Razi Psychiatric Hospital (of whom approx. 60% worked in a rotating shift schedule). The data were collected in two phases: the first step was created by the authors, including gathering demographic data with questionnaire such as gender, age, marital status, education level, years of professional experience, hours of overtime working per month, shift schedules, and their working hospitals and wards. The second step was the Maslach burnout inventory (MBI), human services survey (HSS) version, developed by Maslach and Jackson to assess the three dimensions of burnout. Descriptive statistics (frequency distribution) were used for integrating the demographic variables. Additionally, logistical regression was applied to realize the association between demographic characteristics with the job burnout in SPSS software V.19. Results Our findings indicated that age, hours of work per week, nursing skills, management experience and work experiences accounted for 30% of the variance of depersonalization. Formal employment was significantly associated with emotional exhaustion
Cocoa Procyanidins Suppress Transformation by Inhibiting Mitogen-activated Protein Kinase Kinase*S⃞
Kang, Nam Joo; Lee, Ki Won; Lee, Dong Eun; Rogozin, Evgeny A.; Bode, Ann M.; Lee, Hyong Joo; Dong, Zigang
2008-01-01
Cocoa was shown to inhibit chemically induced carcinogenesis in animals and exert antioxidant activity in humans. However, the molecular mechanisms of the chemopreventive potential of cocoa and its active ingredient(s) remain unknown. Here we report that cocoa procyanidins inhibit neoplastic cell transformation by suppressing the kinase activity of mitogen-activated protein kinase kinase (MEK). A cocoa procyanidin fraction (CPF) and procyanidin B2 at 5 μg/ml and 40 μm, respectively, inhibited 12-O-tetradecanoylphorbol-13-acetate (TPA)-induced neoplastic transformation of JB6 P+ mouse epidermal (JB6 P+) cells by 47 and 93%, respectively. The TPA-induced promoter activity and expression of cyclooxygenase-2, which is involved in tumor promotion and inflammation, were dose-dependently inhibited by CPF or procyanidin B2. The activation of activator protein-1 and nuclear factor-κB induced by TPA was also attenuated by CPF or procyanidin B2. The TPA-induced phosphorylation of MEK, extracellular signal-regulated kinase, and p90 ribosomal s6 kinase was suppressed by CPF or procyanidin B2. In vitro and ex vivo kinase assay data demonstrated that CPF or procyanidin B2 inhibited the kinase activity of MEK1 and directly bound with MEK1. CPF or procyanidin B2 suppressed JB6 P+ cell transformation induced by epidermal growth factor or H-Ras, both of which are known to be involved in MEK/ERK signal activation. In contrast, theobromine (up to 80 μm) had no effect on TPA-induced transformation, cyclooxygenase-2 expression, the transactivation of activator protein-1 or nuclear factor-κB, or MEK. Notably, procyanidin B2 exerted stronger inhibitory effects compared with PD098059 (a well known pharmacological inhibitor of MEK) on MEK1 activity and neoplastic cell transformation. PMID:18519570
International Nuclear Information System (INIS)
Mariano, Davi Brigatto
2011-01-01
The Neutron Activation Analysis Laboratory (LAN-IPEN) has been analysing geological samples such as rocks, soils and sediments, for many years with the INAA comparative method, for geochemical and environmental research. This study presents the results obtained in the implementation of the k 0 -standardization method at LAN - IPEN, for geological sample analysis, by using the program k 0 - IAEA, provided by the International Atomic Energy Agency (IAEA). The thermal to epithermal flux ratio f and the shape factor α of the epithermal flux distribution of the IPEN IEA-R1 nuclear reactor were determined for the pneumatic irradiation facility and one selected irradiation position, for short and long irradiations, respectively. To obtain these factors, the 'are triple-monitor' method with 197 Au- 96 Zr- 94 Zr was used. In order to validate the methodology, the geological reference materials basalts JB-1 (GSJ) and BE-N (IWG-GIT), andesite AGV-1 (USGS), granite GS-N (ANRT), SOIL-7 (IAEA) and sediment Buffalo River Sediment (NIST - BRS-8704), which represent different geological matrices, were analysed. The concentration results obtained agreed with assigned values, with bias less than 10% except for Zn in AGV-1 (11.4%) and Mg in GS-N (13.4%). Three different scores were used to evaluate the results: z-score, zeta-score and Uscore. The z-score showed that the results can be considered satisfactory (z 3) for Mn in BE-N, Mg, Ce and La in GS-N, Mg in JB-1, and Th and Eu in Buffalo River Sediment. The U-score test showed that all results, except Mg in JB-1, were within 95% confidence interval. These results indicate excellent possibilities of using this parametric method at the LAN-IPEN for geological samples analysis in geochemical and environmental studies. (author)
Canessa, M; Labarca, P; Leaf, A
1976-12-25
The possibility that sodium from the serosal bathing medium "back diffuses" into the active sodium transport pool within the mucosal epithelial cell of the isolated toad bladder was examined by determining the effect on the metabolism of the tissue of removing sodium from the serosal medium. It was expected that if recycling of serosal sodium did occur through the active transepithelial transport pathway of the isolated toad bladder, removal of sodium from the serosal medium would reduce the rate of CO2 production by the tissue and enhance of stoichiometric ratio of sodium ions transported across the bladder per molecula of sodium transport dependent CO2 produced simultaneously by the bladder (JNa/JCO2). The data revealed no significant change in this ratio (17.19 with serosal sodium and 16.13 after replacing serosal sodium with choline). Further, when transepithelial sodium transport was inhibited (a) by adding amiloride to the mucosal medium, or (b) by removing sodium from the mucosal medium, subsequent removal of sodium from the serosal medium, or (c) addition of ouabain failed to depress the basal rate of CO2 production by the bladder [(a)rate of basal, nontransport related, CO2 production (JbCO2) equals 1.54 +/- 0.52 with serosal sodium and 1.54 +/- 0.37 without serosal sodium; (b) Jb CO2 equals 2.18 +/- 0.21 with serosal sodium and 2.09 +/- 0.21 without serosal sodium; (c) 1.14 +/- 0.26 without ouabain and 1.13 +/- 0.25 with ouabain; unite of JbCO2 are nmoles mg d.w.-1 min-1]. The results support the hypothesis that little, if any, recycling of serosal sodium occurs in the total bladder.
International Nuclear Information System (INIS)
Ablikim, M.; Bai, J.Z.; Ban, Y.
2006-01-01
Using the data of about 33 pb -1 collected at and around 3.773 GeV with the BES-II detector at the BEPC collider, we have studied the exclusive semileptonic decays D + →K - π + e + ν e , D 0 →anti K 0 π - e + ν e , D + →anti K *0 e + ν e and D 0 →K *- e + ν e . The absolute branching fractions for the decays are measured to be BF(D + →K - π + e + ν e )=(3.50±0.75±0.27)%, BF(D 0 →anti K 0 π - e + ν e )=(2.61±1.04±0.28)%, BF(D + →anti K *0 e + ν e )=(5.06±1.21±0.40)% and BF(D 0 →K *- e + ν e )=(2.87±1.48±0.39)%. The ratio of the vector to pseudoscalar semileptonic decay rates Γ(D + →anti K *0 e + ν e )/Γ(D + →anti K 0 e + ν e ) is determined to be 0.57±0.17±0.02. (orig.)
Barkhausen noise sensor with direct field control
Czech Academy of Sciences Publication Activity Database
Stupakov, Oleksandr
2013-01-01
Roč. 11, č. 1 (2013), s. 209-212 ISSN 1546-198X R&D Projects: GA ČR GP102/09/P108 Institutional research plan: CEZ:AV0Z10100520 Keywords : Barkhausen noise * field measurement * magnetic non-destructive testing Subject RIV: JB - Sensor s, Measurment, Regulation Impact factor: 0.558, year: 2013
African Journals Online (AJOL)
Items 201 - 234 of 234 ... Vol 7, No 1 (2005), Surgical treatment of trochanteric fractures: An Ivorian experience, Abstract PDF. JB Sié Essoh, M Kodo, A Traoré, Y Lambin. Vol 6, No 1-2 (2004), Term quadruplet pregnancy: a case report, Abstract PDF. T Ogunnowo, O Oluwole, CO Aimakhu, AO Ilesanmi, AO Omigbodun.
Detection of bisphenol A using a novel surface plasmon resonance biosensor
Czech Academy of Sciences Publication Activity Database
Hegnerová, Kateřina; Piliarik, Marek; Šteinbachová, M.; Flegelová, Z.; Černohorská, H.; Homola, Jiří
2010-01-01
Roč. 398, č. 5 (2010), s. 1963-1966 ISSN 1618-2642 R&D Projects: GA AV ČR KAN200670701; GA MŠk OC09058 Institutional research plan: CEZ:AV0Z20670512 Keywords : surface plasmon resonance biosensor * bisphenol A * endocrine disruptor Subject RIV: JB - Sensors, Measurment, Regulation Impact factor: 3.841, year: 2010
Partnership for nuclear power in the Czech Republic
Energy Technology Data Exchange (ETDEWEB)
NONE
1995-09-01
A catalogue is presented of 27 organizations involved in the Czech nuclear programme. Characteristics and addresses are given of the Czech electrical utility, plant and component manufacturers, the uranium mining company, design and engineering companies, research establishments, and consulting companies. Some foreign companies with activities in the Czech Republic are also dealt with. (J.B.).
African Journals Online (AJOL)
Items 6851 - 6900 of 11090 ... Vol 10, No 27 (2011), Kenaf seed oil from supercritical carbon dioxide fluid extraction shows cytotoxic effects towards various cancer cell lines, Abstract PDF. LS Yazan, JB Foo, KW Chan, PM Tahir, M Ismail. Vol 12, No 48 (2013), Keratinase production by Bacillus megaterium RS1 using the ...
African Journals Online (AJOL)
ebutamanya
2015-07-07
Jul 7, 2015 ... muscle flaps, such as gracillis muscle flap, transverse abdominal muscle flap, and tensor fascia lata flap, and fascia cutaneous flaps, such as medial ... The artificial vagina. Am J Obstet Gynecol. 1967 Dec. 1;99(7):944-51. PubMed | Google Scholar. 2. Mclndoe AH, Banister JB. An operation for the cure of.
relationship between prostate volume and ipss in african men with ...
African Journals Online (AJOL)
Administrator
Tan JK, Png DJ, Liew LC, Li MK, Wong ML. Prevalence of prostatitis-like symptoms in Singapore: a population- based study. Singapore Medical Journal. 2002;. 43(4):189-193. Ming Yin, Sheldon B, Uma C, Michael JB, Rajiv D. Prevalence of Incidental Prostate Cancer in the General. Population: A Study of Healthy Organ ...
Hernandez-Chavez, Eduardo, Ed.; And Others
The following articles are included in this anthology on Chicano speech: (1) "Mexican Spanish," D.N. Cardenas; (2) "The Archaic and the Modern in the Spanish of New Mexico," J. Ornstein; (3) "Problemas Lexicograficos del Espanol del Sudoeste," A.M. Espinosa, Jr.; (4) "Associative Interference in New Mexican Spanish," J.B. Rael; (5) "Some Aspects…
Surface plasmon resonance biosensors for detection of Alzheimer disease biomarkers
Czech Academy of Sciences Publication Activity Database
Hegnerová, Kateřina; Bocková, Markéta; Vaisocherová, Hana; Krištofíková, Z.; Říčný, J.; Řípová, D.; Homola, Jiří
2009-01-01
Roč. 139, č. 1 (2009), s. 69-73 ISSN 0925-4005 R&D Projects: GA MZd NR9322; GA AV ČR KAN200670701 Institutional research plan: CEZ:AV0Z20670512 Keywords : Alzheimer disease * SPR sensor * 17beta-HSD10 Subject RIV: JB - Sensors, Measurment, Regulation Impact factor: 3.083, year: 2009
African Journals Online (AJOL)
SA Crime Quarterly no 34 • December 2010. 41. Johan Burger (JB): One of the many outstanding successes ... section 49 of the Criminal Procedure Act that governs the legal use of deadly force to effect an arrest, and ... research have linked directly to weaknesses in internal command and control. How do you see changing ...
Přehledný kalkul tříparametrových modelů
Czech Academy of Sciences Publication Activity Database
Klán, Petr
-, 8-9 (2011), s. 70-73 ISSN 1210-9592 Institutional research plan: CEZ:AV0Z10300504 Keywords : automatické řízení * uzavřený regulační obvod, * přenos * Laplaceova transformace * PID regulace Subject RIV: JB - Sensors, Measurment, Regulation http://www.odbornecasopisy.cz/res/pdf/44344.pdf
Detection of chlorine in water
Czech Academy of Sciences Publication Activity Database
Kašík, Ivan; Mrázek, Jan; Podrazký, Ondřej; Seidl, Miroslav; Aubrecht, Jan; Tobiška, Petr; Pospíšilová, Marie; Matějec, Vlastimil; Kovács, B.; Markovics, A.; Szili, M.
2009-01-01
Roč. 139, č. 1 (2009), s. 139-142 ISSN 0925-4005 R&D Projects: GA MŠk(CZ) LC06034; GA ČR(CZ) GA102/05/0948 Institutional research plan: CEZ:AV0Z20670512 Keywords : optical fiber sensor * chlorine Subject RIV: JB - Sensors, Measurment, Regulation Impact factor: 3.083, year: 2009
Partnership for nuclear power in the Czech Republic
International Nuclear Information System (INIS)
1995-01-01
A catalogue is presented of 27 organizations involved in the Czech nuclear programme. Characteristics and addresses are given of the Czech electrical utility, plant and component manufacturers, the uranium mining company, design and engineering companies, research establishments, and consulting companies. Some foreign companies with activities in the Czech Republic are also dealt with. (J.B.)
Detection of a milling-induced surface damage by the magnetic Barkhausen noise
Czech Academy of Sciences Publication Activity Database
Stupakov, Alexandr; Neslušan, M.; Perevertov, Oleksiy
2016-01-01
Roč. 410, Jul (2016), 198-209 ISSN 0304-8853 R&D Projects: GA ČR GB14-36566G; GA ČR GA13-18993S Institutional support: RVO:68378271 Keywords : Barkhausen noise * surface field measurement * magnetization waveformcontrol * hard turning * surface integrity Subject RIV: JB - Sensors, Measurment, Regulation Impact factor: 2.630, year: 2016
SEROPREVALENCE OF HBsAg AMONG PATIENTS WITH FEBRILE ...
African Journals Online (AJOL)
USER
2015-06-01
Jun 1, 2015 ... Nigerian journal of parasitology. 29:38–41. Mazie, J.B., Barcus, T.T., Nicholas, J.W., Kantilaras,. J., Schwartz, I.K., Andrew, C. and Baird,. J.K. (2002). Hepatitis B infection and severe plasmodium falciparum malaria in. Vietnamese adults: American journal of tropical medicine and hygiene, 66(2), 140-. 142.
Energy Technology Data Exchange (ETDEWEB)
NONE
1994-12-31
The aim of the seminar was to present and discuss the latest results obtained in research at the Czech Technical University and collaborating institutions. Part A of the Proceedings contains 99 contributions from the following fields: physical electronics and optics, mathematics, informatics and cybernetics, and materials engineering. Two contributions were selected for INIS. (J.B.).
Detection of foodborne pathogens using surface plasmon resonance biosensors
Czech Academy of Sciences Publication Activity Database
Koubová, Vendula; Brynda, Eduard; Karasová, L.; Škvor, J.; Homola, Jiří; Dostálek, Jakub; Tobiška, Petr; Rošický, Jiří
2001-01-01
Roč. 74, 1/3 (2001), s. 100-105 ISSN 0925-4005 R&D Projects: GA ČR GA102/99/0549; GA AV ČR KSK2055603 Institutional research plan: CEZ:AV0Z4050913 Keywords : optical sensors * surface plasmon resonance * immunosensors Subject RIV: JB - Sensors, Measurment, Regulation Impact factor: 1.440, year: 2001
Adaptive LQG controller tuning
Czech Academy of Sciences Publication Activity Database
Novák, Miroslav; Böhm, Josef; Nedoma, Petr; Tesař, Ludvík
2003-01-01
Roč. 150, č. 6 (2003), s. 655-665 ISSN 1350-2379 R&D Projects: GA ČR GA102/02/0204; GA AV ČR IBS1075102 Institutional research plan: CEZ:AV0Z1075907 Keywords : adaptive controller * LQG controller * controller design Subject RIV: JB - Sensors, Measurment, Regulation Impact factor: 0.745, year: 2003
Effects of various forms of lipopolysaccharide on the expression of ...
African Journals Online (AJOL)
Jane
2011-10-05
Oct 5, 2011 ... Lan-jun Bai1, Wings TY Loo2,3,4*, Yiding Dou4, Min Wang5, Hao Liang5, Mary NB Cheung3,4,6 ... The levels of lactate dehydrogenase (LDH), N-terminal pro ...... Li G-R, Sun H-Y, Chen J-B, Zhou Y, Tse H-F, Lau C-P (2009).
Higher dimensional global monopole in Brans–Dicke theory
Indian Academy of Sciences (India)
Keywords. Global monopole; Brans–Dicke theory; higher dimension. PACS Nos 04.20.Jb; 98.80.Bp; 04.50.+h. 1. Introduction. The idea of higher dimensional theory was originated in super string and super gravity the- ories to unify gravity with other fundamental forces in nature. Solutions of Einstein field equations in higher ...
Magnetoacoustic measurements on steel samples at low magnetizing frequencies
Czech Academy of Sciences Publication Activity Database
Perevertov, Oleksiy; Stupakov, Alexandr
2015-01-01
Roč. 66, č. 7 (2015), s. 58-61 ISSN 1335-3632 R&D Projects: GA ČR GA13-18993S; GA ČR GB14-36566G Institutional support: RVO:68378271 Keywords : magneto-acoustic emission * surface magnetic field * steel * magnetic hysteresis Subject RIV: JB - Sensors, Measurment, Regulation Impact factor: 0.407, year: 2015
African Journals Online (AJOL)
ebutamanya
3 mai 2016 ... J Afr Cancer. 2009;1(2):98-. 103. PubMed | Google Scholar. 3. Potter JD, Slattery ML, Bostick RM et al. Colon Cancer: a. Review of the Epidemiology. Epidemiol Rev. 1993;15(2):499-. 545. PubMed | Google Scholar. 4. Tougeron D, Fauquembergue É, Latouche J-B. Immunotherapy for colorectal cancer.
The instrumental resolution of a moire extensometer in light of its recent automatisation
Czech Academy of Sciences Publication Activity Database
Rowberry, Matthew David; Kriegner, D.; Holý, V.; Frontera, C.; Llull, M.; Olejník, Kamil; Martí, Xavier
2016-01-01
Roč. 91, SEP (2016), s. 258-265 ISSN 0263-2241 R&D Projects: GA MŠk LM2010008 Institutional support: RVO:67985891 ; RVO:68378271 Keywords : geological discontinuity monitoring * mechanical extensometer * moire patterns * instrumental resolution Subject RIV: JB - Sensors, Measurment, Regulation; BM - Solid Matter Physics ; Magnetism (FZU-D) Impact factor: 2.359, year: 2016
International Nuclear Information System (INIS)
1993-01-01
The aim of the seminar was to present and discuss the latest results obtained in research at the Czech Technical University and collaborating institutions. Part A of the Proceedings contains 99 contributions from the following fields: physical electronics and optics, mathematics, informatics and cybernetics, and materials engineering. Two contributions were selected for INIS. (J.B.)
DEFF Research Database (Denmark)
Wac, Katarzyna; Cummings, Mark; Dey, Jayanta
2016-01-01
, high-quality services, we propose an innovative end-to-end service management framework called e2eUberIM. This framework contains a scalable, flexible, and volatile information model (UberIM) and a real-time, "organic" communication and storage process (e2eUber). It leverages the proprietary interfaces...... of different vendors, enabling the resulting enhanced operations system environment to automatically and in real-time optimize operational overhead while maximizing the user experience, and quickly field new innovative, composed "any-services" (XaaS). We document the e2eUberIM requirements and its design...
Directory of Open Access Journals (Sweden)
A. N. R. REDDY
2017-10-01
Full Text Available Heterogeneous catalysts are promising catalysts for optimal biodiesel yield from transesterification of vegetable oils. In this work calcium oxide (CaO heterogeneous catalyst was synthesized from Polymedosa erosa seashell. Calcination was carried out at 900ºC for 2h and characterized using Fourier transform infrared spectroscopy. Catalytic efficiency of CaO was testified in transesterification of crude Jatropha oil (CJO. A response surface methodology (RSM based on five-level-two-factor central composite design (CCD was employed to optimize two critical transesterification parameters catalyst concentration to pretreated CJO (0.01-0.03 w/w % and the reaction time (90 min - 150 min. A JB yield of 96.48% was estimated at 0.023 w/w% catalyst and 125.76 min reaction using response optimizer. The legitimacy of the predicted model was verified through the experiments. The validation experiments conformed a yield of JB 96.4%±0.01% as optimal at 0.023 w/w% catalyst to pretreated oil ratio and 126 min reaction time.
NATO Workshop on Soot in Combustion Systems
Prado, G
1983-01-01
Our interest in Mulhouse for carbon black and soot began some 30 years ago when J.B. Donnet developed the concept of surface chemistry of carbon and its involvement in interactions with gas, liquid and solid phases. In the late sixties, we began to study soot formation in pyrolytic systems and later on in flames. The idea of organ1z1ng a meeting on soot formation originated some four or five years ago, through discussions among Professor J.B. Howard, Dr. A. D'Alessio and ourselves. At that time the scientific community was becoming aware of the necessity to strictly control soot formation and emission. Being involved in the study of surface properties of carbon black as well as of formation of soot, we realized that the combustion community was not always fully aware of the progress made by the physical-chemists on carbon black. Reciprocally, the carbon specialists were often ignoring the research carried out on soot in flames. One objective of this workshop was to stimulate discussions between these two scie...
Utilization of dE/dx approx E sup n /a dependence for DELTA E - E-spectrometer calibration
Gorpinich, O K; Jachmenov, O O
2002-01-01
The method of calibration of DELTA E - E-spectrometers by the use of known empiric form dE/dx approx E sup n /a which describes the specific energy loss of charge particles in the matter for energy calibration of DELTA E - E-spectrometer was designed.
International Nuclear Information System (INIS)
Djilkibaev, Rashid M.; Konoplich, Rostislav V.
2009-01-01
An analytical expression for the spin-averaged amplitude squared of the rare muon decay μ + →e + e - e + ν e ν μ is calculated. Monte Carlo phase space simulation using the analytical expression for the amplitude has been used to get various differential distributions of charged leptons. The approximate analytical expression for the total energy spectrum of charged leptons near the end point is presented. The dependence of the branching ratio on cuts in the total energy of charged leptons is studied taking into account an experimental energy resolution. It is shown that the measured branching ratio is very sensitive to the energy resolution.
Africa Development - Vol 35, No 3 (2010)
African Journals Online (AJOL)
(Re)produire, marquer et (s')approprier des « lieux (publics) de ville » par les mots ou comment les murs (dé)font les langues à Dschang · EMAIL FREE FULL TEXT EMAIL FREE FULL TEXT DOWNLOAD FULL TEXT DOWNLOAD FULL TEXT. JB Tsofack, 93-117. http://dx.doi.org/10.4314/ad.v35i3.70209 ...
Renewable Energy Sources Brno '93
International Nuclear Information System (INIS)
1993-01-01
The proceedings contain 27 contributions dealing with unconventional energy sources. The numbers of contributions in the individual classes of topics indicate that interest has mostly concentrated on the direct utilization of solar energy, whereas wind energy, hydroelectric energy and geothermal energy receive less attention and the use of biomass is at the margin of interest. (J.B.)
African Journals Online (AJOL)
Items 1 - 50 of 70 ... JO Olusina, JB Olaleye, AS Alademomi, TI Ojie. Vol 3, No 1 (2008), Crushing strength of concrete using maize cob ... IO Famakin, SA Makanjuola, O Adeniyi, TO Oladinrin. Vol 5, No 1 (2010), Implications of Spatial Pattern of Social Infrastructure Stock in the Development of Rural Areas of Akwa Ibom State.
ORF Alignment: NC_002945 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available Udp-Galactopyranose Mutase From Mycobacterium ... Tuberculosis pdb|1V0J|C... Chain C, Udp-Galactopyranose ... Mutase From Mycobacterium Tuberculosis pdb|1V0J|B Chain ... ...B, Udp-Galactopyranose Mutase From Mycobacterium ... Tuberculosis pdb|1V0J|A Chain A, Udp-Galactopyra...nose ... Mutase From Mycobacterium Tuberculosis emb|CAA17873.1| ... UDP-GALACTOPYRANOSE MUTASE
ORF Alignment: NC_000962 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available Udp-Galactopyranose Mutase From Mycobacterium ... Tuberculosis pdb|1V0J|C... Chain C, Udp-Galactopyranose ... Mutase From Mycobacterium Tuberculosis pdb|1V0J|B Chain ... ...B, Udp-Galactopyranose Mutase From Mycobacterium ... Tuberculosis pdb|1V0J|A Chain A, Udp-Galactopyra...nose ... Mutase From Mycobacterium Tuberculosis emb|CAA17873.1| ... UDP-GALACTOPYRANOSE MUTASE
ORF Alignment: NC_002755 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available Udp-Galactopyranose Mutase From Mycobacterium ... Tuberculosis pdb|1V0J|C... Chain C, Udp-Galactopyranose ... Mutase From Mycobacterium Tuberculosis pdb|1V0J|B Chain ... ...B, Udp-Galactopyranose Mutase From Mycobacterium ... Tuberculosis pdb|1V0J|A Chain A, Udp-Galactopyra...nose ... Mutase From Mycobacterium Tuberculosis emb|CAA17873.1| ... UDP-GALACTOPYRANOSE MUTASE
Long-term selection experiment with Afrikaner cattle
African Journals Online (AJOL)
Mario Beffa
Long-term selection experiment with Afrikaner cattle. 3. Selection applied and response in calf growth traits. L.M. Beffa. 1,2,3. , J.B. van Wyk. 1# and G.J. Erasmus. 1. 1 University of the Free State, P.O. Box 339, Bloemfontein 9300, South Africa. 2 Matopos Research Station, P. Bag K5137, Bulawayo, Zimbabwe ...
Importance of nuclear power for chemistry
International Nuclear Information System (INIS)
Kolotyrkin, J.
1982-01-01
Examples are given of the use of ionizing radiations in nuclear chemistry, in radiation cross-linking of polymers. The possibilities are also indicated of applications in the disinfection of wastes, in fertilizer production and packaging, in the production of cellulose and hydrogen. The implementation of the said technologies depends on the solution of a number organizational problems. (J.B.)
African Journals Online (AJOL)
infections rhinosinusiennesaigue¨s de l'enfant en France.med mal Infect 2007 ;. 37:127-52. 5. anon jB, jacobs mr, Poole mD, et al. antimicrobial treatment guidelines for acute bacterial rhinosinusitis. Otolaryngol Head neck Surg2004 ; 130:1-45. 6. ebright jr, Pace mT, nazis aF. Septic thrombosis of the cavernous sinuses.
Czech Academy of Sciences Publication Activity Database
Slobodian, P.; Říha, Pavel; Sáha, P.
2012-01-01
Roč. 50, č. 10 (2012), s. 3446-3453 ISSN 0008-6223 Grant - others:OP VaVpI(XE) CZ.1.05/2.1.00/03.0111 Institutional research plan: CEZ:AV0Z20600510 Keywords : carbon nanotubes * polyurethane * high deformation * strain sensor * resistance * biomechanics Subject RIV: JB - Sensor s, Measurment, Regulation Impact factor: 5.868, year: 2012
International Nuclear Information System (INIS)
Kult, L.; Sara, V.
1993-12-01
Oil leaks from the Druzba pipeline between the Morava river and the Nove Mesto or Moutnice towns were examined by aerial photographing and soil sampling. The intensity of pollution was found to lie below regulatory limits. Suspect sites with respect to their pollution by oil substances were entered into maps. (J.B.). 3 tabs., 27 figs
Spectrum-effect relationships between high performance liquid ...
African Journals Online (AJOL)
promoting effect on contractility of intestinal smooth was carried out to ... addition, the equation of spectrum-effect relationships {Y = 3.818 - 1.126X1 + ..... Peng W, Liu YJ, Wu N, Sun T, He XY, Gao YX, Wu CJ. ... Zheng QF, Zhao YL, Wang JB, Liu TT, Zhang B, Gong ... Zhao HY, Han X. Research thoughts and application.
Universal Zero Specular Reflection Curves for MetaMaterials
2012-09-01
parents, Tony Ting and Li Chin, who always taught me the real values and meaning of life. Finally, I would like to thank my boss, Mr. Tan Ching Eng, and...Negative Refraction Makes a Perfect Lens,” Phys. Rev. Lett., vol. 85, pp. 3966, Imperial College, London, 2000. [10] J.B. Pendry, A.J. Holden, D.J. Robbins
Face to Face The IGBT and its Creator
Indian Academy of Sciences (India)
IAS Admin
brand name that they now are. What was it like? JB: When I finished high school, ... US, but the IIT brand was not there back then. My philosophy was to get into the top schools or ..... also very successful and we found ourselves years ahead of the rest of the world meaning big companies like Siliconix, Hitachi and Philips.
African Journals Online (AJOL)
Ahmed, J.B.. Vol 10, No 1 (2017): Special Conference Edition - Articles Analysis of the probability of channel satisfactory state in P2P live streaming systems. Abstract PDF. ISSN: 2006-6996. AJOL African Journals Online. HOW TO USE AJOL... for Researchers · for Librarians · for Authors · FAQ's · More about AJOL · AJOL's ...
Documentation of the ground for the planned MERO-IKL oil pipeline using the remote sensing technique
International Nuclear Information System (INIS)
Kult, L.; Vavra, J.; Sara, V.
1994-02-01
Complete photographic documentation of the planned route for the Ingolstadt-Kralupy-Litvinov pipeline was obtained by remote sensing; the vegetation cover sites and their avitalities were identified and described. The documentation identifies areas of avital plants, and defines potentially hazardous sources of soil or water pollution along the planned route. (J.B.). 1 tab., 17 figs
Upsurge of X-ray astronomy 230-
International Nuclear Information System (INIS)
Hudec, D.R.
1978-01-01
Instruments are described used for X-ray astronomy, namely X-ray detectors and X-ray telescopes. Unlike telescopes, the detectors do not comprise X-ray optics. A survey is given of the results obtained in solar and stellar X-ray astronomy and hypotheses are submitted on the origin of X radiation in the interstellar space. (J.B.)
Biofunctionalized gold nanoparticles for SPR-biosensor-based detection of CEA in blood plasma
Czech Academy of Sciences Publication Activity Database
Špringer, Tomáš; Homola, Jiří
2012-01-01
Roč. 51, č. 10 (2012), s. 2869-2875 ISSN 1618-2642 R&D Projects: GA MŠk OC09058; GA MŠk(CZ) LH11102; GA ČR GBP205/12/G118 Institutional support: RVO:67985882 Keywords : Surface plasmon resonance * Carcinoembryonic antigen * Biosensor Subject RIV: JB - Sensors, Measurment, Regulation Impact factor: 3.659, year: 2012
Preparing the construction of a school reactor
International Nuclear Information System (INIS)
Matejka, K.
1977-01-01
The possibilities are discussed of teaching and training nuclear reactor operation and control, teaching experimental reactor physics and investigating reactor lattice parameters using a training reactor to be installed at the Faculty of Nuclear Science and Physical Engineering in Prague. Requirements are indicated for the reactor's technical design and the Faculty's possibilities to contribute to its construction. (J.B.)
International Nuclear Information System (INIS)
1995-12-01
The proceedings of the seminar contain more than 420 contributions divided into 21 areas of interest. In Part I, 144 contributions are presented from the following fields: mathematics, physics, chemistry, engineering informatics and cybernetics, computer art, and fluid mechanics. For input in INIS, 15 contributions were selected from the physics section and 1 from the chemistry section. (J.B.)
Energy Technology Data Exchange (ETDEWEB)
NONE
1996-12-31
The proceedings of the seminar contain more than 420 contributions divided into 21 areas of interest. In Part I, 144 contributions are presented from the following fields: mathematics, physics, chemistry, engineering informatics and cybernetics, computer art, and fluid mechanics. For input in INIS, 15 contributions were selected from the physics section and 1 from the chemistry section. (J.B.).
Dannhauser, A; Bester, C; Joubert, G; Badenhorst, P; Slabber, M; Badenhorst, A; Du Toit, E; Barnard, H; Botha, P; Nogabe, L
2000-09-01
To determine the nutritional status and household resources of preschool children. A cross-sectional survey. : Two informal settlement areas, Joe Slovo (JS) and JB Mafora (JBM) in Mangaung, near Bloemfontein, South Africa. Preschool children (poor household situation of the participants. The generally poor nutritional status and environmental conditions emphasize the urgency of intervention for these children.
State-Space Dynamic Model for Estimation of Radon Entry Rate, based on Kalman Filtering
Czech Academy of Sciences Publication Activity Database
Brabec, Marek; Jílek, K.
2007-01-01
Roč. 98, - (2007), s. 285-297 ISSN 0265-931X Grant - others:GA SÚJB JC_11/2006 Institutional research plan: CEZ:AV0Z10300504 Keywords : air ventilation rate * radon entry rate * state-space modeling * extended Kalman filter * maximum likelihood estimation * prediction error decomposition Subject RIV: BB - Applied Statistics, Operational Research Impact factor: 0.963, year: 2007
Analysis of a Delayed Delta Modulator.
1983-05-01
15% (35). L4J _.4 Research supported by the Air Force Office of Scientific Research Grant No. LL. w F49620-82-C-0009. *Now with D.H. Wagner, Associates...Convergence of Probability Measures. New York: Wiley, 1968. [3] CHAN, H.C. and ANDERSON, J.B., "Adaptivity versus tree-searching in DPCM", IEEE Trans. Comun
2012-03-22
12):2151–2163, 2004. [12] Beer , C.W. and R.A. Bernheim. “Hyperfine press shift of 133Cs atoms in noble and molecular buffer gases”. Phys. Rev. A., 13...The Journal of Chemical Thermodynamics , 9:1035–1044, 1977. [14] Berends, R. W., W. Kedzierski, A.G. McConkey, J.B. Atkinson, and L. Krause. “Quenching
Czech Academy of Sciences Publication Activity Database
Slobodian, P.; Říha, Pavel; Sáha, P.
2012-01-01
Roč. 50, č. 10 (2012), s. 3446-3453 ISSN 0008-6223 Grant - others:OP VaVpI(XE) CZ.1.05/2.1.00/03.0111 Institutional research plan: CEZ:AV0Z20600510 Keywords : carbon nanotubes * polyurethane * high deformation * strain sensor * resistance * biomechanics Subject RIV: JB - Sensors, Measurment, Regulation Impact factor: 5.868, year: 2012
Evidence for climate change relevant to building design in the UK, 1976-2000
Wright, A. J.
2002-01-01
This work led to the author writing a successful Partners in Innovation (PII) bid, with Prof G Levermore, to analyse building design weather statistics under future climates. This was published as CIBSE Technical Memorandum TM34, ‘Weather Data with Climate Change Scenarios (2004)’, Wright AJ & Parkinson JB, available to CIBSE members on the CIBSE website.
GENGTC-JB: a computer program to calculate temperature distribution for cylindrical geometry capsule
International Nuclear Information System (INIS)
Someya, Hiroyuki; Kobayashi, Toshiki; Niimi, Motoji; Hoshiya, Taiji; Harayama, Yasuo
1987-09-01
In design of JMTR irradiation capsules contained specimens, a program (named GENGTC) has been generally used to evaluate temperature distributions in the capsules. The program was originally compiled by ORNL(U.S.A.) and consisted of very simple calculation methods. From the incorporated calculation methods, the program is easy to use, and has many applications to the capsule design. However, it was considered to replace original computing methods with advanced ones, when the program was checked from a standpoint of the recent computer abilities, and also to be complicated in data input. Therefore, the program was versioned up as aim to make better calculations and improve input method. The present report describes revised calculation methods and input/output guide of the version-up program. (author)
Observation of ψ(3686)→e^{+}e^{-}χ_{cJ} and χ_{cJ}→e^{+}e^{-}J/ψ.
Ablikim, M; Achasov, M N; Ai, X C; Albayrak, O; Albrecht, M; Ambrose, D J; Amoroso, A; An, F F; An, Q; Bai, J Z; Baldini Ferroli, R; Ban, Y; Bennett, D W; Bennett, J V; Bertani, M; Bettoni, D; Bian, J M; Bianchi, F; Boger, E; Boyko, I; Briere, R A; Cai, H; Cai, X; Cakir, O; Calcaterra, A; Cao, G F; Cetin, S A; Chang, J F; Chelkov, G; Chen, G; Chen, H S; Chen, H Y; Chen, J C; Chen, M L; Chen, S; Chen, S J; Chen, X; Chen, X R; Chen, Y B; Cheng, H P; Chu, X K; Cibinetto, G; Dai, H L; Dai, J P; Dbeyssi, A; Dedovich, D; Deng, Z Y; Denig, A; Denysenko, I; Destefanis, M; De Mori, F; Ding, Y; Dong, C; Dong, J; Dong, L Y; Dong, M Y; Dou, Z L; Du, S X; Duan, P F; Fan, J Z; Fang, J; Fang, S S; Fang, X; Fang, Y; Farinelli, R; Fava, L; Fedorov, O; Feldbauer, F; Felici, G; Feng, C Q; Fioravanti, E; Fritsch, M; Fu, C D; Gao, Q; Gao, X L; Gao, X Y; Gao, Y; Gao, Z; Garzia, I; Goetzen, K; Gong, L; Gong, W X; Gradl, W; Greco, M; Gu, M H; Gu, Y T; Guan, Y H; Guo, A Q; Guo, L B; Guo, R P; Guo, Y; Guo, Y P; Haddadi, Z; Hafner, A; Han, S; Hao, X Q; Harris, F A; He, K L; Held, T; Heng, Y K; Hou, Z L; Hu, C; Hu, H M; Hu, J F; Hu, T; Hu, Y; Huang, G S; Huang, J S; Huang, X T; Huang, X Z; Huang, Y; Huang, Z L; Hussain, T; Ji, Q; Ji, Q P; Ji, X B; Ji, X L; Jiang, L W; Jiang, X S; Jiang, X Y; Jiao, J B; Jiao, Z; Jin, D P; Jin, S; Johansson, T; Julin, A; Kalantar-Nayestanaki, N; Kang, X L; Kang, X S; Kavatsyuk, M; Ke, B C; Kiese, P; Kliemt, R; Kloss, B; Kolcu, O B; Kopf, B; Kornicer, M; Kupsc, A; Kühn, W; Lange, J S; Lara, M; Larin, P; Leng, C; Li, C; Li, Cheng; Li, D M; Li, F; Li, F Y; Li, G; Li, H B; Li, H J; Li, J C; Li, Jin; Li, K; Li, K; Li, Lei; Li, P R; Li, Q Y; Li, T; Li, W D; Li, W G; Li, X L; Li, X N; Li, X Q; Li, Y B; Li, Z B; Liang, H; Liang, Y F; Liang, Y T; Liao, G R; Lin, D X; Liu, B; Liu, B J; Liu, C X; Liu, D; Liu, F H; Liu, Fang; Liu, Feng; Liu, H B; Liu, H H; Liu, H H; Liu, H M; Liu, J; Liu, J B; Liu, J P; Liu, J Y; Liu, K; Liu, K Y; Liu, L D; Liu, P L; Liu, Q; Liu, S B; Liu, X; Liu, Y B; Liu, Z A; Liu, Zhiqing; Loehner, H; Lou, X C; Lu, H J; Lu, J G; Lu, Y; Lu, Y P; Luo, C L; Luo, M X; Luo, T; Luo, X L; Lyu, X R; Ma, F C; Ma, H L; Ma, L L; Ma, M M; Ma, Q M; Ma, T; Ma, X N; Ma, X Y; Ma, Y M; Maas, F E; Maggiora, M; Mao, Y J; Mao, Z P; Marcello, S; Messchendorp, J G; Min, J; Mitchell, R E; Mo, X H; Mo, Y J; Morales Morales, C; Muchnoi, N Yu; Muramatsu, H; Nefedov, Y; Nerling, F; Nikolaev, I B; Ning, Z; Nisar, S; Niu, S L; Niu, X Y; Olsen, S L; Ouyang, Q; Pacetti, S; Pan, Y; Patteri, P; Pelizaeus, M; Peng, H P; Peters, K; Pettersson, J; Ping, J L; Ping, R G; Poling, R; Prasad, V; Qi, H R; Qi, M; Qian, S; Qiao, C F; Qin, L Q; Qin, N; Qin, X S; Qin, Z H; Qiu, J F; Rashid, K H; Redmer, C F; Ripka, M; Rong, G; Rosner, Ch; Ruan, X D; Sarantsev, A; Savrié, M; Schoenning, K; Schumann, S; Shan, W; Shao, M; Shen, C P; Shen, P X; Shen, X Y; Sheng, H Y; Shi, M; Song, W M; Song, X Y; Sosio, S; Spataro, S; Sun, G X; Sun, J F; Sun, S S; Sun, X H; Sun, Y J; Sun, Y Z; Sun, Z J; Sun, Z T; Tang, C J; Tang, X; Tapan, I; Thorndike, E H; Tiemens, M; Ullrich, M; Uman, I; Varner, G S; Wang, B; Wang, B L; Wang, D; Wang, D Y; Wang, K; Wang, L L; Wang, L S; Wang, M; Wang, P; Wang, P L; Wang, S G; Wang, W; Wang, W P; Wang, X F; Wang, Y; Wang, Y D; Wang, Y F; Wang, Y Q; Wang, Z; Wang, Z G; Wang, Z H; Wang, Z Y; Wang, Z Y; Weber, T; Wei, D H; Wei, J B; Weidenkaff, P; Wen, S P; Wiedner, U; Wolke, M; Wu, L H; Wu, L J; Wu, Z; Xia, L; Xia, L G; Xia, Y; Xiao, D; Xiao, H; Xiao, Z J; Xie, Y G; Xiu, Q L; Xu, G F; Xu, J J; Xu, L; Xu, Q J; Xu, Q N; Xu, X P; Yan, L; Yan, W B; Yan, W C; Yan, Y H; Yang, H J; Yang, H X; Yang, L; Yang, Y X; Ye, M; Ye, M H; Yin, J H; Yu, B X; Yu, C X; Yu, J S; Yuan, C Z; Yuan, W L; Yuan, Y; Yuncu, A; Zafar, A A; Zallo, A; Zeng, Y; Zeng, Z; Zhang, B X; Zhang, B Y; Zhang, C; Zhang, C C; Zhang, D H; Zhang, H H; Zhang, H Y; Zhang, J; Zhang, J J; Zhang, J L; Zhang, J Q; Zhang, J W; Zhang, J Y; Zhang, J Z; Zhang, K; Zhang, L; Zhang, S Q; Zhang, X Y; Zhang, Y; Zhang, Y H; Zhang, Y N; Zhang, Y T; Zhang, Yu; Zhang, Z H; Zhang, Z P; Zhang, Z Y; Zhao, G; Zhao, J W; Zhao, J Y; Zhao, J Z; Zhao, Lei; Zhao, Ling; Zhao, M G; Zhao, Q; Zhao, Q W; Zhao, S J; Zhao, T C; Zhao, Y B; Zhao, Z G; Zhemchugov, A; Zheng, B; Zheng, J P; Zheng, W J; Zheng, Y H; Zhong, B; Zhou, L; Zhou, X; Zhou, X K; Zhou, X R; Zhou, X Y; Zhu, K; Zhu, K J; Zhu, S; Zhu, S H; Zhu, X L; Zhu, Y C; Zhu, Y S; Zhu, Z A; Zhuang, J; Zotti, L; Zou, B S; Zou, J H
2017-06-02
Using 4.479×10^{8} ψ(3686) events collected with the BESIII detector, we search for the decays ψ(3686)→e^{+}e^{-}χ_{cJ} and χ_{cJ}→e^{+}e^{-}J/ψ, where J=0, 1, 2. The decays ψ(3686)→e^{+}e^{-}χ_{cJ} and χ_{cJ}→e^{+}e^{-}J/ψ are observed for the first time. The measured branching fractions are B(ψ(3686)→e^{+}e^{-}χ_{cJ})=(11.7±2.5±1.0)×10^{-4}, (8.6±0.3±0.6)×10^{-4}, (6.9±0.5±0.6)×10^{-4} for J=0, 1, 2, and B(χ_{cJ}→e^{+}e^{-}J/ψ)=(1.51±0.30±0.13)×10^{-4}, (3.73±0.09±0.25)×10^{-3}, (2.48±0.08±0.16)×10^{-3} for J=0, 1, 2, respectively. The ratios of the branching fractions B(ψ(3686)→e^{+}e^{-}χ_{cJ})/B(ψ(3686)→γχ_{cJ}) and B(χ_{cJ}→e^{+}e^{-}J/ψ)/B(χ_{cJ}→γJ/ψ) are also reported. Also, the α values of helicity angular distributions of the e^{+}e^{-} pair are determined for ψ(3686)→e^{+}e^{-}χ_{c1,2} and χ_{c1,2}→e^{+}e^{-}J/ψ.
... this page: //medlineplus.gov/ency/patientinstructions/000761.htm E-cigarettes and E-hookahs To use the sharing features ... cigarettes because they believe these devices are safe. E-cigarettes and Children Many experts also have concerns about ...
PERAN MEDIASI E-SATISFACTION DAN E-TRUST TERHADAP E-LOYALTY
Directory of Open Access Journals (Sweden)
Rayi Retno Dwi Asih
2018-03-01
Full Text Available As the number of female customers shopping in online clothing stores increases, understanding how female customers’ e-loyalty is formed and fostered in this type of online store becomes very important. The purpose of this paper is to focus on female online clothing shoppers and to examine the mediating of e-loyalty in the context of online clothing stores: e-satisfaction and e-trust. The number of respondents is 196 persons who have online clothing shopping experience in Jakarta. The structural equation modeling was performed to analyze the measurement and structural models. The results show that both Online Satisfaction and Online Security are positively associated with e-trust, whereas web design is not. Furthermore, Online Satisfaction turns positively influence e-loyalty for female online clothing shoppers.
Directory of Open Access Journals (Sweden)
Chase A. Klingaman
2017-02-01
Full Text Available The data presented in this article are related to the research article, “HPLC-based enzyme kinetics assay for glucosinolate hydrolysis facilitate analysis of systems with both multiple reaction products and thermal enzyme denaturation” (C.K. Klingaman, M.J. Wagner, J.R. Brown, J.B. Klecker, E.H. Pauley, C.J. Noldner, J.R. Mays, [1]. This data article describes (1 the synthesis and spectral characterization data of a non-natural glucosinolate analogue, 2,2-diphenylethyl glucosinolate, (2 HPLC standardization data for glucosinolate, isothiocyanate, nitrile, and amine analytes, (3 reaction progress curve data for enzymatic hydrolysis reactions with variable substrate concentration, enzyme concentration, buffer pH, and temperature, and (4 normalized initial velocities of hydrolysis/formation for analytes. These data provide a comprehensive description of the enzyme-catalyzed hydrolysis of 2,2-diphenylethyl glucosinolate (5 and glucotropaeolin (6 under widely varied conditions.
Moriset , Bruno
2018-01-01
preprint for: International Encyclopedia of Human Geography, 2 nd éd. Elsevier; This article presents the fundamentals of e-business and e-commerce and their relations with geography. Electronic platforms and marketplaces provide economies of scale and network effects. E-business gives value chains a high degree of organizational (outsourcing) and locational (offshoring) flexibility, and firms can purchase intermediate goods and business services on a global basis. The rise of e-business shap...
Revolutionizing collaboration through e-work, e-business, and e-service
Nof, Shimon Y; Jeong, Wootae; Moghaddam, Mohsen
2015-01-01
Collaboration in highly distributed organizations of people, robots, and autonomous systems is and must be revolutionized by engineering augmentation. The aim is to augment humans’ abilities at work and, through this augmentation, improve organizations’ abilities to accomplish their missions. This book establishes the theoretical foundations and design principles of collaborative e-Work, e-Business and e-Service, their models and applications, design and implementation techniques. The fundamental premise is that without effective e-Work and e-Services, the potential of emerging activities, such as e-Commerce, virtual manufacturing, tele-robotic medicine, automated construction, smart energy grid, cyber-supported agriculture, and intelligent transportation cannot be fully materialized. Typically, workers and managers of such value networks are frustrated with complex information systems, originally designed and built to simplify and improve performance. Even if the human-computer interface for such systems...
eHealth voor Zorgprocesinnovatie : e-book
Dr. A.L. Cordia
2015-01-01
Het E-book 'eHealth voor Zorgprocesinnovatie' van ir. Anneloes Cordia, expert bij Kenniscentrum Zorginnovatie, heeft als doel eHealth en ICT-systemen in de zorg in verband te brengen met de belangrijke kwaliteitsdoelstellingen zoals doelmatigheid en transparantie. Daarnaast biedt het E-book
Search for contact interactions in the reactions e + e -→ l + l - and e + e -→γγ
Buskulic, D.; Decamp, D.; Goy, C.; Lees, J.-P.; Minard, M.-N.; Mours, B.; Pietrzyk, B.; Alemany, R.; Ariztizabal, F.; Comas, P.; Crespo, J. M.; Delfino, M.; Fernandez, E.; Fernandez-Bosman, M.; Gaitan, V.; Garrido, Li.; Mattison, T.; Pacheco, A.; Padilla, C.; Pascual, A.; Creanza, D.; de Palma, M.; Farilla, A.; Iaselli, G.; Maggi, G.; Maggi, M.; Natali, S.; Nuzzo, S.; Quattromini, M.; Ranieri, A.; Raso, G.; Romano, F.; Ruggieri, F.; Selvaggi, G.; Silvestris, L.; Tempesta, P.; Zito, G.; Chai, Y.; Hu, H.; Huang, D.; Huang, X.; Lin, J.; Wang, T.; Xie, Y.; Xu, D.; Xu, R.; Zhang, J.; Zhang, L.; Zhao, W.; Bauerdick, L. A. T.; Blucher, E.; Bonvicini, G.; Boudreau, J.; Casper, D.; Drevermann, H.; Forty, R. W.; Ganis, G.; Gay, C.; Hagelberg, R.; Harvey, J.; Haywood, S.; Hilgart, J.; Jacobsen, R.; Jost, B.; Knobloch, J.; Lehraus, I.; Lohse, T.; Lusiani, A.; Martinez, M.; Mato, P.; Meinhard, H.; Minten, A.; Miotto, A.; Miquel, R.; Moser, H.-G.; Palazzi, P.; Perlas, J. A.; Pusztaszeri, J.-F.; Ranjard, F.; Redlinger, G.; Rolandi, L.; Rothberg, J.; Ruan, T.; Saich, M.; Schlatter, D.; Schmelling, M.; Sefkow, F.; Tejessy, W.; Wachsmuth, H.; Wiedenmann, W.; Wildish, T.; Witzeling, W.; Wotschack, J.; Ajaltouni, Z.; Badaud, F.; Bardadin-Otwinowska, M.; Fellous, R. El; Falvard, A.; Gay, P.; Guicheney, C.; Henrard, P.; Jousset, J.; Michel, B.; Montret, J.-C.; Pallin, D.; Perret, P.; Podlyski, F.; Proriol, J.; Prulhière, F.; Saadi, F.; Fearnley, T.; Hansen, J. D.; Hansen, J. R.; Hansen, P. H.; Møllerud, R.; Nilsson, B. S.; Efthymiopoulos, I.; Kyriakis, A.; Simopoulou, E.; Vayaki, A.; Zachariadou, K.; Badier, J.; Blondel, A.; Bonneaud, G.; Brient, J. C.; Fouque, G.; Orteu, S.; Rougé, A.; Rumpf, M.; Tanaka, R.; Verderi, M.; Videau, H.; Candlin, D. J.; Parsons, M. I.; Veitch, E.; Moneta, L.; Parrini, G.; Corden, M.; Georgiopoulos, C.; Ikeda, M.; Lannutti, J.; Levinthal, D.; Mermikides, M.; Sawyer, L.; Wasserbaech, S.; Antonelli, A.; Baldini, R.; Bencivenni, G.; Bologna, G.; Bossi, F.; Campana, P.; Capon, G.; Cerutti, F.; Chiarella, V.; D'Ettorre-Piazzoli, B.; Felici, G.; Laurelli, P.; Mannocchi, G.; Murtas, F.; Murtas, G. P.; Passalacqua, L.; Pepe-Altarelli, M.; Picchi, P.; Colrain, P.; Ten Have, I.; Lynch, J. G.; Maitland, W.; Morton, W. T.; Raine, C.; Reeves, P.; Scarr, J. M.; Smith, K.; Smith, M. G.; Thompson, A. S.; Turnbull, R. M.; Brandl, B.; Braun, O.; Geweniger, C.; Hanke, P.; Hepp, V.; Kluge, E. E.; Maumary, Y.; Putzer, A.; Rensch, B.; Stahl, A.; Tittel, K.; Wunsch, M.; Beuselinck, R.; Binnie, D. M.; Cameron, W.; Cattaneo, M.; Colling, D. J.; Dornan, P. J.; Greene, A. M.; Hassard, J. F.; Lieske, N. M.; Moutoussi, A.; Nash, J.; Patton, S.; Payne, D. G.; Phillips, M. J.; San Martin, G.; Sedgbeer, J. K.; Tomalin, I. R.; Wright, A. G.; Girtler, P.; Kneringer, E.; Kuhn, D.; Rudolph, G.; Bowdery, C. K.; Brodbeck, T. J.; Finch, A. J.; Foster, F.; Hughes, G.; Jackson, D.; Keemer, N. R.; Nuttall, M.; Patel, A.; Sloan, T.; Snow, S. W.; Whelan, E. P.; Kleinknecht, K.; Raab, J.; Renk, B.; Sander, H.-G.; Schmidt, H.; Steeg, F.; Walther, S. M.; Wanke, R.; Wolf, B.; Bencheikh, A. M.; Benchouk, C.; Bonissent, A.; Carr, J.; Coyle, P.; Drinkard, J.; Etienne, F.; Nicod, D.; Papalexiou, S.; Payre, P.; Roos, L.; Rousseau, D.; Schwemmling, P.; Talby, M.; Adlung, S.; Assmann, R.; Bauer, C.; Blum, W.; Brown, D.; Cattaneo, P.; Dehning, B.; Dietl, H.; Dydak, F.; Frank, M.; Helley, A. W.; Lauber, J.; Lütjens, G.; Lutz, G.; Männer, W.; Richter, R.; Rotscheidt, H.; Schröder, J.; Schwarz, A. S.; Settles, R.; Seywerd, H.; Stierlin, U.; Stiegler, U.; St. Denis, R.; Wolf, G.; Boucrot, J.; Callot, O.; Cordier, A.; Davier, M.; Duflot, L.; Grivaz, J.-F.; Heusse, Ph.; Jaffe, D. E.; Janot, P.; Kim, D. W.; Le Diberder, F.; Lefrançois, J.; Lutz, A.-M.; Schune, M.-H.; Veillet, J.-J.; Videau, I.; Zhang, Z.; Abbaneo, D.; Bagliesi, G.; Batignani, G.; Bosisio, L.; Bottigli, U.; Bozzi, C.; Calderini, G.; Carpinelli, M.; Ciocci, M. A.; Dell'Orso, R.; Ferrante, I.; Fidecaro, F.; Foà, L.; Focardi, E.; Forti, F.; Giassi, A.; Giorgi, M. A.; Gregorio, A.; Ligabue, F.; Mannelli, E. B.; Marrocchesi, P. S.; Messineo, A.; Palla, F.; Rizzo, G.; Sanguinetti, G.; Spagnolo, P.; Steinberger, J.; Tenchini, R.; Tonelli, G.; Triggiani, G.; Vannini, C.; Venturi, A.; Verdini, P. G.; Walsh, J.; Betteridge, A. P.; Carter, J. M.; Green, M. G.; March, P. V.; Mir, Ll. M.; Medcalf, T.; Quazi, I. S.; Strong, J. A.; West, L. R.; Botterill, D. R.; Clifft, R. W.; Edgecock, T. R.; Edwards, M.; Fisher, S. M.; Jones, T. J.; Norton, P. R.; Salmon, D. P.; Thompson, J. C.; Bloch-Devaux, B.; Colas, P.; Duarte, H.; Kozanecki, W.; Lançon, E.; Lemaire, M. C.; Locci, E.; Perez, P.; Perrier, F.; Rander, J.; Renardy, J.-F.; Rosowsky, A.; Roussarie, A.; Schuller, J.-P.; Schwindling, J.; Si Mohand, D.; Vallage, B.; Johnson, R. P.; Litke, A. M.; Taylor, G.; Wear, J.; Ashman, J. G.; Babbage, W.; Booth, C. N.; Buttar, C.; Carney, R. E.; Cartwright, S.; Combley, F.; Hatfield, F.; Thompson, L. F.; Barberio, E.; Böhrer, A.; Brandt, S.; Cowan, G.; Grupen, C.; Lutters, G.; Rivera, F.; Schäfer, U.; Smolik, L.; Trier, H.; Della Maria, R.; Giannini, G.; Gobbo, B.; Ragusa, F.; Bellantoni, J.; Chen, W.; Cinabro, D.; Conway, J. S.; Cowen, D. F.; Feng, Z.; Ferguson, D. P. S.; Gao, Y. S.; Grahl, J.; Harton, J. L.; Jared, R. C.; Leclaire, B. W.; Lishka, C.; Pan, Y. B.; Pater, J. R.; Saadi, Y.; Schmitt, M.; Sharma, V.; Shi, Z. H.; Walsh, A. M.; Weber, F. V.; Wu, Sau Lan; Wu, X.; Zheng, M.; Zobernig, G.
1993-06-01
Contact interactions are searched for using the differential cross sections for the reactions e + e -→ e + e -, e + e -→ µ + µ -, e + e -→ τ + τ - and e + e -→γγ measured at 12 energies around the Z peak and corresponding to about 20 pb-1 of cumulated luminosity. Four-fermion contact term models assuming various chiralities of lepton currents are fitted to the lepton data and lower limits on the energy scale Λ of such terms are set at 95% c.l. The limits vary in the range 0.9 4.7 TeV, depending on the model and on the lepton flavour. The eeγγ contact terms are searched for assuming various chiralities. Limits on the energy scale Λ between 79 and 130 GeV are extracted from the data. The results are compared and combined with those reported at lower energies.
International Nuclear Information System (INIS)
Lynch, H.L.
1975-08-01
The total cross sections for hadron production and scale invariance as applied to e + e - annihilation are discussed. Also the narrow psi resonances at 3.095 and 3.684 GeV are also considered. General properties as well as specific decay modes are discussed. A definitive review is not given in these lectures. 46 references
Excited fermionic states in e+ e- and eγ collisions
International Nuclear Information System (INIS)
Moraes Gregores, Eduardo de
1994-01-01
Some preliminary results are presented which were obtained in the investigation of signs that can reveal the existence of fermionic excited states in e + e - and eγ collisions where the electron beam is obtained using the conversion method named laser backscattering. 3 refs
Collins, Lauren; Glasser, Allison M; Abudayyeh, Haneen; Pearson, Jennifer L; Villanti, Andrea C
2018-01-05
Given the lack of regulation on marketing of electronic cigarettes (e-cigarettes) in the U.S. and the increasing exchange of e-cigarette-related information online, it is critical to understand how e-cigarette companies market e-cigarettes and how the public engages with e-cigarette information. Results are from a systematic review of peer-reviewed literature on e-cigarettes via a PubMed search through June 1, 2017. Search terms included: "e-cigarette*" OR "electronic cigarette" OR "electronic cigarettes" OR "electronic nicotine delivery" OR "vape" OR "vaping." Experimental studies, quasi-experimental studies, observational studies, qualitative studies, and mixed methods studies providing empirical findings on e-cigarette marketing and communication (i.e., non-marketing communication in the public) were included. One hundred twenty-four publications on e-cigarette marketing and communication were identified. They covered topics including e-cigarette advertisement claims/promotions and exposure/receptivity, the effect of e-cigarette advertisements on e-cigarette and cigarette use, public engagement with e-cigarette information, and the public's portrayal of e-cigarettes. Studies show increases in e-cigarette marketing expenditures and online engagement through social media over time, that e-cigarettes are often framed as an alternative to combustible cigarettes, and that e-cigarette advertisement exposure may be associated with e-cigarette trial in adolescents and young adults. Few studies examine the effects of e-cigarette marketing on perceptions and e-cigarette and cigarette use. Evidence suggests that exposure to e-cigarette advertisements affects perceptions and trial of e-cigarettes, but there is no evidence that exposure affects cigarette use. No studies examined how exposure to e-cigarette communication, particularly misleading or inaccurate information, impacts e-cigarette and tobacco use behaviors. The present article provides a comprehensive review of e
African Journals Online (AJOL)
Tsofack, JB. Vol 35, No 3 (2010) - Articles (Re)produire, marquer et (s')approprier des « lieux (publics) de ville » par les mots ou comment les murs (dé)font les langues à Dschang Abstract PDF. ISSN: 0850-3907. AJOL African Journals Online. HOW TO USE AJOL... for Researchers · for Librarians · for Authors · FAQ's · More ...
Czech Academy of Sciences Publication Activity Database
Chomát, Miroslav; Čtyroký, Jiří; Berková, Daniela; Matějec, Vlastimil; Kaňka, Jiří; Skokánková, Jana; Todorov, Filip; Jančárek, A.; Bittner, P.
2006-01-01
Roč. 119, č. 2 (2006), s. 642-650 ISSN 0925-4005 R&D Projects: GA ČR(CZ) GA102/03/0475; GA MŠk(CZ) OC 288.001 Institutional research plan: CEZ:AV0Z20670512 Keywords : temperature * fibre optic sensors * optical fibre s * refractive index * diffraction gratings Subject RIV: JB - Sensors, Measurment, Regulation Impact factor: 2.331, year: 2006
Food selection in the blesbok on pasture with low plant diversity
African Journals Online (AJOL)
MONRO, R.H., 1979. A study of the growth feeding and body condi- tion of the impala Aepyceros melampus. M.Sc. thesis, University of Pretoria. TILLEY, J.M.A. & TERRY, R.A., 1963. A two stage technique for the in vitro digestion of forage crops. J. Br. Grassld. Soc. 18,. 104- lll. VAN SOEST, P.J. & ROBERTSON, J.B., 1977.
International Nuclear Information System (INIS)
1993-01-01
A report is presented on the economy, businesses, finances, business strategy, environmental policy, human resources and social policy, and public relations of the joint stock company Ceske energeticke zavody (Czech Power Works). A review is given of business performance in 1992. As of 31 December 1992 the assets reached CZK 81,018,965, the profit was CZK 6,280,943. (J.B.)
TAPERED OPTICAL FIBRES FOR LOCAL pH DETECTION
Czech Academy of Sciences Publication Activity Database
Martan, Tomáš; Pospíšilová, Marie; Aubrecht, Jan; Mrázek, Jan; Podrazký, Ondřej; Kašík, Ivan; Matějec, Vlastimil
2010-01-01
Roč. 206, č. 1 (2010), 0120171-0120172 ISSN 1742-6588. [8th International Workshop on Information Optics (WIO' 09). Paris, 20.07.2009-24.07.2009] R&D Projects: GA ČR(CZ) GP102/08/P639 Institutional research plan: CEZ:AV0Z20670512 Keywords : optical planar sensor * fluorescence * pH Subject RIV: JB - Sensor s, Measurment, Regulation
Chemistry and the development of research into the structure of matter
International Nuclear Information System (INIS)
Coldanskij, V.
1977-01-01
Efforts have been made recently to explain the structure of the atomic nucleus and the structure of the electron shell of the atom using a unified quantum mechanics description. The applications are surveyed of the knowledge of the nucleus and electron shell structure in chemistry. Electron paramagnetic resonance, nuclear magnetic resonance and gamma resonance spectrometry are presented as examples. (J.B.)
Problems of zirconium metal production in Czechoslovakia
International Nuclear Information System (INIS)
Vareka, J.; Vaclavik, E.
1975-01-01
The problems are summed up of the production and quality control of zirconium sponge. A survey is given of industrial applications of zirconium in form of pure metal or alloys in nuclear power production, ferrous and non-ferrous metallurgy, chemical engineering and electrical engineering. A survey is also presented of the manufacture of zirconium metal in advanced capitalist countries. (J.B.)
Detection of botulinum neurotoxins in buffer and hney using a surface plasmon resonance (SPR) sensor
Czech Academy of Sciences Publication Activity Database
Ladd, J.; Taylor, A.; Homola, Jiří; Jiang, S.
2008-01-01
Roč. 130, č. 1 (2008), s. 129-134 ISSN 0925-4005 Grant - others:US FDA(US) FD-U-002250; National Science Foundation(US) CBET-0528605 Institutional research plan: CEZ:AV0Z20670512 Source of funding: N - neverejné zdroje ; N - neverejné zdroje Keywords : surface plasmons * biosensors * toxicology Subject RIV: JB - Sensors, Measurment, Regulation Impact factor: 3.122, year: 2008
Directory of Open Access Journals (Sweden)
Kinoshita Y
2013-09-01
Full Text Available Kinoshita Y, DiBonaventura M, Rossi B, Iwamoto K, Wang ECY, Briere JB. Clin Exp Gastroenterol. 2013;6:51–59.On page 54, in the second paragraph, line 6, note that "26.65% versus 17.02%" should be "29.65% versus 17.02%".View original paper by Kinoshita Y, DiBonaventura M, Rossi B et al.
Optical fibre sensor coated with porous silica layers for gas and chemical vapour detection
Czech Academy of Sciences Publication Activity Database
Abdelghani, A.; Chovelon, J. M.; Jaffrezic-Renault, N.; Lacroix, M.; Gagnaire, H.; Veillas, C.; Berková, Daniela; Chomát, Miroslav; Matějec, Vlastimil
B44, l/3 (1997), s. 495-498 ISSN 0925-4005 R&D Projects: GA ČR GA102/95/0871; GA ČR GA102/96/0939 Grant - others:EU COPERNICUS(XE) CIPA-CT94-0140 Keywords : nonelectric sensing devices * optical fibres * chemical sensors * sol-gel processing Subject RIV: JB - Sensors, Measurment, Regulation Impact factor: 0.858, year: 1997
Chemical detection of liquid media with a refractrometric sensor based a multimode optical fibre
Czech Academy of Sciences Publication Activity Database
Cherif, K.; Hleli, S.; Abdelghani, A.; Jaffrezic-Renault, N.; Matějec, Vlastimil
2002-01-01
Roč. 2, č. 6 (2002), s. 195-204 ISSN 1424-8220 R&D Projects: GA ČR GA102/02/0780; GA AV ČR KSK2067107 Projekt 07/01:4074 Institutional research plan: CEZ:AV0Z2067918 Keywords : optical fibres * refractometer * optical sensors Subject RIV: JB - Sensors, Measurment, Regulation Impact factor: 0.990, year: 2002 http://www.mdpi.net/sensors
Czech Academy of Sciences Publication Activity Database
Stachiv, Ivo; Vokoun, David; Jeng, Y.-R.
2014-01-01
Roč. 104, č. 8 (2014), "083102-1"-"083102-4" ISSN 0003-6951 R&D Projects: GA ČR GAP107/12/0800 Institutional support: RVO:68378271 Keywords : functional films * mass sensor * resonant frequency Subject RIV: JB - Sensors, Measurment, Regulation Impact factor: 3.302, year: 2014 http://scitation.aip.org/content/aip/journal/apl/104/8/10.1063/1.4866417
Effect of Fe doping on optical properties of freestanding semi-insulating HVPE GaN:Fe
Czech Academy of Sciences Publication Activity Database
Gladkov, Petar; Humlíček, J.; Hulicius, Eduard; Šimeček, Tomislav; Paskova, T.; Evans, K.
2010-01-01
Roč. 312, č. 8 (2010), s. 1205-1209 ISSN 0022-0248 R&D Projects: GA AV ČR IAA100100719; GA MŠk(CZ) LC06040 Institutional research plan: CEZ:AV0Z20670512; CEZ:AV0Z10100521 Keywords : Fe-doping * Optical characterization * Hybride vapor phase epitaxy * Nitrides Subject RIV: JB - Sensors, Measurment, Regulation Impact factor: 1.737, year: 2010
Detection of milled 100Cr6 steel surface by eddy current and incremental permeance methods
Czech Academy of Sciences Publication Activity Database
Perevertov, Oleksiy; Neslušan, M.; Stupakov, Alexandr
2017-01-01
Roč. 87, Apr (2017), s. 15-23 ISSN 0963-8695 R&D Projects: GA ČR GB14-36566G; GA ČR GA13-18993S Institutional support: RVO:68378271 Keywords : Eddy currents * hard milling * incremental permeance * magnetic materials * surface characterization Subject RIV: JB - Sensors, Measurment, Regulation OBOR OECD: Electrical and electronic engineering Impact factor: 2.726, year: 2016