Elektrooniline maksekäsk kiirendab kohtumenetlust / Marko Aavik

Index Scriptorium Estoniae

Aavik, Marko, 1977-

2008-01-01

Eesti kohtusüsteemist ning maksekäsumenetlusest. Ilmunud ka Valgamaalane 17. juuni 2008, lk. 2 ; Harju Ekspress 20. juuni 2008, lk. 6 ; Meie Maa 2. juuli 2008, lk. 5 ; Nädaline 1. juuli 2008, lk. 5 ; Severnoje Poberezhje 2. juuli 2008, lk. 2 (Melnitsõ pravosudija stali molot bõstreje) ; Sakala 18. juuli 2008, lk. 2 ; Vooremaa : Jõgeva Valla Teataja 4. okt. 2008, lk. 2 ; Meie Maa 8. okt. 2008, lk. 6, pealkiri kujul: e-maksekäsk lahendab võlanõude kiiresti ; Vooremaa 7. okt. 2008, lk. 2, pealkiri kujul: e-maksekäsk lahendab võlanõuded kiiresti ; Koit 9. okt. 2008, lk. 3, pealkiri kujul: e-maksekäsk säästab aega ja raha ; Virumaa Teataja 9. okt. 2008, lk. 7, pealkiri kujul: e-maksekäsk lahendab võlanõuded kiiresti ; Kuulutaja 10. okt. 2008, lk. 4, pealkiri kujul: e-maksekäsk lahendab võlanõuded kiiresti ; Nädaline 14. okt. 2008, lk. 10, pealkiri kujul: e-maksekäsk lahendab võlanõuded kiiresti ; Lääne Elu 14. okt. 2008, lk. 5, pealkiri kujul: e-maksekäsk lahendab võlanõuded kiiresti ; Pärnu Postimees 18. okt. 2008, lk. 19, pealkiri kujul: e-maksekäsk lahendab võlanõuded kiiresti

77 FR 76090 - Pendency of Request for Approval of Special Withdrawal Liability Rules; the I.A.M. National...

Science.gov (United States)

2012-12-26

... Liability Rules; the I.A.M. National Pension Fund National Pension Plan AGENCY: Pension Benefit Guaranty... Fund National Pension Plan for approval of a plan amendment providing for special withdrawal liability... on Extension of Special Withdrawal Liability Rules, a multiemployer pension plan may, with PBGC...

Summary revaluation of cold testing of the first block of nuclear power plant Mochovce; Suhrnne zhodnotenie neaktivneho vyskusania 1. bloku jadrovej elektrarne Mochovce

Energy Technology Data Exchange (ETDEWEB)

Miskolci, M; Sarvaic, I [Nuclear Power Plants Research Institute Trnava, Inc., Okruzna 5, 918 64 Trnava (Slovakia)

1998-04-03

The document contents summary revaluation of the stage of cold testing of the first unit of nuclear power plant Mochovce. The valuation is processed in individual systems with safety significance. The process and results of system testing and their conclusions for the block readiness for active testing are summarized in the document. The valuation has been elaborated by a scientific management for start-up of nuclear power plant Mochovce as an independent conductor assistance for activation check from the nuclear safety point of view. The valuation of the activation results of systems in the first unit of nuclear power plant was processed as of 15.3.1998 61 figs., 44 tabs., `Translation to english is available from OMEGA INFO, Vysehradska 33, SK-84215 Bratislava, Slovak Republic, E-Mail: kuruc at fns.uniba.sk`

Urbánno-rurálně rozdiely voličského správania v Česku a na Slovensku

Czech Academy of Sciences Publication Activity Database

Kostelecký, Tomáš; Krivý, V.

2015-01-01

Roč. 47, č. 4 (2015), s. 390-413 ISSN 0049-1225 R&D Projects: GA ČR(CZ) GAP408/12/1442 Institutional support: RVO:68378025 Keywords : voting behaviour * aggregated data * Czech and Slovak society Subject RIV: AO - Sociology , Demography Impact factor: 0.275, year: 2015 https://www.sav.sk/journals/uploads/08190954Krivy%20-%20Kostelecky%20OK.pdf

Enviroportal.sk - information portal about the environment

International Nuclear Information System (INIS)

Navratil, R.; Kmet, M.

2005-01-01

In this presentation author deals with history, conception and exploitation of information portal about environment in the Slovak Republic. This portal - Enviroportal.sk was introduced into service in testing operation in April 2005. Perspectives of Enviroportal.sk are discussed

Detection of illegitimate rearrangement within the immunoglobulin locus on 14q32.3 in B-cell malignancies using end-sequenced probes

DEFF Research Database (Denmark)

Silahtaroglu, Asli; Poulsen, Tim; Giselø, Claus

2001-01-01

in the literature or at http://www.biologia.uniba.it/rmc/. Validation, orientation, and overlap of these probes were confirmed using interphase-, metaphase-, and fiber-FISH. We have identified seven BAC end-sequenced probes (3087C18, 47P23, 76N15, 12F16, 101G24, 112H5, and 151B17) covering 612 kb of the distal IGHV...

Formation of Skål International Club in Vietnam

OpenAIRE

Tran, Quang

2014-01-01

This paper presents a project plan of Skål International Vietnam as a new joining club, with the purpose of forming a new Skål International club in Vietnam. The idea was born in September, 2011 during the 72nd Skål International World Congress in Turku, Finland, where the author – a Young Skål had invited to attend . Vietnam situated in the peninsula of South-East Asia, the country holds great potentials of nature, culture and human power for tourism growth. In spite of joining an Inter...

CyPPA, a Positive SK3/SK2 Modulator, Reduces Activity of Dopaminergic Neurons, Inhibits Dopamine Release, and Counteracts Hyperdopaminergic Behaviors Induced by Methylphenidate

DEFF Research Database (Denmark)

Herrik, Kjartan F; Redrobe, John P; Holst, Dorte

2012-01-01

Dopamine (DA) containing midbrain neurons play critical roles in several psychiatric and neurological diseases, including schizophrenia and attention deficit hyperactivity disorder, and the substantia nigra pars compacta neurons selectively degenerate in Parkinson's disease. Pharmacological......]-amine (CyPPA), a subtype-selective positive modulator of SK channels (SK3¿>¿SK2¿>¿>¿>¿SK1, IK), decreased spontaneous firing rate, increased the duration of the apamin-sensitive afterhyperpolarization, and caused an activity-dependent inhibition of current-evoked action potentials in DA neurons from both...

Expertise and facilities of the IAM and ECN Petten in support of nuclear plant life management programmes

International Nuclear Information System (INIS)

Crutzen, S.; Debarberis, L.; Toerroenen, K.; Horsten, M.G.; Tjoa, G.L.; Vries, M.I. de

1995-01-01

The steel material properties of the pressure vessel are slowly degrading throughout the component lifetime; generally of the order of 30 year. The degradation could be attributed to many factors, like neutron irradiation, thermal aging, stress aging, corrosion, etc. and the synergism between the different factors. Neutron irradiation is one of the major known single factors for Reactor Pressure Vessel (RPV) steel degradation. Within the frame of activities of the 4th Framework programme of the European Commission and of the European Network 'Aging Materials and Evaluation Studies' (AMES), a number of projects dealing with aging of materials, radiation and thermal aging, and the validation of mitigation measures, like annealing, and the sensibility to re-embrittlement after annealing are ongoing at the Institute for Advanced Materials (IAM) of the JRC, Petten and at ECN in Petten. A survey of irradiation technology available at the High Flux Reactor (HFR) Petten, as well as expertise and facilities of the IAM and ECN Petten in support of the programmes is given. The AMES irradiation facility for the HFR Petten and the irradiation projects are discussed in detail. A general overview of the ongoing and planned projects is also given. (author). 12 refs, 5 figs

SK2 channels regulate mitochondrial respiration and mitochondrial Ca2+ uptake.

Science.gov (United States)

Honrath, Birgit; Matschke, Lina; Meyer, Tammo; Magerhans, Lena; Perocchi, Fabiana; Ganjam, Goutham K; Zischka, Hans; Krasel, Cornelius; Gerding, Albert; Bakker, Barbara M; Bünemann, Moritz; Strack, Stefan; Decher, Niels; Culmsee, Carsten; Dolga, Amalia M

2017-05-01

Mitochondrial calcium ([Ca 2+ ] m ) overload and changes in mitochondrial metabolism are key players in neuronal death. Small conductance calcium-activated potassium (SK) channels provide protection in different paradigms of neuronal cell death. Recently, SK channels were identified at the inner mitochondrial membrane, however, their particular role in the observed neuroprotection remains unclear. Here, we show a potential neuroprotective mechanism that involves attenuation of [Ca 2+ ] m uptake upon SK channel activation as detected by time lapse mitochondrial Ca 2+ measurements with the Ca 2+ -binding mitochondria-targeted aequorin and FRET-based [Ca 2+ ] m probes. High-resolution respirometry revealed a reduction in mitochondrial respiration and complex I activity upon pharmacological activation and overexpression of mitochondrial SK2 channels resulting in reduced mitochondrial ROS formation. Overexpression of mitochondria-targeted SK2 channels enhanced mitochondrial resilience against neuronal death, and this effect was inhibited by overexpression of a mitochondria-targeted dominant-negative SK2 channel. These findings suggest that SK channels provide neuroprotection by reducing [Ca 2+ ] m uptake and mitochondrial respiration in conditions, where sustained mitochondrial damage determines progressive neuronal death.

Minority game with SK interactions

International Nuclear Information System (INIS)

Menezes, Pedro Castro; Sherrington, David

2013-01-01

A batch minority game with fake random history and additional SK-like quenched interaction is introduced and analysed. A mixing parameter λ quantifies the admixture and dictates the relative dominance of the two contributions: if λ → 0, agent decisions are based on their strategies and point-scores alone, as in the pure minority game, whereas for λ > 0 the agents also communicate with each other directly and update their points accordingly. Keeping the minority game dynamics in which the agents’ points are updated in parallel at each time step, the aim is to understand what happens if instead of simply using the normal strategy-based decisions, the agents also take account of an ‘effective field’ generated by the other agents. It is shown that the SK interaction introduces a ‘noise’ term which is broader than that in the normal minority game and which furthermore kills the normal phase transition. It is also shown that the same effect would occur if, instead of an SK interaction, Gaussian-distributed quenched random fields are added. By calculating order parameters in the time-translational invariant phase we show that the system is persistent in a ergodic phase. Both simulational and analytical results are presented. (paper)

Thermostable L-arabinose isomerase from Bacillus stearothermophilus IAM 11001 for D-tagatose production: gene cloning, purification and characterisation.

Science.gov (United States)

Cheng, Lifang; Mu, Wanmeng; Jiang, Bo

2010-06-01

D-Tagatose, as one of the rare sugars, has been found to be a natural and safe low-calorie sweetener in food products and is classified as a GRAS substance. L-Arabinose isomerase (L-AI, EC 5.3.1.4), catalysing the isomerisations of L-arabinose and D-galactose to L-ribulose and D-tagatose respectively, is considered to be the most promising enzyme for the production of D-tagatose. The araA gene encoding an L-AI from Bacillus stearothermophilus IAM 11001 was cloned, sequenced and overexpressed in Escherichia coli. The gene is composed of 1491 bp nucleotides and codes for a protein of 496 amino acid residues. The recombinant L-AI was purified to electrophoretical homogeneity by affinity chromatography. The purified enzyme was optimally active at 65 degrees C and pH 7.5 and had an absolute requirement for the divalent metal ion Mn(2+) for both catalytic activity and thermostability. The enzyme was relatively active and stable at acidic pH of 6. The bioconversion yield of D-galactose to D-tagatose by the purified L-AI after 12 h at 65 degrees C reached 36%. The purified L-AI from B. stearothermophilus IAM 11001 was characterised and shown to be a good candidate for potential application in D-tagatose production. Copyright (c) 2010 Society of Chemical Industry.

Kun tabere kigger på skærmen

DEFF Research Database (Denmark)

Meier Sørensen, Bent

2017-01-01

Enhver, der har prøvet at tage en telefon fra et barn, ved, hvordan det må have været for Frodo at forsøge at fravriste Gollum ringen i " Ringenes Herre". Smartphones og andre skærme er blevet børns og alle andres " Precious", som Gollum kalder ringen. Vi rører mere ved skærme, end vi rører ved...

Coupling of SK channels, L-type Ca2+ channels, and ryanodine receptors in cardiomyocytes.

Science.gov (United States)

Zhang, Xiao-Dong; Coulibaly, Zana A; Chen, Wei Chun; Ledford, Hannah A; Lee, Jeong Han; Sirish, Padmini; Dai, Gu; Jian, Zhong; Chuang, Frank; Brust-Mascher, Ingrid; Yamoah, Ebenezer N; Chen-Izu, Ye; Izu, Leighton T; Chiamvimonvat, Nipavan

2018-03-16

Small-conductance Ca 2+ -activated K + (SK) channels regulate the excitability of cardiomyocytes by integrating intracellular Ca 2+ and membrane potentials on a beat-to-beat basis. The inextricable interplay between activation of SK channels and Ca 2+ dynamics suggests the pathology of one begets another. Yet, the exact mechanistic underpinning for the activation of cardiac SK channels remains unaddressed. Here, we investigated the intracellular Ca 2+ microdomains necessary for SK channel activation. SK currents coupled with Ca 2+ influx via L-type Ca 2+ channels (LTCCs) continued to be elicited after application of caffeine, ryanodine or thapsigargin to deplete SR Ca 2+ store, suggesting that LTCCs provide the immediate Ca 2+ microdomain for the activation of SK channels in cardiomyocytes. Super-resolution imaging of SK2, Ca v 1.2 Ca 2+ channel, and ryanodine receptor 2 (RyR2) was performed to quantify the nearest neighbor distances (NND) and localized the three molecules within hundreds of nanometers. The distribution of NND between SK2 and RyR2 as well as SK2 and Ca v 1.2 was bimodal, suggesting a spatial relationship between the channels. The activation mechanism revealed by our study paved the way for the understanding of the roles of SK channels on the feedback mechanism to regulate the activities of LTCCs and RyR2 to influence local and global Ca 2+ signaling.

Pharmacokinetic/Toxicity Properties of the New Anti-Staphylococcal Lead Compound SK-03-92

Directory of Open Access Journals (Sweden)

William R. Schwan

2015-11-01

Full Text Available Because of the potential of a new anti-staphylococcal lead compound SK-03-92 as a topical antibiotic, a patch, or an orally active drug, we sought to determine its safety profile and oral bioavailability. SK-03-92 had a high IC50 (125 μg/mL in vitro against several mammalian cell lines, and mice injected intraperiteonally at the highest dose did not exhibit gross toxicity (e.g., altered gait, ungroomed, significant weight loss. Single dose (100 μg/g pharmacokinetic (PK analysis with formulated SK-03-92 showed that peak plasma concentration (1.64 μg/mL was achieved at 20–30 min. Oral relative bioavailability was 8%, and the drug half-life was 20–30 min, demonstrating that SK-03-92 is likely not a candidate for oral delivery. Five-day and two-week PK analyses demonstrated that SK-03-92 plasma levels were low. Multi-dose analysis showed no gross adverse effects to the mice and a SK-03-92 peak plasma concentration of 2.12 μg/mL with the presence of significant concentrations of breakdown products 15 min after dosing. SK-03-92 appeared to be very safe based on tissue culture and mouse gross toxicity determinations, but the peak plasma concentration suggests that a pro-drug of SK-03-92 or preparation of analogs of SK-03-92 with greater bioavailability and longer half-lives are warranted.

Selective activation of heteromeric SK channels contributes to action potential repolarization in mouse atrial myocytes.

Science.gov (United States)

Hancock, Jane M; Weatherall, Kate L; Choisy, Stéphanie C; James, Andrew F; Hancox, Jules C; Marrion, Neil V

2015-05-01

Activation of small conductance calcium-activated potassium (SK) channels is proposed to contribute to repolarization of the action potential in atrial myocytes. This role is controversial, as these cardiac SK channels appear to exhibit an uncharacteristic pharmacology. The objectives of this study were to resolve whether activation of SK channels contributes to atrial action potential repolarization and to determine the likely subunit composition of the channel. The effect of 2 SK channel inhibitors was assessed on outward current evoked in voltage clamp and on action potential duration in perforated patch and whole-cell current clamp recording from acutely isolated mouse atrial myocytes. The presence of SK channel subunits was assessed using immunocytochemistry. A significant component of outward current was reduced by the SK channel blockers apamin and UCL1684. Block by apamin displayed a sensitivity indicating that this current was carried by homomeric SK2 channels. Action potential duration was significantly prolonged by UCL1684, but not by apamin. This effect was accompanied by an increase in beat-to-beat variability and action potential triangulation. This pharmacology was matched by that of expressed heteromeric SK2-SK3 channels in HEK293 cells. Immunocytochemistry showed that atrial myocytes express both SK2 and SK3 channels with an overlapping expression pattern. Only proposed heteromeric SK2-SK3 channels are physiologically activated to contribute to action potential repolarization, which is indicated by the difference in pharmacology of evoked outward current and prolongation of atrial action potential duration. The effect of blocking this channel on the action potential suggests that SK channel inhibition during cardiac function has the potential to be proarrhythmic. Copyright © 2015 Heart Rhythm Society. Published by Elsevier Inc. All rights reserved.

Mitochondria-targeted antioxidant SkQ1 improves impaired dermal wound healing in old mice.

Science.gov (United States)

Demyanenko, Ilya A; Popova, Ekaterina N; Zakharova, Vlada V; Ilyinskaya, Olga P; Vasilieva, Tamara V; Romashchenko, Valeria P; Fedorov, Artem V; Manskikh, Vasily N; Skulachev, Maxim V; Zinovkin, Roman A; Pletjushkina, Olga Yu; Skulachev, Vladimir P; Chernyak, Boris V

2015-07-01

The process of skin wound healing is delayed or impaired in aging animals. To investigate the possible role of mitochondrial reactive oxygen species (mtROS) in cutaneous wound healing of aged mice, we have applied the mitochondria-targeted antioxidant SkQ1. The SkQ1 treatment resulted in accelerated resolution of the inflammatory phase, formation of granulation tissue, vascularization and epithelization of the wounds. The wounds of SkQ1-treated mice contained increased amount of myofibroblasts which produce extracellular matrix proteins and growth factors mediating granulation tissue formation. This effect resembled SkQ1-induced differentiation of fibroblasts to myofibroblast, observed earlierin vitro. The Transforming Growth Factor beta (TGFb) produced by SkQ1-treated fibroblasts was found to stimulated motility of endothelial cells in vitro, an effect which may underlie pro-angiogenic action of SkQ1 in the wounds. In vitro experiments showed that SkQ1 prevented decomposition of VE-cadherin containing contacts and following increase in permeability of endothelial cells monolayer, induced by pro-inflammatory cytokine TNF. Prevention of excessive reaction of endothelium to the pro-inflammatory cytokine(s) might account for anti-inflammatory effect of SkQ1. Our findings point to an important role of mtROS in pathogenesis of age-related chronic wounds.

The SK3 channel promotes placental vascularization by enhancing secretion of angiogenic factors.

Science.gov (United States)

Rada, Cara C; Murray, Grace; England, Sarah K

2014-11-15

Proper placental perfusion is essential for fetal exchange of oxygen, nutrients, and waste with the maternal circulation. Impairment of uteroplacental vascular function can lead to pregnancy complications, including preeclampsia and intrauterine growth restriction (IUGR). Potassium channels have been recognized as regulators of vascular proliferation, angiogenesis, and secretion of vasoactive factors, and their dysfunction may underlie pregnancy-related vascular diseases. Overexpression of one channel in particular, the small-conductance calcium-activated potassium channel 3 (SK3), is known to increase vascularization in mice, and mice overexpressing the SK3 channel (SK3(T/T) mice) have a high rate of fetal demise and IUGR. Here, we show that overexpression of SK3 causes fetal loss through abnormal placental vascularization. We previously reported that, at pregnancy day 14, placentas isolated from SK3(T/T) mice are smaller than those obtained from wild-type mice. In this study, histological analysis reveals that SK3(T/-) placentas at this stage have abnormal placental morphology, and microcomputed tomography shows that these placentas have significantly larger and more blood vessels than those from wild-type mice. To identify the mechanism by which these vascularization defects occur, we measured levels of vascular endothelial growth factor (VEGF), placental growth factor, and the soluble form of VEGF receptor 1 (sFlt-1), which must be tightly regulated to ensure proper placental development. Our data reveal that overexpression of SK3 alters systemic and placental ratios of the angiogenic factor VEGF to antiangiogenic factor sFlt-1 throughout pregnancy. Additionally, we observe increased expression of hypoxia-inducing factor 2α in SK3(T/-) placentas. We conclude that the SK3 channel modulates placental vascular development and fetal health by altering VEGF signaling. Copyright © 2014 the American Physiological Society.

SK2 channels regulate mitochondrial respiration and mitochondrial Ca2+ uptake

NARCIS (Netherlands)

Honrath, Birgit; Matschke, Lina; Meyer, Tammo; Magerhans, Lena; Perocchi, Fabiana; Ganjam, Goutham K; Zischka, Hans; Krasel, Cornelius; Gerding, Albert; Bakker, Barbara M; Bünemann, Moritz; Strack, Stefan; Decher, Niels; Culmsee, Carsten; Dolga, Amalia M

Mitochondrial calcium ([Ca(2+)]m) overload and changes in mitochondrial metabolism are key players in neuronal death. Small conductance calcium-activated potassium (SK) channels provide protection in different paradigms of neuronal cell death. Recently, SK channels were identified at the inner

Hepatoma SK Hep-1 cells exhibit characteristics of oncogenic mesenchymal stem cells with highly metastatic capacity.

Directory of Open Access Journals (Sweden)

Jong Ryeol Eun

Full Text Available SK Hep-1 cells (SK cells derived from a patient with liver adenocarcinoma have been considered a human hepatoma cell line with mesenchymal origin characteristics, however, SK cells do not express liver genes and exhibit liver function, thus, we hypothesized whether mesenchymal cells might contribute to human liver primary cancers. Here, we characterized SK cells and its tumourigenicity.We found that classical mesenchymal stem cell (MSC markers were presented on SK cells, but endothelial marker CD31, hematopoietic markers CD34 and CD45 were negative. SK cells are capable of differentiate into adipocytes and osteoblasts as adipose-derived MSC (Ad-MSC and bone marrow-derived MSC (BM-MSC do. Importantly, a single SK cell exhibited a substantial tumourigenicity and metastatic capacity in immunodefficient mice. Metastasis not only occurred in circulating organs such as lung, liver, and kidneys, but also in muscle, outer abdomen, and skin. SK cells presented greater in vitro invasive capacity than those of Ad-MSC and BM-MSC. The xenograft cells from subcutaneous and metastatic tumors exhibited a similar tumourigenicity and metastatic capacity, and showed the same relatively homogenous population with MSC characteristics when compared to parental SK cells. SK cells could unlimitedly expand in vitro without losing MSC characteristics, its tumuorigenicity and metastatic capacity, indicating that SK cells are oncogenic MSC with enhanced self-renewal capacity. We believe that this is the first report that human MSC appear to be transformed into cancer stem cells (CSC, and that their derivatives also function as CSCs.Our findings demonstrate that SK cells represent a transformation mechanism of normal MSC into an enhanced self-renewal CSC with metastasis capacity, SK cells and their xenografts represent a same relative homogeneity of CSC with substantial metastatic capacity. Thus, it represents a novel mechanism of tumor initiation, development and

Subtype-specific, bi-component inhibition of SK channels by low internal pH

DEFF Research Database (Denmark)

Peitersen, Torben; Jespersen, Thomas; Jorgensen, Nanna K

2006-01-01

The effects of low intracellular pH (pH(i) 6.4) on cloned small-conductance Ca2+-activated K+ channel currents of all three subtypes (SK1, SK2, and SK3) were investigated in HEK293 cells using the patch-clamp technique. In 400 nM internal Ca2+ [Ca2+]i, all subtypes were inhibited by pH(i) 6...

The solar kettle-thermos flask (SK-TF) and solar vacuum tube oven

Energy Technology Data Exchange (ETDEWEB)

Yak, Alex Kee Koo [AkayConsult Enterprise, Johor Bahru (Malaysia)

2008-07-01

The Solar Kettle-Thermos Flask (SK-TF) and Solar Vacuum Tube Oven (SaVeTao): A Cost Effective, Sustainable and Renewable Water Pasteurization and Food Processing System For The Developing World. Based on the perfect solar thermal energy harvesting paradigm of maximum solar radiation absorption and minimum loss of stored converted solar thermal energy, Solar Vacuum Glass Tubes (SVGT) indefinitely delivers solar pasteurized safe drinking water, powered solely by free solar energy. The SVGT is the heart of the SK-TF. Being vacuum insulated, the SK-TF doubles up as a vacuum flask, delivering stored solar heated water in the morning before the Sun is up. With a high stagnation temperature of more than 200 C, the SK-TF can also be used for other heating purposes e.g. an oven or autoclave. Powered solely by free solar energy, the SK-TF and SaVeTaO could very well be the answer in providing safe solar pasteurized drinking water and cooking to the global poor and needy in a sustainable and renewable way. (orig.)

Distribution, expression and functional effects of small conductance Ca-activated potassium (SK) channels in rat myometrium.

Science.gov (United States)

Noble, Karen; Floyd, Rachel; Shmygol, Andre; Shmygol, Anatoly; Mobasheri, A; Wray, Susan

2010-01-01

Calcium-activated potassium channels are important in a variety of smooth muscles, contributing to excitability and contractility. In the myometrium previous work has focussed on the large conductance channels (BK), and the role of small conductance channels (SK) has received scant attention, despite the finding that over-expression of an SK channel isoform (SK3) results in uterine dysfunction and delayed parturition. This study therefore characterises the expression of the three SK channel isoforms (SK1-3) in rat myometrium throughout pregnancy and investigates their effect on cytosolic [Ca] and force and compares this with that of BK channels. Consistent expression of all SK isoform transcripts and clear immunostaining of SK1-3 was found. Inhibition of SK1-3 channels (apamin, scyllatoxin) significantly inhibited outward current, caused membrane depolarisation and elicited action potentials in previously quiescent cells. Apamin or scyllatoxin increased the amplitude of [Ca] and force in spontaneously contracting myometrial strips throughout gestation. The functional effect of SK inhibition was larger than that of BK channel inhibition. Thus we show for the first time that SK1-3 channels are expressed and translated throughout pregnancy and contribute to outward current, regulate membrane potential and hence Ca signals in pregnant rat myometrium. They contribute more to quiescence that BK channels. 2009 Elsevier Ltd. All rights reserved.

[Roles of KLF5 in inhibition TNFα-induced SK-BR-3 breast cancer cell apoptosis].

Science.gov (United States)

Shi, Jianhong; Liu, Caiyun; Zhang, Anyi; Cui, Naipeng; Wang, Bing; Chen, Baoping; Ma, Zhenfeng

2014-07-08

To explore the expression levels and roles of Krüpple-like factor 5 (KLF5) in tumor necrosis factor α (TNFα)-induced SK-BR-3 breast cancer cells. SK-BR-3 breast cancer cells were stimulated by TNFα at different concentrations (0, 1, 5, 10, 20 µg/L) for specified durations (0, 6, 12, 24, 36 h). Western blot was performed to detect KLF5 protein levels. Then Western blot and quantitative real-time PCR (qRT-PCR) were used to detect the expression levels of apoptosis genes. Flow cytometry and qRT-PCR were used to observe the effects of exogenous KLF5 on TNFα-induced apoptosis of SK-BR-3 breast cancer cell. KLF5 expression levels significantly decreased in TNFα-stimulated SK-BR-3 breast cancer cells in a concentration- and time-dependent manner. Quantitative RT-PCR results showed that TNFα up-regulate apoptosis gene caspase 3, caspase 9 and bax expression levels and down-regulate bcl-1 level in SK-BR-3 cells. Adenovirus expression vectors of pAd-GFP and pAd-GFP-KLF5 were constructed and used to infect SK-BR-3 breast cancer cells. Over-expression of GFP-KLF5 inhibited apoptosis in TNFα-stimulated SK-BR-3 breast cancer cells. TNFα reduces KLF5 expression in SK-BR-3 breast cancer cells and KLF5 participates in TNFα-induced SK-BR-3 cell apoptosis.

Spent fuel composition database system on WWW. SFCOMPO on WWW Ver.2

International Nuclear Information System (INIS)

Mochizuki, Hiroki; Suyama, Kenya; Nomura, Yasushi; Okuno, Hiroshi

2001-08-01

'SFCOMPO on WWW Ver.2' is an advanced version of 'SFCOMPO on WWW (Spent Fuel Composition Database System on WWW' released in 1997. This new version has a function of database management by an introduced relational database software 'PostgreSQL' and has various searching methods. All of the data required for the calculation of isotopic composition is available from the web site of this system. This report describes the outline of this system and the searching method using Internet. In addition, the isotopic composition data and the reactor data of the 14 LWRs (7 PWR and 7 BWR) registered in this system are described. (author)

Pharmacokinetics of the vasopressin antagonist, SK and F 101926, a synthetic octapeptide, in the rat

International Nuclear Information System (INIS)

Lynn, R.K.; Straub, K.M.; Landvatter, S.W.; Garvie, C.T.

1986-01-01

SK and F 101926 is a synthetic analogue of vasopressin which antagonizes vasopressin induced antidiuresis. Radiolabeled SK and F 101926 ( 3 H-3,3-D-TYR) was administered i.v. as a single bolus to male Sprague Dawley rats. Serial plasma samples were analyzed for SK and F 101926 by HPLC/LSC. The plasma concentration time curve for SK and F 101926 displayed three disposition phases. However, 80% of the total area under the curve was represented in one phase which displayed a half-life (t 1/2) of 20 min. The total systematic clearance (Cl) and the steady state volume of distribution (Vdss) were 15 ml/min/kg and 450 ml/kg, respectively. The t 1/2, Cl and Vdss were identical following doses of 10 and 100 μg/kg. 3 H-SK and F 101926 accounted for > 80% of the plasma radiolabel 0-30 min after dosing. However, by 12 hr, 3 H-SK and F 101926 represented only 6% of the plasma radiolabel. Following oral administration of 3 H-SK and F 101926, < 5% of the administered radiolabel reached the systematic circulation; however, no parent compound was detectable in plasma. These studies demonstrate that although SK and F 101926 has a relatively low systematic clearance, it also displays a relatively small volume of distribution which together result in a moderate beta elimination half-life

NS309 decreases rat detrusor smooth muscle membrane potential and phasic contractions by activating SK3 channels

Science.gov (United States)

Parajuli, Shankar P; Hristov, Kiril L; Soder, Rupal P; Kellett, Whitney F; Petkov, Georgi V

2013-01-01

Background and Purpose Overactive bladder (OAB) is often associated with abnormally increased detrusor smooth muscle (DSM) contractions. We used NS309, a selective and potent opener of the small or intermediate conductance Ca2+-activated K+ (SK or IK, respectively) channels, to evaluate how SK/IK channel activation modulates DSM function. Experimental Approach We employed single-cell RT-PCR, immunocytochemistry, whole cell patch-clamp in freshly isolated rat DSM cells and isometric tension recordings of isolated DSM strips to explore how the pharmacological activation of SK/IK channels with NS309 modulates DSM function. Key Results We detected SK3 but not SK1, SK2 or IK channels expression at both mRNA and protein levels by RT-PCR and immunocytochemistry in DSM single cells. NS309 (10 μM) significantly increased the whole cell SK currents and hyperpolarized DSM cell resting membrane potential. The NS309 hyperpolarizing effect was blocked by apamin, a selective SK channel inhibitor. NS309 inhibited the spontaneous phasic contraction amplitude, force, frequency, duration and tone of isolated DSM strips in a concentration-dependent manner. The inhibitory effect of NS309 on spontaneous phasic contractions was blocked by apamin but not by TRAM-34, indicating no functional role of the IK channels in rat DSM. NS309 also significantly inhibited the pharmacologically and electrical field stimulation-induced DSM contractions. Conclusions and Implications Our data reveal that SK3 channel is the main SK/IK subtype in rat DSM. Pharmacological activation of SK3 channels with NS309 decreases rat DSM cell excitability and contractility, suggesting that SK3 channels might be potential therapeutic targets to control OAB associated with detrusor overactivity. PMID:23145946

Spent fuel composition database system on WWW. SFCOMPO on WWW Ver.2

Energy Technology Data Exchange (ETDEWEB)

Mochizuki, Hiroki [Japan Research Institute, Ltd., Tokyo (Japan); Suyama, Kenya; Nomura, Yasushi; Okuno, Hiroshi [Japan Atomic Energy Research Inst., Tokai, Ibaraki (Japan). Tokai Research Establishment

2001-08-01

'SFCOMPO on WWW Ver.2' is an advanced version of 'SFCOMPO on WWW' ('Spent Fuel Composition Database System on WWW') released in 1997. This new version has a function of database management by an introduced relational database software 'PostgreSQL' and has various searching methods. All of the data required for the calculation of isotopic composition is available from the web site of this system. This report describes the outline of this system and the searching method using Internet. In addition, the isotopic composition data and the reactor data of the 14 LWRs (7 PWR and 7 BWR) registered in this system are described. (author)

Small-conductance calcium-activated potassium (SK) channels contribute to action potential repolarization in human atria

DEFF Research Database (Denmark)

Skibsbye, Lasse; Poulet, Claire; Diness, Jonas Goldin

2014-01-01

(+) currents by ∼15% and prolonged action potential duration (APD), but no effect was observed in myocytes from AF patients. In trabeculae muscle strips from right atrial appendages of SR patients, both compounds increased APD and effective refractory period, and depolarized the resting membrane potential......, while only NS8593 induced these effects in tissue from AF patients. SK channel inhibition did not alter any electrophysiological parameter in human interventricular septum tissue. CONCLUSIONS: SK channels are present in human atria where they participate in repolarization. SK2 and SK3 were down...

Contribution of Somatic and Dendritic SK Channels in the Firing Rate of Deep Cerebellar Nuclei: Implication in Cerebellar Ataxia

Directory of Open Access Journals (Sweden)

Samira Abbasi

2016-01-01

Discussion: Therefore, inhibition of SK channel in DCN can cause cerebellar ataxia, and SK channel openers can have a therapeutic effect on cerebellar ataxia. In addition, the location of SK channels could be important in therapeutic goals. Dendritic SK channels can be a more effective target compared to somatic SK channels

Characterization of CD4 and CD8 T Cell Responses in MuSK Myasthenia Gravis

Science.gov (United States)

Yi, JS; Guidon, A; Sparks, S; Osborne, R; Juel, VC; Massey, JM; Sanders, DB; Weinhold, KJ; Guptill, JT

2014-01-01

Muscle specific tyrosine kinase myasthenia gravis (MuSK MG) is a form of autoimmune MG that predominantly affects women and has unique clinical features, including prominent bulbar weakness, muscle atrophy, and excellent response to therapeutic plasma exchange. Patients with MuSK MG have predominantly IgG4 autoantibodies directed against MuSK on the postsynaptic muscle membrane. Lymphocyte functionality has not been reported in this condition. The goal of this study was to characterize T-cell responses in patients with MuSK MG. Intracellular production of IFN-gamma, TNF-alpha, IL-2, IL-17, and IL-21 by CD4+ and CD8+ T-cells was measured by polychromatic flow cytometry in peripheral blood samples from 11 Musk MG patients and 10 healthy controls. Only one MuSK MG patient was not receiving immunosuppressive therapy. Regulatory T-cells (Treg) were also included in our analysis to determine if changes in T cell function were due to altered Treg frequencies. CD8+ T-cells from MuSK MG patients had higher frequencies of polyfunctional responses than controls, and CD4+ T-cells had higher IL-2, TNF-alpha, and IL-17. MuSK MG patients had a higher percentage of CD4+ T-cells producing combinations of IFN-gamma/IL-2/TNF-gamma, TNF-alpha/IL-2, and IFN-gamma/TNF-alpha. Interestingly, Treg numbers and CD39 expression were not different from control values. MuSK MG patients had increased frequencies of Th1 and Th17 cytokines and were primed for polyfunctional proinflammatory responses that cannot be explained by a defect in Treg function or number. PMID:24378287

Infantile Onset Myasthenia Gravis with MuSK Antibodies

Directory of Open Access Journals (Sweden)

J Gordon Millichap

2006-08-01

Full Text Available A late infantile case of myasthenia gravis (MG with anti-muscle-specific receptor tyrosine kinase (MuSK high antibody (Ab titer is reported from Kyushu University, Fukuoka; and Nagasaki University, Japan.

WWW chart of the nuclides

International Nuclear Information System (INIS)

Huang Xiaolong; Zhou Chunmei; Zhuang Youxiang; Zhao Zhixiang; Golashvili, T.V.; Chechev, V.P.

2000-01-01

WWW chart of the nuclides was established on the basis of the latest evaluations of nuclear structure and decay data. By viewing WWW chart of the nuclides, one can retrieve the fundamental data of nuclide such as atomic mass, abundance, spin and parity; the decay mode, branching ratio, half-life and Q-value of radioactive nuclide, energy and intensity of strong γ-ray, etc. The URL (Uniform Resource Locator) of WWW chart of the nuclides is: http://myhome.py.gd.cn/chart/index,asp

Protective roles for potassium SK/KCa2 channels in microglia and neurons

Directory of Open Access Journals (Sweden)

Amalia M Dolga

2012-11-01

Full Text Available New concepts on potassium channel function in neuroinflammation suggest that they regulate mechanisms of microglial activation, including intracellular calcium homeostasis, morphological alterations, pro-inflammatory cytokine release, antigen presentation, and phagocytosis. Although little is known about voltage independent potassium channels in microglia, special attention emerges on small (SK/KCNN1-3/KCa2 and intermediate (IK/KCNN4/KCa3.1-conductance calcium-activated potassium channels as regulators of microglial activation in the field of research on neuroinflammation and neurodegeneration. In particular, recent findings suggested that SK/KCa2 channels, by regulating calcium homeostasis, may elicit a dual mechanism of action with protective properties in neurons and inhibition of inflammatory responses in microglia. Thus, modulating SK/KCa2 channels and calcium signaling may provide novel therapeutic strategies in neurological disorders, where neuronal cell death and inflammatory responses concomitantly contribute to disease progression. Here, we review the particular role of SK/KCa2 channels for [Ca2+]i regulation in microglia and neurons, and we discuss the potential impact for further experimental approaches addressing novel therapeutic strategies in neurological diseases, where neuronal cell death and neuroinflammatory processes are prominent.

Development of norepinephrine transporter reuptake inhibition assays using SK-N-BE(2C cells

Directory of Open Access Journals (Sweden)

Ann M. Decker

2018-05-01

Full Text Available This report describes efforts to develop and validate novel norepinephrine transporter reuptake inhibition assays using human neuroblastoma SK-N-BE(2C cells in 24-well format. Before conducting the assays, the SK-N-BE(2C cells were first evaluated for their ability to uptake [3H]norepinephrine and were shown to have a saturable uptake with a KM value of 416 nM. Using this determined KM value, reuptake inhibition assays were then conducted with a variety of ligands including antidepressants, as well as piperazine and phenyltropane derivatives. The results obtained with the SK-N-BE(2C cells indicate that this model system can detect a range of ligand potencies, which compare well with other established transporter assays. Our data suggest that SK-N-BE(2C cells have potential utility to serve as another model system to detect norepinephrine reuptake inhibition activity.

S.K. De Datta receives Clifton Garvin Fellowship

OpenAIRE

Felker, Susan B.

2004-01-01

S.K. De Datta, of Blacksburg, associate provost for international affairs at Virginia Tech, received the university's Clifton Garvin Fellowship Award. The award was conferred by the Virginia Tech Board of Visitors at its quarterly meeting Monday, Nov. 8.

Pomegranate inhibits neuroinflammation and amyloidogenesis in IL-1β-stimulated SK-N-SH cells.

Science.gov (United States)

Velagapudi, Ravikanth; Baco, Gina; Khela, Sunjeet; Okorji, Uchechukwu; Olajide, Olumayokun

2016-06-01

Pomegranate fruit, Punica granatum L. (Punicaceae), and its constituents have been shown to inhibit inflammation. In this study, we aimed to assess the effects of freeze-dried pomegranate (PWE) on PGE2 production in IL-1β-stimulated SK-N-SH cells. An enzyme immunoassay (EIA) was used to measure prostaglandin E2 (PGE2) production from supernatants of IL-1β-stimulated SK-N-SH cells. Expression of COX-2, phospho-IκB, and phospho-IKK proteins was evaluated, while NF-κB reporter gene assay was carried out in TNFα-stimulated HEK293 cells to determine the effect of PWE on NF-κB transactivation. Levels of BACE-1 and Aβ in SK-N-SH cells stimulated with IL-1β were measured with an in cell ELISA. PWE (25-200 μg/ml) dose dependently reduced COX-2-dependent PGE2 production in SK-N-SH cells stimulated with IL-1β. Phosphorylation of IκB and IKK was significantly (p pomegranate inhibits inflammation, as well as amyloidogenesis in IL-1β-stimulated SK-N-SH cells. We propose that pomegranate is a potential nutritional strategy in slowing the progression of neurodegenerative disorders such as Alzheimer's disease.

The 7SK snRNP associates with the little elongation complex to promote snRNA gene expression.

Science.gov (United States)

Egloff, Sylvain; Vitali, Patrice; Tellier, Michael; Raffel, Raoul; Murphy, Shona; Kiss, Tamás

2017-04-03

The 7SK small nuclear RNP (snRNP), composed of the 7SK small nuclear RNA (snRNA), MePCE, and Larp7, regulates the mRNA elongation capacity of RNA polymerase II (RNAPII) through controlling the nuclear activity of positive transcription elongation factor b (P-TEFb). Here, we demonstrate that the human 7SK snRNP also functions as a canonical transcription factor that, in collaboration with the little elongation complex (LEC) comprising ELL, Ice1, Ice2, and ZC3H8, promotes transcription of RNAPII-specific spliceosomal snRNA and small nucleolar RNA (snoRNA) genes. The 7SK snRNA specifically associates with a fraction of RNAPII hyperphosphorylated at Ser5 and Ser7, which is a hallmark of RNAPII engaged in snRNA synthesis. Chromatin immunoprecipitation (ChIP) and chromatin isolation by RNA purification (ChIRP) experiments revealed enrichments for all components of the 7SK snRNP on RNAPII-specific sn/snoRNA genes. Depletion of 7SK snRNA or Larp7 disrupts LEC integrity, inhibits RNAPII recruitment to RNAPII-specific sn/snoRNA genes, and reduces nascent snRNA and snoRNA synthesis. Thus, through controlling both mRNA elongation and sn/snoRNA synthesis, the 7SK snRNP is a key regulator of nuclear RNA production by RNAPII. © 2017 The Authors.

Pozytywizm, racjonalizm i... romantyzm Marii Skłodowskiej-Curie

Directory of Open Access Journals (Sweden)

Barbara Petelenz

2015-12-01

Full Text Available The International Year of Chemistry (2011, intertwined with commemoration of the Nobel Prize in Chemistry awarded in 1911 to Marie Skłodowska-Curie, made me to ask about the philosophical background of this outstanding woman. The first factor which I could see was the positivism, launched by August Comte in France and developed a few decades later by his Polish followers. Another factor which seemed to me important was the interplay between the emotional (romantic and intellectual (positivistic attitudes among the Poles in the 19th century. In her research, Marie Skłodowska-Curie used the positivistic, rationalistic method. This has led her (jointly with her husband Pierre Curie to elucidation of the radiation phenomena discovered by Henri Becquerel in 1896. The research initiated by the Curies (rewarded by the half of the Nobel Prize in Physics 1903 caused a subversion of the 19th century’s views on the structure of Matter. The way to such spectacular results must have been paved not only by the positivistic intellectual discipline but also by a dose of romantic enchantment. In the applicative terms, Marie Skłodowska-Curie became a pioneer of the evidence-based medicine. In moral terms, she represented a rare example of the practical altruism, inspired indirectly by Christianity, and directly by the Comte’s “religion of Humanity”.

Reversal of methylation silencing of Apo2L/TRAIL receptor 1 (DR4) expression overcomes resistance of SK-MEL-3 and SK-MEL-28 melanoma cells to interferons (IFNs) or Apo2L/TRAIL.

Science.gov (United States)

Bae, S I; Cheriyath, V; Jacobs, B S; Reu, F J; Borden, E C

2008-01-17

Human melanoma cell lines, SK-MEL-3 and SK-MEL-28, despite induction of the proapoptotic cytokine, Apo2L/TRAIL, did not undergo apoptosis in response to interferons (IFN-alpha2b or IFN-beta). Postulating that genes important for apoptosis induction by IFNs might be silenced by methylation, the DNA demethylating agent 5-aza-2'-deoxycytidine (5-AZAdC) was assessed. DR4 (TRAIL-R1) was identified as one of the genes reactivated by 5-AZAdC with a >3-fold increase in 8 of 10 melanoma cell lines. Pretreatment with 5-AZAdC sensitized SK-MEL-3 and SK-MEL-28 cells to apoptosis induced by IFN-alpha2b and IFN-beta; methylation-specific PCR and bisulfite sequencing confirmed demethylation of 5'CpG islands of DR4 and flow cytometry showed an increase in DR4 protein on the cell surface. In cells with reactivated DR4, neutralizing mAB to TRAIL reduced apoptosis in response to IFN-beta or Apo2L/TRAIL. To further confirm the role of DR4, it was expressed by retroviral vector in SK-MEL-3 and SK-MEL-28 cells with reversal of resistance to IFN-beta and Apo2L/TRAIL. Thus, reexpressing DR4 by 5-AZAdC or retroviral transfection in melanoma cell in which promoter methylation had suppressed its expression, potentiated apoptosis by IFN-alpha2b, IFN-beta and Apo2L/TRAIL. Reactivation of silenced proapoptotic genes by inhibitors of DNA methylation may enhance clinical response to IFNs or Apo2L/TRAIL.

Differential Cytokine Changes in Patients with Myasthenia Gravis with Antibodies against AChR and MuSK.

Directory of Open Access Journals (Sweden)

Vuslat Yilmaz

Full Text Available Neuromuscular transmission failure in myasthenia gravis (MG is most commonly elicited by autoantibodies (ab to the acetylcholine receptor or the muscle-specific kinase, constituting AChR-MG and MuSK-MG. It is controversial whether these MG subtypes arise through different T helper (Th 1, Th2 or Th17 polarized immune reactions and how these reactions are blunted by immunosuppression. To address these questions, plasma levels of cytokines related to various Th subtypes were determined in patients with AChR-MG, MuSK-MG and healthy controls (CON. Peripheral blood mononuclear cells (PBMC were activated in vitro by anti-CD3, and cytokines were quantified in supernatants. In purified blood CD4+ T cells, RNA of various cytokines, Th subtype specific transcription factors and the co-stimulatory molecule, CD40L, were quantified by qRT-PCR. Plasma levels of Th1, Th2 and Th17 related cytokines were overall not significantly different between MG subtypes and CON. By contrast, in vitro stimulated PBMC from MuSK-MG but not AChR-MG patients showed significantly increased secretion of the Th1, Th17 and T follicular helper cell related cytokines, IFN-γ, IL-17A and IL-21. Stimulated expression of IL-4, IL-6, IL-10 and IL-13 was not significantly different. At the RNA level, expression of CD40L by CD4+ T cells was reduced in both AChR-MG and MuSK-MG patients while expression of Th subset related cytokines and transcription factors were normal. Immunosuppression treatment had two effects: First, it reduced levels of IL12p40 in the plasma of AChR-MG and MuSK-MG patients, leaving other cytokine levels unchanged; second, it reduced spontaneous secretion of IFN-γ and increased secretion of IL-6 and IL-10 by cultured PBMC from AChR-MG, but not MuSK-MG patients. We conclude that Th1 and Th17 immune reactions play a role in MuSK-MG. Immunosuppression attenuates the Th1 response in AChR-MG and MuSK-MG, but otherwise modulates immune responses in AChR-MG and MuSK

Global features of the Alcanivorax borkumensis SK2 genome

DEFF Research Database (Denmark)

Reva, Oleg N.; Hallin, Peter Fischer; Willenbrock, Hanni

2008-01-01

The global feature of the completely sequenced Alcanivorax borkumensis SK2 type strain chromosome is its symmetry and homogeneity. The origin and terminus of replication are located opposite to each other in the chromosome and are discerned with high signal to noise ratios by maximal oligonucleot......The global feature of the completely sequenced Alcanivorax borkumensis SK2 type strain chromosome is its symmetry and homogeneity. The origin and terminus of replication are located opposite to each other in the chromosome and are discerned with high signal to noise ratios by maximal...... oligonucleotide usage biases on the leading and lagging strand. Genomic DNA structure is rather uniform throughout the chromosome with respect to intrinsic curvature, position preference or base stacking energy. The orthologs and paralogs of A. borkumensis genes with the highest sequence homology were found...

Influence of source batch Sk dispersion on dosimetry for prostate cancer treatment with permanent implants

DEFF Research Database (Denmark)

Nunez-Cumplido, Eduardo; Perez-Calatayud, J; Casares-Magaz, O

2015-01-01

PURPOSE: In clinical practice, specific air kerma strength (SK) value is used in treatment planning system (TPS) permanent brachytherapy implant calculations with (125)I and (103)Pd sources; in fact, commercial TPS provide only one SK input value for all implanted sources and the certified shipment...

[Roles of Y box-binding protein 1 in SK-BR-3 breast cancer proliferation].

Science.gov (United States)

Shi, Jianhong; Lü, Xinrui; Wang, Bing; Daudan, Lin; Yanan, Wang; Yuhui, Bu; Zhenfeng, Ma

2014-09-30

To explore the roles of Y box-binding protein 1 (YB-1) in breast cancer cell proliferation. Twenty cases of surgical removal of breast cancer tissue (diagnosed with invasive ductal carcinoma, stage II, by postoperative paraffin pathology) and normal breast tissues adjacent to carcinoma were collected during June 2013 to August 2013.Quantitative real-time PCR (qRT-PCR) was performed to detect the YB1 mRNA levels. Cultured mammary epithelial cells (HBL-100) and breast cancer cells (MCF7, MDA-MB-231 & SK-BR-3 cells) were harvested and qRT-PCR was performed to detect the YB1 mRNA levels.SK-BR-3 cells were stimulated with various concentrations of PDGF-BB and YB1 expression levels were detected by qRT-PCR. Down-regulation or over-expression of YB1 by si-YB1 or Ad-GFP-YB1 was detected in SK-BR-3 cells. And MTS cell proliferation assay kit was used to detect cell proliferation. YB1 mRNA levels were significantly higher in breast cancer tissues and MDA-MB-231 and SK-BR-3 breast cancer cell lines than that in adjacent normal breast tissues and HBL-100 mammary epithelial cells respectively (P BR-3 cells in a dose-dependent manner. A down-regulation of endogenous YB1 decreases and an over-expression of exogenous YB1 promotes the proliferation activity in SK-BR-3 cells.

hnRNP R and its main interactor, the noncoding RNA 7SK, coregulate the axonal transcriptome of motoneurons.

Science.gov (United States)

Briese, Michael; Saal-Bauernschubert, Lena; Ji, Changhe; Moradi, Mehri; Ghanawi, Hanaa; Uhl, Michael; Appenzeller, Silke; Backofen, Rolf; Sendtner, Michael

2018-03-20

Disturbed RNA processing and subcellular transport contribute to the pathomechanisms of motoneuron diseases such as amyotrophic lateral sclerosis and spinal muscular atrophy. RNA-binding proteins are involved in these processes, but the mechanisms by which they regulate the subcellular diversity of transcriptomes, particularly in axons, are not understood. Heterogeneous nuclear ribonucleoprotein R (hnRNP R) interacts with several proteins involved in motoneuron diseases. It is located in axons of developing motoneurons, and its depletion causes defects in axon growth. Here, we used individual nucleotide-resolution cross-linking and immunoprecipitation (iCLIP) to determine the RNA interactome of hnRNP R in motoneurons. We identified ∼3,500 RNA targets, predominantly with functions in synaptic transmission and axon guidance. Among the RNA targets identified by iCLIP, the noncoding RNA 7SK was the top interactor of hnRNP R. We detected 7SK in the nucleus and also in the cytosol of motoneurons. In axons, 7SK localized in close proximity to hnRNP R, and depletion of hnRNP R reduced axonal 7SK. Furthermore, suppression of 7SK led to defective axon growth that was accompanied by axonal transcriptome alterations similar to those caused by hnRNP R depletion. Using a series of 7SK-deletion mutants, we show that the function of 7SK in axon elongation depends on its interaction with hnRNP R but not with the PTEF-B complex involved in transcriptional regulation. These results propose a role for 7SK as an essential interactor of hnRNP R to regulate its function in axon maintenance. Copyright © 2018 the Author(s). Published by PNAS.

Complete sequences of four plasmids of Lactococcus lactis subsp cremoris SK11 reveal extensive adaptation to the dairy environment

NARCIS (Netherlands)

Siezen, R.J.; Renckens, B.; Swam, van I.; Peters, S.; Kranenburg, van R.; Kleerebezem, M.; Vos, de W.M.

2005-01-01

Lactococcus lactis strains are known to carry plasmids encoding industrially important traits. L. lactis subsp. cremoris SK11 is widely used by the dairy industry in cheese making. Its complete plasmid complement was sequenced and found to contain the plasmids pSK11A (10,372 bp), pSK11B (13,332 bp),

Experimental analysis on frosting characteristic of SK-type finned refrigerating heat exchanger with large-diameter circular holes

International Nuclear Information System (INIS)

Fang, Zhao-song; Wang, Hou-hua; Zhang, Jie; Wu, Wei-wei

2014-01-01

This paper presents the construction of both a plane fin-and-tube heat exchanger and a SK-type fin-and-tube heat exchanger. Based on plane fin-and-tube heat exchanger, comparative industrial prototype experiments of SK-type fin-and-tube heat exchanger energy efficiency performance were carried out in the artificial climate chamber. Test results confirmed several findings: when the amount of the refrigerant charged is the same and face velocity u = 3.75 m s −1 , SK-type fin-and-tube heat exchanger refrigeration capacity increases by an average of 9.13%; energy consumption reduces by an average of 11.25%, coefficient of performance (COP) of heat exchanger increases by an average of 22.65% with continuous operation during the first 2 h. Also, when the operation time exceeds 2 h, the COP of both types of heat exchangers are both less than 0.6, illustrating that under frost conditions, the defrost interval should not be too long, otherwise energy consumption may sharply spike. - Highlights: •The large holes of SK-type induced the generation of turbulence flow. •The refrigeration capacity and COP of SK-type exceeds that of plane one. •The SK-type fin-and-tube heat exchanger is a new kind of heat transfer equipment. •The defrost interval should not exceed 2 h under frost conditions

Overexpression of YB1 C-terminal domain inhibits proliferation, angiogenesis and tumorigenicity in a SK-BR-3 breast cancer xenograft mouse model.

Science.gov (United States)

Shi, Jian-Hong; Cui, Nai-Peng; Wang, Shuo; Zhao, Ming-Zhi; Wang, Bing; Wang, Ya-Nan; Chen, Bao-Ping

2016-01-01

Y-box-binding protein 1 (YB1) is a multifunctional transcription factor with vital roles in proliferation, differentiation and apoptosis. In this study, we have examined the role of its C-terminal domain (YB1 CTD) in proliferation, angiogenesis and tumorigenicity in breast cancer. Breast cancer cell line SK-BR-3 was infected with GFP-tagged YB1 CTD adenovirus expression vector. An 3-(4,5-dimethylthiazol-2-yl)-5-(3-carboxymethoxyphenyl)-2-(4-sulfophenyl)-2H-tetrazolium (MTS) proliferation assay showed that YB1 CTD decreased SK-BR-3 cell proliferation, and down-regulated cyclin B1 and up-regulated p21 levels in SK-BR-3 cells. YB1 CTD overexpression changed the cytoskeletal organization and slightly inhibited the migration of SK-BR-3 cells. YB1 CTD also inhibited secreted VEGF expression in SK-BR-3 cells, which decreased SK-BR-3-induced EA.hy926 endothelial cell angiogenesis in vitro. YB1 CTD overexpression attenuated the ability of SK-BR-3 cells to form tumours in nude mice, and decreased in vivo VEGF levels and angiogenesis in the xenografts in SK-BR-3 tumour-bearing mice. Taken together, our findings demonstrate the vital role of YB1 CTD overexpression in inhibiting proliferation, angiogenesis and tumorigenicity of breast cancer cell line SK-BR-3.

Inhibition of SK4 Potassium Channels Suppresses Cell Proliferation, Migration and the Epithelial-Mesenchymal Transition in Triple-Negative Breast Cancer Cells.

Directory of Open Access Journals (Sweden)

Panshi Zhang

Full Text Available Treatments for triple-negative breast cancer (TNBC are limited; intermediate-conductance calcium-activated potassium (SK4 channels are closely involved in tumor progression, but little is known about these channels in TNBC. We aimed to investigate whether SK4 channels affect TNBC. First, by immunohistochemistry (IHC and western blotting (WB, increased SK4 protein expression in breast tumor tissues was detected relative to that in non-tumor breast tissues, but there was no apparent expression difference between various subtypes of breast cancer (p>0.05. Next, functional SK4 channels were detected in the TNBC cell line MDA-MB-231 using WB, real-time PCR, immunofluorescence and patch-clamp recording. By employing SK4 specific siRNAs and blockers, including TRAM-34 and clotrimazole, in combination with an MTT assay, a colony-formation assay, flow cytometry and a cell motility assay, we found that the suppression of SK4 channels significantly inhibited cell proliferation and migration and promoted apoptosis in MDA-MB-231 cells (p<0.05. Further investigation revealed that treatment with epidermal growth factor (EGF/basic fibroblast growth factor (bFGF caused MDA-MB-231 cells to undergo the epithelial-mesenchymal transition (EMT and to show increased SK4 mRNA expression. In addition, the down-regulation of SK4 expression inhibited the EMT markers Vimentin and Snail1. Collectively, our findings suggest that SK4 channels are expressed in TNBC and are involved in the proliferation, apoptosis, migration and EMT processes of TNBC cells.

Branching fractions of Bplus → Ψ(2S)Kplus and BO → Ψ(2S)K*0 decays at CDF

International Nuclear Information System (INIS)

Warburton, A.

1996-07-01

This paper describes the observation of the decays B + → ψ(2S)K + and B 0 → ψ(2S)K * (892) 0 in 1.8 TeV pp collisions and presents measurements of the branching fractions Br(B + → ψ(2S)K + ) and Br(B 0 → ψ(2S)K * (892) 0 ) relative to Br(B + → J/ψK + ) and Br(B 0 → J/ψK * (892) 0 ), respectively. The ψ(2S) mesons are reconstructed in both the ψ(2S) → μ + μ - and ψ(2S) → J/ψπ + π - channels. The world average branching fractions for the J/ψ channels are used to extract the absolute branching fractions Br(B + → ψ(2S)K + ) = (6.8±1.0(stat.)±1.4(syst.))x10 -4 and Br(B 0 → ψ(2S)K * (892) 0 ) = (9.0±2.1(stat.)±2. 0(syst.))x10 -4 . 9 refs., 13 figs., 8 tabs

Group SkSP-R sampling plan for accelerated life tests

Indian Academy of Sciences (India)

Muhammad Aslam

2017-09-15

Sep 15, 2017 ... SkSP-R sampling; life test; Weibull distribution; producer's risk; ... designed a sampling plan under a time-truncated life test .... adjusted using an acceleration factor. ... where P is the probability of lot acceptance for a single.

Gene expression in SK-Mel-28 human melanoma cells treated with the snake venom jararhagin.

Science.gov (United States)

Klein, Anelise; Capitanio, Juliana Silva; Maria, Durvanei Augusto; Ruiz, Itamar Romano Garcia

2011-01-01

Alternative approaches to improve the treatment of advanced melanomas are highly needed. The disintegrin domain of metalloproteinases binds integrin receptors on tumor cells, blocking migration, invasion, and metastatization. Previous studies showed that jararhagin, from the Bothrops jararaca snake venom, induces changes in the morphology and viability of SK-Mel-28 human melanoma cells, and decreases the number of metastases in mice injected with pre-treated cells. The purpose of this study was to evaluate the molecular effects of jararhagin on SK-Mel-28 cells and fibroblasts, concerning the expression of integrins, cadherins, caspases, and TP53 genes. Sub-toxic doses of jararhagin were administered to confluent cells. RT-PCR was performed following extraction of total RNA. Jararhagin treatments induced similar morphological alterations in both normal and tumor cells, with higher IC50 values for fibroblasts. Integrin genes were downregulated in untreated cells, except for ITGA6a,b, ITGAv, and ITGB3 which were highly expressed in SK-Mel-28. The integrin expression profiles were not affected by the toxin. However, jararhagin 30ng/μl upregulated genes TP53, CDKN1A, CDKN2A, CASP3, CASP5, CASP6, CASP8, and E-CDH in SK-Mel-28, and genes ITGB6, ITGB7, CASP3, TP53, and CDKN1B in fibroblasts. Appropriate jararhagin concentration can have apoptotic and suppressant effects on SK-Mel-28 cells, rather than on fibroblasts, and can be used to develop potential anti-cancer drugs. Copyright © 2010 Elsevier Ltd. All rights reserved.

Uncovering a Role for SK2 in Angelman Syndrome

Directory of Open Access Journals (Sweden)

Sofia B. Lizarraga

2015-07-01

Full Text Available Angelman syndrome is a severe neurodevelopmental disorder caused by mutations in UBE3A. Sun et al. (2015 report SK2 as a UBE3A substrate and provide insight into the molecular mechanisms that might underlie impaired neuronal function in individuals affected by Angelman syndrome.

Expression of the Small Conductance Ca(2+)-Activated Potassium Channel Subtype 3 (SK3) in Rat Uterus after Stimulation with 17β-Estradiol

DEFF Research Database (Denmark)

Rahbek, Mette; Nazemi, Sasan; Odum, Lars

2014-01-01

the expression of SK3 in the uterus of rats stimulated with 17β-estradiol and progesterone in order to get an in depth understanding of the rat uterine SK3. Using immunohistochemistry SK3 was localized to the glandular and luminal endometrial lamina epitheliali. Furthermore, a weak signal was observed...... in the myometrium. Using Western blot the protein level of SK3 was found to increase in uteri from animals treated with 17β-estradiol, an effect that was not reflected at the mRNA level. The levels of mRNA for SK3 were significantly lower in the uterus of 17β-estradiol-treated animals than in the uterus...... of ovariectomized animals. We conclude that the SK channels are present in the endometrial epithelium, and possibly also in the myometrium of the rat uterus. Furthermore, the hormonal effect on SK3 caused by 17β-estradiol includes divergent regulation at mRNA and protein levels....

Observation of the decay B¯s0→ψ(2SK+π−

Directory of Open Access Journals (Sweden)

R. Aaij

2015-07-01

Full Text Available The decay B¯s0→ψ(2SK+π− is observed using a data set corresponding to an integrated luminosity of 3.0 fb−1 collected by the LHCb experiment in pp collisions at centre-of-mass energies of 7 and 8 TeV. The branching fraction relative to the B0→ψ(2SK+π− decay mode is measured to beB(B¯s0→ψ(2SK+π−B(B0→ψ(2SK+π−=5.38±0.36(stat±0.22(syst±0.31(fs/fd%, where fs/fd indicates the uncertainty due to the ratio of probabilities for a b quark to hadronise into a Bs0 or B0 meson. Using an amplitude analysis, the fraction of decays proceeding via an intermediate K⁎(8920 meson is measured to be 0.645±0.049(stat±0.049(syst and its longitudinal polarisation fraction is 0.524±0.056(stat±0.029(syst. The relative branching fraction for this component is determined to be B(B¯s0→ψ(2SK⁎(8920B(B0→ψ(2SK⁎(8920=5.58±0.57(stat±0.40(syst±0.32(fs/fd%. In addition, the mass splitting between the Bs0 and B0 mesons is measured as M(Bs0−M(B0=87.45±0.44(stat±0.09(syst MeV/c2.

TaSK5, an abiotic stress-inducible GSK3/shaggy-like kinase from wheat, confers salt and drought tolerance in transgenic Arabidopsis.

Science.gov (United States)

Christov, Nikolai Kirilov; Christova, Petya Koeva; Kato, Hideki; Liu, Yuelin; Sasaki, Kentaro; Imai, Ryozo

2014-11-01

A novel cold-inducible GSK3/shaggy-like kinase, TaSK5, was isolated from winter wheat using a macroarray-based differential screening approach. TaSK5 showed high similarity to Arabidopsis subgroup I GSK3/shaggy-like kinases ASK-alpha, AtSK-gamma and ASK-epsilon. RNA gel blot analyses revealed TaSK5 induction by cold and NaCl treatments and to a lesser extent by drought treatment. TaSK5 functionally complemented the cold- and salt-sensitive phenotypes of a yeast GSK3/shaggy-like kinase mutant, △mck1. Transgenic Arabidopsis plants overexpressing TaSK5 cDNA showed enhanced tolerance to salt and drought stresses. By contrast, the tolerance of the transgenic plants to freezing stress was not altered. Microarray analysis revealed that a number of abiotic stress-inducible genes were constitutively induced in the transgenic Arabidopsis plants, suggesting that TaSK5 may function in a novel signal transduction pathway that appears to be unrelated to DREB1/CBF regulon and may involve crosstalk between abiotic and hormonal signals. Copyright © 2014 Elsevier Masson SAS. All rights reserved.

Technical Monitoring System for a New Part of Gdańsk Deepwater Container Terminal

Directory of Open Access Journals (Sweden)

Miśkiewicz Mikołaj

2017-04-01

Full Text Available Development strategy for the port of Gdańsk assumes that , up to 2027, it will become the main transport centre in the Baltic Sea region. To this end , for many years work has been carried out to facilitate access to the port both by sea and land. One of the elements of extension of the port is the building of another terminal of Deepwater Container Terminal, Gdańsk. In this task, geotechnical operations aimed at appropriate preparation of subgrade for storage of containers and operation of cranes, have been especially important. Effectiveness of the assumed design solution of land-side girder for gantry crane has been verified by means of a technical monitoring system. This paper presents main elements of design the land-side girder of a new quay of the container terminal in Gdańsk, together with its computational analysis, as well as the results collected during a few months of observation, which have revealed real work of monitored elements.

Hvem sidder dér bag skærmen?

DEFF Research Database (Denmark)

Werlauff, Erik; Schaumburg-Müller, Peer

2009-01-01

Med udgangspunkt i nutidens daytrader, der sidder ´"bag skærmen" og foretager talrige daglige køb og salg af børsnoterede aktier mv., analyseres det i artiklen, hvornår en sådan lovlig daytrading udarter til strafbar kursmanipulation. Nogle daytradere har ment, at hvis en ikke-professionel invest...

Mitochondria-Targeted Antioxidants SkQ1 and MitoTEMPO Failed to Exert a Long-Term Beneficial Effect in Murine Polymicrobial Sepsis

Directory of Open Access Journals (Sweden)

Pia Rademann

2017-01-01

Full Text Available Mitochondrial-derived reactive oxygen species have been deemed an important contributor in sepsis pathogenesis. We investigated whether two mitochondria-targeted antioxidants (mtAOX; SkQ1 and MitoTEMPO improved long-term outcome, lessened inflammation, and improved organ homeostasis in polymicrobial murine sepsis. 3-month-old female CD-1 mice (n=90 underwent cecal ligation and puncture (CLP and received SkQ1 (5 nmol/kg, MitoTEMPO (50 nmol/kg, or vehicle 5 times post-CLP. Separately, 52 SkQ1-treated CLP mice were sacrificed at 24 h and 48 h for additional endpoints. Neither MitoTEMPO nor SkQ1 exerted any protracted survival benefit. Conversely, SkQ1 exacerbated 28-day mortality by 29%. CLP induced release of 10 circulating cytokines, increased urea, ALT, and LDH, and decreased glucose but irrespectively of treatment. Similar occurred for CLP-induced lymphopenia/neutrophilia and the NO blood release. At 48 h post-CLP, dying mice had approximately 100-fold more CFUs in the spleen than survivors, but this was not SkQ1 related. At 48 h, macrophage and granulocyte counts increased in the peritoneal lavage but irrespectively of SkQ1. Similarly, hepatic mitophagy was not altered by SkQ1 at 24 h. The absence of survival benefit of mtAOX may be due to the extended treatment and/or a relatively moderate-risk-of-death CLP cohort. Long-term effect of mtAOX in abdominal sepsis appears different to sepsis/inflammation models arising from other body compartments.

Evaluating Cytotoxicity of Hyaluronate Targeted Solid Lipid Nanoparticles of Etoposide on SK-OV-3 Cells

Directory of Open Access Journals (Sweden)

Parviz Mohammadi Ghalaei

2014-01-01

Full Text Available The epithelial ovarian carcinoma is one of the most fatal gynecological cancers. Etoposide is used in treating platinum-resistant ovarian cancer. Sodium hyaluronate is a substance that binds to the CD44 receptors overexpressed in SK-OV-3 cells of epithelial ovarian carcinoma. The aim of the present work was to study the cytotoxicity effect of hyaluronate targeted solid lipid nanoparticles (SLNs of etoposide on SK-OV-3 cells. The cytotoxicity of the targeted and nontargeted SLNs of etoposide was compared to free drug on the SK-OV-3 cells by MTT assay method. The cellular uptake of the targeted and nontargeted nanoparticles containing sodium fluorescein was also studied. The difference of cell vitality between nontargeted nanoparticles and also targeted nanoparticles with free drug was significant. Targeted nanoparticles also caused more toxicity than nontargeted nanoparticles (P<0.05. After 4 hours of incubating, the fluorescence was remarkably higher in the cells treated by targeted SLNs rather than nontargeted ones, and there was no observable fluorescence in cells incubated with pure sodium fluorescein. Hyaluronate targeted SLNs containing etoposide increased the cytotoxicity of etoposide on SK-OV-3 cells which may be a worthwhile potential method for reducing the prescribed dose and systemic side effects of this drug in epithelial ovarian carcinoma.

Build a WWW Homepage for Your School!

Science.gov (United States)

Chrobak, Kimberly

1995-01-01

Discusses the use of World Wide Web (WWW) Homepage for school information. Topics include school sites; installation of a WWW browser; file tags; sites for beginner's guides to the language (HTML); two Usenet discussion groups; and a sample lesson plan including objective, procedure, and evaluation. (AEF)

[Effect of 3-bromopyruvate on mitochondrial membrane potential and apoptosis of human breast carcinoma SK-BR-3 cells].

Science.gov (United States)

Zhang, Yuanyuan; Liu, Zhe; Zhang, Qianwen; Chao, Zhenhua; Zhang, Pei; Xia, Fei; Jiang, Chenchen; Liu, Hao; Jiang, Zhiwen

2013-09-01

To study the effect of glycolysis inhibitor 3-bromopyruvate (3-BrPA) in inducing apoptosis of human breast carcinoma cells SK-BR-3 and the possible mechanism. MTT assay was used to detect the growth inhibition induced by 3-BrPA in breast cancer cells SK-BR-3. The apoptotic cells were detected by flow cytometry with propidium iodide (PI). ATP levels in the cells were detected by ATP assay kit, and DHE fluorescent probe technique was used to determine superoxide anion levels; the mitochondrial membrane potential was assessed using JC-1 staining assay. MTT assay showed that the proliferation of SK-BR-3 cells was inhibited by 3-BrPA in a time- and concentration-dependent manner. Exposure to 80, 160, and 320 µmol·L(-1) 3-BrPA for 24 h resulted in cell apoptosis rates of 6.7%, 22.3%, and 79.6%, respectively, and the intracellular ATP levels of SK-BR-3 cells treated with 80, 160, 320 µmol·L(-1) 3-BrPA for 5 h were 87.7%, 60.6%, and 23.7% of the control levels. 3-BrPA at 160 µmol·L(-1) increased reactive oxygen levels and lowered mitochondrial membrane potential of SK-BR-3 cells. 3-BrPA can inhibit cell proliferation, reduce the mitochondrial membrane potential and induce apoptosis in SK-BR-3 cells, the mechanism of which may involve a reduced ATP level by inhibiting glycolysis and increasing the reactive oxygen level in the cells.

Involvement of Transglutaminase-2 in α-MSH-Induced Melanogenesis in SK-MEL-2 Human Melanoma Cells.

Science.gov (United States)

Kim, Hyun Ji; Lee, Hye Ja; Park, Mi Kyung; Gang, Kyung Jin; Byun, Hyun Jung; Park, Jeong Ho; Kim, Mi Kyung; Kim, Soo Youl; Lee, Chang Hoon

2014-05-01

Skin hyperpigmentation is one of the most common skin disorders caused by abnormal melanogenesis. The mechanism and key factors at play are not fully understood. Previous reports have indicated that cystamine (CTM) inhibits melanin synthesis, though its molecular mechanism in melanogenesis remains unclear. In the present study, we investigated the effect of CTM on melanin production using ELISA reader and the expression of proteins involved in melanogenesis by Western blotting, and examined the involvement of transglutaminase-2 (Tgase-2) in SK-MEL-2 human melanoma cells by gene silencing. In the results, CTM dose-dependently suppressed melanin production and dendrite extension in α-MSH-induced melanogenesis of SK-MEL-2 human melanoma cells. CTM also suppressed α-MSH-induced chemotactic migration as well as the expressions of melanogenesis factors TRP-1, TRP-2 and MITF in α-MSH-treated SK-MEL-2 cells. Meanwhile, gene silencing of Tgase-2 suppressed dendrite extension and the expressions of TRP-1 and TRP-2 in α-MSH-treated SK-MEL-2 cells. Overall, these findings suggested that CTM suppresses α-MSH-induced melanogenesis via Tgase-2 inhibition and that therefore, Tgase-2 might be a new target in hyperpigmentation disorder therapy.

Production of prostate-specific antigen by a breast cancer cell line, Sk-Br-3

International Nuclear Information System (INIS)

Kamali Sarvestani, E.; Ghaderi, A.

2002-01-01

Prostate-specific antigen is a 33-KDa serine protease that is produced predominantly by prostate epithelium. However, it has been shown that about 30-40% of female breast tumors produce prostate-specific antigen and its production is associated with the presence of estrogen and progesterone receptors. We have now developed a new tissue culture system to study prostate-specific antigen production in breast cancer and its association with prognostic factors such as progesterone receptor and c-erbB-2. For this purpose we investigated the ability of prostate-specific antigen production in five different cell lines, including two breast cancer cell lines, Sk-Br-3 and MDA-MB-453. The prostate-specific antigen in tissue culture supernatant and cytoplasm of the Sk-Br-3 cell line was detected by western blotting and immunoperoxidase, respectively. Furthermore, we found lower expression of c-erbB-2 in Sk-Br-3 than non-prostate-specific antigen producer breast cancer cell line, MDA-MB-453. Progesterone receptor was expressed by both prostate-specific antigen-positive and -negative cell lines and only the intensity of staining and the number of positive cells in Sk-Br-3 population was higher than MDA-MB-453. According to our findings prostate-specific antigen can be considered as a good prognostic factor in breast cancer and we suggest that these two cell lines are a good in vitro model to study the relationship of different breast cancer prognostic factors and their regulations

Składniki mineralne w orzechach występujących w składzie „mieszanek studenckich” = Minerals in nuts which are components of „Trail Mix”

Directory of Open Access Journals (Sweden)

Natalia Mikołajczak

2016-09-01

Wydział Nauki o Żywności, Uniwersytet Warmińsko-Mazurski w Olsztynie   Uniwersytet Warmińsko-Mazurski w Olsztynie, Katedra Przetwórstwa i Chemii Surowców Roślinnych Pl. Cieszyński 1, 10-726 Olsztyn e-mail: natalia.mikolajczak@uwm.edu.pl   Streszczenie   Wprowadzenie i cel pracy: Orzechy stanowią cenną grupę żywności pod względem wartości żywieniowej, dlatego też są jednym z głównych składników wykorzystywanych w produkcji mieszanek studenckich. Obecność orzechów w codziennej diecie konsumenta ma pozytywny wpływ na organizm poprzez redukcję poziomu cholesterolu we krwi, przeciwdziałanie nowotworom i cukrzycy czy również wspomaganie utraty masy ciała. Wszystkie te korzyści wynikają ze składu chemicznego orzechów i obecności w nich wielu wartościowych składników odżywczych, w szczególności składników mineralnych. Celem pracy był przegląd aktualnego piśmiennictwa na temat zawartości poszczególnych składników mineralnych w orzechach, będących składnikami tradycyjnych mieszanek studenckich, czyli laskowych, włoskich, arachidowych, nerkowcach oraz migdałach. Skrócony opis stanu wiedzy: Orzechy to cenne źródło składników mineralnych, zarówno mikro, jak i makroelementów. Przede wszystkim, orzechy laskowe, włoskie, arachidowe oraz migdały dostarczają znacznych ilości potasu, którego zawartość w 100 g surowca odnotowuje się na poziomie wyższym niż 500 mg. Z kolei zawartość fosforu obecna jest na zbliżonym poziomie jedynie w migdałach. Mikroelementy takie jak żelazo, miedź, cynk i mangan występują we wszystkich orzechach w ilości 5-10 mg/100 g. Podsumowanie: Zebrane dane literaturowe potwierdzają fakt, że analizowane rodzaje orzechów są cennym źródłem zarówno mikro, jak i makroelementów. Są one bogactwem potasu, fosforu, magnezu oraz wapnia. Ponadto, dostarczają także znacznych ilości żelaza, cynku oraz manganu.   Słowa kluczowe: składniki mineralne, orzechy laskowe, orzechy

Optical spectroscopy of the blue supergiant Sk-69° 279 and its circumstellar shell with SALT

Science.gov (United States)

Gvaramadze, V. V.; Kniazev, A. Y.; Maryeva, O. V.; Berdnikov, L. N.

2018-02-01

We report the results of optical spectroscopy of the blue supergiant Sk-69° 279 and its circular shell in the Large Magellanic Cloud (LMC) with the Southern African Large Telescope (SALT). We classify Sk-69° 279 as an O9.2 Iaf star and analyse its spectrum by using the stellar atmosphere code CMFGEN, obtaining a stellar temperature of ≈30 kK, a luminosity of log (L*/ L⊙) = 5.54, a mass-loss rate of log (\\dot{M}/ M_{⊙} yr^{-1}) = -5.26, and a wind velocity of 800km s-1. We found also that Sk-69° 279 possesses an extended atmosphere with an effective temperature of ≈24 kK and that its surface helium and nitrogen abundances are enhanced, respectively, by factors of ≈2 and 20-30. This suggests that either Sk-69° 279 was initially a (single) fast-rotating ( ≳ 400 km s- 1) star, which only recently evolved off the main sequence, or that it is a product of close binary evolution. The long-slit spectroscopy of the shell around Sk-69° 279 revealed that its nitrogen abundance is enhanced by the same factor as the stellar atmosphere, which implies that the shell is composed mostly of the CNO processed material lost by the star. Our findings support previous propositions that some massive stars can produce compact circumstellar shells and, presumably, appear as luminous blue variables while they are still on the main sequence or have only recently left it.

Comparative Phosphoproteomics Reveals the Role of AmpC β-lactamase Phosphorylation in the Clinical Imipenem-resistant Strain Acinetobacter baumannii SK17*

Science.gov (United States)

Lai, Juo-Hsin; Yang, Jhih-Tian; Chern, Jeffy; Chen, Te-Li; Wu, Wan-Ling; Liao, Jiahn-Haur; Tsai, Shih-Feng; Liang, Suh-Yuen; Chou, Chi-Chi

2016-01-01

Nosocomial infectious outbreaks caused by multidrug-resistant Acinetobacter baumannii have emerged as a serious threat to human health. Phosphoproteomics of pathogenic bacteria has been used to identify the mechanisms of bacterial virulence and antimicrobial resistance. In this study, we used a shotgun strategy combined with high-accuracy mass spectrometry to analyze the phosphoproteomics of the imipenem-susceptible strain SK17-S and -resistant strain SK17-R. We identified 410 phosphosites on 248 unique phosphoproteins in SK17-S and 285 phosphosites on 211 unique phosphoproteins in SK17-R. The distributions of the Ser/Thr/Tyr/Asp/His phosphosites in SK17-S and SK17-R were 47.0%/27.6%/12.4%/8.0%/4.9% versus 41.4%/29.5%/17.5%/6.7%/4.9%, respectively. The Ser-90 phosphosite, located on the catalytic motif S88VS90K of the AmpC β-lactamase, was first identified in SK17-S. Based on site-directed mutagenesis, the nonphosphorylatable mutant S90A was found to be more resistant to imipenem, whereas the phosphorylation-simulated mutant S90D was sensitive to imipenem. Additionally, the S90A mutant protein exhibited higher β-lactamase activity and conferred greater bacterial protection against imipenem in SK17-S compared with the wild-type. In sum, our results revealed that in A. baumannii, Ser-90 phosphorylation of AmpC negatively regulates both β-lactamase activity and the ability to counteract the antibiotic effects of imipenem. These findings highlight the impact of phosphorylation-mediated regulation in antibiotic-resistant bacteria on future drug design and new therapies. PMID:26499836

Pääsküla raamatukogu / Maris Takk

Index Scriptorium Estoniae

Takk, Maris

2006-01-01

Pääsküla raamatukogu (Tallinn, Pärnu mnt. 480A) sisekujundus, mille eest sisekujundajad Katrin Kaevats ja Peeter Pere (AB Muru & Pere) pälvisid Eesti Sisearhitektide Liidu 2005. a. ühiskondliku interjööri preemia. Ehitaja: OÜ SCE Grupp. K. Kaevatsist, tema tähtsamad tööd. P. Perest, valik AB Muru & Pere projektidest. Ill.: kaks korruste plaani, 17 värv. vaadet, K. Kaevatsi ja P. Pere fotod

Calotropis procera extract induces apoptosis and cell cycle arrest at G2/M phase in human skin melanoma (SK-MEL-2) cells.

Science.gov (United States)

Joshi, Aparna L; Roham, Pratiksha H; Mhaske, Rooth; Jadhav, Mahadev; Krishnadas, Kavitha; Kharat, Amol; Hardikar, Bhagyashree; Kharat, Kiran R

2015-01-01

Calotropis procera (family: Asclepiadaceae) contains cardiac glycosides which are cytotoxic to cancer cells. The extracts of C. procera have been reported to be cytotoxic to many cancer cell lines and this is the first report against the human skin melanoma cells (SK-MEL-2). The SK-MEL-2 cells treated with C. procera methanolic extract (CPME) were analysed for growth inhibition and apoptosis. The exposure of phosphatidylserine in apoptotic SK-MEL-2 was analysed by using the Annexin-V FITC flow cytometry method. In CPME-treated SK-MEL-2 cells, 19.6% of apoptotic and 58.3% dead cells were observed. The 15.97% and 15.85% of early apoptotic cells were found at 20 μg/mL of the ouabain and paclitaxel, respectively. Active caspases, nuclear degradation confirmed apoptotic SK-MEL-2 cells in time- and dose-dependent manner. The cell cycle analysis shows that CPME treated cells halt at G2/M phase. Significant cytotoxic activity of CPME against SK-MEL-2 may be attributed to its high cardenolide content.

Effect of SkQ1 Antioxidant on Structural and Functional Conditions of The Brain in PostResuscitation Period

Directory of Open Access Journals (Sweden)

M. L. Lovat

2016-01-01

Full Text Available The aim was to assess the efficacy of mitochondriatargeted antioxidant SkQ1 in prevention of structural and functional abnormalities of brain postresuscitation after cardiac arrest.Materials and methods. Adult male Wistar rats (n=19 underwent cardiac arrest for 7 minutes followed by resuscitation. Nine rats were administered with 500 nmol/kg SkQ1 per os with water for 2 weeks (1 week before and 1 week after resuscitation. A control group consisted of shamoperated animals (n=10. At days 4—6 post operation locomotor activity and anxiety («elevated plus maze» test and sensorimotor function of limbs («beam walking» test were examined. Total numbers of neurons per 1 mm of their layer length in vulnerable neuronal populations (cerebellar Purkinje cells and piramidal neurons of hippocampus fields CA1 and CA4 were estimated by histological analysis of the specimens stained with cresyl violet on day 7 postresuscitation. To identify possible mechanisms of SkQ1 action, the immunohistochemical study of a glialderived neurotrophic factor (GDNF expression in piramidal neurons of hippocampus was performed by indirect peroxidaseantiperoxidase method and antiGDNF primary polyclonal antibodies.Results. Ischemiareperfusion resulted in neuronal loss in all studied brain areas followed by reduction in locomotor activity and development of sensorimotor deficit. SkQ1 prevented development of postresuscitative locomotor and sensorimotor irregularities, significantly reduced Purkinje cells loss, prevented death of piramidal neurons in hippocampal field CA4, but not in CA1. Data demonstrated, that iIn Purkinje cells from resuscitated rats treated with SkQ1 there was a significant increase in number of GDNFpositive neurons, which were more resistant to ischemia (transition of GDNFnegative cells toward the category of cells actively expressing this factor that promoted their survival postresuscitation.Conclusion. Data confirm the positive effects of SkQ1

Comparative Phosphoproteomics Reveals the Role of AmpC β-lactamase Phosphorylation in the Clinical Imipenem-resistant Strain Acinetobacter baumannii SK17.

Science.gov (United States)

Lai, Juo-Hsin; Yang, Jhih-Tian; Chern, Jeffy; Chen, Te-Li; Wu, Wan-Ling; Liao, Jiahn-Haur; Tsai, Shih-Feng; Liang, Suh-Yuen; Chou, Chi-Chi; Wu, Shih-Hsiung

2016-01-01

Nosocomial infectious outbreaks caused by multidrug-resistant Acinetobacter baumannii have emerged as a serious threat to human health. Phosphoproteomics of pathogenic bacteria has been used to identify the mechanisms of bacterial virulence and antimicrobial resistance. In this study, we used a shotgun strategy combined with high-accuracy mass spectrometry to analyze the phosphoproteomics of the imipenem-susceptible strain SK17-S and -resistant strain SK17-R. We identified 410 phosphosites on 248 unique phosphoproteins in SK17-S and 285 phosphosites on 211 unique phosphoproteins in SK17-R. The distributions of the Ser/Thr/Tyr/Asp/His phosphosites in SK17-S and SK17-R were 47.0%/27.6%/12.4%/8.0%/4.9% versus 41.4%/29.5%/17.5%/6.7%/4.9%, respectively. The Ser-90 phosphosite, located on the catalytic motif S(88)VS(90)K of the AmpC β-lactamase, was first identified in SK17-S. Based on site-directed mutagenesis, the nonphosphorylatable mutant S90A was found to be more resistant to imipenem, whereas the phosphorylation-simulated mutant S90D was sensitive to imipenem. Additionally, the S90A mutant protein exhibited higher β-lactamase activity and conferred greater bacterial protection against imipenem in SK17-S compared with the wild-type. In sum, our results revealed that in A. baumannii, Ser-90 phosphorylation of AmpC negatively regulates both β-lactamase activity and the ability to counteract the antibiotic effects of imipenem. These findings highlight the impact of phosphorylation-mediated regulation in antibiotic-resistant bacteria on future drug design and new therapies. © 2016 by The American Society for Biochemistry and Molecular Biology, Inc.

http://www.vbgsn.org

International Development Research Centre (IDRC) Digital Library (Canada)

http://www.vbgsn.org. LES TIC POUR PREVENIR ET. LUTTER CONTRE LES VBG. GROUPE D'ETUDES ET DE RECHERCHES GENRE ET SOCIETES. Une base technique utilisant des solutions open source. Il s'agit d'une plateforme web et mobile qui permet aux parties prenantes de pouvoir remonter et partager les ...

Anti-MuSK-Positive Myasthenia Gravis in a Patient with Parkinsonism and Cognitive Impairment

Directory of Open Access Journals (Sweden)

S. Lanfranconi

2011-01-01

Full Text Available Muscle-specific tyrosine kinase- (MuSK- antibodies-positive Myasthenia Gravis accounts for about one third of Seronegative Myasthenia Gravis and is clinically characterized by early onset of prominent bulbar, neck, shoulder girdle, and respiratory weakness. The response to medical therapy is generally poor. Here we report a case of late-onset MuSK-antibodies-positive Myasthenia Gravis presenting with signs of cognitive impairment and parkinsonism in addition to bulbar involvement and external ophthalmoplegia. The pattern of involvement of both peripheral and central nervous system dysfunction might suggest a common pathogenic mechanism, involving impaired cholinergic transmission.

www.elearnSCI.org

DEFF Research Database (Denmark)

Chhabra, H S; Harvey, Lee; Muldoon, S

2013-01-01

OBJECTIVE: To develop a web-based educational resource for health professionals responsible for the management of spinal cord injury (SCI). The resource:www.elearnSCI.org is comprised of seven learning modules, each subdivided into various submodules. Six of the seven modules address the educatio......OBJECTIVE: To develop a web-based educational resource for health professionals responsible for the management of spinal cord injury (SCI). The resource:www.elearnSCI.org is comprised of seven learning modules, each subdivided into various submodules. Six of the seven modules address...... the educational needs of all disciplines involved in comprehensive SCI management. The seventh module addresses prevention of SCI. Each submodule includes an overview, activities, self-assessment questions and references. DEVELOPMENT OF THE RESOURCE: Three hundred and thirty-two experts from The International...... Spinal Cord Society (ISCoS) and various affiliated societies from 36 countries were involved in developing the resource through 28 subcommittees. The content of each submodule was reviewed and approved by the Education and Scientific Committees of ISCoS and finally by an Editorial Committee of 23 experts...

The Mitochondria-Targeted Antioxidant SkQ1 Downregulates Aryl Hydrocarbon Receptor-Dependent Genes in the Retina of OXYS Rats with AMD-Like Retinopathy

Directory of Open Access Journals (Sweden)

M. L. Perepechaeva

2014-01-01

Full Text Available The mitochondria-targeted antioxidant SkQ1 is a novel drug thought to retard development of age-related diseases. It has been shown that SkQ1 reduces clinical signs of retinopathy in senescence-accelerated OXYS rats, which are a known animal model of human age-related macular degeneration (AMD. The aim of this work was to test whether SkQ1 affects transcriptional activity of AhR (aryl hydrocarbon receptor and Nrf2 (nuclear factor erythroid 2-related factor 2, which are considered as AMD-associated genes in the retina of OXYS and Wistar rats. Our results showed that only AhR and AhR-dependent genes were sensitive to SkQ1. Dietary supplementation with SkQ1 decreased the AhR mRNA level in both OXYS and Wistar rats. At baseline, the retinal Cyp1a1 mRNA level was lower in OXYS rats. SkQ1 supplementation decreased the Cyp1a1 mRNA level in Wistar rats, but this level remained unchanged in OXYS rats. Baseline Cyp1a2 and Cyp1b1 mRNA expression was stronger in OXYS than in Wistar rats. In the OXYS strain, Cyp1a2 and Cyp1b1 mRNA levels decreased as a result of SkQ1 supplementation. These data suggest that the Cyp1a2 and Cyp1b1 enzymes are involved in the pathogenesis of AMD-like retinopathy of OXYS rats and are possible therapeutic targets of SkQ1.

Production of coagulation factor VII in human cell lines Sk-Hep-1 and HKB-11.

Science.gov (United States)

Corrêa de Freitas, Marcela Cristina; Bomfim, Aline de Sousa; Mizukami, Amanda; Picanço-Castro, Virgínia; Swiech, Kamilla; Covas, Dimas Tadeu

2017-09-01

Recombinant factor VII (rFVII) is the main therapeutic choice for hemophilia patients who have developed inhibitory antibodies against conventional treatments (FVIII and FIX). Because of the post-translational modifications, rFVII needs to be produced in mammalian cell lines. In this study, for the first time, we have shown efficient rFVII production in HepG2, Sk-Hep-1, and HKB-11 cell lines. Experiments in static conditions for a period of 96 h showed that HepG2-FVII produced the highest amounts of rhFVII, with an average of 1843 ng/mL. Sk-hep-1-FVII cells reached a maximum protein production of 1432 ng/mL and HKB-11-FVII cells reached 1468 ng/mL. Sk-Hep-1-rFVII and HKB-11-rFVII were selected for the first step of scale-up. Over 10 days of spinner flask culture, HKB-11 and SK-Hep-1 cells showed a cumulative production of rFVII of 152 μg and 202.6 μg in 50 mL, respectively. Thus, these human cell lines can be used for an efficient production of recombinant FVII. With more investment in basic research, human cell lines can be optimized for the commercial production of different bio therapeutic proteins. Copyright © 2017 Elsevier Inc. All rights reserved.

Ocena przydatności kryteriów Williamsa w rozpoznawaniu atopowego zapalenia skóry w praktyce lekarza pediatry

Directory of Open Access Journals (Sweden)

Zbigniew Samochocki

2009-09-01

Full Text Available O trudnościach w rozpoznawaniu AZS u dzieci świadczy stosowanie wielu różnych metod diagnostycznych. Jedną z nich są kryteria zaproponowane przez Williamsa iwsp. Celem pracy było określenie przydatności kryteriów Williamsa iwsp. wrozpoznawaniu AZS u dzieci poprzez ocenę porównawczą z kryteriami Hanifina iRajki. Badaniami objęto 166 pacjentów Poradni Dermatologicznej (67 chłopców i 99 dziewczynek w wieku od 4 do 15 lat (średnio 10,3 roku, którzy niezależnie od zmian skórnych zgłaszali świąd skóry. Poddano ich badaniu klinicznemu i procedurom zawartym w kryteriach Hanifina i Rajki. Dokonano analizy statystycznej wyników. U 108 dzieci rozpoznano AZS, a u 58 – świerzb, łojotokowe zapalenie skóry, zapalenie skóry z podrażnienia, łuszczycę, trądzik młodzieńczy oraz pokrzywkę. U wszystkich chorych naAZS wykazano suchość skóry. Zajęcie typowych okolic podawane wwywiadzie, początek zmian skórnych <2. roku życia, czynne zmiany w przegubach i osobnicze obciążenie atopią obserwowano odpowiednio u 96,3% (104/108, 71,3% (77/108, 67,6% (73/108 i 64,3% (70/108 pacjentów. Wszystkie te cechy występowały statystycznie istotnie częściej (p<0,001 wporównaniu z grupą dzieci, u których nie rozpoznano wyprysku atopowego. Stosując kryteria Williamsa i wsp., u 3/108 chorych wykazano fałszywie ujemne wyniki, a u 2/58 – fałszywie dodatnie. Czułość i swoistość tej metody badawczej wynosiła odpowiednio 97,2% i 96,6%. Wnioski: 1. Kryteria diagnostyczne Williamsa i wsp. są bardzo pomocne w praktyce lekarza pediatry w rozpoznawaniu AZS u dzieci powyżej 3. roku życia. 2. Suchość skóry i potwierdzenie wwywiadzie obecności zmian wypryskowych o typowej lokalizacji są najbardziej przydatne w rozpoznawaniu AZS u dzieci. 3. W przypadkach wątpliwych rozszerzenie granicy wieku wystąpienia pierwszych zmian skórnych z 2 do 5 lat zwiększa wykrywalność choroby.

Isoegomaketone induces apoptosis in SK-MEL-2 human melanoma cells through mitochondrial apoptotic pathway via activating the PI3K/Akt pathway.

Science.gov (United States)

Kwon, Soon-Jae; Lee, Ju-Hye; Moon, Kwang-Deog; Jeong, Il-Yun; Yee, Sung-Tae; Lee, Mi-Kyung; Seo, Kwon-Il

2014-11-01

Isoegomaketone (IK) is a major biologically active component of Perilla frutescens. In this study, we investigated the contribution of reactive oxygen species (ROS) to IK-induced apoptosis in human melanoma SK-MEL-2 cells. We found that IK inhibited the proliferation of SK-MEL-2 human melanoma cells in a dose-dependent manner. IK also induced sub-G1 DNA accumulation, formation of apoptotic bodies, nuclear condensation, and a DNA ladder in SK-MEL-2 cells. IK also induced activation of caspase-3 and -9, whereas caspase‑8 was unaffected. Further, N-acetyl-L-cysteine (NAC, ROS scavenger) treatment to SK-MEL-2 cells significantly reduced IK-induced cell death. Pretreatment of NAC to SK-MEL-2 cells followed by 100 µM IK reduced the protein levels of Bax and cytochrome c as well as PARP cleavage, whereas the protein level of Bcl-2 increased. Moreover, IK inhibited the phosphorylation of AKT/mTOR protein and cell proliferation induced by LY294002, a PI3K inhibitor. In conclusion, IK-induced ROS generation regulates cell growth inhibition and it induces apoptosis through caspase‑dependent and -independent pathways via modulation of PI3K/AKT signaling in SK-MEL-2 cells.

Genome-wide analysis of KAP1, the 7SK snRNP complex, and RNA polymerase II

Directory of Open Access Journals (Sweden)

Ryan P. McNamara

2016-03-01

Full Text Available The transition of RNA polymerase II (Pol II from transcription initiation into productive elongation in eukaryotic cells is regulated by the P-TEFb kinase, which phosphorylates the C-terminal domain of paused Pol II at promoter-proximal regions. Our recent study found that P-TEFb (in an inhibited state bound to the 7SK snRNP complex interacts with the KAP1/TRIM28 transcriptional regulator, and that KAP1 and the 7SK snRNP co-occupy most gene promoters containing paused Pol II. Here we provide a detailed experimental description and analysis of the ChIP-seq datasets that have been deposited into Gene Expression Omnibus (GEO: GS72622, so that independent groups can replicate and expand upon these findings. We propose these datasets would provide valuable information for researchers studying mechanisms of transcriptional regulation including Pol II pausing and pause release. Keywords: P-TEFb/7SK snRNP, KAP1, RNA polymerase II, ChIP-seq, Transcription elongation

REDItools: high-throughput RNA editing detection made easy.

Science.gov (United States)

Picardi, Ernesto; Pesole, Graziano

2013-07-15

The reliable detection of RNA editing sites from massive sequencing data remains challenging and, although several methodologies have been proposed, no computational tools have been released to date. Here, we introduce REDItools a suite of python scripts to perform high-throughput investigation of RNA editing using next-generation sequencing data. REDItools are in python programming language and freely available at http://code.google.com/p/reditools/. ernesto.picardi@uniba.it or graziano.pesole@uniba.it Supplementary data are available at Bioinformatics online.

METCAM/MUC18 promoted tumorigenesis of human breast cancer SK-BR-3 cells in a dosage-specific manner.

Science.gov (United States)

Huang, Chang-Yu; Wu, Guang-Jer

2016-04-01

Overexpression of METCAM/MUC18, an immunoglobulin-like cell-adhesion molecule, promotes tumorigenesis and progression of human breast cancer cells. We also observed an intriguing phenomenon that a high-expressing SK-BR-3 clone manifested a transient tumor suppression effect in vivo. The purpose of this study was to understand if this was caused by clonal variation, METCAM/MUC18-dosage effect, or the number of cells injected. Several G418-resistant clones of SK-BR-3, expressing different levels of METCAM/MUC18, were obtained for testing effects of human METCAM/MUC18 on in vitro motility, invasiveness, and anchorage-independent colony formation (in vitro tumorigenicity) and in vivo tumorigenesis in female Balb/C athymic nude mice. Tumor sections were made for histology and immunohistochemistry analyses, and tumor lysates for Western blot analysis to determine the effects of human METCAM/MUC18 expression on levels of various downstream effectors. METCAM/MUC18 promoted in vitro motility, invasiveness, and in vitro tumorigenicity of SK-BR-3 cells in a dosage-specific manner. Overexpression of METCAM/MUC18 could promote in vivo tumorigenesis of SK-BR-3 cells even when one tenth of the previously used cell number (5 × 10(5)) was injected and in vivo tumorigenesis of SK-BR-3 cells was directly proportional to the dosage of the protein. The previously observed transient tumor suppression effect from the same clone was no longer observed. The downstream effector, such as phospho-AKT/AKT ratio, was elevated in the tumors. Transient suppression observed previously in the clone was caused by injection of a high cell number (2 × 10(6)-5 × 10(6)). METCAM/MUC18 positively promotes tumorigenesis of SK-BR-3 cells by increasing the survival and proliferation pathway. Copyright © 2016. Published by Elsevier B.V.

Survivin selective inhibitor YM155 induce apoptosis in SK-NEP-1 Wilms tumor cells

International Nuclear Information System (INIS)

Tao, Yan-Fang; Wu, Dong; Wang, Na; Feng, Xing; Li, Yan-Hong; Ni, Jian; Wang, Jian; Pan, Jian; Lu, Jun; Du, Xiao-Juan; Sun, Li-Chao; Zhao, Xuan; Peng, Liang; Cao, Lan; Xiao, Pei-Fang; Pang, Li

2012-01-01

Survivin, a member of the family of inhibitor of apoptosis proteins, functions as a key regulator of mitosis and programmed cell death. YM155, a novel molecular targeted agent, suppresses survivin, which is overexpressed in many tumor types. The aim of this study was to determine the antitumor activity of YM155 in SK-NEP-1 cells. SK-NEP-1 cell growth in vitro and in vivo was assessed by MTT and nude mice experiments. Annexin V/propidium iodide staining followed by flow cytometric analysis was used to detect apoptosis in cell culture. Then gene expression profile of tumor cells treated with YM155 was analyzed with real-time PCR arrays. We then analyzed the expression data with MEV (Multi Experiment View) cluster software. Datasets representing genes with altered expression profile derived from cluster analyses were imported into the Ingenuity Pathway Analysis tool. YM155 treatment resulted in inhibition of cell proliferation of SK-NEP-1cells in a dose-dependent manner. Annexin V assay, cell cycle, and activation of caspase-3 demonstrates that YM155 induced apoptosis in SK-NEP-1 cells. YM155 significantly inhibited growth of SK-NEP-1 xenografts (YM155 5 mg/kg: 1.45 ± 0.77 cm 3 ; YM155 10 mg/kg: 0.95 ± 0.55 cm 3 ) compared to DMSO group (DMSO: 3.70 ± 2.4 cm 3 ) or PBS group cells (PBS: 3.78 ± 2.20 cm 3 , ANOVA P < 0.01). YM155 treatment decreased weight of tumors (YM155 5 mg/kg: 1.05 ± 0.24 g; YM155 10 mg/kg: 0.72 ± 0.17 g) compared to DMSO group (DMSO: 2.06 ± 0.38 g) or PBS group cells (PBS: 2.36 ± 0.43 g, ANOVA P < 0.01). Real-time PCR array analysis showed between Test group and control group there are 32 genes significantly up-regulated and 54 genes were significantly down-regulated after YM155 treatment. Ingenuity pathway analysis (IPA) showed cell death was the highest rated network with 65 focus molecules and the significance score of 44. The IPA analysis also groups the differentially expressed genes into biological mechanisms that are related to cell

Blýská se…

Czech Academy of Sciences Publication Activity Database

Kolmašová, Ivana

2015-01-01

Roč. 60, č. 2 (2015), s. 123-132 ISSN 0032-2423 Institutional support: RVO:68378289 Keywords : lightning discharges * thundercloud * transient luminous events Subject RIV: DG - Athmosphere Sciences, Meteorology http://www.dml.cz/handle/10338.dmlcz/144406

PENYEBARAN INFORMASI MENGGUNAKAN WWW (WORLD WIDE WEB

Directory of Open Access Journals (Sweden)

Ika Atman Satya

2011-12-01

Full Text Available Media Informasi secara tradisional telah kita kenai dengan menggunakan koran, televisi, radio dan buku referensi. Media informasi tersebut untuk penyebarannya memerlukan penunjang agar informasi tersebut dapat disebarkan secara lutis. Selain penggunaan media tradisional tersebut penyebaran informasi dengan menggunakan jaringan komputer Internet juga berkembang. Salah satu cara penyebaran informasi dengan menggunakan aplikasi WWW (World Wide Web yang mempunyai kemampuan menggabungkan gambar, text dan suara secara interaktif. Pada tulisan ini akan dibahas tentang kemampuan, penggunaan dan pengembangan server WWW.

RuvBL2 Is Involved in Histone Deacetylase Inhibitor PCI-24781-Induced Cell Death in SK-N-DZ Neuroblastoma Cells

Science.gov (United States)

Zhan, Qinglei; Tsai, Sauna; Lu, Yonghai; Wang, Chunmei; Kwan, Yiuwa; Ngai, Saiming

2013-01-01

Neuroblastoma is the second most common solid tumor diagnosed during infancy. The survival rate among children with high-risk neuroblastoma is less than 40%, highlighting the urgent needs for new treatment strategies. PCI-24781 is a novel hydroxamic acid-based histone deacetylase (HDAC) inhibitor that has high efficacy and safety for cancer treatment. However, the underlying mechanisms of PCI-24781 are not clearly elucidated in neuroblastoma cells. In the present study, we demonstrated that PCI-24781 treatment significantly inhibited tumor growth at very low doses in neuroblastoma cells SK-N-DZ, not in normal cell line HS-68. However, PCI-24781 caused the accumulation of acetylated histone H3 both in SK-N-DZ and HS-68 cell line. Treatment of SK-N-DZ with PCI-24781 also induced cell cycle arrest in G2/M phase and activated apoptosis signaling pathways via the up-regulation of DR4, p21, p53 and caspase 3. Further proteomic analysis revealed differential protein expression profiles between non-treated and PCI-24781 treated SK-N-DZ cells. Totally 42 differentially expressed proteins were identified by MALDI-TOF MS system. Western blotting confirmed the expression level of five candidate proteins including prohibitin, hHR23a, RuvBL2, TRAP1 and PDCD6IP. Selective knockdown of RuvBL2 rescued cells from PCI-24781-induced cell death, implying that RuvBL2 might play an important role in anti-tumor activity of PCI-24781 in SK-N-DZ cells. The present results provide a new insight into the potential mechanism of PCI-24781 in SK-N-DZ cell line. PMID:23977108

The tetraindole SK228 reverses the epithelial-to-mesenchymal transition of breast cancer cells by up-regulating members of the miR-200 family.

Directory of Open Access Journals (Sweden)

Chie-Hong Wang

Full Text Available The results of recent studies have shown that metastasis, the most common malignancy and primary cause of mortality promoted by breast cancer in women, is associated with the epithelial-to-mesenchymal transition (EMT. The results of the current study show that SK228, a novel indole containing substance, exhibits anti-cancer activity. In addition, the effects of SK228 on the regulation of EMT in breast cancer cells as well as the underlying mechanism have been explored. SK228 was observed to induce a fibroblastoid to epithelial-like change in the appearance of various breast cancer cell lines and to suppress the migration and invasion of these cancer cells in vitro. Moreover, expression of E-cadherin was found to increase following SK228 treatment whereas ZEB1 expression was repressed. Expression of other major EMT inducers, including ZEB2, Slug and Twist1, is also repressed by SK228 as a consequence of up-regulation of members of the miR-200 family, especially miR-200c. The results of animal studies demonstrate that SK228 treatment leads to effective suppression of breast cancer growth and metastasis in vivo. The observations made in this investigation show that SK228 reverses the EMT process in breast cancer cells via an effect on the miR-200c/ZEB1/E-cadherin signalling pathway. In addition, the results of a detailed analysis of the in vivo anti-cancer activities of SK228, carried out using a breast cancer xenograft animal model, show that this substance is a potential chemotherapeutic agent for the treatment of breast cancer.

Polyploidization on SK-N-MC human neuroblastoma cells infected with herpes simplex virus 1.

Science.gov (United States)

Karalyan, Zaven; Izmailyan, Roza; Karalova, Elena; Abroyan, Liana; Hakobyan, Lina; Avetisyan, Aida; Semerjyan, Zara

2016-01-01

Polyploidization is one of the most dramatic changes occurring within cell genome owing to various reasons including under many viral infections. We examined the impact of herpes simplex virus-1 (HSV-1) on SK-N-MC human neuroblastoma cell line. The infected cells were followed from 6 hours up to 96 hours post infection (hpi). A large number of polyploid cells with giant nuclei was observed under the influence of HSV-1 at 24 hpi with the DNA content of 32c to 64c or more, in comparison with control SK-N-MC cells that were characterized by relatively moderate values of ploidy, i.e. 8с to 16с (where 1c is the haploid amount of nuclear DNA found in normal diploid populations in G0/G1). After 48-96 hpi, the population of polyploid cells with giant nuclei decreased to the benchmark level. The SK-NMC cells infected with HSV-1 for 24 hours were stained with gallocyanine and monitored for cytological features. The infected cells underwent virus induced cellcell and nuclei fusion with the formation of dense nuclei syncytium. The metabolic activity of HSV-1 infected cells was higher in both nuclei and nucleoli when compared to control cells.

Zircon in highly evolved hercynian Homolka granite, Moldanubian zone, Czech Republic: indicator of magma source and petrogenesis

Czech Academy of Sciences Publication Activity Database

Uher, P.; Breiter, K.; Klečka, M.; Pivec, Edvín

1998-01-01

Roč. 49, č. 3 (1998), s. 151-160 ISSN 0016-7738 Grant - others:SK(CZ) VEGA 4078 Subject RIV: DB - Geology ; Mineralogy Impact factor: 0.273, year: 1998 http://www.geologicacarpathica.sk/src/main.php

The SigmaR1 chaperone drives breast and colorectal cancer cell migration by tuning SK3-dependent Ca2+ homeostasis.

Science.gov (United States)

Gueguinou, M; Crottès, D; Chantôme, A; Rapetti-Mauss, R; Potier-Cartereau, M; Clarysse, L; Girault, A; Fourbon, Y; Jézéquel, P; Guérin-Charbonnel, C; Fromont, G; Martin, P; Pellissier, B; Schiappa, R; Chamorey, E; Mignen, O; Uguen, A; Borgese, F; Vandier, C; Soriani, O

2017-06-22

The remodeling of calcium homeostasis contributes to the cancer hallmarks and the molecular mechanisms involved in calcium channel regulation in tumors remain to be characterized. Here, we report that SigmaR1, a stress-activated chaperone, is required to increase calcium influx by triggering the coupling between SK3, a Ca 2+ -activated K + channel (KCNN3) and the voltage-independent calcium channel Orai1. We show that SigmaR1 physically binds SK3 in BC cells. Inhibition of SigmaR1 activity, either by molecular silencing or by the use of sigma ligand (igmesine), decreased SK3 current and Ca 2+ entry in breast cancer (BC) and colorectal cancer (CRC) cells. Interestingly, SigmaR1 inhibition diminished SK3 and/or Orai1 levels in lipid nanodomains isolated from BC cells. Analyses of tissue microarray from CRC patients showed higher SigmaR1 expression levels in cancer samples and a correlation with tumor grade. Moreover, the exploration of a cohort of 4937 BC patients indicated that high expression of SigmaR1 and Orai1 channels was significantly correlated to a lower overall survival. As the SK3/Orai1 tandem drives invasive process in CRC and bone metastasis progression in BC, our results may inaugurate innovative therapeutic approaches targeting SigmaR1 to control the remodeling of Ca 2+ homeostasis in epithelial cancers.

Calcium-dependent stoichiometries of the KCa2.2 (SK) intracellular domain/calmodulin complex in solution.

Science.gov (United States)

Halling, D Brent; Kenrick, Sophia A; Riggs, Austen F; Aldrich, Richard W

2014-02-01

Ca(2+) activates SK Ca(2+)-activated K(+) channels through the protein Ca(2+) sensor, calmodulin (CaM). To understand how SK channels operate, it is necessary to determine how Ca(2+) regulates CaM binding to its target on SK. Tagless, recombinant SK peptide (SKp), was purified for binding studies with CaM at low and high Ca(2+) concentrations. Composition gradient multi-angle light scattering accurately measures the molar mass, stoichiometry, and affinity of protein complexes. In 2 mM Ca(2+), SKp and CaM bind with three different stoichiometries that depend on the molar ratio of SKp:CaM in solution. These complexes include 28 kD 1SKp/1CaM, 39 kD 2SKp/1CaM, and 44 kD 1SKp/2CaM. A 2SKp/2CaM complex, observed in prior crystallographic studies, is absent. At sedimentation coefficient is smaller for a 1SKp:1CaM solution than it is for either 2SKp:1CaM or 1SKp:2CaM. At low Ca(2+) and at >100 µM protein concentrations, a molar excess of SKp over CaM causes aggregation. Aggregation is not observed in Ca(2+) or with CaM in molar excess. In low Ca(2+) both 1SKp:1CaM and 1SKp:2CaM solutions have similar sedimentation coefficients, which is consistent with the absence of a 1SKp/2CaM complex in low Ca(2+). These results suggest that complexes with stoichiometries other than 2SKp/2CaM are important in gating.

Dihydromyricetin induces cell cycle arrest and apoptosis in melanoma SK-MEL-28 cells.

Science.gov (United States)

Zeng, Guofang; Liu, Jie; Chen, Hege; Liu, Bin; Zhang, Qingyu; Li, Mingyi; Zhu, Runzhi

2014-06-01

Dihydromyricetin (DHM) exhibits multiple pharmacological activities; however, the role of DHM in anti-melanoma activities and the underlying molecular mechanisms are unclear. The aim of the present study was to evaluate the effects of DHM on cell proliferation, cell cycle distribution and apoptosis in the human melanoma SK-MEL-28 cell line, and to explore the related mechanisms. The effect of DHM on cell proliferation was investigated by MTT assay, and cell cycle distribution was determined by flow cytometry. TUNEL assay was used to evaluate DHM-mediated apoptosis, and western blotting was applied to examine expression levels of p53, p21, Cdc25A, Cdc2, P-Cdc2, Bax, IKK-α, NF-κB p65, p38 and P-p38 proteins. The results revealed that DHM suppressed cell proliferation of SK-MEL-28 cells in a concentration- and time-dependent manner, and caused cell cycle arrest at the G1/S phase. DHM increased the production of p53 and p21 proteins and downregulated the production of Cdc25A, Cdc2 and P-Cdc2 proteins, which induced cell cycle arrest. Additionally, DHM significantly induced the apoptosis of SK-MEL-28 cells, and enhanced the expression levels of Bax proteins and decreased the protein levels of IKK-α, NF-κB (p65) and P-p38. The results suggest that DHM may be a novel and effective candidate agent to inhibit the growth of melanoma.

$K^{0}_{s}-K^{0}_{s}$ correlations in pp collisions at $\\sqrt{s}=7 TeV$ from the LHC ALICE experiment

CERN Document Server

Abelev, Betty; Adamova, Dagmar; Adare, Andrew Marshall; Aggarwal, Madan; Aglieri Rinella, Gianluca; Agocs, Andras Gabor; Agostinelli, Andrea; Aguilar Salazar, Saul; Ahammed, Zubayer; Ahmad, Arshad; Ahmad, Nazeer; Ahn, Sang Un; Akindinov, Alexander; Aleksandrov, Dmitry; Alessandro, Bruno; Alfaro Molina, Jose Ruben; Alici, Andrea; Alkin, Anton; Almaraz Avina, Erick Jonathan; Alme, Johan; Alt, Torsten; Altini, Valerio; Altinpinar, Sedat; Altsybeev, Igor; Andrei, Cristian; Andronic, Anton; Anguelov, Venelin; Anielski, Jonas; Anticic, Tome; Antinori, Federico; Antonioli, Pietro; Aphecetche, Laurent Bernard; Appelshauser, Harald; Arbor, Nicolas; Arcelli, Silvia; Armesto, Nestor; Arnaldi, Roberta; Aronsson, Tomas Robert; Arsene, Ionut Cristian; Arslandok, Mesut; Augustinus, Andre; Averbeck, Ralf Peter; Awes, Terry; Aysto, Juha Heikki; Azmi, Mohd Danish; Bach, Matthias Jakob; Badala, Angela; Baek, Yong Wook; Bailhache, Raphaelle Marie; Bala, Renu; Baldini Ferroli, Rinaldo; Baldisseri, Alberto; Baldit, Alain; Baltasar Dos Santos Pedrosa, Fernando; Ban, Jaroslav; Baral, Rama Chandra; Barbera, Roberto; Barile, Francesco; Barnafoldi, Gergely Gabor; Barnby, Lee Stuart; Barret, Valerie; Bartke, Jerzy Gustaw; Basile, Maurizio; Bastid, Nicole; Basu, Sumit; Bathen, Bastian; Batigne, Guillaume; Batyunya, Boris; Baumann, Christoph Heinrich; Bearden, Ian Gardner; Beck, Hans; Behera, Nirbhay Kumar; Belikov, Iouri; Bellini, Francesca; Bellwied, Rene; Belmont-Moreno, Ernesto; Bencedi, Gyula; Beole, Stefania; Berceanu, Ionela; Bercuci, Alexandru; Berdnikov, Yaroslav; Berenyi, Daniel; Bergognon, Anais Annick Erica; Berzano, Dario; Betev, Latchezar; Bhasin, Anju; Bhati, Ashok Kumar; Bhom, Jihyun; Bianchi, Livio; Bianchi, Nicola; Bianchin, Chiara; Bielcik, Jaroslav; Bielcikova, Jana; Bilandzic, Ante; Bjelogrlic, Sandro; Blanco, F; Blanco, Francesco; Blau, Dmitry; Blume, Christoph; Bock, Nicolas; Boettger, Stefan; Bogdanov, Alexey; Boggild, Hans; Bogolyubsky, Mikhail; Boldizsar, Laszlo; Bombara, Marek; Book, Julian; Borel, Herve; Borissov, Alexander; Bose, Suvendu Nath; Bossu, Francesco; Botje, Michiel; Boyer, Bruno Alexandre; Braidot, Ermes; Braun-Munzinger, Peter; Bregant, Marco; Breitner, Timo Gunther; Browning, Tyler Allen; Broz, Michal; Brun, Rene; Bruna, Elena; Bruno, Giuseppe Eugenio; Budnikov, Dmitry; Buesching, Henner; Bufalino, Stefania; Bugaiev, Kyrylo; Busch, Oliver; Buthelezi, Edith Zinhle; Caffarri, Davide; Cai, Xu; Caines, Helen Louise; Calvo Villar, Ernesto; Camerini, Paolo; Canoa Roman, Veronica; Cara Romeo, Giovanni; Carena, Francesco; Carena, Wisla; Carminati, Federico; Casanova Diaz, Amaya Ofelia; Castillo Castellanos, Javier Ernesto; Casula, Ester Anna Rita; Catanescu, Vasile; Cavicchioli, Costanza; Ceballos Sanchez, Cesar; Cepila, Jan; Cerello, Piergiorgio; Chang, Beomsu; Chapeland, Sylvain; Charvet, Jean-Luc Fernand; Chattopadhyay, Sukalyan; Chattopadhyay, Subhasis; Chawla, Isha; Cherney, Michael Gerard; Cheshkov, Cvetan; Cheynis, Brigitte; Chiavassa, Emilio; Chibante Barroso, Vasco Miguel; Chinellato, David; Chochula, Peter; Chojnacki, Marek; Choudhury, Subikash; Christakoglou, Panagiotis; Christensen, Christian Holm; Christiansen, Peter; Chujo, Tatsuya; Chung, Suh-Urk; Cicalo, Corrado; Cifarelli, Luisa; Cindolo, Federico; Cleymans, Jean Willy Andre; Coccetti, Fabrizio; Colamaria, Fabio; Colella, Domenico; Conesa Balbastre, Gustavo; Conesa del Valle, Zaida; Constantin, Paul; Contin, Giacomo; Contreras, Jesus Guillermo; Cormier, Thomas Michael; Corrales Morales, Yasser; Cortes Maldonado, Ismael; Cortese, Pietro; Cosentino, Mauro Rogerio; Costa, Filippo; Cotallo, Manuel Enrique; Crochet, Philippe; Cruz Alaniz, Emilia; Cuautle, Eleazar; Cunqueiro, Leticia; D'Erasmo, Ginevra; Dainese, Andrea; Dalsgaard, Hans Hjersing; Danu, Andrea; Das, Debasish; Das, Indranil; Das, Kushal; Dash, Ajay Kumar; Dash, Sadhana; De, Sudipan; de Barros, Gabriel; De Caro, Annalisa; de Cataldo, Giacinto; de Cuveland, Jan; De Falco, Alessandro; De Gruttola, Daniele; De Marco, Nora; De Pasquale, Salvatore; de Rooij, Raoul Stefan; Delagrange, Hugues; Deloff, Andrzej; Demanov, Vyacheslav; Denes, Ervin; Deppman, Airton; Di Bari, Domenico; Di Giglio, Carmelo; Di Liberto, Sergio; Di Mauro, Antonio; Di Nezza, Pasquale; Diaz Corchero, Miguel Angel; Dietel, Thomas; Divia, Roberto; Djuvsland, Oeystein; Dobrin, Alexandru Florin; Dobrowolski, Tadeusz Antoni; Dominguez, Isabel; Donigus, Benjamin; Dordic, Olja; Driga, Olga; Dubey, Anand Kumar; Ducroux, Laurent; Dupieux, Pascal; Dutta Majumdar, AK; Dutta Majumdar, Mihir Ranjan; Elia, Domenico; Emschermann, David Philip; Engel, Heiko; Erdal, Hege Austrheim; Espagnon, Bruno; Estienne, Magali Danielle; Esumi, Shinichi; Evans, David; Eyyubova, Gyulnara; Fabris, Daniela; Faivre, Julien; Falchieri, Davide; Fantoni, Alessandra; Fasel, Markus; Fedunov, Anatoly; Fehlker, Dominik; Feldkamp, Linus; Felea, Daniel; Fenton-Olsen, Bo; Feofilov, Grigory; Fernandez Tellez, Arturo; Ferretti, Alessandro; Ferretti, Roberta; Figiel, Jan; Figueredo, Marcel; Filchagin, Sergey; Finogeev, Dmitry; Fionda, Fiorella; Fiore, Enrichetta Maria; Floris, Michele; Foertsch, Siegfried Valentin; Foka, Panagiota; Fokin, Sergey; Fragiacomo, Enrico; Frankenfeld, Ulrich Michael; Fuchs, Ulrich; Furget, Christophe; Fusco Girard, Mario; Gaardhoje, Jens Joergen; Gagliardi, Martino; Gago, Alberto; Gallio, Mauro; Gangadharan, Dhevan Raja; Ganoti, Paraskevi; Garabatos, Jose; Garcia-Solis, Edmundo; Garishvili, Irakli; Gerhard, Jochen; Germain, Marie; Geuna, Claudio; Gheata, Andrei George; Gheata, Mihaela; Ghidini, Bruno; Ghosh, Premomoy; Gianotti, Paola; Girard, Martin Robert; Giubellino, Paolo; Gladysz-Dziadus, Ewa; Glassel, Peter; Gomez, Ramon; Gonschior, Alexey; Gonzalez Ferreiro, Elena; Gonzalez-Trueba, Laura Helena; Gonzalez-Zamora, Pedro; Gorbunov, Sergey; Goswami, Ankita; Gotovac, Sven; Grabski, Varlen; Graczykowski, Lukasz Kamil; Grajcarek, Robert; Grelli, Alessandro; Grigoras, Alina Gabriela; Grigoras, Costin; Grigoriev, Vladislav; Grigoryan, Ara; Grigoryan, Smbat; Grinyov, Boris; Grion, Nevio; Grosse-Oetringhaus, Jan Fiete; Grossiord, Jean-Yves; Grosso, Raffaele; Guber, Fedor; Guernane, Rachid; Guerra Gutierrez, Cesar; Guerzoni, Barbara; Guilbaud, Maxime Rene Joseph; Gulbrandsen, Kristjan Herlache; Gunji, Taku; Gupta, Anik; Gupta, Ramni; Gutbrod, Hans; Haaland, Oystein Senneset; Hadjidakis, Cynthia Marie; Haiduc, Maria; Hamagaki, Hideki; Hamar, Gergoe; Hanratty, Luke David; Hansen, Alexander; Harmanova, Zuzana; Harris, John William; Hartig, Matthias; Hasegan, Dumitru; Hatzifotiadou, Despoina; Hayrapetyan, Arsen; Heckel, Stefan Thomas; Heide, Markus Ansgar; Helstrup, Haavard; Herghelegiu, Andrei Ionut; Herrera Corral, Gerardo Antonio; Herrmann, Norbert; Hess, Benjamin Andreas; Hetland, Kristin Fanebust; Hicks, Bernard; Hille, Per Thomas; Hippolyte, Boris; Horaguchi, Takuma; Hori, Yasuto; Hristov, Peter Zahariev; Hrivnacova, Ivana; Huang, Meidana; Humanic, Thomas; Hwang, Dae Sung; Ichou, Raphaelle; Ilkaev, Radiy; Ilkiv, Iryna; Inaba, Motoi; Incani, Elisa; Innocenti, Gian Michele; Ippolitov, Mikhail; Irfan, Muhammad; Ivan, Cristian George; Ivanov, Andrey; Ivanov, Marian; Ivanov, Vladimir; Ivanytskyi, Oleksii; Jacholkowski, Adam Wlodzimierz; Jacobs, Peter; Jangal, Swensy Gwladys; Janik, Malgorzata Anna; Janik, Rudolf; Jayarathna, Sandun; Jena, Satyajit; Jha, Deeptanshu Manu; Jimenez Bustamante, Raul Tonatiuh; Jirden, Lennart; Jones, Peter Graham; Jung, Hyung Taik; Jusko, Anton; Kakoyan, Vanik; Kalcher, Sebastian; Kalinak, Peter; Kalliokoski, Tuomo Esa Aukusti; Kalweit, Alexander Philipp; Kanaki, Kalliopi; Kang, Ju Hwan; Kaplin, Vladimir; Karasu Uysal, Ayben; Karavichev, Oleg; Karavicheva, Tatiana; Karpechev, Evgeny; Kazantsev, Andrey; Kebschull, Udo Wolfgang; Keidel, Ralf; Khan, Mohisin Mohammed; Khan, Palash; Khan, Shuaib Ahmad; Khanzadeev, Alexei; Kharlov, Yury; Kileng, Bjarte; Kim, Beomkyu; Kim, Dong Jo; Kim, Do Won; Kim, Jonghyun; Kim, Jin Sook; Kim, Minwoo; Kim, Mimae; Kim, Se Yong; Kim, Seon Hee; Kim, Taesoo; Kirsch, Stefan; Kisel, Ivan; Kiselev, Sergey; Kisiel, Adam Ryszard; Klay, Jennifer Lynn; Klein, Jochen; Klein-Bosing, Christian; Kluge, Alexander; Knichel, Michael Linus; Knospe, Anders Garritt; Koch, Kathrin; Kohler, Markus; Kolojvari, Anatoly; Kondratiev, Valery; Kondratyeva, Natalia; Konevskih, Artem; Korneev, Andrey; Kour, Ravjeet; Kowalski, Marek; Kox, Serge; Koyithatta Meethaleveedu, Greeshma; Kral, Jiri; Kralik, Ivan; Kramer, Frederick; Kraus, Ingrid Christine; Krawutschke, Tobias; Krelina, Michal; Kretz, Matthias; Krivda, Marian; Krizek, Filip; Krus, Miroslav; Kryshen, Evgeny; Krzewicki, Mikolaj; Kucheriaev, Yury; Kuhn, Christian Claude; Kuijer, Paul; Kulakov, Igor; Kumar, Jitendra; Kurashvili, Podist; Kurepin, A; Kurepin, AB; Kuryakin, Alexey; Kushpil, Svetlana; Kushpil, Vasily; Kweon, Min Jung; Kwon, Youngil; La Pointe, Sarah Louise; La Rocca, Paola; Ladron de Guevara, Pedro; Lakomov, Igor; Langoy, Rune; Lara, Camilo Ernesto; Lardeux, Antoine Xavier; Lazzeroni, Cristina; Le Bornec, Yves; Lea, Ramona; Lechman, Mateusz; Lee, Graham Richard; Lee, Ki Sang; Lee, Sung Chul; Lefevre, Frederic; Lehnert, Joerg Walter; Leistam, Lars; Lemmon, Roy Crawford; Lenhardt, Matthieu Laurent; Lenti, Vito; Leon Monzon, Ildefonso; Leon Vargas, Hermes; Leoncino, Marco; Levai, Peter; Lien, Jorgen; Lietava, Roman; Lindal, Svein; Lindenstruth, Volker; Lippmann, Christian; Lisa, Michael Annan; Liu, Lijiao; Loenne, Per-Ivar; Loggins, Vera; Loginov, Vitaly; Lohn, Stefan Bernhard; Lohner, Daniel; Loizides, Constantinos; Loo, Kai Krister; Lopez, Xavier Bernard; Lopez Torres, Ernesto; Lovhoiden, Gunnar; Lu, Xianguo; Luettig, Philipp; Lunardon, Marcello; Luo, Jiebin; Luparello, Grazia; Luquin, Lionel; Luzzi, Cinzia; Ma, Rongrong; Maevskaya, Alla; Mager, Magnus; Mahapatra, Durga Prasad; Maire, Antonin; Mal'Kevich, Dmitry; Malaev, Mikhail; Maldonado Cervantes, Ivonne Alicia; Malinina, Ludmila; Malzacher, Peter; Mamonov, Alexander; Manceau, Loic Henri Antoine; Manko, Vladislav; Manso, Franck; Manzari, Vito; Mao, Yaxian; Marchisone, Massimiliano; Mares, Jiri; Margagliotti, Giacomo Vito; Margotti, Anselmo; Marin, Ana Maria; Marin Tobon, Cesar Augusto; Markert, Christina; Martashvili, Irakli; Martinengo, Paolo; Martinez, Mario Ivan; Martinez Davalos, Arnulfo; Martinez Garcia, Gines; Martynov, Yevgen; Mas, Alexis Jean-Michel; Masciocchi, Silvia; Masera, Massimo; Masoni, Alberto; Mastromarco, Mario; Mastroserio, Annalisa; Matthews, Zoe Louise; Matyja, Adam Tomasz; Mayani, Daniel; Mayer, Christoph; Mazer, Joel; Mazzoni, Alessandra Maria; Meddi, Franco; Menchaca-Rocha, Arturo Alejandro; Mercado Perez, Jorge; Meres, Michal; Miake, Yasuo; Milano, Leonardo; Milosevic, Jovan; Mischke, Andre; Mishra, Aditya Nath; Miskowiec, Dariusz; Mitu, Ciprian Mihai; Mlynarz, Jocelyn; Mohanty, Ajit Kumar; Mohanty, Bedangadas; Molnar, Levente; Montano Zetina, Luis Manuel; Monteno, Marco; Montes, Esther; Moon, Taebong; Morando, Maurizio; Moreira De Godoy, Denise Aparecida; Moretto, Sandra; Morsch, Andreas; Muccifora, Valeria; Mudnic, Eugen; Muhuri, Sanjib; Mukherjee, Maitreyee; Muller, Hans; Munhoz, Marcelo; Musa, Luciano; Musso, Alfredo; Nandi, Basanta Kumar; Nania, Rosario; Nappi, Eugenio; Nattrass, Christine; Naumov, Nikolay; Navin, Sparsh; Nayak, Tapan Kumar; Nazarenko, Sergey; Nazarov, Gleb; Nedosekin, Alexander; Nicassio, Maria; Niculescu, Mihai; Nielsen, Borge Svane; Niida, Takafumi; Nikolaev, Sergey; Nikolic, Vedran; Nikulin, Sergey; Nikulin, Vladimir; Nilsen, Bjorn Steven; Nilsson, Mads Stormo; Noferini, Francesco; Nomokonov, Petr; Nooren, Gerardus; Novitzky, Norbert; Nyanin, Alexandre; Nyatha, Anitha; Nygaard, Casper; Nystrand, Joakim Ingemar; Oeschler, Helmut Oskar; Oh, Saehanseul; Oh, Sun Kun; Oleniacz, Janusz; Oppedisano, Chiara; Ortona, Giacomo; Oskarsson, Anders Nils Erik; Otwinowski, Jacek Tomasz; Oyama, Ken; Pachmayer, Yvonne Chiara; Pachr, Milos; Padilla, Fatima; Pagano, Paola; Paic, Guy; Painke, Florian; Pajares, Carlos; Pal, S; Pal, Susanta Kumar; Palaha, Arvinder Singh; Palmeri, Armando; Papikyan, Vardanush; Pappalardo, Giuseppe; Park, Woo Jin; Passfeld, Annika; Patalakha, Dmitri Ivanovich; Paticchio, Vincenzo; Pavlinov, Alexei; Pawlak, Tomasz Jan; Peitzmann, Thomas; Pereira Da Costa, Hugo Denis Antonio; Pereira De Oliveira Filho, Elienos; Peresunko, Dmitri; Perez Lara, Carlos Eugenio; Perez Lezama, Edgar; Perini, Diego; Perrino, Davide; Peryt, Wiktor Stanislaw; Pesci, Alessandro; Peskov, Vladimir; Pestov, Yury; Petracek, Vojtech; Petran, Michal; Petris, Mariana; Petrov, Plamen Rumenov; Petrovici, Mihai; Petta, Catia; Piano, Stefano; Piccotti, Anna; Pikna, Miroslav; Pillot, Philippe; Pinazza, Ombretta; Pinsky, Lawrence; Pitz, Nora; Piuz, Francois; Piyarathna, Danthasinghe; Ploskon, Mateusz Andrzej; Pluta, Jan Marian; Pochybova, Sona; Podesta Lerma, Pedro Luis Manuel; Poghosyan, Martin; Polichtchouk, Boris; Pop, Amalia; Porteboeuf-Houssais, Sarah; Pospisil, Vladimir; Potukuchi, Baba; Prasad, Sidharth Kumar; Preghenella, Roberto; Prino, Francesco; Pruneau, Claude Andre; Pshenichnov, Igor; Puchagin, Sergey; Puddu, Giovanna; Pujahari, Prabhat Ranjan; Pujol Teixido, Jordi; Pulvirenti, Alberto; Punin, Valery; Putis, Marian; Putschke, Jorn Henning; Quercigh, Emanuele; Qvigstad, Henrik; Rachevski, Alexandre; Rademakers, Alphonse; Radomski, Sylwester; Raiha, Tomi Samuli; Rak, Jan; Rakotozafindrabe, Andry Malala; Ramello, Luciano; Ramirez Reyes, Abdiel; Raniwala, Rashmi; Raniwala, Sudhir; Rasanen, Sami Sakari; Rascanu, Bogdan Theodor; Rathee, Deepika; Read, Kenneth Francis; Real, Jean-Sebastien; Redlich, Krzysztof; Reichelt, Patrick; Reicher, Martijn; Renfordt, Rainer Arno Ernst; Reolon, Anna Rita; Reshetin, Andrey; Rettig, Felix Vincenz; Revol, Jean-Pierre; Reygers, Klaus Johannes; Riccati, Lodovico; Ricci, Renato Angelo; Richert, Tuva; Richter, Matthias Rudolph; Riedler, Petra; Riegler, Werner; Riggi, Francesco; Rodrigues Fernandes Rabacal, Bartolomeu; Rodriguez Cahuantzi, Mario; Rodriguez Manso, Alis; Roed, Ketil; Rohr, David; Rohrich, Dieter; Romita, Rosa; Ronchetti, Federico; Rosnet, Philippe; Rossegger, Stefan; Rossi, Andrea; Roy, Christelle Sophie; Roy, Pradip Kumar; Rubio Montero, Antonio Juan; Rui, Rinaldo; Russo, Riccardo; Ryabinkin, Evgeny; Rybicki, Andrzej; Sadovsky, Sergey; Safarik, Karel; Sahoo, Raghunath; Sahu, Pradip Kumar; Saini, Jogender; Sakaguchi, Hiroaki; Sakai, Shingo; Sakata, Dosatsu; Salgado, Carlos Albert; Salzwedel, Jai; Sambyal, Sanjeev Singh; Samsonov, Vladimir; Sanchez Castro, Xitzel; Sandor, Ladislav; Sandoval, Andres; Sano, Masato; Sano, Satoshi; Santo, Rainer; Santoro, Romualdo; Sarkamo, Juho Jaako; Scapparone, Eugenio; Scarlassara, Fernando; Scharenberg, Rolf Paul; Schiaua, Claudiu Cornel; Schicker, Rainer Martin; Schmidt, Christian Joachim; Schmidt, Hans Rudolf; Schreiner, Steffen; Schuchmann, Simone; Schukraft, Jurgen; Schutz, Yves Roland; Schwarz, Kilian Eberhard; Schweda, Kai Oliver; Scioli, Gilda; Scomparin, Enrico; Scott, Patrick Aaron; Scott, Rebecca; Segato, Gianfranco; Selyuzhenkov, Ilya; Senyukov, Serhiy; Seo, Jeewon; Serci, Sergio; Serradilla, Eulogio; Sevcenco, Adrian; Shabetai, Alexandre; Shabratova, Galina; Shahoyan, Ruben; Sharma, Natasha; Sharma, Satish; Shigaki, Kenta; Shimomura, Maya; Shtejer, Katherin; Sibiriak, Yury; Siciliano, Melinda; Sicking, Eva; Siddhanta, Sabyasachi; Siemiarczuk, Teodor; Silvermyr, David Olle Rickard; Silvestre, Catherine; Simatovic, Goran; Simonetti, Giuseppe; Singaraju, Rama Narayana; Singh, Ranbir; Singha, Subhash; Singhal, Vikas; Sinha, Bikash; Sinha, Tinku; Sitar, Branislav; Sitta, Mario; Skaali, Bernhard; Skjerdal, Kyrre; Smakal, Radek; Smirnov, Nikolai; Snellings, Raimond; Sogaard, Carsten; Soltz, Ron Ariel; Son, Hyungsuk; Song, Jihye; Song, Myunggeun; Soos, Csaba; Soramel, Francesca; Sputowska, Iwona; Spyropoulou-Stassinaki, Martha; Srivastava, Brijesh Kumar; Stachel, Johanna; Stan, Ionel; Stefanek, Grzegorz; Stefanini, Giorgio; Steinbeck, Timm Morten; Steinpreis, Matthew; Stenlund, Evert Anders; Steyn, Gideon Francois; Stiller, Johannes Hendrik; Stocco, Diego; Stolpovskiy, Mikhail; Strabykin, Kirill; Strmen, Peter; Suaide, Alexandre Alarcon do Passo; Subieta Vasquez, Martin Alfonso; Sugitate, Toru; Suire, Christophe Pierre; Sukhorukov, Mikhail; Sultanov, Rishat; Sumbera, Michal; Susa, Tatjana; Szanto de Toledo, Alejandro; Szarka, Imrich; Szczepankiewicz, Adam; Szostak, Artur Krzysztof; Szymanski, Maciej; Takahashi, Jun; Tapia Takaki, Daniel Jesus; Tarazona Martinez, Alfonso; Tauro, Arturo; Tejeda Munoz, Guillermo; Telesca, Adriana; Terrevoli, Cristina; Thader, Jochen Mathias; Thomas, Deepa; Tieulent, Raphael Noel; Timmins, Anthony; Toia, Alberica; Torii, Hisayuki; Tosello, Flavio; Trzaska, Wladyslaw Henryk; Tsuji, Tomoya; Tumkin, Alexandr; Turrisi, Rosario; Tveter, Trine Spedstad; Ulery, Jason Glyndwr; Ullaland, Kjetil; Ulrich, Jochen; Uras, Antonio; Urban, Jozef; Urciuoli, Guido Marie; Usai, Gianluca; Vajzer, Michal; Vala, Martin; Valencia Palomo, Lizardo; Vallero, Sara; van der Kolk, Naomi; van Leeuwen, Marco; Vande Vyvre, Pierre; Vannucci, Luigi; Vargas, Aurora Diozcora; Varma, Raghava; Vasileiou, Maria; Vasiliev, Andrey; Vechernin, Vladimir; Veldhoen, Misha; Venaruzzo, Massimo; Vercellin, Ermanno; Vergara, Sergio; Vernet, Renaud; Verweij, Marta; Vickovic, Linda; Viesti, Giuseppe; Vikhlyantsev, Oleg; Vilakazi, Zabulon; Villalobos Baillie, Orlando; Vinogradov, Alexander; Vinogradov, Leonid; Vinogradov, Yury; Virgili, Tiziano; Viyogi, Yogendra; Vodopianov, Alexander; Voloshin, Kirill; Voloshin, Sergey; Volpe, Giacomo; von Haller, Barthelemy; Vranic, Danilo; Øvrebekk, Gaute; Vrlakova, Janka; Vulpescu, Bogdan; Vyushin, Alexey; Wagner, Boris; Wagner, Vladimir; Wan, Renzhuo; Wang, Dong; Wang, Mengliang; Wang, Yifei; Wang, Yaping; Watanabe, Kengo; Weber, Michael; Wessels, Johannes; Westerhoff, Uwe; Wiechula, Jens; Wikne, Jon; Wilde, Martin Rudolf; Wilk, Alexander; Wilk, Grzegorz Andrzej; Williams, Crispin; Windelband, Bernd Stefan; Xaplanteris Karampatsos, Leonidas; Yaldo, Chris G; Yamaguchi, Yorito; Yang, Hongyan; Yang, Shiming; Yasnopolsky, Stanislav; Yi, JunGyu; Yin, Zhongbao; Yoo, In-Kwon; Yoon, Jongik; Yu, Weilin; Yuan, Xianbao; Yushmanov, Igor; Zach, Cenek; Zampolli, Chiara; Zaporozhets, Sergey; Zarochentsev, Andrey; Zavada, Petr; Zaviyalov, Nikolai; Zbroszczyk, Hanna Paulina; Zelnicek, Pierre; Zgura, Sorin Ion; Zhalov, Mikhail; Zhang, Haitao; Zhang, Xiaoming; Zhou, Daicui; Zhou, Fengchu; Zhou, You; Zhu, Jianhui; Zhu, Xiangrong; Zichichi, Antonino; Zimmermann, Alice; Zinovjev, Gennady; Zoccarato, Yannick Denis; Zynovyev, Mykhaylo; Zyzak, Maksym

2013-07-16

Identical neutral kaon pair correlations are measured in $\\sqrt{s}$=7 TeV pp collisions in the ALICE experiment. One-dimensional K$^{0}_{s}$-K$^{0}_{s}$ correlation functions in terms of the invariant momentum difference of kaon pairs are formed in two multiplicity and two transverse momentum ranges. The femtoscopic parameters for the radius and correlation strength of the kaon source are extracted. The fit includes quantum statistics and final-state interactions of the $a_0/f_0$ resonance. K$^{0}_{s}$-K$^{0}_{s}$ correlations show an increase in radius for increasing multiplicity and a slight decrease in radius for increasing transverse mass, $m_T$, as seen in pion-pion correlations in the pp system and in heavy-ion collisions. Transverse mass scaling is observed between the K$^{0}_{s}$-K$^{0}_{s}$ and pion-pion radii. Also, the first observation is made of the decay of the $f_{2}'$(1525) meson into the K$^{0}_{s}$-K$^{0}_{s}$ channel in pp collisions.

Intra-annual distribution of Temora longicornis biomass in the Gulf of Gdańsk (the southern Baltic Sea – numerical simulations

Directory of Open Access Journals (Sweden)

Lidia Dzierzbicka-Głowacka

2017-11-01

Full Text Available A population model of the copepod Temora longicornis coupled with the ecosystem model 3D CEMBS (Coupled Ecosystem Model of the Baltic Sea was used to determine the intra-annual distribution of the species biomass in the Gdańsk Basin (the southern Baltic Sea. The population model for T. longicornis consists of twelve equations for twelve state variables, six for mass and six for abundance, i.e. two state variables for each of the six model stages of the development: eggs (Egg, non-feeding stage (N1, subsequent nauplii stages (N2–N6, two copepodite stages (C1–C3 and C4–C5 and adults (C6. The empirical validation of the population model was based on in situ data collected in 2010 and 2011 in the Gdańsk Deep and the western part of the Gulf of Gdańsk. The highest values of the model biomass occurred in the period of high water temperatures – in June 2010 and July 2011 in the Gulf of Gdańsk (ca 5200 mg wet weight (w.w. m–2 and 6300 mg w.w. m–2, and for almost the whole summer in the Gdańsk Deep (24 500 mg w.w. m–2 and 27 800 mg w.w. m–2. Temora longicornis produced 4 to 5 generations per year in the Gulf of Gdańsk and Gdańsk Deep, respectively. The population model was satisfactorily verified and the calculated results were consistent with the in situ data. Despite some differences between the field and model data, the developed population model of T. longicornis is the first model for this species in the Baltic Sea and, even though it needs further improvement, it can be a useful tool for determining the population dynamics of the species and ecological relationships in the environment.

The Making of the Gdańsk Metropolitan Region. Local Discourses of Identities, Powers, and Hopes

Directory of Open Access Journals (Sweden)

Czepczyński Mariusz

2014-12-01

Full Text Available The process of metropolitanisation of the Gdańsk area is facilitated by public discourse involving local and regional politicians, media, and inhabitants. The discussion is based upon historical narrations, but also local ambitions, hopes and emotions, as well as infrastructural projects and investment attractiveness. Foucault suggests that modern power is a dispersed set of micro-practices, many of which operate through the normalising gaze of surveillance regimes. Gdańsk metropolitan cooperation, competition and encounters make the core of the paper; local and regional unifying initiatives and processes are accompanied by examples of separatism, identity conflicts, and political disagreements

Chronic ethanol exposure induces SK-N-SH cell apoptosis by increasing N-methyl-D-aspartic acid receptor expression and intracellular calcium.

Science.gov (United States)

Wang, Hongbo; Wang, Xiaolong; Li, Yan; Yu, Hao; Wang, Changliang; Feng, Chunmei; Xu, Guohui; Chen, Jiajun; You, Jiabin; Wang, Pengfei; Wu, Xu; Zhao, Rui; Zhang, Guohua

2018-04-01

It has been identified that chronic ethanol exposure damages the nervous system, particularly neurons. There is scientific evidence suggesting that neuronal loss caused by chronic ethanol exposure has an association with neuron apoptosis and intracellular calcium oscillation is one of the primary inducers of apoptosis. Therefore, the present study aimed to investigate the inductive effects of intracellular calcium oscillation on apoptosis in SK-N-SH human neuroblastoma cells and the protective effects of the N-methyl-D-aspartic acid receptor (NMDAR) antagonist, memantine, on SK-N-SH cell apoptosis caused by chronic ethanol exposure. SK-N-SH cells were treated with 100 mM ethanol and memantine (4 µM) for 2 days. Protein expression of NR1 was downregulated by RNA interference (RNAi). Apoptosis was detected by Annexin V/propidium iodide (PI) double-staining and flow cytometry and cell viability was detected using an MTS kit. Fluorescence dual wavelength spectrophotometry was used to determine the intracellular calcium concentration and the levels of NR1 and caspase-3 were detected using western blotting. NR1 mRNA levels were also detected using qPCR. It was found that chronic ethanol exposure reduced neuronal cell viability and caused apoptosis of SK-N-SH cells, and the extent of damage in SK-N-SH cells was associated with ethanol exposure concentration and time. In addition, chronic ethanol exposure increased the concentration of intracellular calcium in SK-N-SH cells by inducing the expression of NMDAR, resulting in apoptosis, and memantine treatment reduced ethanol-induced cell apoptosis. The results of the present study indicate that the application of memantine may provide a novel strategy for the treatment of alcoholic dementia.

A novel subtilase with NaCl-activated and oxidant-stable activity from Virgibacillus sp. SK37

Directory of Open Access Journals (Sweden)

Yamabhai Montarop

2011-06-01

Full Text Available Abstract Background Microbial proteases are one of the most commercially valuable enzymes, of which the largest market share has been taken by subtilases or alkaline proteases of the Bacillus species. Despite a large amount of information on microbial proteases, a search for novel proteases with unique properties is still of interest for both basic and applied aspects of this highly complex class of enzymes. Oxidant stable proteases (OSPs have been shown to have a wide application in the detergent and bleaching industries and recently have become one of the most attractive enzymes in various biotechnological applications. Results A gene encoding a novel member of the subtilase superfamily was isolated from Virgibacillus sp. SK37, a protease-producing bacterium isolated from Thai fish sauce fermentation. The gene was cloned by an activity-based screening of a genomic DNA expression library on Luria-Bertani (LB agar plates containing 1 mM IPTG and 3% skim milk. Of the 100,000 clones screened, all six isolated positive clones comprised one overlapping open reading frame of 45% identity to the aprX gene from Bacillus species. This gene, designated aprX-sk37 was cloned into pET21d(+ and over-expressed in E. coli BL21(DE3. The enzyme product, designated AprX-SK37, was purified by an immobilized metal ion affinity chromatography to apparent homogeneity and characterized. The AprX-SK37 enzyme showed optimal catalytic conditions at pH 9.5 and 55°C, based on the azocasein assay containing 5 mM CaCl2. Maximum catalytic activity was found at 1 M NaCl with residual activity of 30% at 3 M NaCl. Thermal stability of the enzyme was also enhanced by 1 M NaCl. The enzyme was absolutely calcium-dependent, with optimal concentration of CaCl2 at 15 mM. Inhibitory effects by phenylmethanesulfonyl fluoride and ethylenediaminetetraacetic acid indicated that this enzyme is a metal-dependent serine protease. The enzyme activity was sensitive towards reducing agents

Reflection seismic studies over the end-glacial Burträsk fault, Skellefteå, Sweden

Directory of Open Access Journals (Sweden)

C. Juhlin

2011-01-01

Full Text Available Reflection seismic data were acquired along a ca. 22 km long profile over the end-glacial Burträsk fault with a nominal receiver and source spacing of 20 m. A steeply dipping reflection can be correlated to the Burträsk fault, indicating that the fault dips at about 55° to the southeast near the surface. The reflection from the fault is rather poorly imaged, probably due to a lateral offset in the fault of about 1 km at this location and the crookedness of the seismic profile in the vicinity of the fault. A more pronounced steeply dipping reflection is observed about 4 km southeast of the Burträsk fault. Based on its correlation with a topographic low at the surface this reflection is interpreted to originate from a fracture zone. There are no signs of large displacements along this zone as the glacial ice receded, but earthquakes could be associated with it today. Other reflections on the processed seismic section may originate from changes in lithological variations in the supra-crustal rocks or from intrusions of more mafic rock. Constraints on the fault geometry provided by the reflection seismic data will help determine what stresses were required to activate the fault when the major rupture along it occurred ca. 9500 years ago.

Preventive and therapeutic effects of SkQ1-containing Visomitin eye drops against light-induced retinal degeneration.

Science.gov (United States)

Novikova, Yu P; Gancharova, O S; Eichler, O V; Philippov, P P; Grigoryan, E N

2014-10-01

The human retina is constantly affected by light of varying intensity, this being especially true for photoreceptor cells and retinal pigment epithelium. Traditionally, photoinduced damages of the retina are induced by visible light of high intensity in albino rats using the LIRD (light-induced retinal degeneration) model. This model allows study of pathological processes in the retina and the search for retinoprotectors preventing retinal photodamage. In addition, the etiology and mechanisms of retina damage in the LIRD model have much in common with the mechanisms of the development of age-related retinal disorders, in particular, with age-related macular degeneration (AMD). We have studied preventive and therapeutic effects of Visomitin eye drops (based on the mitochondria-targeted antioxidant SkQ1) on albino rat retinas damaged by bright light. In the first series of experiments, rats receiving Visomitin for two weeks prior to illumination demonstrated significantly less expressed atrophic and degenerative changes in the retina compared to animals receiving similar drops with no SkQ1. In the second series, the illuminated rats were treated for two weeks with Visomitin or similar drops without SkQ1. The damaged retinas of the experimental animals were repaired much more effectively than those of the control animals. Therefore, we conclude that Visomitin SkQ1-containing eye drops have pronounced preventive and therapeutic effects on the photodamaged retina and might be recommended as a photoprotector and a pharmaceutical preparation for the treatment of AMD in combination with conventional medicines.

Surrealist's Dreams and Classical Tradition

Czech Academy of Sciences Publication Activity Database

Bažant, Jan

2015-01-01

Roč. 48, č. 1 (2015), s. 82-94 ISSN 0044-9008 Institutional support: RVO:67985955 Keywords : Medusa * snakes * surrealism Subject RIV: AB - History http://www.dejum.sav.sk/?language=sk§ion=magazine&id=98&textId=590&sub=study

Lycopene Inhibits Metastasis of Human Liver Adenocarcinoma SK-Hep-1 Cells by Downregulation of NADPH Oxidase 4 Protein Expression.

Science.gov (United States)

Jhou, Bo-Yi; Song, Tuzz-Ying; Lee, Inn; Hu, Miao-Lin; Yang, Nae-Cherng

2017-08-16

NADPH oxidase 4 (NOX4), with the sole function to produce reactive oxygen species (ROS), can be a molecular target for disrupting cancer metastasis. Several studies have indicated that lycopene exhibited anti-metastatic actions in vitro and in vivo. However, the role of NOX4 in the anti-metastatic action of lycopene remains unknown. Herein, we first confirmed the anti-metastatic effect of lycopene (0.1-5 μM) on human liver adenocarcinoma SK-Hep-1 cells. We showed that lycopene significantly inhibited NOX4 protein expression, with the strongest inhibition of 64.3 ± 10.2% (P lycopene. Lycopene also significantly inhibited NOX4 mRNA expression, NOX activity, and intracellular ROS levels in SK-Hep-1 cells. We then determined the effects of lycopene on transforming growth factor β (TGF-β)-induced metastasis. We found that TGF-β (5 ng/mL) significantly increased migration, invasion, and adhesion activity, the intracellular ROS level, matrix metalloproteinase 9 (MMP-9) and MMP-2 activities, the level of NOX4 protein expression, and NOX activity. All these TGF-β-induced effects were antagonized by the incubation of SK-Hep-1 cells with lycopene (2.5 μM). Using transient transfection of siRNA against NOX4, we found that the downregulation of NOX4 could mimic lycopene by inhibiting cell migration and the activities of MMP-9 and MMP-2 during the incubation with or without TGF-β on SK-Hep-1 cells. The results demonstrate that the downregulation of NOX4 plays a crucial role in the anti-metastatic action of lycopene in SK-Hep-1 cells.

Recessive variants of MuSK are associated with late onset CMS and predominant limb girdle weakness.

Science.gov (United States)

Owen, David; Töpf, Ana; Preethish-Kumar, Veeramani; Lorenzoni, Paulo José; Vroling, Bas; Scola, Rosana Herminia; Dias-Tosta, Elza; Geraldo, Argemiro; Polavarapu, Kiran; Nashi, Saraswati; Cox, Daniel; Evangelista, Teresinha; Dawson, John; Thompson, Rachel; Senderek, Jan; Laurie, Steven; Beltran, Sergi; Gut, Marta; Gut, Ivo; Nalini, Atchayaram; Lochmüller, Hanns

2018-04-28

Congenital myasthenic syndrome (CMS) is a heterogeneous disorder that causes fatigable muscle weakness. CMS has been associated with variants in the MuSK gene and, to date, 16 patients have been reported. MuSK-CMS patients present a different phenotypic pattern of limb girdle weakness. Here, we describe four additional patients and discuss the phenotypic and clinical relationship with those previously reported. Two novel damaging missense variants are described: c.1742T > A; p.I581N found in homozygosis, and c.1634T > C; p.L545P found in compound heterozygosis with p.R166*. The reported patients had predominant limb girdle weakness with symptom onset at 12, 17, 18, and 30 years of age, and the majority exhibited a good clinical response to Salbutamol therapy, but not to esterase inhibitors. Meta-analysis including previously reported variants revealed an increased likelihood of a severe, respiratory phenotype with null alleles. Missense variants exclusively affecting the kinase domain, but not the catalytic site, are associated with late onset. These data refine the phenotype associated with MuSK-related CMS. © 2018 Wiley Periodicals, Inc.

Upregulation of SK3 and IK1 channels contributes to the enhanced endothelial calcium signaling and the preserved coronary relaxation in obese Zucker rats.

Directory of Open Access Journals (Sweden)

Belén Climent

Full Text Available Endothelial small- and intermediate-conductance KCa channels, SK3 and IK1, are key mediators in the endothelium-derived hyperpolarization and relaxation of vascular smooth muscle and also in the modulation of endothelial Ca2+ signaling and nitric oxide (NO release. Obesity is associated with endothelial dysfunction and impaired relaxation, although how obesity influences endothelial SK3/IK1 function is unclear. Therefore we assessed whether the role of these channels in the coronary circulation is altered in obese animals.In coronary arteries mounted in microvascular myographs, selective blockade of SK3/IK1 channels unmasked an increased contribution of these channels to the ACh- and to the exogenous NO- induced relaxations in arteries of Obese Zucker Rats (OZR compared to Lean Zucker Rats (LZR. Relaxant responses induced by the SK3/IK1 channel activator NS309 were enhanced in OZR and NO- endothelium-dependent in LZR, whereas an additional endothelium-independent relaxant component was found in OZR. Fura2-AM fluorescence revealed a larger ACh-induced intracellular Ca2+ mobilization in the endothelium of coronary arteries from OZR, which was inhibited by blockade of SK3/IK1 channels in both LZR and OZR. Western blot analysis showed an increased expression of SK3/IK1 channels in coronary arteries of OZR and immunohistochemistry suggested that it takes place predominantly in the endothelial layer.Obesity may induce activation of adaptive vascular mechanisms to preserve the dilator function in coronary arteries. Increased function and expression of SK3/IK1 channels by influencing endothelial Ca2+ dynamics might contribute to the unaltered endothelium-dependent coronary relaxation in the early stages of obesity.

Býčí skála Cave, Czech Republic: Radiocarbon dates of rock paintings

Czech Academy of Sciences Publication Activity Database

Svoboda, Jiří; van der Plicht, H.; Balák, I.

2005-01-01

Roč. 43, - (2005), s. 7-9 ISSN 1022-3282 Institutional research plan: CEZ:AV0Z80010507 Keywords : Býčí skála Czech Republic * rock art * radiocarbon dating Subject RIV: AC - Archeology, Anthropology, Ethnology

Image Reference Database in Teleradiology: Migrating to WWW

Science.gov (United States)

Pasqui, Valdo

The paper presents a multimedia Image Reference Data Base (IRDB) used in Teleradiology. The application was developed at the University of Florence in the framework of the European Community TELEMED Project. TELEMED overall goals and IRDB requirements are outlined and the resulting architecture is described. IRDB is a multisite database containing radiological images, selected because their scientific interest, and their related information. The architecture consists of a set of IRDB Installations which are accessed from Viewing Stations (VS) located at different medical sites. The interaction between VS and IRDB Installations follows the client-server paradigm and uses an OSI level-7 protocol, named Telemed Communication Language. After reviewing Florence prototype implementation and experimentation, IRDB migration to World Wide Web (WWW) is discussed. A possible scenery to implement IRDB on the basis of WWW model is depicted in order to exploit WWW servers and browsers capabilities. Finally, the advantages of this conversion are outlined.

Le rêve dans la psychanalyse

Czech Academy of Sciences Publication Activity Database

Pechar, Jiří

2016-01-01

Roč. 12, č. 3 (2016), s. 1-5 ISSN 1336-6556 Institutional support: RVO:67985955 Keywords : psychoanalysis * dream-work * condensation * displacement * screen-memory * Freud Subject RIV: AA - Philosophy ; Religion http://www.ostium.sk/sk/le-r%c8%87ve-dans-la-psychanalyse/

La lecture de Merleau-Ponty par Renaud Barbaras

Czech Academy of Sciences Publication Activity Database

Pechar, Jiří

2015-01-01

Roč. 11, č. 2 (2015), s. 1-6 ISSN 1336-6556 Institutional support: RVO:67985955 Keywords : Merleau-Ponty * Husserl * phenomenology * linguistics of Ferdinand de Saussure Subject RIV: AA - Philosophy ; Religion http://www.ostium.sk/sk/la-lecture-de-merleau-ponty-par-renaud-barbaras/

Aucun oeil ne l'a vu. Sur une force étrange d'agir pour les choses lointaines d'apres Levinas

Czech Academy of Sciences Publication Activity Database

Bierhanzl, Jan

2015-01-01

Roč. 11, č. 2 (2015) ISSN 1336-6556 R&D Projects: GA ČR(CZ) GAP401/10/1164 Institutional support: RVO:67985955 Keywords : invisibilty * utopia * action * subjectivity Subject RIV: AA - Philosophy ; Religion http://www.ostium.sk/sk/aucun-oeil-ne-la-vu/

Intracellular synthesis of glutamic acid in Bacillus methylotrophicus SK19.001, a glutamate-independent poly(γ-glutamic acid)-producing strain.

Science.gov (United States)

Peng, Yingyun; Zhang, Tao; Mu, Wanmeng; Miao, Ming; Jiang, Bo

2016-01-15

Bacillus methylotrophicus SK19.001 is a glutamate-independent strain that produces poly(γ-glutamic acid) (γ-PGA), a polymer of D- and L-glutamic acids that possesses applications in food, the environment, agriculture, etc. This study was undertaken to explore the synthetic pathway of intracellular L- and D-glutamic acid in SK19.001 by investigating the effects of tricarboxylic acid cycle intermediates and different amino acids as metabolic precursors on the production of γ-PGA and analyzing the activities of the enzymes involved in the synthesis of L- and D-glutamate. Tricarboxylic acid cycle intermediates and amino acids could participate in the synthesis of γ-PGA via independent pathways in SK19.001. L-Aspartate aminotransferase, L-glutaminase and L-glutamate synthase were the enzymatic sources of L-glutamate. Glutamate racemase was responsible for the formation of D-glutamate for the synthesis of γ-PGA, and the synthetase had stereoselectivity for glutamate substrate. The enzymatic sources of L-glutamate were investigated for the first time in the glutamate-independent γ-PGA-producing strain, and multiple enzymatic sources of L-glutamate were verified in SK19.001, which will benefit efforts to improve production of γ-PGA with metabolic engineering strategies. © 2015 Society of Chemical Industry.

Is strategic asset management applicable to small and medium utilities?

Science.gov (United States)

Alegre, Helena

2010-01-01

Urban water infrastructures provide essential services to modern societies and represent a major portion of the value of municipal physical assets. Managing these assets rationally is therefore fundamental for the sustainability of the services and to the economy of societies. "Asset Management" (AM) is a modern term for an old practice--assets have always been managed. In recent years, significant evolution occurred in terms of the AM formal approaches, of the monitoring and decision support tools and of the implementation success cases. However, most tools developed are too sophisticated and data seek for small utilities. The European R&D network COST Action C18 ( E-mail: www.costc18.org) identified key research problems related to the management of urban water infrastructures, currently not covered by on-going projects of the European Framework Program. The top 1 topic is "Efficient management of small community". This paper addresses challenges and opportunities for small and medium utilities with regard to infrastructure AM (IAM). To put this into context, the first sections discuss the need for IAM, highlight key recent developments, and present IAM drivers, as well as research and development gaps, priorities and products needed.

The 5K70SK automatically tuned, high power, S-band klystron

Science.gov (United States)

Goldfinger, A.

1977-01-01

Primary objectives include delivery of 44 5K70SK klystron amplifier tubes and 26 remote tuner assemblies with spare parts kits. Results of a reliability demonstration on a klystron test cavity are discussed, along with reliability tests performed on a remote tuning unit. Production problems and one design modification are reported and discussed. Results of PAT and DVT are included.

Food truck som ett nytt fenomen i Skåne

OpenAIRE

Fromell, Hilda; Winter, Regina

2016-01-01

Food truck is a mobile restaurant business which originates from the United States, and can now be seen also in Sweden. There are specific guidelines regarding the food that are served from the food trucks rolling the streets of Skåne from 2013. For example the food should be ecological, which is in keeping with the other municipal goals regarding food and meal. The concept is communicated and marketed through social media, which makes it possible to effectively reach many people. Four food t...

BMP9 inhibits proliferation and metastasis of HER2-positive SK-BR-3 breast cancer cells through ERK1/2 and PI3K/AKT pathways.

Science.gov (United States)

Ren, Wei; Liu, Yuehong; Wan, Shaoheng; Fei, Chang; Wang, Wei; Chen, Yingying; Zhang, Zhihui; Wang, Ting; Wang, Jinshu; Zhou, Lan; Weng, Yaguang; He, Tongchuan; Zhang, Yan

2014-01-01

Bone morphogenetic protein 9 (BMP9), a member of TGF-β superfamily, is reported to inhibit the growth and migration of prostate cancer, osteosarcoma and triple-negative MDA-MB-231 breast cancer cells. However, little is known about the effect of on the biological behaviors of HER2-positive SK-BR-3 breast cancer cells and the underlying mechanisms. This study aimed to investigate the effects of BMP9 on the proliferation and metastasis of SK-BR-3 cells with BMP9 over-expression or BMP9 down-regulated expression. Results indicated that exogenously expressed BMP9 inhibited the proliferation and metastasis of SK-BR-3 cells while decreased endogenous BMP9 expression in SK-BR-3 cells promoted the proliferation and migration of breast cancer cells in vitro and in vivo. In SK-BR-3 cells with BMP9 over-expression, the phosphorylation of HER2, ERK1/2 and AKT was markedly suppressed and the HER2 expression decreased at both mRNA and protein levels, while opposite results were observed in SK-BR-3 cells with BMP9 knock down. When the phosphorylation of ERK1/2 and PI3K/AKT was inhibited by PD98059 and LY294002, respectively, the decreased proliferation and invasion induced by BMP9 knock down were eliminated. These findings suggest that BMP9 can inhibit the proliferation and metastasis of SK-BR-3 cells via inactivating ERK1/2 and PI3K/AKT signaling pathways. Thus, BMP9 may serve as a useful agent in the treatment of HER-2 positive breast cancer.

A dehydrin-dehydrin interaction: the case of SK3 from Opuntia streptacantha

Directory of Open Access Journals (Sweden)

Itzell eHernandez

2014-10-01

Full Text Available Dehydrins belongs to a large group of highly hydrophilic proteins known as Late Embryogenesis Abundant (LEA proteins. It is well know that dehydrins are intrinsically disordered plant proteins that accumulate during the late stages of embryogenesis and in response to abiotic stresses; however, the molecular mechanisms by which their functions are carried out are still unclear. We have previously reported that transgenic Arabidopsis plants overexpressing an Opuntia streptacantha SK3 dehydrin (OpsDHN1 show enhanced tolerance to freezing stress. Herein, we show using a split-ubiquitin yeast two-hybrid system that OpsDHN1 dimerizes. We found that the deletion of regions containing K-segments and the histidine-rich region in the OpsDHN1 protein affects dimer formation. Not surprisingly, in silico protein sequence analysis suggests that OpsDHN1 is an intrinsically disordered protein, an observation that was confirmed by circular dichroism and gel filtration of the recombinantly expressed protein. The addition of zinc triggered the association of recombinantly expressed OpsDHN1 protein, likely through its histidine-rich motif. These data brings new insights about the molecular mechanism of the OpsDHN1 SK3-dehydrin

PS1-12sk IS A PECULIAR SUPERNOVA FROM A He-RICH PROGENITOR SYSTEM IN A BRIGHTEST CLUSTER GALAXY ENVIRONMENT

International Nuclear Information System (INIS)

Sanders, N. E.; Soderberg, A. M.; Foley, R. J.; Chornock, R.; Milisavljevic, D.; Margutti, R.; Drout, M. R.; Moe, M.; Berger, E.; Brown, W. R.; Lunnan, R.; Smartt, S. J.; Fraser, M.; Kotak, R.; Magill, L.; Smith, K. W.; Wright, D.; Huang, K.; Urata, Y.; Mulchaey, J. S.

2013-01-01

We report on our discovery and observations of the Pan-STARRS1 supernova (SN) PS1-12sk, a transient with properties that indicate atypical star formation in its host galaxy cluster or pose a challenge to popular progenitor system models for this class of explosion. The optical spectra of PS1-12sk classify it as a Type Ibn SN (SN Ibn; cf. SN 2006jc), dominated by intermediate-width (3 × 10 3 km s –1 ) and time variable He I emission. Our multi-wavelength monitoring establishes the rise time dt ∼ 9-23 days and shows an NUV-NIR spectral energy distribution with temperature ∼> 17 × 10 3 K and a peak magnitude of M z = –18.88 ± 0.02 mag. SN Ibn spectroscopic properties are commonly interpreted as the signature of a massive star (17-100 M ☉ ) explosion within an He-enriched circumstellar medium. However, unlike previous SNe Ibn, PS1-12sk is associated with an elliptical brightest cluster galaxy, CGCG 208–042 (z = 0.054) in cluster RXC J0844.9+4258. The expected probability of an event like PS1-12sk in such environments is low given the measured infrequency of core-collapse SNe in red-sequence galaxies compounded by the low volumetric rate of SN Ibn. Furthermore, we find no evidence of star formation at the explosion site to sensitive limits (Σ Hα ∼ –3 M ☉ yr –1 kpc –2 ). We therefore discuss white dwarf binary systems as a possible progenitor channel for SNe Ibn. We conclude that PS1-12sk represents either a fortuitous and statistically unlikely discovery, evidence for a top-heavy initial mass function in galaxy cluster cooling flow filaments, or the first clue suggesting an alternate progenitor channel for SNe Ibn.

Therapeutic action of the mitochondria-targeted antioxidant SkQ1 on retinopathy in OXYS rats linked with improvement of VEGF and PEDF gene expression.

Directory of Open Access Journals (Sweden)

Anton M Markovets

Full Text Available UNLABELLED: The incidence of age-related macular degeneration (AMD, the main cause of blindness in older patients in the developed countries, is increasing with the ageing population. At present there is no effective treatment for the prevailing geographic atrophy, dry AMD, whereas antiangiogenic therapies successful used in managing the wet form of AMD. Recently we showed that mitochondria-targeted antioxidant plastoquinonyl-decyl-triphenylphosphonium (SkQ1 is able to prevent the development and moreover caused regression of pre-existing signs of the retinopathy in OXYS rats, an animal model of AMD. Here we examine the effects of SkQ1 on expression of key regulators of angiogenesis vascular endothelial growth factor A (VEGF and its antagonist pigment epithelium-derived factor (PEDF genes in the retina of OXYS rats as evidenced by real-time PCR and an ELISA test for VEGF using Wistar rats as control. Ophthalmoscopic examinations confirmed that SkQ1 supplementation (from 1.5 to 3 months of age, 250 nmol/kg prevented development while eye drops SkQ1 (250 nM, from 9 to 12 months caused some reduction of retinopathy signs in OXYS rats and did not reveal any negative effects on the control Wistar rat's retina. Prevention of premature retinopathy by SkQ1 was connected with an increase of VEGF mRNA and protein in OXYS rat's retina up to the levels corresponding to the Wistar rats, and did not involve changes in PEDF expression. In contrast the treatment with SkQ1 drops caused a decrease of VEGF mRNA and protein levels and an increase in the PEDF mRNA level in the middle-aged OXYS rats, but in Wistar rats the changes of gene expression were the opposite. CONCLUSIONS: The beneficial effects of SkQ1 on retinopathy connected with normalization of expression of VEGF and PEDF in the retina of OXYS rats and depended on age of the animals and the stage of retinopathy.

Constant envelope OFDM scheme for 6PolSK-QPSK

Science.gov (United States)

Li, Yupeng; Ding, Ding

2018-03-01

A constant envelope OFDM scheme with phase modulator (PM-CE-OFDM) for 6PolSK-QPSK modulation was demonstrated. Performance under large fiber launch power is measured to check its advantages in counteracting fiber nonlinear impairments. In our simulation, PM-CE-OFDM, RF-assisted constant envelope OFDM (RF-CE-OFDM) and conventional OFDM (Con-OFDM) are transmitted through 80 km standard single mode fiber (SSMF) single channel and WDM system. Simulation results confirm that PM-CE-OFDM has best performance in resisting fiber nonlinearity. In addition, benefiting from the simple system structure, the complexity and cost of PM-CE-OFDM system could be reduced effectively.

Býčí skála: prvé datování skalních maleb

Czech Academy of Sciences Publication Activity Database

Svoboda, Jiří; Plicht van der, J.; Balák, I.

2005-01-01

Roč. 84, - (2005), s. 574-575 ISSN 0042-4544 Institutional research plan: CEZ:AV0Z80010507 Keywords : Býčí skála * rock art * radiocarbon dating Subject RIV: AC - Archeology, Anthropology, Ethnology

A Long-Gap Peripheral Nerve Injury Therapy Using Human Skeletal Muscle-Derived Stem Cells (Sk-SCs: An Achievement of Significant Morphological, Numerical and Functional Recovery.

Directory of Open Access Journals (Sweden)

Tetsuro Tamaki

Full Text Available Losses in vital functions of the somatic motor and sensory nervous system are induced by severe long-gap peripheral nerve transection injury. In such cases, autologous nerve grafts are the gold standard treatment, despite the unavoidable sacrifice of other healthy functions, whereas the prognosis is not always favorable. Here, we use human skeletal muscle-derived stem cells (Sk-SCs to reconstitute the function after long nerve-gap injury. Muscles samples were obtained from the amputated legs from 9 patients following unforeseen accidents. The Sk-SCs were isolated using conditioned collagenase solution, and sorted as CD34+/45- (Sk-34 and CD34-/45-/29+ (Sk-DN/29+ cells. Cells were separately cultured/expanded under optimal conditions for 2 weeks, then injected into the athymic nude mice sciatic nerve long-gap model (7-mm bridging an acellular conduit. After 8-12 weeks, active cell engraftment was observed only in the Sk-34 cell transplanted group, showing preferential differentiation into Schwann cells and perineurial/endoneurial cells, as well as formation of the myelin sheath and perineurium/endoneurium surrounding regenerated axons, resulted in 87% of numerical recovery. Differentiation into vascular cell lineage (pericyte and endothelial cells were also observed. A significant tetanic tension recovery (over 90% of downstream muscles following electrical stimulation of the sciatic nerve (at upper portion of the gap was also achieved. In contrast, Sk-DN/29+ cells were completely eliminated during the first 4 weeks, but relatively higher numerical (83% vs. 41% in axon and functional (80% vs. 60% in tetanus recovery than control were observed. Noteworthy, significant increase in the formation of vascular networks in the conduit during the early stage (first 2 weeks of recovery was observed in both groups with the expression of key factors (mRNA and protein levels, suggesting the paracrine effects to angiogenesis. These results suggested that the

A Long-Gap Peripheral Nerve Injury Therapy Using Human Skeletal Muscle-Derived Stem Cells (Sk-SCs): An Achievement of Significant Morphological, Numerical and Functional Recovery.

Science.gov (United States)

Tamaki, Tetsuro; Hirata, Maki; Nakajima, Nobuyuki; Saito, Kosuke; Hashimoto, Hiroyuki; Soeda, Shuichi; Uchiyama, Yoshiyasu; Watanabe, Masahiko

2016-01-01

Losses in vital functions of the somatic motor and sensory nervous system are induced by severe long-gap peripheral nerve transection injury. In such cases, autologous nerve grafts are the gold standard treatment, despite the unavoidable sacrifice of other healthy functions, whereas the prognosis is not always favorable. Here, we use human skeletal muscle-derived stem cells (Sk-SCs) to reconstitute the function after long nerve-gap injury. Muscles samples were obtained from the amputated legs from 9 patients following unforeseen accidents. The Sk-SCs were isolated using conditioned collagenase solution, and sorted as CD34+/45- (Sk-34) and CD34-/45-/29+ (Sk-DN/29+) cells. Cells were separately cultured/expanded under optimal conditions for 2 weeks, then injected into the athymic nude mice sciatic nerve long-gap model (7-mm) bridging an acellular conduit. After 8-12 weeks, active cell engraftment was observed only in the Sk-34 cell transplanted group, showing preferential differentiation into Schwann cells and perineurial/endoneurial cells, as well as formation of the myelin sheath and perineurium/endoneurium surrounding regenerated axons, resulted in 87% of numerical recovery. Differentiation into vascular cell lineage (pericyte and endothelial cells) were also observed. A significant tetanic tension recovery (over 90%) of downstream muscles following electrical stimulation of the sciatic nerve (at upper portion of the gap) was also achieved. In contrast, Sk-DN/29+ cells were completely eliminated during the first 4 weeks, but relatively higher numerical (83% vs. 41% in axon) and functional (80% vs. 60% in tetanus) recovery than control were observed. Noteworthy, significant increase in the formation of vascular networks in the conduit during the early stage (first 2 weeks) of recovery was observed in both groups with the expression of key factors (mRNA and protein levels), suggesting the paracrine effects to angiogenesis. These results suggested that the human Sk

In vitro characterization of PlySK1249, a novel phage lysin, and assessment of its antibacterial activity in a mouse model of Streptococcus agalactiae bacteremia.

Science.gov (United States)

Oechslin, Frank; Daraspe, Jean; Giddey, Marlyse; Moreillon, Philippe; Resch, Grégory

2013-12-01

Beta-hemolytic Streptococcus agalactiae is the leading cause of bacteremia and invasive infections. These diseases are treated with β-lactams or macrolides, but the emergence of less susceptible and even fully resistant strains is a cause for concern. New bacteriophage lysins could be promising alternatives against such organisms. They hydrolyze the bacterial peptidoglycan at the end of the phage cycle, in order to release the phage progeny. By using a bioinformatic approach to screen several beta-hemolytic streptococci, a gene coding for a lysin was identified on a prophage carried by Streptococcus dysgalactiae subsp. equisimilis SK1249. The gene product, named PlySK1249, harbored an original three-domain structure with a central cell wall-binding domain surrounded by an N-terminal amidase and a C-terminal CHAP domain. Purified PlySK1249 was highly lytic and bactericidal for S. dysgalactiae (2-log10 CFU/ml decrease within 15 min). Moreover, it also efficiently killed S. agalactiae (1.5-log10 CFU/ml decrease within 15 min) but not several streptococcal commensal species. We further investigated the activity of PlySK1249 in a mouse model of S. agalactiae bacteremia. Eighty percent of the animals (n = 10) challenged intraperitoneally with 10(6) CFU of S. agalactiae died within 72 h, whereas repeated injections of PlySK1249 (45 mg/kg 3 times within 24 h) significantly protected the mice (P S. dysgalactiae, demonstrated high cross-lytic activity against S. agalactiae both in vitro and in vivo. These encouraging results indicated that PlySK1249 might represent a good candidate to be developed as a new enzybiotic for the treatment of systemic S. agalactiae infections.

Design guidelines for teaching about design guidelines for educational WWW-sites

NARCIS (Netherlands)

Collis, Betty; Winnips, Koos; Ottmann, Thomas; Tomek, Ivan

1998-01-01

This paper describes how the authors use a mixture of World Wide Web (WWW)-based functionalities and new didactics to teach educational technology students at the University of Twente (Netherlands) about the design of WWW-based learning environments. Topics discussed include: (1) the content of

Reve et action: Bloch, Heidegger et Levinas

Czech Academy of Sciences Publication Activity Database

Bierhanzl, Jan

2016-01-01

Roč. 12, č. 3 (2016), s. 1-6 ISSN 1336-6556 R&D Projects: GA ČR(CZ) GA16-23046S Institutional support: RVO:67985955 Keywords : possibility * wishing * decision * action * dream * utopia Subject RIV: AA - Philosophy ; Religion http://www.ostium.sk/sk/r%C8%87ve-er-action-bloch-heidegger-et-levinas/

PS1-12sk IS A PECULIAR SUPERNOVA FROM A He-RICH PROGENITOR SYSTEM IN A BRIGHTEST CLUSTER GALAXY ENVIRONMENT

Energy Technology Data Exchange (ETDEWEB)

Sanders, N. E.; Soderberg, A. M.; Foley, R. J.; Chornock, R.; Milisavljevic, D.; Margutti, R.; Drout, M. R.; Moe, M.; Berger, E.; Brown, W. R.; Lunnan, R. [Harvard-Smithsonian Center for Astrophysics, 60 Garden Street, Cambridge, MA 02138 (United States); Smartt, S. J.; Fraser, M.; Kotak, R.; Magill, L.; Smith, K. W.; Wright, D. [Astrophysics Research Centre, School of Maths and Physics, Queens University, Belfast BT7 1NN (United Kingdom); Huang, K. [Academia Sinica Institute of Astronomy and Astrophysics, Taipei 106, Taiwan (China); Urata, Y. [Institute of Astronomy, National Central University, Chung-Li 32054, Taiwan (China); Mulchaey, J. S., E-mail: nsanders@cfa.harvard.edu [Carnegie Observatories, 813 Santa Barbara Street, Pasadena, CA 91101 (United States); and others

2013-05-20

We report on our discovery and observations of the Pan-STARRS1 supernova (SN) PS1-12sk, a transient with properties that indicate atypical star formation in its host galaxy cluster or pose a challenge to popular progenitor system models for this class of explosion. The optical spectra of PS1-12sk classify it as a Type Ibn SN (SN Ibn; cf. SN 2006jc), dominated by intermediate-width (3 Multiplication-Sign 10{sup 3} km s{sup -1}) and time variable He I emission. Our multi-wavelength monitoring establishes the rise time dt {approx} 9-23 days and shows an NUV-NIR spectral energy distribution with temperature {approx}> 17 Multiplication-Sign 10{sup 3} K and a peak magnitude of M{sub z} = -18.88 {+-} 0.02 mag. SN Ibn spectroscopic properties are commonly interpreted as the signature of a massive star (17-100 M{sub Sun }) explosion within an He-enriched circumstellar medium. However, unlike previous SNe Ibn, PS1-12sk is associated with an elliptical brightest cluster galaxy, CGCG 208-042 (z = 0.054) in cluster RXC J0844.9+4258. The expected probability of an event like PS1-12sk in such environments is low given the measured infrequency of core-collapse SNe in red-sequence galaxies compounded by the low volumetric rate of SN Ibn. Furthermore, we find no evidence of star formation at the explosion site to sensitive limits ({Sigma}{sub H{alpha}} {approx}< 2 Multiplication-Sign 10{sup -3} M{sub Sun} yr{sup -1} kpc{sup -2}). We therefore discuss white dwarf binary systems as a possible progenitor channel for SNe Ibn. We conclude that PS1-12sk represents either a fortuitous and statistically unlikely discovery, evidence for a top-heavy initial mass function in galaxy cluster cooling flow filaments, or the first clue suggesting an alternate progenitor channel for SNe Ibn.

Mechanisms underlying the cardiac pacemaker: the role of SK4 calcium-activated potassium channels.

Science.gov (United States)

Weisbrod, David; Khun, Shiraz Haron; Bueno, Hanna; Peretz, Asher; Attali, Bernard

2016-01-01

The proper expression and function of the cardiac pacemaker is a critical feature of heart physiology. The sinoatrial node (SAN) in human right atrium generates an electrical stimulation approximately 70 times per minute, which propagates from a conductive network to the myocardium leading to chamber contractions during the systoles. Although the SAN and other nodal conductive structures were identified more than a century ago, the mechanisms involved in the generation of cardiac automaticity remain highly debated. In this short review, we survey the current data related to the development of the human cardiac conduction system and the various mechanisms that have been proposed to underlie the pacemaker activity. We also present the human embryonic stem cell-derived cardiomyocyte system, which is used as a model for studying the pacemaker. Finally, we describe our latest characterization of the previously unrecognized role of the SK4 Ca(2+)-activated K(+) channel conductance in pacemaker cells. By exquisitely balancing the inward currents during the diastolic depolarization, the SK4 channels appear to play a crucial role in human cardiac automaticity.

Nekonvenční metody zpracování nožířských materiálů

OpenAIRE

Bražina, Jakub

2017-01-01

Tato práce se zaobírá problematikou nekonvenčních nožířských materiálu a jejich následnou aplikaci pro výrobu a zpracování loveckého nože. V rešeršní části je čtenáři přiblížena nožířská problematika, kde jsou uvedeny základní konstrukční charakteristiky a potřebné vlastnosti nože. V další části práce jsou popsány různé kovové i nekovové materiály, jejich vlastnosti, případné zpracování a výroba. Dále se práce zabývá problematikou povrchové ochrany těchto nožířských materiálu. Práce se také z...

Distribution and fate of polycyclic aromatic hydrocarbons (PAHs in recent sediments from the Gulf of Gdańsk (SE Baltic

Directory of Open Access Journals (Sweden)

Ludwik Lubecki

2010-12-01

Full Text Available Polycyclic aromatic hydrocarbons (PAHs were determined in recent (0-10 cm sediments from the Gulf of Gdańsk during 2003-07 andcorrelated with environmental parameters. Located in the south-eastern part of the Baltic and receiving the waters of the River Wisła(Vistula, this area of negligible tides and strong anthropogenic stress, highly eutrophic as a consequence, is an exceptionalmodel basin for studying the fate of hydrophobic organic contaminants introduced to the sea. Environmental conditions determine thedistribution and composition patterns of parent PAHs in Gulf of Gdańsk sediments. PAHs were associated mainly with fine particlesediments, rich in organic carbon, with hypoxia/anoxia near the bottom. The highest PAH contents were found in the Gdańsk Deep(ca 110 m, where the mean concentration of Σ12PAHs was ~3600 ng g-1, and no distinct temporal trend was observed.Lighter PAHs were found to be depleted in deeper regions. It was estimated that the Wisła discharges ~50% of the total PAH load deposited in recent Gulf sediments.

WWW-based remote analysis framework for UniSampo and Shaman analysis software

International Nuclear Information System (INIS)

Aarnio, P.A.; Ala-Heikkilae, J.J.; Routti, J.T.; Nikkinen, M.T.

2005-01-01

UniSampo and Shaman are well-established analytical tools for gamma-ray spectrum analysis and the subsequent radionuclide identification. These tools are normally run locally on a Unix or Linux workstation in interactive mode. However, it is also possible to run them in batch/non-interactive mode by starting them with the correct parameters. This is how they are used in the standard analysis pipeline operation. This functionality also makes it possible to use them for remote operation over the network. Framework for running UniSampo and Shaman analysis using the standard WWW-protocol has been developed. A WWW-server receives requests from the client WWW-browser and runs the analysis software via a set of CGI-scripts. Authentication, input data transfer, and output and display of the final analysis results is all carried out using standard WWW-mechanisms. This WWW-framework can be utilized, for example, by organizations that have radioactivity surveillance stations in a wide area. A computer with a standard internet/intranet connection suffices for on-site analyses. (author)

Rapid agonist-induced loss of sup 125 I-. beta. -endorphin opioid receptor sites in NG108-15, but not SK-N-SH neuroblastoma cells

Energy Technology Data Exchange (ETDEWEB)

Cone, R.I.; Lameh, J.; Sadee, W. (Univ. of California, San Francisco (United States))

1991-01-01

The authors have measured {mu} and {delta} opioid receptor sites on intact SK-N-SH and NG108-15 neuroblastoma cells, respectively, in culture. Use of {sup 125}I-{beta}-endorphin ({beta}E) as a tracer, together with {beta}E(6-31) to block high-affinity non-opioid binding in both cell lines, permitted the measurement of cell surface {mu} and {delta} opioid receptor sites. Labeling was at {delta} sites in NG108-15 cells and predominantly at {mu} sites in SK-N-SH cells. Pretreatment with the {mu} and {delta} agonist, DADLE, caused a rapid loss of cell surface {delta} receptor sites in NG108-15 cells, but failed to reduce significantly {mu} receptor density in SK-N-SH cells.

Under the glacier, the groundwater - the case of Skálafell area, Iceland

Science.gov (United States)

Vincent, Aude; Hart, Jane

2017-04-01

The research addressing glaciers evolution under climate change is well developed, and is now looking not only at their mass balance, but also at the associated subsurface hydrology and downstream hydrology. However, the groundwater component is rarely considered, even though it will be required to forecast the evolution of water resources and of water linked hazards under climate change. The few available studies demonstrate the existence of sub-or pro-glacial aquifers. Some of them suggest strong coupling between rivers and the aquifer, observe the flooding due to water table rising following enhanced glacier melting, or expect stronger recharge in the future due to glacier melting. The present study is the first step of a wider project, GlacAq, aiming at filling this knowledge gap, by characterizing the particular hydrogeology encountered under and downstream of glaciers of alpine type, i.e. sub-, pro- and periglacial hydrogeology, and its sensibility to climate change, in order to provide operational management directions. Skálafell glacier area (Iceland) has been chosen as it has already been followed for climatic, glaciological, and surface hydrology data (Hart et al. (2015), Young et al. (2015)). The present work will use those data, as well as topographic and surface data from the National Land Survey of Iceland, and geological data, to run a comprehensive numerical modelling. The work conducted on the Skálafell site will lead both to the achievement of an operational understanding of a poorly known underground system, and to the anticipation of its hydrodynamic response to climate change. The foreseen mechanisms include an enhanced sub-glacial aquifer recharge, intense surface water bodies-aquifer exchanges, and the aquifer discharge either through springs, or to an offshore system. Those offshore stocks are being increasingly recognised, but their origins are still only guessed at. Skálafell site allows the exploration of the potential role of the

Režimy menového kurzu a volatilita: porovnanie vybraných krajín ERM a Vyšehradskej skupiny

Czech Academy of Sciences Publication Activity Database

Valachy, J.; Kočenda, Evžen

2005-01-01

Roč. 53, č. 2 (2005), s. 144-160 ISSN 0013-3035 Institutional research plan: CEZ:AV0Z70850503 Keywords : exchange rate regime * volatility * integration Subject RIV: AH - Economics Impact factor: 0.204, year: 2005 http://www.sav.sk/index.php?lang=sk&charset=&doc=publish-journal&part=list_articles&journal_issue_no=1111#abstract_515

Arabidopsis mutant sk156 reveals complex regulation of SPL15 in a miR156-controlled gene network.

Science.gov (United States)

Wei, Shu; Gruber, Margaret Y; Yu, Bianyun; Gao, Ming-Jun; Khachatourians, George G; Hegedus, Dwayne D; Parkin, Isobel A P; Hannoufa, Abdelali

2012-09-18

The Arabidopsis microRNA156 (miR156) regulates 11 members of the SQUAMOSA PROMOTER BINDING PROTEIN LIKE (SPL) family by base pairing to complementary target mRNAs. Each SPL gene further regulates a set of other genes; thus, miR156 controls numerous genes through a complex gene regulation network. Increased axillary branching occurs in transgenic Arabidopsis overexpressing miR156b, similar to that observed in loss-of-function max3 and max4 mutants with lesions in carotenoid cleavage dioxygenases. Arabidopsis miR156b was found to enhance carotenoid levels and reproductive shoot branching when expressed in Brassica napus, suggesting a link between miR156b expression and carotenoid metabolism. However, details of the miR156 regulatory network of SPL genes related to carotenoid metabolism are not known. In this study, an Arabidopsis T-DNA enhancer mutant, sk156, was identified due to its altered branching and trichome morphology and increased seed carotenoid levels compared to wild type (WT) ecovar Columbia. Enhanced miR156b expression due to the 35S enhancers present on the T-DNA insert was responsible for these phenotypes. Constitutive and leaf primodium-specific expression of a miR156-insensitive (mutated) SPL15 (SPL15m) largely restored WT seed carotenoid levels and plant morphology when expressed in sk156. The Arabidopsis native miR156-sensitive SPL15 (SPL15n) and SPL15m driven by a native SPL15 promoter did not restore the WT phenotype in sk156. Our findings suggest that SPL15 function is somewhat redundant with other SPL family members, which collectively affect plant phenotypes. Moreover, substantially decreased miR156b transcript levels in sk156 expressing SPL15m, together with the presence of multiple repeats of SPL-binding GTAC core sequence close to the miR156b transcription start site, suggested feedback regulation of miR156b expression by SPL15. This was supported by the demonstration of specific in vitro interaction between DNA-binding SBP domain of SPL15

WWW-based environments for collaborative group work

NARCIS (Netherlands)

Collis, Betty

1998-01-01

Since 1994, we have been involved in the design and use of a series of WWW-based environments to support collaborative group work for students in a technical university in The Netherlands. These environments, and the course re-design that accompanies each new environment, began in April 1994 and

Effect of the SK/IK channel modulator 4,5-dichloro-1,3-diethyl-1,3-dihydro-benzoimidazol-2-one (NS4591) on contractile force in rat, pig and human detrusor smooth muscle

DEFF Research Database (Denmark)

Nielsen, Jens Steen; Rode, Frederik; Rahbek, Mette

2011-01-01

• To investigate the importance of small (SK)- and intermediate (IK)-conductance Ca2(+) -activated K(+) channels on bladder function, by studying the effects of 4,5-dichloro-1,3-diethyl-1,3-dihydro-benzoimidazol-2-one (NS4591), a new modulator of SK/IK channels, on contractions induced by electri......• To investigate the importance of small (SK)- and intermediate (IK)-conductance Ca2(+) -activated K(+) channels on bladder function, by studying the effects of 4,5-dichloro-1,3-diethyl-1,3-dihydro-benzoimidazol-2-one (NS4591), a new modulator of SK/IK channels, on contractions induced...

Improvement of WWW chart of the nuclides interface

International Nuclear Information System (INIS)

Okamoto, Tsutomu; Minato, Futoshi; Iwamoto, Osamu; Koura, Hiroyuki

2016-03-01

The booklet 'chart of the nuclides' is issued every 4 years since 1976 from Nuclear Data Center, Japan Atomic Energy Agency. The chart of the nuclides for WWW (World Wide Web) was developed in 1999 in order to be available from the Internet browser. The Internet connection speeds, browser functions and JavaScript libraries has, however, progressed at present compared with the Internet technology in those days. In connection with the release of the 2014 edition of the chart of the nuclides, the interface of the WWW chart of the nuclides has been improved by introducing new Internet technologies aiming at enhancing convenience on accessibilities via browsers. We introduced a scrolling screen that would make capabilities of easy screen movement on a map with the addition of the drag scrolling function. Considering smart phone access, the light-weight edition which introduced automatic switch was prepared. The new system results in reduction in access time and usefulness in mobile environment. The method of making figures of the chart was reconsidered due to addition of new decay schemes to the 2014 edition. SVG (Scalable Vector Graphics) was adopted so as to make figures easily. It is concluded that the accessibilities of WWW chart of the nuclides are substantially improved from the previous version by introducing the new technologies. (author)

Activation of human IK and SK Ca2+ -activated K+ channels by NS309 (6,7-dichloro-1H-indole-2,3-dione 3-oxime)

DEFF Research Database (Denmark)

Strøbaek, Dorte; Teuber, Lene; Jørgensen, Tino D

2004-01-01

We have identified and characterized the compound NS309 (6,7-dichloro-1H-indole-2,3-dione 3-oxime) as a potent activator of human Ca2+ -activated K+ channels of SK and IK types, whereas it is devoid of effect on BK type channels. IK- and SK-channels have previously been reported to be activated...

Strategy of development and online marketing for website www.skutecnydarek.cz

OpenAIRE

Fodor, Aleš

2011-01-01

The goal of this bachelor's thesis is to suggest particular online marketing strategy for People in need's website - www.skutecnydarek.cz. Firstly the thesis is going to aim at analysing the present condition of marketing activities and the quality of the web site for www.skutecnydarek.cz. Then the online marketing strategy is going be developed.

Regional information portal - www.peipsi.org / Piret Uus

Index Scriptorium Estoniae

Uus, Piret

2004-01-01

Piirkondlik infoportaal - www.peipsi.org - pakub mitmekülgset teavet Peipsi Koostöö Keskuse tegevuse, projektide, teadusuuringute tulemuste, aruannete kohta, samuti on kättesaadav info Peipsi järve keskkonnaseisundist, ajaloost, kultuurist, geograafiast jne

WWW Case Study Program To Enhance Thinking, Critically and Globally: The Impact of NAFTA on the Apparel Industry.

Science.gov (United States)

Frey, Diane K.; Eckman, Molly

1999-01-01

An interactive Web program was developed to present a case study on textile/apparel products for a family and consumer sciences course. Students found the case studies relevant and stimulating for complex thinking. (SK)

RNA sequence analyses of r-Moj-DM treated cells: TXNIP is required to induce apoptosis of SK-Mel-28.

Science.gov (United States)

McBride, Terri D; Andrew, U; Ly, Nicko; Soto, Julio G

2016-10-01

RNA sequencing of untreated and r-Moj-DM treated SK-Mel-28 cells was performed after 6 h, to begin unraveling the apoptotic pathway induced by r-Moj-DM. Bioinformatic analyses of RNA sequencing data yielded 40 genes that were differentially expressed. Nine genes were upregulated and 31 were downregulated. qRT-PCR was used to validate differential expression of 13 genes with known survival or apoptotic-inducing activities. Expression of BNiP3, IGFBP3, PTPSF, Prune 2, TGF-ß, and TXNIP were compared from cells treated with r-Moj-DN (a strong apoptotic inducer) or r-Moj-DA (a non-apoptotic inducer) for 1 h, 2 h, 4 h, and 6 h after treatment. Our results demonstrate that significant differences in expression are only detected after 4 h of treatment. In addition, expression of TXNIP (an apoptotic inducer) remains elevated at 4 h and 6 h only in r-Moj-DN treated cells. Based on the consistency of elevated TXNIP expression, we further studied TXNIP as a novel target of disintegrin activation. Confocal microscopy of anti-TXNIP stained SK-Mel-28 cells suggests nuclear localization of TXNIP after r-Moj-DM treatment. A stable TXNIP knockdown SK-Mel-28 cell line was produced to test TXNIP' role in the apoptotic induction by r-Moj-DM. High cell viability (74.3% ±9.1) was obtained after r-Moj-DM treatment of TXNIP knocked down SK-Mel-28 cells, compared to 34% ±0.187 for untransduced cells. These results suggest that TXNIP is required early in the apoptotic-inducing pathway resulting from r-Moj-DM binding to the αv integrin subunit. Copyright © 2016 Elsevier Ltd. All rights reserved.

The mojastin mutant Moj-DM induces apoptosis of the human melanoma SK-Mel-28, but not the mutant Moj-NN nor the non-mutated recombinant Moj-WN.

Science.gov (United States)

Seoane, Agustin I; Tran, Victoria L; Sanchez, Elda E; White, Stephanie A; Choi, Jason L; Gaytán, Brandon; Chavez, Natalie; Reyes, Steven R; Ramos, Carla J; Tran, Luan H; Lucena, Sara E; Sugarek, Maria; Perez, John C; Mandal, Stephanie A; Ghorab, Shervin; Rodriguez-Acosta, Alexis; Fung, Branden K; Soto, Julio G

2010-09-01

In this study, three recombinant mojastin peptides (Moj-WN, Moj-NN, and Moj-DM) were produced and compared functionally. Recombinant Moj peptides were purified as GST-fusions. GST-Moj-WN and GST-Moj-NN inhibited ADP-induced platelet aggregation in platelet rich plasma. The GST-Moj-WN had an IC(50) of 160nM, while the GST-Moj-NN had an IC(50) of 493nM. The GST-Moj-DM did not inhibit platelet aggregation. All three GST-Moj peptides inhibited SK-Mel-28 cell adhesion to fibronectin. The GST-Moj-WN inhibited the binding of SK-Mel-28 cells to fibronectin with an IC(50) of 11nM, followed by the GST-Moj-NN (IC(50) of 28nM), and the GST-Moj-DM (IC(50) of 46nM). The GST-Moj peptides' ability to induce apoptosis on SK-Mel-28 cells was determined using Annexin-V-FITC and nuclear fragmentation assays. Cells were incubated with 5muM GST-Moj peptides for 24h. At 5microM GST-Moj-DM peptide, 13.56%+/-2.08 of treated SK-Mel-28 cells were in early apoptosis. The GST-Moj-DM peptide also caused nuclear fragmentation as determined by fluorescent microscopy and Hoechst staining. The GST-Moj-WN and GST-Moj-NN peptides failed to induce apoptosis. We characterized the SK-Mel-28 integrin expression, as the first step in determining r-Moj binding specificity. Our results indicate that SK-Mel-28 cells express alphavbeta3, alphav, alpha6, beta1, and beta3 integrin receptors. Published by Elsevier Ltd.

Pro-inflammatory cytokines derived from West Nile virus (WNV-infected SK-N-SH cells mediate neuroinflammatory markers and neuronal death

Directory of Open Access Journals (Sweden)

Nerurkar Vivek R

2010-10-01

Full Text Available Abstract Background WNV-associated encephalitis (WNVE is characterized by increased production of pro-inflammatory mediators, glial cells activation and eventual loss of neurons. WNV infection of neurons is rapidly progressive and destructive whereas infection of non-neuronal brain cells is limited. However, the role of neurons and pathological consequences of pro-inflammatory cytokines released as a result of WNV infection is unclear. Therefore, the objective of this study was to examine the role of key cytokines secreted by WNV-infected neurons in mediating neuroinflammatory markers and neuronal death. Methods A transformed human neuroblastoma cell line, SK-N-SH, was infected with WNV at multiplicity of infection (MOI-1 and -5, and WNV replication kinetics and expression profile of key pro-inflammatory cytokines were analyzed by plaque assay, qRT-PCR, and ELISA. Cell death was measured in SK-N-SH cell line in the presence and absence of neutralizing antibodies against key pro-inflammatory cytokines using cell viability assay, TUNEL and flow cytometry. Further, naïve primary astrocytes were treated with UV-inactivated supernatant from mock- and WNV-infected SK-N-SH cell line and the activation of astrocytes was measured using flow cytometry and ELISA. Results WNV-infected SK-N-SH cells induced the expression of IL-1β, -6, -8, and TNF-α in a dose- and time-dependent manner, which coincided with increase in virus-induced cell death. Treatment of cells with anti-IL-1β or -TNF-α resulted in significant reduction of the neurotoxic effects of WNV. Furthermore treatment of naïve astrocytes with UV-inactivated supernatant from WNV-infected SK-N-SH cell line increased expression of glial fibrillary acidic protein and key inflammatory cytokines. Conclusion Our results for the first time suggest that neurons are one of the potential sources of pro-inflammatory cytokines in WNV-infected brain and these neuron-derived cytokines contribute to WNV

Sjuksköterskor och skötares upplevelser av möten i psykiatrisk öppenvård : En intervjustudie

OpenAIRE

Bäckman, Jenny; Nyman, Nyman

2016-01-01

Syftet med studien var att undersöka sjuksköterskors och skötares upplevelser av möten med patienter i psykiatrisk öppenvård.   Bakgrund – I psykiatrisk öppenvård möter sjuksköterskor och skötare många olika människor med individuella behov. Sedan tidigare forskning har det framkommit att patienters känsla av trygghet uppkommer genom faktorer som personalens inställning och empati. Relationen mellan personal och patient är viktig för patientens känsla av att bli tagen på allvar samt att bli b...

Immunization of mice with LRP4 induces myasthenia similar to MuSK-associated myasthenia gravis.

Science.gov (United States)

Mori, Shuuichi; Motohashi, Norio; Takashima, Rumi; Kishi, Masahiko; Nishimune, Hiroshi; Shigemoto, Kazuhiro

2017-11-01

Since the first report of experimental animal models of myasthenia gravis (MG) with autoantibodies against low-density lipoprotein receptor-related protein 4 (LRP4), there have not been any major reports replicating the pathogenicity of anti-LRP4 antibodies (Abs). Recent clinical studies have cast doubt on the specificity and pathogenicity of anti-LRP4 antibodies for MG, highlighting the need for further research. In this study, we purified antigens corresponding to the extracellular region of human LRP4 stably expressed with chaperones in 293 cells and used these antigens to immunize female A/J mice. Immunization with LRP4 protein caused mice to develop myasthenia having similar electrophysiological and histological features as are observed in MG patients with circulating Abs against muscle-specific kinase (MuSK). Our results clearly demonstrate that active immunization of mice with LRP4 proteins causes myasthenia similar to the MG induced by anti-MuSK Abs. Further experimental and clinical studies are required to prove the pathogenicity of anti-LRP4 Abs in MG patients. Copyright © 2017 The Authors. Published by Elsevier Inc. All rights reserved.

The cytotoxicity of a 2-chloroethylnitrosourea analog of sarcosinamide in the SK-MG-1 human glioma cell line as a possible indicator for transport

Energy Technology Data Exchange (ETDEWEB)

Skalski, V.; Feindel, W.; Panasci, L.C. (Lady Davis Institute for Medical Research, Montreal, Quebec (Canada))

1989-07-01

The cytotoxicities of a new sarcosinamide analog of chloroethylnitrosourea (SarCNU) and of BCNU were examined in the glioma cell line SK-MG-1 in the presence or absence of excess concentrations of amino acids and sarcosinamide. The cytotoxicity of SarCNU, but not of BCNU, was significantly reduced in the presence of excess sarcosinamide. The stability of SarCNU was not significantly altered by increasing concentrations of sarcosinamide. In order to investigate the possibility that sarcosinamide inhibits the uptake of SarCNU, the transport of tritiated sarcosinamide was examined in SK-MG-1 cells. The uptake of 3H-sarcosinamide was inhibited by excess, unlabelled sarcosinamide and SarCNU but not by BCNU, glycine or sarcosine. These results suggest the existence of a carrier-mediated transport for sarcosinamide which can accomodate SarCNU in SK-MG-1 cells.

Arabidopsis mutant sk156 reveals complex regulation of SPL15 in a miR156-controlled gene network

Directory of Open Access Journals (Sweden)

Wei Shu

2012-09-01

Full Text Available Abstract Background The Arabidopsis microRNA156 (miR156 regulates 11 members of the SQUAMOSA PROMOTER BINDING PROTEIN LIKE (SPL family by base pairing to complementary target mRNAs. Each SPL gene further regulates a set of other genes; thus, miR156 controls numerous genes through a complex gene regulation network. Increased axillary branching occurs in transgenic Arabidopsis overexpressing miR156b, similar to that observed in loss-of-function max3 and max4 mutants with lesions in carotenoid cleavage dioxygenases. Arabidopsis miR156b was found to enhance carotenoid levels and reproductive shoot branching when expressed in Brassica napus, suggesting a link between miR156b expression and carotenoid metabolism. However, details of the miR156 regulatory network of SPL genes related to carotenoid metabolism are not known. Results In this study, an Arabidopsis T-DNA enhancer mutant, sk156, was identified due to its altered branching and trichome morphology and increased seed carotenoid levels compared to wild type (WT ecovar Columbia. Enhanced miR156b expression due to the 35S enhancers present on the T-DNA insert was responsible for these phenotypes. Constitutive and leaf primodium-specific expression of a miR156-insensitive (mutated SPL15 (SPL15m largely restored WT seed carotenoid levels and plant morphology when expressed in sk156. The Arabidopsis native miR156-sensitive SPL15 (SPL15n and SPL15m driven by a native SPL15 promoter did not restore the WT phenotype in sk156. Our findings suggest that SPL15 function is somewhat redundant with other SPL family members, which collectively affect plant phenotypes. Moreover, substantially decreased miR156b transcript levels in sk156 expressing SPL15m, together with the presence of multiple repeats of SPL-binding GTAC core sequence close to the miR156b transcription start site, suggested feedback regulation of miR156b expression by SPL15. This was supported by the demonstration of specific in vitro

Computer programs to make a Chart of the nuclides for WWW

International Nuclear Information System (INIS)

Nakagawa, Tsuneo; Katakura, Jun-ichi; Horiguchi, Takayoshi

1999-06-01

Computer programs to make a chart of the nuclides for World Wide Web (WWW) have been developed. The programs make a data file for WWW chart of the nuclides from a data file containing nuclide information in the format similar to ENSDF, by filling unknown half-lives with calculated ones. Then, the WWW chart of the nuclides in the gif format is created from the data file. The programs to make html files and image map files, to select a chart of selected nuclides, and to show various information of nuclides are included in the system. All the programs are written in C language. This report describes the formats of files, the programs and 1998 issue of Chart of the Nuclides made by means of the present programs. (author)

Accessing HEP Collaboration documents using WWW and WAIS

International Nuclear Information System (INIS)

Nguyen, T.D.; Buckley-Geer, E.; Ritchie, D.J.

1995-09-01

WAIS stands for Wide Area Information Server. It is a distributed information retrieval system. A WAIS system has a client-server architecture which consists of clients talking to a server via a TCP/IP network using the ANSI standard Z39-50 VI protocol. A freely available version (FreeWAIS) is supported by the Clearinghouse for Networked Information Discovery and Retrieval, also known as CNIDR. FreeWAIS-sf, which is the software the authors are using at Fermilab, is an extension of FreeWAIS. FreeWAIS-sf supports all the functionalities which FreeWAIS offers as well as additional indexing and searching capabilities for structured fields. World Wide Web (WWW) was originally developed by Tim Berners-Lee at CERN and is now the backbone for serving information on Internet. Here, the authors describe a system for accessing HEP collaboration documents using WWW and WAIS

Accessing HEP Collaboration documents using WWW and WAIS

Energy Technology Data Exchange (ETDEWEB)

Nguyen, T.D.; Buckley-Geer, E.; Ritchie, D.J.

1995-09-01

WAIS stands for Wide Area Information Server. It is a distributed information retrieval system. A WAIS system has a client-server architecture which consists of clients talking to a server via a TCP/IP network using the ANSI standard Z39-50 VI protocol. A freely available version (FreeWAIS) is supported by the Clearinghouse for Networked Information Discovery and Retrieval, also known as CNIDR. FreeWAIS-sf, which is the software the authors are using at Fermilab, is an extension of FreeWAIS. FreeWAIS-sf supports all the functionalities which FreeWAIS offers as well as additional indexing and searching capabilities for structured fields. World Wide Web (WWW) was originally developed by Tim Berners-Lee at CERN and is now the backbone for serving information on Internet. Here, the authors describe a system for accessing HEP collaboration documents using WWW and WAIS.

SkQ1 Ophthalmic Solution for Dry Eye Treatment: Results of a Phase 2 Safety and Efficacy Clinical Study in the Environment and During Challenge in the Controlled Adverse Environment Model.

Science.gov (United States)

Petrov, Anton; Perekhvatova, Natalia; Skulachev, Maxim; Stein, Linda; Ousler, George

2016-01-01

This Phase 2 clinical trial assessed the efficacy and safety of the novel antioxidative, renewable compound SkQ1 for topical treatment of dry eye signs and symptoms. In a single-center, randomized, double-masked, placebo-controlled, 29-day study, 91 subjects with mild to moderate dry eye instilled the study drug twice daily and recorded dry eye symptoms daily. Subjects were randomized 1:1:1 into one of three ophthalmic solution treatment groups: SkQ1 1.55 µg/mL, SkQ1 0.155 µg/mL, or 0.0 µg/mL (placebo). Subjects were exposed to a controlled adverse environment chamber at 3 of the 4 study visits (Day -7, Day 1, and Day 29). Investigator assessments occurred at all study visits. SkQ1 was safe and efficacious in treating dry eye signs and symptoms. Statistically significant improvements with SkQ1 compared to placebo occurred for the dry eye signs of corneal fluorescein staining and lissamine green staining in the central region and lid margin redness, and for the dry eye symptoms of ocular discomfort, dryness, and grittiness. In addition, SkQ1 demonstrated greater efficacy compared to placebo, although the differences were not statistically significant, for corneal fluorescein staining in other regions and/or time points (total staining score, central region, corneal sum score, and temporal region), lissamine green staining for the central and nasal regions, and blink rate scores. This Phase 2 study indicated that SkQ1 is safe and efficacious for the treatment of dry eye signs and symptoms and supported previous study results. Clinicaltrials.gov identifier: NCT02121301. Miotech S.A.

Neuroprotection against apoptosis of SK-N-MC cells using RMP-7- and lactoferrin-grafted liposomes carrying quercetin

Directory of Open Access Journals (Sweden)

Kuo Y

2017-04-01

Full Text Available Yung-Chih Kuo, Chien-Wei Tsao Department of Chemical Engineering, National Chung Cheng University, Chia-Yi, Taiwan, Republic of China Abstract: A drug delivery system of quercetin (QU-encapsulated liposomes (LS grafted with RMP-7, a bradykinin analog, and lactoferrin (Lf was developed to permeate the blood–brain barrier (BBB and rescue degenerated neurons, acting as an Alzheimer’s disease (AD pharmacotherapy. This colloidal formulation of QU-encapsulated LS grafted with RMP-7 and Lf (RMP-7-Lf-QU-LS was used to traverse human brain microvascular endothelial cells (HBMECs regulated by human astrocytes (HAs and to treat SK-N-MC cells after an insult with cytotoxic β-amyloid (Aβ fibrils. We found that surface RMP-7 and Lf enhanced the ability of QU to cross the BBB without inducing strong toxicity and damaging the tight junction. In addition, RMP-7-Lf-QU-LS significantly reduced Aβ-induced neurotoxicity and improved the viability of SK-N-MC cells. Compared with free QU, RMP-7-Lf-QU-LS could also significantly inhibit the expression of phosphorylated c-Jun N terminal kinase, phosphorylated p38, and phosphorylated tau protein at serine 202 by SK-N-MC cells, indicating an important role of RMP-7, Lf, and LS in protecting neurons against apoptosis. RMP-7-Lf-QU-LS is a promising carrier targeting the BBB to prevent Aβ-insulted neurodegeneration and may have potential in managing AD in future clinical applications. Keywords: Alzheimer’s disease, blood–brain barrier, β-amyloid, drug targeting, neurodegeneration, pharmacotherapy

Dítě ve velkomoravských právních památkách

Czech Academy of Sciences Publication Activity Database

Havlíková, Lubomíra

2012-01-01

Roč. 5, č. 1 (2012), s. 1-10 ISSN 1337-8740 R&D Projects: GA MŠk 7AMB12SK161 Institutional support: RVO:68378017 Keywords : history * gender studies * Great Moravian law * Slavonic law * Byzantine law * child * woman * matrimony * Great Moravia * Constanrtine and Methodius Subject RIV: AB - History http://www.ukm.ff.ukf.sk/wp-content/uploads/2012/09/konstantinove-listy-2012text.pdf

Confirming a Role for α9nAChRs and SK Potassium Channels in Type II Hair Cells of the Turtle Posterior Crista

Directory of Open Access Journals (Sweden)

Xiaorong Xu Parks

2017-11-01

Full Text Available In turtle posterior cristae, cholinergic vestibular efferent neurons (VENs synapse on type II hair cells, bouton afferents innervating type II hair cells, and afferent calyces innervating type I hair cells. Electrical stimulation of VENs releases acetylcholine (ACh at these synapses to exert diverse effects on afferent background discharge including rapid inhibition of bouton afferents and excitation of calyx-bearing afferents. Efferent-mediated inhibition is most pronounced in bouton afferents innervating type II hair cells near the torus, but becomes progressively smaller and briefer when moving longitudinally through the crista toward afferents innervating the planum. Sharp-electrode recordings have inferred that efferent-mediated inhibition of bouton afferents requires the sequential activation of alpha9-containing nicotinic ACh receptors (α9*nAChRs and small-conductance, calcium-dependent potassium channels (SK in type II hair cells. Gradations in the strength of efferent-mediated inhibition across the crista likely reflect variations in α9*nAChRs and/or SK activation in type II hair cells from those different regions. However, in turtle cristae, neither inference has been confirmed with direct recordings from type II hair cells. To address these gaps, we performed whole-cell, patch-clamp recordings from type II hair cells within a split-epithelial preparation of the turtle posterior crista. Here, we can easily visualize and record hair cells while maintaining their native location within the neuroepithelium. Consistent with α9*nAChR/SK activation, ACh-sensitive currents in type II hair cells were inward at hyperpolarizing potentials but reversed near −90 mV to produce outward currents that typically peaked around −20 mV. ACh-sensitive currents were largest in torus hair cells but absent from hair cells near the planum. In current clamp recordings under zero-current conditions, ACh robustly hyperpolarized type II hair cells. ACh

www.kernenergie.de - nuclear power has a German Internet address

International Nuclear Information System (INIS)

Anon.

2000-01-01

www.kernenergie.de is the address on the worldwide web under which the German nuclear organizations, Deutsches Atomforum (DAtF), Informationskreis Kernenergie (IK), and Kerntechnische Gesellschaft (KTG) as well as atw - internationale Zeitschrift fuer Kernenergie, and INFORUM can be reached. Extensive sources of information, discussions, on-line dictionaries, computer codes, dynamic web pages, digital documents and multimedia offerings can be called up via the portal under the individual web sites. In this way, www.kernenergie.de provides a comprehensive and up-to-date background of information about nuclear power and adjacent topics in the digital worldwide web. (orig.) [de

Detection and characterization of side population in Ewing's sarcoma SK-ES-1 cells in vitro

International Nuclear Information System (INIS)

Yang, Min; Zhang, Rui; Yan, Ming; Ye, Zhengxu; Liang, Wei; Luo, Zhuojing

2010-01-01

Dye exclusion is a valuable technique to isolate cancer stem cells (CSCs) based on an ability of stem cell to efflux fluorescent DNA-binding dye, especially for tumors without unique surface markers. It has been proven that side population (SP) cells that exclude Hoechst 33342 dye are enriched with stem-like cells in several cancer cell lines. In this study, we isolated and characterized SP cells from human Ewing's sarcoma cell line SK-ES-1 in vitro. SP cells were detected in SK-ES-1 and comprised 1.2% of total cell population. Only SP cells had the capacity to regenerate both SP and non-SP cells. The proliferation rates were similar between SP and non-SP cells. However, the clonogenicity and invasiveness of SP cells were significantly higher than that of non-SP cells. Further characterization of this SP phenotype presented other properties. SP cells exhibited increased multi-drug resistance and the ATP binding cassette protein (ABC) transporters were up-regulated in SP population. These findings suggest that SP cells derived from Ewing's sarcoma play the critical role in tumor metastasis and recurrence and might be an ideal target for clinical therapy.

DJ1 Expression Downregulates in Neuroblastoma Cells (SK-N-MC Chronically Exposed to HIV-1 and Cocaine.

Directory of Open Access Journals (Sweden)

Upal eRoy

2015-07-01

Full Text Available Background: HIV-associated neurological disorder (HAND has long been recognized as a consequence of Human Immunodeficiency Virus (HIV infection in the brain. The pathology of HAND gets more complicated with the recreational drug use such as cocaine. Recent studies have suggested multiple genetic influences involved in the pathology of addiction and HAND but only a fraction of the entire genetic risk has been investigated so far. In this regard, role of DJ1 protein (a gene linked to autosomal recessive early-onset Parkinson’s disease in regulating dopamine transmission and reactive oxygen species (ROS production in neuronal cells will be worth investigating in HIV-1 and cocaine exposed microenvironment. Being a very abundant protein in the brain, DJ1 could serve as a potential marker for early detection of HIV-1 and/or cocaine related neurological disorder.Methods: In vitro analysis was done to observe the effect of HIV-1 and/or cocaine on DJ1 protein expression in neuroblastoma cells (SK-N-MC. Gene expression and protein analysis of DJ1 was done on the HIV infected and/or cocaine treated SK-N-MC and compared to untreated cells using real time PCR, Western Blot and flow cytometry.Results: Gene expression and protein analysis indicated that there was a significant decrease in DJ1 expression in SK-N-MC chronically exposed to HIV-1 and/or cocaine.Conclusion: This is the first study to establish that DJ1 expression level in the neuronal cells significantly decreased in presence of HIV-1and/or cocaine indicating oxidative stress level of dopamine neurons.

Variability of morphological conditions of the Vistula river channel in the section Czerwińsk-Kępa Polska

Directory of Open Access Journals (Sweden)

Popek Zbigniew

2015-03-01

Full Text Available Variability of morphological conditions of the Vistula river channel in the section Czerwińsk-Kępa Polska. The paper presents an assessment of morphological changes that occurred in the Vistula river channel in selected section of about 33 km long, located in the middle of the Vistula river course between Czerwińsk and Kępa Polska (km 576–609. Based on the analysis of archival material from 1972–2009, a characteristics of river channel changes, taking primarily into account the horizontal layout (shape in the plan, was obtained. An attempt was made to estimate the trends and rate of transformation of the following parameters in the river channel: width, length, and position of the riverbanks, abundance and size of islands and fluvial deposits, as well as their percentage in the total area of the main river channel and the floodplain area between levees.

Vliv všímavosti na afektivitu: fenomenologický výklad buddhistické meditace vipassanā

Czech Academy of Sciences Publication Activity Database

Puc, Jan

2016-01-01

Roč. 12, č. 4 (2016), s. 1-11 ISSN 1336-6556 R&D Projects: GA ČR(CZ) GA15-10832S Institutional support: RVO:67985955 Keywords : passive synthesis * affection * attention * mindfulness * Husserl * vipassanā * meditation * Buddhism Subject RIV: AA - Philosophy ; Religion OBOR OECD: Philosophy, History and Philosophy of science and technology http://www.ostium.sk/sk/vliv-vsimavosti-na-afektivitu-fenomenologicky-vyklad-buddhisticke-meditace-vipassana1/

Dispersant Application during SG Wet Layup at SK Unit 1

Energy Technology Data Exchange (ETDEWEB)

Kwon, Hyukchul; Lee, Dooho; Sung, Kibang [KHNP Central Institute, Daejeon (Korea, Republic of)

2014-05-15

The corrosion products in the feedwater are deposited onto the steam generators (SGs) despite the effort to control them within limit of impurity. This deposit is one of causes for occurrence of SCC (Stress Corrosion Cracking), water level fluctuation and further corrosion of SGs. To minimize corrosion and remove deposit, the nuclear power plants apply high pH to the secondary system and SG chemical cleaning, respectively. But these methods can be costly and carry risks of extended outages or incomplete cleaning. Another method is an on-line dispersant application. The role of dispersant is to make deposit suspended in the SGs. Then, the suspended deposit is discharged to the blowdown system. The iron removal is increased in the blowdown system during the dispersant application. Additional significant benefit in the form of reduced corrosion product transport may be obtained through applying dispersant in the SGs wet lay operational mode. This method helps to reduce the total SGs loading without affecting critical outage activities and with minimal additional effort on the part of the utilities. This study provides the results of the dispersant application trial during the SG wet layup at SK Unit 1. As the PAA concentrations were increased, the corrosion rates of Alloy 690 and SA 106 Gr.B were increased. The corrosion rate of Alloy 690 was 2 times less than that of SA 106 Gr.B at 100 ppm of PAA based on the electrochemical experimental. There were no significant feasibility problems with application of PAA during the SG wet layup. The reasonable estimation of the additional mass removed by the presence of PAA during SGs wet layup is 460 g. The iron removal depended on PAA concentration injected based on the comparative results of the SK Unit 1 and TMI-1. It is expected that injection of PAA into the SG result in a significant decrease in the amount of iron transported to the SGs during the startup.

Effect of and satisfaction with www.elearnSCI.org for training of nurse students

DEFF Research Database (Denmark)

Liu, N; Li, X W; Zhou, M W

2014-01-01

STUDY DESIGN: Interventional training session. OBJECTIVE: To investigate the effect and satisfaction with didactic training using printed text of a submodule of www.elearnSCI.org for nurse students and to assess the answers of each question. SETTING: A Peking University teaching hospital. METHODS......: Twenty-eight nurse students in two groups (14 in each) were involved. Only group A received a translated print-out of the slides from the 'Nursing management' submodule in www.elearnSCI.org for 1-h self-study before the class. At the beginning of class, both groups were tested using the self assessment...... presentation are effective methods for training the content of www.elearnSCI.org to nurse students. The training satisfaction of this submodule within the www.elearnSCI.org is favorable....

Involuntary autobiographical memories are relatively more often reported during high cognitive load tasks.

Science.gov (United States)

Barzykowski, Krystian; Niedźwieńska, Agnieszka

2018-01-01

Recent studies on involuntary autobiographical memories (IAMs) in daily life have shown that they are most frequently reported during daily routines (e.g. while ironing). Such studies have suggested that reporting IAMs may be influenced by the level of the ongoing task demands and availability of cognitive resources. In two studies, we investigated the effects of cognitive load on reporting IAMs. To examine the presumed cognitive load dependency of IAMs, we utilised an often-employed experimental paradigm (Schlagman & Kvavilashvili, 2008) to elicit IAMs under conditions that differed in cognitive load. When performing a vigilance task, participants had to interrupt the task each time they experienced any spontaneous mental contents and write them down. We manipulated the level of cognitive load by either instructing (cognitive load group) or not instructing (control group) participants to perform an additional demanding task. We compared the groups on the number of IAMs and other mental contents (non-IAM contents) recorded, as well as on the frequency of IAMs that was calculated as a proportion of IAMs in all mental contents reported by the participant. We expected that if reporting IAMs depends on the level of cognitive demands, then we should observe lower frequency of IAMs in the cognitive load group compared to the control group. Consistently across studies, we observed a lower number of IAMs and non-IAM contents in the cognitive load group. However, IAMs unexpectedly constituted a higher percentage of all mental contents when participants were cognitively loaded. Further implications of the cognitive load effects for IAMs research and experimental methodology are discussed. Copyright © 2017 Elsevier B.V. All rights reserved.

Primary urethral leiomyoma in a female patient: A case report and ...

African Journals Online (AJOL)

R. Sharma

www.ees.elsevier.com/afju · www.sciencedirect.com. Case report. Primary urethral leiomyoma in a female patient: A case report and review of the literature. R. Sharma. ∗. , S.K. Mitra, R.K. Dey, S. Basu, R.K. Das. Urology Department, R.G. Kar Medical College, Kolkata, India. Received 14 July 2014; received in revised form ...

Inclusive K0SK0S resonance production in ep collisions at HERA

CERN Document Server

AUTHOR|(CDS)2076592; Magill, S.; Musgrave, B.; Nicholass, D.; Repond, J.; Yoshida, R.; Mattingly, M.C.K.; Antonioli, P.; Bari, G.; Bellagamba, L.; Boscherini, D.; Bruni, A.; Bruni, G.; Cindolo, F.; Corradi, M.; Iacobucci, G.; Margotti, A.; Nania, R.; Polini, A.; Antonelli, S.; Basile, M.; Bindi, M.; Cifarelli, L.; Contin, A.; De Pasquale, S.; Sartorelli, G.; Zichichi, A.; Bartsch, D.; Brock, I.; Hartmann, H.; Hilger, E.; Jakob, H.P.; Jungst, M.; Nuncio-Quiroz, A.E.; Paul, E.; Samson, U.; Schonberg, V.; Shehzadi, R.; Wlasenko, M.; Brook, N.H.; Heath, G.P.; Morris, J.D.; Capua, M.; Fazio, S.; Mastroberardino, A.; Schioppa, M.; Susinno, G.; Tassi, E.; Kim, J.Y.; Ibrahim, Z.A.; Kamaluddin, B.; Wan Abdullah, W.A.T.; Ning, Y.; Ren, Z.; Sciulli, F.; Chwastowski, J.; Eskreys, A.; Figiel, J.; Galas, A.; Gil, M.; Olkiewicz, K.; Stopa, P.; Zawiejski, L.; Adamczyk, L.; Bold, T.; Grabowska-Bold, I.; Kisielewska, D.; Lukasik, J.; Przybycien, M.; Suszycki, L.; Kotanski, A.; Slominski, W.; Behrens, U.; Blohm, C.; Bonato, A.; Borras, K.; Ciesielski, R.; Coppola, N.; Fang, S.; Fourletova, J.; Geiser, A.; Gottlicher, P.; Grebenyuk, J.; Gregor, I.; Haas, T.; Hain, W.; Huttmann, A.; Januschek, F.; Kahle, B.; Katkov, I.I.; Klein, U.; Kotz, U.; Kowalski, H.; Lobodzinska, E.; Lohr, B.; Mankel, R.; Melzer-Pellmann, I.A.; Miglioranzi, S.; Montanari, A.; Namsoo, T.; Notz, D.; Parenti, A.; Rinaldi, L.; Roloff, P.; Rubinsky, I.; Santamarta, R.; Schneekloth, U.; Spiridonov, A.; Szuba, D.; Szuba, J.; Theedt, T.; Wolf, G.; Wrona, K.; Yagues Molina, A.G.; Youngman, C.; Zeuner, W.; Drugakov, V.; Lohmann, W.; Schlenstedt, S.; Barbagli, G.; Gallo, E.; Pelfer, P.G.; Bamberger, A.; Dobur, D.; Karstens, F.; Vlasov, N.N.; Bussey, P.J.; Doyle, A.T.; Dunne, W.; Forrest, M.; Rosin, M.; Saxon, D.H.; Skillicorn, I.O.; Gialas, I.; Papageorgiu, K.; Holm, U.; Klanner, R.; Lohrmann, E.; Schleper, P.; Schorner-Sadenius, T.; Sztuk, J.; Stadie, H.; Turcato, M.; Foudas, C.; Fry, C.; Long, K.R.; Tapper, A.D.; Matsumoto, T.; Nagano, K.; Tokushuku, K.; Yamada, S.; Yamazaki, Y.; Barakbaev, A.N.; Boos, E.G.; Pokrovskiy, N.S.; Zhautykov, B.O.; Aushev, V.; Borodin, M.; Kadenko, I.; Kozulia, A.; Libov, V.; Lisovyi, M.; Lontkovskyi, D.; Makarenko, I.; Sorokin, Iu.; Verbytskyi, A.; Volynets, O.; Son, D.; de Favereau, J.; Piotrzkowski, K.; Barreiro, F.; Glasman, C.; Jimenez, M.; Labarga, L.; del Peso, J.; Ron, E.; Soares, M.; Terron, J.; Zambrana, M.; Corriveau, F.; Liu, C.; Schwartz, J.; Walsh, R.; Zhou, C.; Tsurugai, T.; Antonov, A.; Dolgoshein, B.A.; Gladkov, D.; Sosnovtsev, V.; Stifutkin, A.; Suchkov, S.; Dementiev, R.K.; Ermolov, P.F.; Gladilin, L.K.; Golubkov, Yu.A.; Khein, L.A.; Korzhavina, I.A.; Kuzmin, V.A.; Levchenko, B.B.; Lukina, O.Yu.; Proskuryakov, A.S.; Shcheglova, L.M.; Zotkin, D.S.; Abt, I.; Caldwell, A.; Kollar, D.; Reisert, B.; Schmidke, W.B.; Grigorescu, G.; Keramidas, A.; Koffeman, E.; Kooijman, P.; Pellegrino, A.; Tiecke, H.; Vazquez Acosta, Monica Luisa; Wiggers, L.; Brummer, N.; Bylsma, B.; Durkin, L.S.; Lee, A.; Ling, T.Y.; Allfrey, Philip Daniel; Bell, M.A.; Cooper-Sarkar, A.M.; Devenish, R.C.E.; Ferrando, J.; Foster, B.; Korcsak-Gorzo, K.; Oliver, K.; Robertson, A.; Uribe-Estrada, C.; Walczak, R.; Bertolin, A.; Dal Corso, F.; Dusini, S.; Longhin, A.; Stanco, L.; Bellan, P.; Brugnera, R.; Carlin, R.; Garfagnini, A.; Limentani, S.; Oh, B.Y.; Raval, A.; Ukleja, J.; Whitmore, J.J.; Iga, Y.; D'Agostini, G.; Marini, G.; Nigro, A.; Cole, J.E.; Hart, J.C.; Abramowicz, H.; Ingbir, R.; Kananov, S.; Levy, A.; Stern, A.; Kuze, M.; Maeda, J.; Hori, R.; Kagawa, S.; Okazaki, N.; Shimizu, S.; Tawara, T.; Hamatsu, R.; Kaji, H.; Kitamura, S.; Ota, O.; Ri, Y.D.; Costa, M.; Ferrero, M.I.; Monaco, V.; Sacchi, R.; Solano, A.; Arneodo, M.; Ruspa, M.; Fourletov, S.; Martin, J.F.; Stewart, T.P.; Boutle, S.K.; Butterworth, J.M.; Gwenlan, C.; Jones, T.W.; Loizides, J.H.; Wing, M.; Brzozowska, B.; Ciborowski, J.; Grzelak, G.; Kulinski, P.; Luzniak, P.; Malka, J.; Nowak, R.J.; Pawlak, J.M.; Tymieniecka, T.; Ukleja, A.; zarnecki, A.F.; Adamus, M.; Plucinski, P.; Eisenberg, Y.; Hochman, D.; Karshon, U.; Brownson, E.; Danielson, T.; Everett, A.; Kcira, D.; Reeder, D.D.; Ryan, P.; Savin, A.A.; Smith, W.H.; Wolfe, H.; Bhadra, S.; Catterall, C.D.; Cui, Y.; Hartner, G.; Menary, S.; Noor, U.; Standage, J.; Whyte, J.

2008-01-01

Inclusive K0SK0S production in ep collisions at HERA was studied with the ZEUS detector using an integrated luminosity of 0.5 fb-1. Enhancements in the mass spectrum were observed and are attributed to the production of f2(1270)/a02(1320), f'2(1525) and f0(1710). The f0(1710) state was observed with a statistical significance of 5 standard deviations. Masses and widths were obtained using a fit which takes into account theoretical predictions based on SU(3) symmetry arguments.

[Prevalence of the Diabetic Retinopathy and Genetic Factors Significance in the Development of Diabetic Retinopathy in Patients with Diabetes Mellitus type I and II in Slovakia (DIARET SK study). Overview of Actual Findings and Design of the Epidemiological DIARET SK Study].

Science.gov (United States)

Krásnik, V; Štefaničková, J; Fabková, J; Bucková, D; Helbich, M

2015-09-01

Diabetic retinopathy (DR) is the second most common microvascular complication and the most common cause of blindness in patients with diabetes mellitus (DM). Despite the ongoing research, the findings of diabetic retinopathy epidemiological and risk factors are, until now, not consistent. More finding may be revealed by epidemiological studies, consistently mapping DR epidemiology under the current possibilities of investigations and treatment of the DM. DIARET SK Study, with 5 000 enrolled patients with diabetes mellitus in the Slovak Republic, is, until now, the largest epidemiological study to set the prevalence of diabetic retinopathy. The primary aim is to establish the prevalence of diabetic retinopathy in patients with diabetes mellitus type I and II, according to the duration of the disease. The secondary aim is to establish prevalence of the different stages of the DR and diabetic macular edema (DME) and analysis of the risk factors influence. Included are patients with DM type I and II regardless to the ocular complications history and the period of DM duration. Each enrolled patient has both complex diabetic and ophthalmic examinations.Projects to establish DR prevalence: Tens of projects concerned with diabetic retinopathy epidemiology with different approaches to establish the prevalence and with different patients population. Results from different studies vary significantly (from 12.3 % to 66.9 %). The results depend on the design of the study and the patients recruitment, used examination methods, specific patients population with regard to the geography, prevalence of risk factors, period of diabetes duration, glycated hemoglobin (HbA1C) level, blood pressure, and is higher in type I diabetic patients. The most accurate results are from population epidemiological studies with well-controlled patient recruitment and uniform complex examination that are similar to the DIARET SK study. The DIARET SK study represents the largest epidemiological study

A Framework for WWW Query Processing

Science.gov (United States)

Wu, Binghui Helen; Wharton, Stephen (Technical Monitor)

2000-01-01

Query processing is the most common operation in a DBMS. Sophisticated query processing has been mainly targeted at a single enterprise environment providing centralized control over data and metadata. Submitting queries by anonymous users on the web is different in such a way that load balancing or DBMS' accessing control becomes the key issue. This paper provides a solution by introducing a framework for WWW query processing. The success of this framework lies in the utilization of query optimization techniques and the ontological approach. This methodology has proved to be cost effective at the NASA Goddard Space Flight Center Distributed Active Archive Center (GDAAC).

Neuroprotective effects of corn silk maysin via inhibition of H2O2-induced apoptotic cell death in SK-N-MC cells.

Science.gov (United States)

Choi, Doo Jin; Kim, Sun-Lim; Choi, Ji Won; Park, Yong Il

2014-07-25

Neuroprotective effects of maysin, which is a flavone glycoside that was isolated from the corn silk (CS, Zea mays L.) of a Korean hybrid corn Kwangpyeongok, against oxidative stress (H2O2)-induced apoptotic cell death of human neuroblastoma SK-N-MC cells were investigated. Maysin cytotoxicity was determined by measuring cell viability using MTT and lactate dehydrogenase (LDH) assays. Intracellular reactive oxygen species (ROS) were measured using a 2,7-dichlorofluorescein diacetate (DCF-DA) assay. Apoptotic cell death was monitored by annexin V-FITC/PI double staining and by a TUNEL assay. Antioxidant enzyme mRNA levels were determined by real-time PCR. The cleavage of poly (ADP-ribose) polymerase (PARP) was measured by western blotting. Maysin pretreatment reduced the cytotoxic effect of H2O2 on SK-N-MC cells, as shown by the increase in cell viability and by reduced LDH release. Maysin pretreatment also dose-dependently reduced the intracellular ROS level and inhibited PARP cleavage. In addition, DNA damage and H2O2-induced apoptotic cell death were significantly attenuated by maysin pretreatment. Moreover, maysin pretreatment (5-50 μg/ml) for 2h significantly and dose-dependently increased the mRNA levels of antioxidant enzymes (CAT, GPx-1, SOD-1, SOD-2 and HO-1) in H2O2 (200 μM)-insulted cells. These results suggest that CS maysin has neuroprotective effects against oxidative stress (H2O2)-induced apoptotic death of human brain SK-N-MC cells through its antioxidative action. This report is the first regarding neuroprotective health benefits of corn silk maysin by its anti-apoptotic action and by triggering the expression of intracellular antioxidant enzyme systems in SK-N-MC cells. Copyright © 2014 Elsevier Inc. All rights reserved.

MiRNA-135a regulates the expression of small conductance calcium-activated potassium (SK3) channels in epilepsy-like conditions

NARCIS (Netherlands)

Honrath, Birgit; Norwood, Braxton; Tanrioever, Gaye; Kuter, Katarzyna; Henshall, David C; Aksel-Aksoy, Ayla; Schratt, Gerhard; Pasterkamp, Jeroen; Dencher, Norbert A.; Nieweg, Katja; Culmsee, Carsten; Dolga, Amalia Mihalea

2017-01-01

Background Excessive and hypersynchronous neuronal discharges are key characteristics in the pathophysiology of neurological disorders such as epilepsy. Owing to their ability of regulating neuronal excitability, small conductance calcium-activated potassium (SK) channels have been implicated in

Retention behavior of flavonoids on immobilized artificial membrane chromatography and correlation with cell-based permeability.

Science.gov (United States)

Tsopelas, Fotios; Tsagkrasouli, Maria; Poursanidis, Pavlos; Pitsaki, Maria; Vasios, George; Danias, Panagiotis; Panderi, Irene; Tsantili-Kakoulidou, Anna; Giaginis, Constantinos

2018-03-01

The aim of the study was to investigate the immobilized artificial membrane (IAM) retention mechanism for a set of flavonoids and to evaluate the potential of IAM chromatography to model Caco-2 permeability. For this purpose, the retention behavior of 41 flavonoid analogs on two IAM stationary phases, IAM.PC.MG and IAM.PC.DD2, was investigated. Correlations between retention factors, logk w(IAM) and octanol-water partitioning (logP) were established and the role of hydroxyl groups of flavonoids to the underlying retention mechanism was explored. IAM retention and logP values were used to establish sound linear models with Caco-2 permeability (logP app ) taken from the literature. Both stepwise regression and multivariate analysis confirmed the contribution of hydrogen bond descriptors, as additional parameters in the either logk w(IAM) or logP models. Retention factors on both IAM stationary phases showed comparable performance with n-octanol-water partitioning towards Caco-2 permeability. Copyright © 2017 John Wiley & Sons, Ltd.

Andrographolide promotes vincristine-induced SK-NEP-1 tumor cell death via PI3K-AKT-p53 signaling pathway

Science.gov (United States)

Zhang, Mingsheng; Xue, Enda; Shao, Wei

2016-01-01

Background Nephroblastoma (Wilms’ tumor [WT]) is the most common malignant renal cancer in children. Although the outcome of WT has significantly improved as a result of the combination of surgery, chemotherapy, and radiotherapy; in some cases WT results in severe complications. Thus, novel strategies that would decrease treatment burden are required. The aim of the current study was to investigate the synergistic antitumor effect of andrographolide (AND) in combination with vincristine (VCR) on WT cells. Methods Cell Counting Kit-8 assay was used to investigate the synergistic antiproliferation effect of AND and/or VCR on SK-NEP-1 cells in vitro. Meanwhile, SK-NEP-1 xenografts were used to detect the antitumor effect in vivo. Apoptosis and autophagy were then detected by Annexin V, monodansylcadaverine staining. Finally, the underlying signaling transduction was determined with Western blotting. Results The combination of AND with VCR significantly suppressed SK-NEP-1 cell proliferation in vitro and inhibited xenograft tumor growth in vivo, compared with AND or VCR treatment alone. In addition, the synergistic antitumor effect of AND on the cells was due to an increased apoptosis, not autophagy. Moreover, PI3K-AKT-p53 signaling pathway was involved in the process of combination treatment, which was confirmed when a selective AKT activator was applied. Conclusion The combination of AND with VCR has a strong synergistic antitumor effect on WT via PI3K-AKT-p53 signaling pathway, thereby representing a potential treatment for WT in the near future. PMID:27729773

Spent fuel isotopic composition data base system on WWW. SFCOMPO on W3

International Nuclear Information System (INIS)

Suyama, Kenya

1997-11-01

Spent Fuel Composition Data Base System 'SFCOMPO' has been developed on IBM compatible PC. This data base system is not widely used, since users must purchase the data base software by themselves. 'SFCOMPO on W3' is a system to overcome this problem. User can search and visualize the data in the data base by accessing WWW server through the Internet from local machine. Only a browsing software to access WWW should be prepared. It enables us to easily search data of spent fuel composition if we can access the Internet. This system can be operated on WWW server machine which supports use of Common Gateway Interface (CGI). This report describes the background of the development of SFCOMPO on W3 and is it's user's manual. (author)

Vypravěčské strategie v povídkách Raymonda Carvera

OpenAIRE

SELNER, Ondřej

2016-01-01

The thesis Vypravěčské strategie v povídkách Raymonda Carvera deals with the literary concept of a narrator. It's results - typologically different narrators and their characterizations - are based on reading and analysis of all published Carver's short stories. The thesis is divided into two main parts - into the theoretical part in which we briefly introduce the development and fundamental concepts of narrator in the literary theory (e.g. in concepts of F. K. Stanzel, K. Friedmann, G. Genet...

Grasshoppers (Orthoptera: Caelifera and crickets (Orthoptera: Ensifera from slopes of Macošská stráň and Vilémovická stráň (Moravský kras Protected landscape area, Czech Republic

Directory of Open Access Journals (Sweden)

Jana Niedobová

2011-01-01

Full Text Available In 2008 we found 21 species of grasshoppers and crickets on Macošská stráň slope and 18 species on Vilémovická stráň slope. Both slopes are located in the northern part of the Moravský kras Protected landscape area and have xerothermic character. Both slopes are influenced by pasture management. For the most comprehensive picture of Orthoptera we used a standard method (sweeping of vegetation and nonstandard methods (pitfall traps and Möricke yellow cups. Termophilous species of Orthoptera on Macošská stráň (47% were dominating. On Vilémovická stráň mezophilous species (46% were dominating. The most common species were Stenobothrus lineatus (Panzer, 1796 on Macošská stráň slope and Chorthippus parallelus (Zetterstedt, 1821, Stenobothrus lineatus, Chorthippus bigutulus (Linné, 1758 and Chorthippus dorsatus (Zetterstedt, 1821 on Vilémovická stráň slope. Rare species of this assemblage were Stenobothrus nigromaculatus (Herrich-Schaffer, 1840 which was on Macošská stráň slope only and Tetrix bipunctata (Linnaeus, 1758 which has much bigger abundances also on Macošská stráň slope.

Effect of the SK/IK channel modulator 4,5-dichloro-1,3-diethyl-1,3-dihydro-benzoimidazol-2-one (NS4591) on contractile force in rat, pig and human detrusor smooth muscle

DEFF Research Database (Denmark)

Nielsen, Jens Steen; Rode, Frederik; Rahbek, Mette

2011-01-01

• To investigate the importance of small (SK)- and intermediate (IK)-conductance Ca2(+) -activated K(+) channels on bladder function, by studying the effects of 4,5-dichloro-1,3-diethyl-1,3-dihydro-benzoimidazol-2-one (NS4591), a new modulator of SK/IK channels, on contractions induced by electri...

Development of a search system of NRDF on WWW

International Nuclear Information System (INIS)

Masui, Hiroshi; Ohbayashi, Yoshihide; Aoyama, Shigeyoshi; Ohnishi, Akira; Kato, Kiyoshi; Chiba, Masaki

2000-01-01

We develop a data search system and a data entry system for the Nuclear Reaction Data File (NRDF), which is one of the charged-particle reaction database compiled by Japan Charged Particle Reaction Group (JCPRG). Using a WWW browser, we can easily search, retrieve and utilize the data of NRDF. (author)

Spent fuel isotopic composition data base system on WWW. SFCOMPO on W3

Energy Technology Data Exchange (ETDEWEB)

Suyama, Kenya [Japan Atomic Energy Research Inst., Tokai, Ibaraki (Japan). Tokai Research Establishment

1997-11-01

Spent Fuel Composition Data Base System `SFCOMPO` has been developed on IBM compatible PC. This data base system is not widely used, since users must purchase the data base software by themselves. `SFCOMPO on W3` is a system to overcome this problem. User can search and visualize the data in the data base by accessing WWW server through the Internet from local machine. Only a browsing software to access WWW should be prepared. It enables us to easily search data of spent fuel composition if we can access the Internet. This system can be operated on WWW server machine which supports use of Common Gateway Interface (CGI). This report describes the background of the development of SFCOMPO on W3 and is it`s user`s manual. (author)

Loss of function mutation in LARP7, chaperone of 7SK ncRNA, causes a syndrome of facial dysmorphism, intellectual disability, and primordial dwarfism.

Science.gov (United States)

Alazami, Anas M; Al-Owain, Mohammad; Alzahrani, Fatema; Shuaib, Taghreed; Al-Shamrani, Hussain; Al-Falki, Yahya H; Al-Qahtani, Saleh M; Alsheddi, Tarfa; Colak, Dilek; Alkuraya, Fowzan S

2012-10-01

Primordial dwarfism (PD) is a clinically and genetically heterogeneous condition. Various molecular mechanisms are known to underlie the disease including impaired mitotic mechanics, abnormal IGF2 expression, perturbed DNA damage response, defective spliceosomal machinery, and abnormal replication licensing. Here, we describe a syndromic form of PD associated with severe intellectual disability and distinct facial features in a large multiplex Saudi family. Analysis reveals a novel underlying mechanism for PD involving depletion of 7SK, an abundant cellular noncoding RNA (ncRNA), due to mutation of its chaperone LARP7. We show that 7SK levels are tightly linked to LARP7 expression across cell lines, and that this chaperone is ubiquitously expressed in the mouse embryo. The 7SK is known to influence the expression of a wide array of genes through its inhibitory effect on the positive transcription elongation factor b (P-TEFb) as well as its competing role in HMGA1-mediated transcriptional regulation. This study documents a critical role played by ncRNA in human development and adds to the growing list of molecular mechanisms that, when perturbed, converge on the PD phenotype. © 2012 Wiley Periodicals, Inc.

Ionospheric Electron/Ion Densities Temperatures on CD-ROM and WWW

Science.gov (United States)

Bilitza, Dieter; Papitashvili, Natasha; Schar, Bill; Grebowsky, Joseph

2002-01-01

As part of this project a large volume of ionospheric satellite insitu data from the sixties, seventies and early eighties were made accessible online in ASCII format for public use. This includes 14 data sets from the BE-B, Alouette 2, DME-A, AE-B, ISIS-1, ISIS-2, OGO-6, DE-2, AEROS-A, AE-C, AE-D, AE-E, and Hinotori satellites. The original data existed in various machine-specific, highly compressed, binary encoding on 7-, or 9-track magnetic tapes. The data were decoded and converted to a common ASCII data format, solar and magnetic indices were added, and some quality control measures were taken. The original intent of producing CD-ROMs with these data was overtaken by the rapid development of the Internet. Most users now prefer to obtain the data directly online and greatly value WWW-interfaces to browse, plot and subset the data. Accordingly the data were made available online on the anonymous ftp site of NASA's National Space Science Data Center (NSSDC) at ftp://nssdcftp.gsfc.nasa.gov/spacecraft data/ and on NSSDC's ATMOWeb (http://nssdc.gsfc.nasa.gov/atmoweb/), a WWW-interface for plotting, subsetting, and downloading the data. Several new features were implemented into ATMOWeb as part of this project including a filtering and scatter plot capability. The availability of this new database and WWW system was announced through several electronic mailer (AGU, CEDAR, IRI, etc) and through talks and posters during scientific meetings.

Je rozhodčí soud pro sport v Lausanne ideálním vzorem sportovní arbitráže?

Czech Academy of Sciences Publication Activity Database

Hamerník, Pavel

2014-01-01

Roč. 4, 3 - 4 (2014), s. 43-49 ISSN 1338-5569 Institutional support: RVO:68378122 Keywords : Court of Arbitration for Sport * Swiss federal tribunal * arbitration Subject RIV: AG - Legal Sciences www.magisterofficiorum.sk

First report on intersex in invasive round goby Neogobius melanostomus from the Baltic Sea (Gulf of Gdańsk, Poland

Directory of Open Access Journals (Sweden)

Tatiana Guellard

2015-01-01

Full Text Available This study is the first to report the presence of intersex in invasive round goby Neogobius melanostomus inhabiting the Baltic Sea. The discovery was made in the area of two harbours of the Gulf of Gdańsk (Poland. Macro- and microscopic male gonad analysis revealed the presence of female gametes in testes (testis-ova of single specimens. In addition, a female-like urogenital papilla was observed in one of the intersex fish. These findings might be due to the exposure to estrogenic endocrine disrupting compounds (EDCs however the occurrence of single intersex individuals as a baseline level in investigated population is also possible. In the future, more comprehensive research in the other areas of the Gulf of Gdańsk needs to be carried out in order to determine the extent and to better understand the cause of the observed phenomenon.

Uuenes Eesti riigipea kodulehekülg www.president.ee / Kristel Peterson

Index Scriptorium Estoniae

Peterson, Kristel

2007-01-01

Eesti Vabariigi Presidendi uuendatud kujundusega koduleheküljest aadressil www.president.ee. Veebilehe kujunduse tellis presidendi kantselei firmalt ADM Interactive OÜ, loodusfotode autoriks on Jarek Jõepera

The Chinese Cretaceous Continental Scientific Drilling Project in the Songliao Basin, NE China: Organic-rich source rock evaluation with geophysical logs from Borehole SK-2

Science.gov (United States)

Zhang, X.; Zou, C.

2017-12-01

The Cretaceous strata have been recognized as an important target of oil or gas exploration in the Songliao Basin, northeast China. The second borehole (SK-2) of the Chinese Cretaceous Continental Scientific Drilling Project in the Songliao Basin (CCSD-SK) is the first one to drill through the Cretaceous continental strata in the frame of ICDP. It was designed not only to solve multiple scientific problems (including the Cretaceous paleoenvironment and paleoclimate, as well as deep resources exploration of the Songliao Basin), but also to expect to achieve new breakthroughs in oil and gas exploration. Based on the project, various geophysical log data (including gamma, sonic, resistivity, density etc.) and core samples have been collected from Borehole SK-2. We do research on organic-rich source rocks estimation using various geophysical log data. Firstly, we comprehensively analyzed organic-rich source rocks' geophysical log response characteristics. Then, source rock's identification methods were constructed to identify organic-rich source rocks with geophysical logs. The main identification methods include cross-plot, multiple overlap and Decision Tree method. Finally, the technique and the CARBOLOG method were applied to evaluate total organic carbon (TOC) content from geophysical logs which provide continuous vertical profile estimations (Passey, 1990; Carpentier et al., 1991). The results show that source rocks are widely distributed in Borehole SK-2, over a large depth strata (985 5700m), including Nenjiang, Qingshankou, Denglouku, Yingcheng, Shahezi Formations. The organic-rich source rocks with higher TOC content occur in the Qingshankou (1647 1650m), Denglouku (2534 2887m) and Shahezi (3367 5697m) Formations. The highest TOC content in these formations can reach 10.31%, 6.58%, 12.79% respectively. The bed thickness of organic-rich source rocks in the these formations are totally up to 7.88m, 74.34m, 276.60m respectively. These organic-rich rocks in the

Pääsküla sõjaväeobjekti jääkreostus ning piirkonna edasise kasutamise perspektiivid / Triin Uudeväli, Anto Raukas

Index Scriptorium Estoniae

Uudeväli, Triin

2004-01-01

Pääskülas asunud NL-i raketijuhtimisekeskuse ja sideväeosa poolt tekitatud keskkonnareostuse hindamisest, likvideerimisest ning ettepanekutest territooriumi edasiseks kasutamiseks. Kaart. Skeem. Fotod

Functional characterization of six aspartate (D) recombinant mojastin mutants (r-Moj): A second aspartate amino acid carboxyl to the RGD in r-Moj-D_ peptides is not sufficient to induce apoptosis of SK-Mel-28 cells.

Science.gov (United States)

Ramos, Carla J; Gutierrez, Daniel A; Aranda, Ana S; Koshlaychuk, Melissa A; Carrillo, David A; Medrano, Rafael; McBride, Terri D; U, Andrew; Medina, Stephanie M; Lombardo, Melissa C; Lucena, Sara E; Sanchez, Elda E; Soto, Julio G

2016-08-01

Disintegrins are small peptides produced in viper venom that act as integrin antagonists. When bound to integrins, disintegrins induce altered cellular behaviors, such as apoptotic induction. Disintegrins with RGDDL or RGDDM motifs induce apoptosis of normal and cancer cells. We hypothesized that a second aspartate (D) carboxyl to the RGD is sufficient to induce apoptosis. Five recombinant mojastin D mutants were produced by site-directed mutagenesis (r-Moj-DA, r-Moj-DG, r-Moj-DL, r-Moj-DN, and r-Moj-DV). Stable αv integrin knockdown and shRNA scrambled control SK-Mel-28 cell lines were produced to test a second hypothesis: r-Moj-D_ peptides bind to αv integrin. Only r-Moj-DL, r-Moj-DM, and r-Moj-DN induced apoptosis of SK-Mel-28 cells (at 29.4%, 25.6%, and 36.2%, respectively). Apoptotic induction was significantly reduced in SK-Mel-28 cells with a stable αv integrin knockdown (to 2%, 17%, and 2%, respectively), but not in SK-Mel-28 cells with a stable scrambled shRNA. All six r-Moj-D_ peptides inhibited cell proliferation; ranging from 49.56% (r-Moj-DN) to 75.6% (r-Moj-DA). Cell proliferation inhibition by r-Moj-D_ peptides was significantly reduced in SK-Mel-28 cells with a stable αv integrin knockdown. All six r-Moj-D_ peptides inhibited SK-Mel-28 cell migration at high levels (69%-100%). As a consequence, rac-1 mRNA expression levels were significantly reduced as early as 1 h after treatment, suggesting that rac-1 is involved in the cell migration activity of SK-Mel-28. Copyright © 2016 Elsevier Ltd. All rights reserved.

Andrographolide promotes vincristine-induced SK-NEP-1 tumor cell death via PI3K-AKT-p53 signaling pathway

Directory of Open Access Journals (Sweden)

Zhang M

2016-09-01

Full Text Available Mingsheng Zhang, Enda Xue, Wei Shao Department of Pediatric Surgery, Liaocheng People’s Hospital, Liaocheng, Shandong Province, People’s Republic of China Background: Nephroblastoma (Wilms’ tumor [WT] is the most common malignant renal cancer in children. Although the outcome of WT has significantly improved as a result of the combination of surgery, chemotherapy, and radiotherapy; in some cases WT results in severe complications. Thus, novel strategies that would decrease treatment burden are required. The aim of the current study was to investigate the synergistic antitumor effect of andrographolide (AND in combination with vincristine (VCR on WT cells.Methods: Cell Counting Kit-8 assay was used to investigate the synergistic antiproliferation effect of AND and/or VCR on SK-NEP-1 cells in vitro. Meanwhile, SK-NEP-1 xenografts were used to detect the antitumor effect in vivo. Apoptosis and autophagy were then detected by Annexin V, monodansylcadaverine staining. Finally, the underlying signaling transduction was determined with Western blotting.Results: The combination of AND with VCR significantly suppressed SK-NEP-1 cell proliferation in vitro and inhibited xenograft tumor growth in vivo, compared with AND or VCR treatment alone. In addition, the synergistic antitumor effect of AND on the cells was due to an increased apoptosis, not autophagy. Moreover, PI3K-AKT-p53 signaling pathway was involved in the process of combination treatment, which was confirmed when a selective AKT activator was applied.Conclusion: The combination of AND with VCR has a strong synergistic antitumor effect on WT via PI3K-AKT-p53 signaling pathway, thereby representing a potential treatment for WT in the near future. Keywords: andrographolide, vincristine, p53, drug combination

[Learning from regional differences: online platform: http://www.versorgungsatlas.de].

Science.gov (United States)

Mangiapane, S

2014-02-01

In 2011, the Central Research Institute of Ambulatory Health Care in Germany (ZI) published the website http://www.versorgungsatlas.de, a portal that presents research results from regional health services in Germany. The Web portal provides a publicly accessible source of information and a growing number of selected analyses focusing on regional variation in health care. Each topic is presented in terms of interactive maps, tables, and diagrams and is supplemented by a paper that examines the results in detail and provides an explanation of the findings. The portal has been designed to provide a forum on which health service researchers can publish their results derived from various data sources of different institutions in Germany and can comment on results already available on http://www.versorgungsatlas.de. For health policy actors, the discussion of regional differences offers a new, previously unavailable basis for determining the region-specific treatment needs and for providing health-care management with the goal of high-quality care for each resident.

Wytrzymałość na ścinanie odpadów komunalnych a stateczność skarp składowisk

Directory of Open Access Journals (Sweden)

Tymoteusz Zydroń

2015-12-01

Full Text Available W pierwszej części pracy dokonano analizy literatury tematycznej dotyczącej parametrów charakteryzujących wytrzymałość na ścinanie odpadów komunalnych. Wykazała ona, że odpady komunalne charakteryzują się bardzo zróżnicowanymi warto­ściami kąta tarcia wewnętrznego i spójności, które zależą m.in. od ich struktury, stopnia rozkładu, metody badań, w tym zakresu odkształceń. Wpływ tych czynników na wytrzyma­łość na ścinanie odpadów jest często niejednoznaczny, co powoduje, że dobór parametrów wytrzymałościowych dla prognozowania stateczności składowisk jest zadaniem złożonym. W drugiej części pracy dokonano obliczeń stateczności skarpy kwatery składowiska od­ padów komunalnych w Chełmku, wykorzystując wartości parametrów wytrzymałościowych przyjętych z przedmiotowej literatury. Wykazano, że tradycyjna metoda obliczeń stateczności skarpy składowiska, z zastosowaniem uśrednionych parametrów wytrzyma­łościowych odpadów, dała wysoką wartość współczynnika stateczności, natomiast analiza probabilistyczna wykazała, że bezpieczeństwo konstrukcji można uznać jako sytuujące się pomiędzy słabym, a przeciętnym.

Cloning and knockout of formate hydrogen lyase and H{sub 2}-uptake hydrogenase genes in Enterobacter aerogenes for enhanced hydrogen production

Energy Technology Data Exchange (ETDEWEB)

Zhao, Hongxin; Ma, Kun; Lu, Yuan; Zhang, Chong; Wang, Liyan; Xing, Xin-Hui [Institute of Biochemical Engineering, Department of Chemical Engineering, Tsinghua University, Tsinghua Yuan, Beijing 100084 (China)

2009-01-15

A 5431-bp DNA fragment partially encoding the formate hydrogen lyase (FHL) gene cluster hycABCDE was isolated and identified from Enterobacter aerogenes IAM1183 chromosomal DNA. All the five putative gene products showed a high degree of homology to the reported bacterial FHL proteins. The gene hycA, encoding the FHL repressor protein, and hybO, encoding the small subunit of the uptake hydrogenase, were targeted for genetic knockout for improving the hydrogen production. The pYM-Red recombination system was adopted to form insertional mutations in the E. aerogenes genome, thereby creating mutant strains of IAM1183-A ({delta} hycA), IAM1183-O ({delta} hybO), and IAM1183-AO ({delta} hycA/ {delta} hybO double knockout). The hydrogen production experiments with these mutants showed that the maximum specific hydrogen productivities of IAM1183-A, IAM1183-O, and IAM1183-AO were 2879.466 {+-} 38.59, 2747.203 {+-} 13.25 and 3372.019 {+-} 4.39 (ml h{sup -1} g{sup -1}dry cell weight), respectively, higher than that of the wild strain (2321.861 {+-} 15.34 ml h{sup -1} g{sup -1}dry cell weight). The total H{sub 2} yields by the three mutants IAM1183-A, IAM1183-O and IAM1183-AO were 0.73, 0.78, and 0.83 mol-H{sub 2}/mol glucose, respectively, while the wild-type IAM1183 was only 0.65 mol-H{sub 2}/mol glucose. The metabolites of the mutants including acetate, ethanol, 2,3-butanediol and succinate were all increased compared with that of the wild type, implying the changed metabolic flux by the mutation. In the fermentor cultivation with IAM1183 {delta} hycA/ {delta} hybO, the total hydrogen volume after 16 h cultivation reached 4.4 L, while that for the wild type was only 2.9 L. (author)

Boolean and advanced searching for EDGAR data on www.sec.gov

Data.gov (United States)

Securities and Exchange Commission — This search allows users to enter complex boolean queries to access all but the most recent day's EDGAR filings on www.sec.gov. Filings are from 1994 to present.

webXice: an Infrastructure for Information Commerce on the WWW

NARCIS (Netherlands)

Wombacher, Andreas; Kostaki, Paraskevi; Aberer, Karl

Systems for information commerce on the WWW have to support flexible business models if they should be able to cover a wide range of requirements imposed by the different types of information businesses. This leads to non-trivial functional and security requirements both on the provider and consumer

Několik poznámek k výročí 20 let od rozsudku Bosman

Czech Academy of Sciences Publication Activity Database

Hamerník, Pavel

2015-01-01

Roč. 5, č. 3 (2015), s. 26-30 ISSN 1338-5569 Institutional support: RVO:68378122 Keywords : EU Law * transfer fee * football Subject RIV: AG - Legal Sciences http://www.magisterofficiorum.sk/vydania-rocnik-v-2015/cislo-3-2015/

Design of SMC base on FeSi and modified resin

Czech Academy of Sciences Publication Activity Database

Strečková, M.; Fáberová, M.; Bureš, R.; Kobera, Libor; Brus, Jiří

2013-01-01

Roč. 13, 3-4 (2013), s. 147-151 ISSN 1335-8987 Institutional support: RVO:61389013 Keywords : SMC * core - shell powder * microcomposites Subject RIV: CD - Macromolecular Chemistry http://www.imr.saske.sk/pmp/c3-4_2013.html

Persuasive interface: Designing for the WWW

DEFF Research Database (Denmark)

Dormann, Claire

1997-01-01

rhetorical figures such as metaphor, metonymy or visual pun are described and illustrated in relation with Web pages. The figures pertain to every aspect of Web design, images and concepts used to convey meaning, and the detailed visual characteristics of all Web components. Subsequently, their application...... to the design of Web pages is discussed. The rhetorical perspective suggests manners in which to express the most efficient statement. Rhetorical figures are techniques that are employed to enhance documents or to find original solutions to design problems. The concern here is to make Web authors aware......The design of Web documents is approached from the perspective of visual rhetoric and important aspects of persuasive discourses (e.g. the role of emotion) are presented in connection with the World Wide Web (WWW). The origin of the rhetorical figures is first briefly outlined. Then, a few...

A synergistic antiproliferation effect of curcumin and docosahexaenoic acid in SK-BR-3 breast cancer cells: unique signaling not explained by the effects of either compound alone

International Nuclear Information System (INIS)

Altenburg, Jeffrey D; Bieberich, Andrew A; Terry, Colin; Harvey, Kevin A; VanHorn, Justin F; Xu, Zhidong; Jo Davisson, V; Siddiqui, Rafat A

2011-01-01

Breast cancer is a collection of diseases in which molecular phenotypes can act as both indicators and mediators of therapeutic strategy. Therefore, candidate therapeutics must be assessed in the context of multiple cell lines with known molecular phenotypes. Docosahexaenoic acid (DHA) and curcumin (CCM) are dietary compounds known to antagonize breast cancer cell proliferation. We report that these compounds in combination exert a variable antiproliferative effect across multiple breast cell lines, which is synergistic in SK-BR-3 cells and triggers cell signaling events not predicted by the activity of either compound alone. Dose response curves for CCM and DHA were generated for five breast cell lines. Effects of the DHA+ CCM combination on cell proliferation were evaluated using varying concentrations, at a fixed ratio, of CCM and DHA based on their individual ED 50 . Detection of synergy was performed using nonlinear regression of a sigmoid dose response model and Combination Index approaches. Cell molecular network responses were investigated through whole genome microarray analysis of transcript level changes. Gene expression results were validated by RT-PCR, and western blot analysis was performed for potential signaling mediators. Cellular curcumin uptake, with and without DHA, was analyzed via flow cytometry and HPLC. CCM+DHA had an antiproliferative effect in SK-BR-3, MDA-MB-231, MDA-MB-361, MCF7 and MCF10AT cells. The effect was synergistic for SK-BR-3 (ER - PR - Her2 + ) relative to the two compounds individually. A whole genome microarray approach was used to investigate changes in gene expression for the synergistic effects of CCM+DHA in SK-BR-3 cells lines. CCM+DHA triggered transcript-level responses, in disease-relevant functional categories, that were largely non-overlapping with changes caused by CCM or DHA individually. Genes involved in cell cycle arrest, apoptosis, inhibition of metastasis, and cell adhesion were upregulated, whereas genes

On the nature of capture centers in irradiated ceramics SK-1

International Nuclear Information System (INIS)

Ashurov, M.Kh.; Gasanov, E.M.; Kim, Gen Chan; Nuritdinov, I.; Saidahmedov, Kh.

2006-01-01

Full text: Along with other methods, for detection of radiation defects, the luminescent methods are widely used. One of such methods is the thermo-stimulated luminescence (TSL) method. By using this method, information on nature and energy depth (E c ) of capture centers can be obtained. In this work, the influence of high dose γ--irradiation on magnesial ceramics SK-1 was studied by the TL method. The samples were irradiated with ' 60 Co source, and the γ-irradiation dose varied between 10 4 and 10 10 R. The TL curves were measured in the temperature ranges from 80 to 700 K. As a result of irradiation the samples acquired brown colour. After γ-irradiation one can see the peak with maximum of 220 K and the peaks with 428, 548 and 658 K in the low-temperature ( 300 K) regions of the TL curves, respectively. To determine the nature of capture centers the samples were annealed in the air-conditions environment. Annealing conditions do not lead to changes in intensities of the existing TL peaks. After heat treatment in air the increase in intensity of 220, 428 and 548 K of TLS peaks can be observed, whereas in 10-hour treatment the saturation can be observed. Besides, the TL peaks at 353-363 K appears. Consequent restoring annealing decreases intensities of 220, 428 and 548 K and leads to disappearing peaks at 353-363 K. The energy depth values E c calculated by the Uhrbach formula E c =T, K/500 occurred to be : 0,44 eV; 0,86 eV and 1,096 eV for 220, 428 and 548 K, respectively. Besides, at annealing the increase of reflection characteristics of ceramics samples within 300-700 nm in observed, whereas the reflection intensities fall for the samples undergone the annealing. The analysis of the experimental results demonstrated that 220, 428 and 548 K peaks and additional absorption in the region of 300-700 nm are conditioned by V-centers. Possible mechanisms of CC formation and improvement of explanation characteristics of SK-1 ceramics in the ionization fields are

The effect of VMP35 supplement ingredients encapsulated in a novel Phospholipid Prodosome SK713 SLP nutrient delivery technology on properties of live human blood.

Directory of Open Access Journals (Sweden)

Kenneth Blum

2015-09-01

Full Text Available Background: In North America digestive malfunction in terms of disintegration, dissolution, and absorption of food and nutrients, is a widespread malady. Malabsorption is also an exacerbating factor in most chronic degenerative diseases that might benefit from dietary supplementation. The purpose of this experiment was to determine, as shown by changes in properties of live blood, whether, a novel soy-lecithin-phospholipid-nutrient encapsulation technology could promote rapid bioavailability and bioactivity of a VMP35 nutraceutical formulation encapsulated within its clustoidal multilamellar Soy Lecithin Phospholipid (SLP liquid SK713 SLP structures. Method: Changes in peripheral blood smears from 38 subjects were measured utilizing peripheral live blood cell imaging (LBCI with phase contrast microscopy. Results: Compared to baseline and control, consistently and reproducibly, the SK713 SLP technology effected positive changes in the blood as demonstrated by observable morphological, hematological and rheological changes five minutes from intake and sustained for at least 30 minutes post intake. Conclusions: These results showed that the SK713 SLP system makes an important contribution by increasing the potential benefits of dietary supplementation to those patients with compromised digestive processes. We encourage additional research on this novel delivery system believing that it has potential impact on future therapy.

MIBG causes oxidative stress and up-regulation of anti-oxidant enzymes in the human neuroblastoma cell line SK-N-BE(2c)

NARCIS (Netherlands)

Cornelissen, J.; van Kuilenburg, A. B.; Voûte, P. A.; van Gennip, A. H.

1997-01-01

We report the effects of meta-iodobenzylguanidine (MIBG), a neuroblastoma-seeking agent, on cell proliferation and several oxidative stress-related parameters in the human neuroblastoma cell line SK-N-BE(2c). MIBG inhibited the proliferation of this cell line in micromolar concentrations.

Knowledge-based emergency planning for storage tank farms

Czech Academy of Sciences Publication Activity Database

Nevrlý, Václav; Bitala, P.; Nevrlá, P.; Střižík, Michal

2008-01-01

Roč. 10, č. 1 (2008), s. 10-15 ISSN 1335-4205 Institutional research plan: CEZ:AV0Z20760514 Keywords : emergency * preparedness * modeling tank fire boilover Subject RIV: AQ - Safety, Health Protection, Human - Machine http://www.utc.sk/komunikacie

German register for detection of late sequelae after radiotherapy for children and adolescents (RiSK): present status and first results

International Nuclear Information System (INIS)

Boelling, T.; Schuck, A.; Willich, N.; Pape, H.; Ruebe, C.; Meyer, F.M.; Martini, C.; Timmermann, B.; Asadpour, B.; Kortmann, R.D.; Beck, J.D.; Langer, T.; Paulides, M.

2007-01-01

Undoubtedly, radiotherapy is an important treatment strategy for many malignancies in paediatric oncology. However, sufficient data about late side effects do not exist. There is a lack of information about radiation dose-effect relationships in view of late side effects in childhood and adolescence. Late effects after radiotherapy in childhood and adolescence have mainly been characterized retrospectively with small patient numbers. Many of these analyses are limited due to little information about organ dose levels and older radiation techniques in some cases. Therefore the German Group of Paediatric Radiation Oncology (APRO) established the ''Register for the evaluation of late side effects after radiation in childhood and adolescence (RiSK)''. Aim of this prospective multicentric register study is to evaluate irradiation dose effect relationships of organs and part of organs with respect to late effects. The feasibility of RiSK has already been shown and first results have recently been published. The characterization of late effects after cancer therapy in childhood is of rising interest. In Germany, several study groups like the ''Late Effects Surveillance System'' (LESS) or the working group ''Quality of life'' examine different aspects of late effects. In the United States of America, the ''Childhood Cancer Survivor Study'' has been established to characterize retrospectively the health status of 5-year-survivors of childhood cancer. In these studies, more than 12,000 patients were evaluated by questionnaires regarding their health status. For radiotherapy, this study is not able to give detailed information about late side effects due to rare data about radiation doses and organ dose levels. To our knowledge, ''RiSK'' is the only multicentric study that evaluates radiation associated side effects prospectively with detailed information about organ dose levels. (orig.)

A numerical investigation of phytoplankton and Pseudocalanus elongatus dynamics in the spring bloom time in the Gdańsk Gulf

Science.gov (United States)

Dzierzbicka-Głowacka, Lidia

2005-01-01

A nutrient-phytoplankton-zooplankton-detritus (1D-NPZD) `phytoplankton {Phyt} and Pseudocalanus elongatus {Zoop} dynamics in the spring bloom time in the Gdańsk Gulf. The 1D-NPZD model consists of three coupled, partial second-order differential equations of the diffusion type for phytoplankton {Phyt}, zooplankton {Zoop}, nutrients {Nutr} and one ordinary first-order differential equation for benthic detritus pool {Detr}, together with initial and boundary conditions. In this model, the {Zoop} is presented by only one species of copepod ( P. elongatus) and {Zoop} is composed of six cohorts of copepods with weights ( Wi) and numbers ( Zi); where Zoop= limit∑i=16W iZ i. The calculations were made for 90 days (March, April, May) for two stations at Gdańsk Gulf with a vertical space step of 0.5m and a time step of 900 s. The flow field and water temperature used as the inputs in the biological model 1D-NPZD were reproduced by the prognostic numerical simulation technique using hydrographic climatological data. The results of the numerical investigations described here were compared with the mean observed values of surface chlorophyll- a and depth integrated P. elongatus biomass for 10 years, 1980-1990. The slight differences between the calculated and mean observed values of surface chlorophyll- a and zooplankton biomass are ca. 10-60 mg C m -3 and ca. 5-23 mg C m -2, respectively, depending on the location of the hydrographic station. The 1D-NPZD model with a high-resolution zooplankton module for P. elongatus can be used to describe the temporal patterns for phytoplankton biomass and P. elongatus in the centre of the Gdańsk Gulf.

German register for detection of late sequelae after radiotherapy for children and adolescents (RiSK): present status and first results

Energy Technology Data Exchange (ETDEWEB)

Boelling, T.; Schuck, A.; Willich, N. [Dept. of Radiotherapy of the Univ. Hospital Muenster (Germany); Pape, H. [Dept. of Radiotherapy of the Univ. Hospital Duesseldorf (Germany); Ruebe, C. [Dept. of Radiotherapy of the Univ. Saarland, Homburg/Saar (Germany); Meyer, F.M. [Dept. of Radiotherapy of the Clinic of Augsburg (Germany); Martini, C. [Dept. of Radiotherapy of the Univ. Hospitals Freiburg (Germany); Timmermann, B. [Paul Scherrer Inst., Villigen (Switzerland); Asadpour, B. [Dept. of Radiotherapy of the Univ. Hospital Aachen (Germany); Kortmann, R.D. [Dept. of Radiotherapy of the Univ. Hospital Leipzig (Germany); Beck, J.D.; Langer, T.; Paulides, M. [LESS Center, Univ. Children' s Hospital Erlangen (Germany)

2007-12-15

Undoubtedly, radiotherapy is an important treatment strategy for many malignancies in paediatric oncology. However, sufficient data about late side effects do not exist. There is a lack of information about radiation dose-effect relationships in view of late side effects in childhood and adolescence. Late effects after radiotherapy in childhood and adolescence have mainly been characterized retrospectively with small patient numbers. Many of these analyses are limited due to little information about organ dose levels and older radiation techniques in some cases. Therefore the German Group of Paediatric Radiation Oncology (APRO) established the 'Register for the evaluation of late side effects after radiation in childhood and adolescence (RiSK)'. Aim of this prospective multicentric register study is to evaluate irradiation dose effect relationships of organs and part of organs with respect to late effects. The feasibility of RiSK has already been shown and first results have recently been published. The characterization of late effects after cancer therapy in childhood is of rising interest. In Germany, several study groups like the 'Late Effects Surveillance System' (LESS) or the working group 'Quality of life' examine different aspects of late effects. In the United States of America, the 'Childhood Cancer Survivor Study' has been established to characterize retrospectively the health status of 5-year-survivors of childhood cancer. In these studies, more than 12,000 patients were evaluated by questionnaires regarding their health status. For radiotherapy, this study is not able to give detailed information about late side effects due to rare data about radiation doses and organ dose levels. To our knowledge, 'RiSK' is the only multicentric study that evaluates radiation associated side effects prospectively with detailed information about organ dose levels. (orig.)

Elementary analysis and energetic potential of the municipal sewage sludges from the Gdańsk and Kościerzyna WWTPs

Science.gov (United States)

Ostojski, Arkadiusz

2018-01-01

This paper aims to present municipal sewage sludge (MSS) elementary analysis and energetic potential based on measurement of heat of combustion (higher heating value HHV) and calculation of calorific values (lower heating value LHV). The analysis takes into the consideration water content in sewage sludge, at different utilization stages, in wastewater treatment plants in Gdańsk Wschód and Kościerzyna - Pomeranian Voivodeship. The study yielded the following results (in % dry matter): ash 19÷31 %, C - 31÷36 %, H - 5÷6 %, N - 4÷6 %, O - 28÷32 %, S - 1 %. Calorific value of stabilized sludges in Gdańsk was on average 13.8÷15 MJ/kg. In case of sludges not undergoing digestion from Kościerzyna WWTP, the calorific value was at the level of 17.5 MJ/kg. Thus, sewage sludges are good energy carriers. High water content though is the problem, as it lowers the useful effect of heat. There is no alternative for thermal sewage sludge neutralization, which is in conformity with valid Polish National Waste Management Plan (KPGO 2022).

Macrovipecetin, a C-type lectin from Macrovipera lebetina venom, inhibits proliferation migration and invasion of SK-MEL-28 human melanoma cells and enhances their sensitivity to cisplatin.

Science.gov (United States)

Hammouda, Manel B; Riahi-Chebbi, Ichrak; Souid, Soumaya; Othman, Houcemeddine; Aloui, Zohra; Srairi-Abid, Najet; Karoui, Habib; Gasmi, Ammar; Magnenat, Edith M; Wells, Timothy N C; Clemetson, Kenneth J; Rodríguez-López, José Neptuno; Essafi-Benkhadir, Khadija

2018-03-01

The resistance of melanoma cells to cisplatin restricts its clinical use. Therefore, the search for novel tumor inhibitors and effective combination treatments that sensitize tumor cells to this drug are still needed. We purified macrovipecetin, a novel heterodimeric C-type lectin, from Macrovipera lebetina snake venom and investigated its anti-tumoral effect on its own or combined with cisplatin, in human melanoma cells. Biochemical characterization, in vitro cells assays such as viability, apoptosis, adhesion, migration, invasion, Western blotting and in silico analysis were used in this study. Macrovipecetin decreased melanoma cell viability 100 times more than cisplatin. Interestingly, when combined with the drug, macrovipecetin enhanced the sensitivity of SK-MEL-28 cells by augmenting their apoptosis through increased expression of the apoptosis inducing factor (AIF) and activation of ERK 1/2 , p38, AKT and NF-κB. Moreover, macrovipecetin alone or combined with cisplatin induced the expression of TRADD, p53, Bax, Bim and Bad and down-regulated the Bcl-2 expression and ROS levels in SK-MEL-28 cells. Interestingly, these treatments impaired SK-MEL-28 cell adhesion, migration and invasion through modulating the function and expression of αvβ3 integrin along with regulating E-cadherin, vimentin, β-catenin, c-Src and RhoA expression. In silico study suggested that only the α chain of macrovipecetin interacts with a region overlapping the RGD motif binding site on this integrin. We validated the antitumor effect of macrovipecetin when combined, or not, with cisplatin on SK-MEL-28 cells. The presented work proposes the potential use of macrovipecetin and cisplatin in combination as an effective anti-melanoma treatment. Copyright © 2017 Elsevier B.V. All rights reserved.

Analýza a návrh online marketingovej stratégie spoločnosti AQT.sk

OpenAIRE

Múdry, Daniel

2017-01-01

The diploma thesis deals with the online marketing strategy and online activities of the company AQT.sk. The aim of the thesis is to analyze this strategy, individual tools and activities that the company uses and to propose further steps to improve the performance and efficiency of online marketing as a component of the communication mix. Theoretical part briefly describes the development of online marketing and at the same time presents in detail individual online marketing tools and their ...

TIMP-1 overexpression does not affect sensitivity to HER2-targeting drugs in the HER2-gene-amplified SK-BR-3 human breast cancer cell line

DEFF Research Database (Denmark)

Deng, Xiaohong; Fogh, Louise; Lademann, Ulrik Axel

2013-01-01

affect sensitivity to the HER2-targeting drugs trastuzumab and lapatinib. SK-BR-3 human breast cancer cells were stably transfected with TIMP-1, characterized with regard to TIMP-1 protein expression, proliferation, and functionality of the secreted TIMP-1, and the sensitivity to trastuzumab...... and lapatinib was studied in five selected single-cell subclones expressing TIMP-1 protein at various levels plus the parental SK-BR-3 cell line. Both trastuzumab and lapatinib reduced cell viability, as determined by MTT assay, but the sensitivity to the drugs was not associated with the expression level...... to trastuzumab and lapatinib....

Kit-negative fibroblast-like cells expressing SK3, a Ca2+-activated K+ channel, in the gut musculature in health and disease

DEFF Research Database (Denmark)

Vanderwinden, Jean-Marie; Rumessen, Jüri J; de Kerchove d'Exaerde, Alban

2002-01-01

The apamin-sensitive component of the inhibitory response of the gastrointestinal musculature involves the small conductance Ca(2+)-activated K(+) channel SK3. Kit-immunoreactive (ir) interstitial cells of Cajal appear to be involved in nitrergic inhibition while the role of the recently describe...

Learner support in a distributed learning environment:the use of WWW-based teachware packages

Directory of Open Access Journals (Sweden)

Christian Langenbach

1997-01-01

Full Text Available Various forms of education and training, based on the classical Computer Based Training (CBT, have become well established within companies and in higher education. With regard to the flexibility in terms of time and location, as well as in terms of incurred cost, they are far superior to traditional forms of instruction. A relatively recent development which has not yet gained widespread acceptance is the use of the World Wide Web (WWW as a basis and platform for distributed computer assisted teaching and learning. In addition to the advantages outlined with regard to classical CBT, the WWW offers the two advantages of world wide availablity as well as ease of promptly updating courses, but also adds many possibilities of collaborative learning. Using the Java programming language and the ever improving means of online presentation it has become possible to realize sophisticated WWW-based teachware packages which are comparable in terms of appearance and functionality to classical CBT applications created with dedicated authoring systems.

Melanotransferrin induces human melanoma SK-Mel-28 cell invasion in vivo

International Nuclear Information System (INIS)

Bertrand, Yanick; Demeule, Michel; Michaud-Levesque, Jonathan; Beliveau, Richard

2007-01-01

The expression of melanotransferrin (MTf), a membrane-bound glycoprotein highly expressed in melanomas, is correlated with tumor vascularization and progression, suggesting a proinvasive function associated with MTf in malignant tumors. To test this hypothesis, we silenced MTf in human melanoma SK-MEL-28 cells using small interfering RNA (siRNA) and examined the plasmin activity and invasiveness of MTf-silenced melanoma. In vitro, the siRNA-mediated MTf knockdown inhibited by 58% the cell surface activation of plasminogen into plasmin. In addition, decreased expression of MTf in melanoma cells reduced cell migration. In vivo, we used a nude mice invasion model in which tissue factor (TF) induces vascular [ 125 I]-fibrin deposition following injection. Using this metastasis model, the invasive potential of MTf-silenced cells into the lungs was reduced by fivefold. Altogether, these findings strongly suggest that MTf overexpression in melanoma cells contributes to tumor progession by stimulating plasmin generation as well as cell migration and invasion

The first recorded bloom of Pseudochattonella farcimen (Dictyochophyceae, Heterokonta, (Riisberg I., 2008 in the Gulf of Gdańsk

Directory of Open Access Journals (Sweden)

Maria Łotocka

2009-03-01

Full Text Available In April 2001 a local bloom of the heterokont phytoflagellate Pseudochattonella farcimen (Riisberg I., 2008 (initially named Chattonella aff. verruculosa was observed for the first time in the southern part of the Gulf of Gdańsk.The species occurred in high cell densities: the count was 11.5 × 106 cells dm-3 and the biomass 927.5 µgC dm-3.

Um siðferðis- og skapgerðarmenntun: á óformlegt nám erindi inn í skóla?

OpenAIRE

Pálsdóttir, Kolbrún Þ.

2017-01-01

Þessi grein varpar ljósi á siðferðis- og skapgerðarmenntun innan skóla og stöðu slíkrar menntunar á Íslandi. Margt bendir til þess að þó að fræðimenn hafi á síðustu árum varpað ljósi á mikilvægi þess að efla siðferðilega dómgreind nemenda, sem og félags- og tilfinningaþroska þeirra, verði sá þáttur skólastarfsins iðulega útundan. Innleiðingu á lífsleikni sem námsgrein í grunn- og framhaldsskóla má skoða sem einn þátt í þeirri viðleitni að efla siðferðismenntun og heildstæða sýn...

The CpG island searcher: a new WWW resource.

Science.gov (United States)

Takai, Daiya; Jones, Peter A

2003-01-01

Clusters of CpG dinucleotides in GC rich regions of the genome called "CpG islands" frequently occur in the 5' ends of genes. Methylation of CpG islands plays a role in transcriptional silencing in higher organisms in certain situations. We have established a CpG-island-extraction algorithm, which we previously developed [Takai and Jones, 2002], on a web site which has a simple user interface to identify CpG islands from submitted sequences of up to 50kb. The web site determines the locations of CpG islands using parameters (lower limit of %GC, ObsCpG/ExpCpG, length) set by the user, to display the value of parameters on each CpG island, and provides a graphical map of CpG dinucleotide distribution and borders of CpG islands. A command-line version of the CpG islands searcher has also been developed for larger sequences. The CpG Island Searcher was applied to the latest sequence and mapping information of human chromosomes 20, 21 and 22, and a total of 2345 CpG islands were extracted and 534 (23%) of them contained first coding exons and 650 (28%) contained other exons. The CpG Island Searcher is available on the World Wide Web at http://www.cpgislands.com or http://www.uscnorris.com/cpgislands/cpg.cgi.

Polska w oczach guwernera Skórzewskich, czyli zapiski księdza Pocharda z lat 1792–1833 w zbiorach Biblioteki Uniwersyteckiej w Poznaniu

Directory of Open Access Journals (Sweden)

Renata Wilgosiewicz-Skutecka

2011-01-01

Full Text Available W zbiorach rękopisów przechowywanych w Bibliotece Uniwersyteckiej w Poznaniu znajdują się trzy tomy wspomnień Claude’a Antoine’a Pocharda – francuskiego księdza, żyjącego w czasach rewolucji francuskiej, należącego do prêtres réfractaires i w roku 1792 zmuszonego do opuszczenia ojczyzny. W latach 1792–1796 pozostawał on na emigracji w Szwajcarii, później przyjął posadę guwernera synów Józefa Skórzewskiego, starosty gnieźnieńskiego, i Heleny z Lipskich Skórzewskiej. Zapiski księdza Pocharda prowadzone w latach 1792–1833 dotyczą obu tych okresów. Ich lektura daje możliwość śledzenia losów duchownego w trudnych czasach rewolucyjnych, a także zagłębienia się w relacje naocznego świadka wydarzeń z życia rodzinnego Skórzewskich, wydarzeń ukazanych w szerszym kontekście historycznym – polskim i europejskim. Artykuł jest wprowadzeniem do badania tych rękopisów jako wielowątkowego materiału mogącego zainteresować zarówno literaturoznawców, jak i historyków, pozwalającego weryfikować wiedzę i stawiać hipotezy dotyczące dziejów jednego z najznamienitszych rodów wielkopolskich.

Recombinant rubistatin (r-Rub), an MVD disintegrin, inhibits cell migration and proliferation, and is a strong apoptotic inducer of the human melanoma cell line SK-Mel-28.

Science.gov (United States)

Carey, Clayton M; Bueno, Raymund; Gutierrez, Daniel A; Petro, Christopher; Lucena, Sara E; Sanchez, Elda E; Soto, Julio G

2012-02-01

Disintegrins are low molecular weight peptides isolated from viper venom. These peptides bind to integrin receptors using a conserved binding motif sequence containing an RGD or similar motif. As a consequence, disintegrins can inhibit platelet aggregation and inhibit cell migration, proliferation, and initiate apoptosis in cancer cell lines. Rubistatin is a MVD disintegrin cloned from a Crotalus ruber ruber venom gland. The biological activity of MVD disintegrins is poorly understood. Recombinant rubistatin (r-Rub) was cloned into a pET32b plasmid and expressed in reductase-deficient Escherichia coli. Expression was induced with IPTG and the resulting fusion peptide was affinity purified, followed by thrombin cleavage, and removal of vector coded sequences. r-Rub peptide inhibited ADP-induced platelet aggregation by 54% ± 6.38 in whole blood. We assessed the ability of r-Rub to initiate apoptosis in three human cancer cell lines. Cultures of SK-Mel-28, HeLA, and T24 cells were grown for 24 h with 2.5 μM r-Rub followed by Hoechst staining. Chromatin fragmentation was observed in treated SK-Mel-28, but not in T24 or HeLA cells. A TUNEL assay revealed that 51.55% ± 5.28 of SK-Mel-28 cells were apoptotic after 18 h of treatment with 3.5 μM of r-Rub. Cell migration and proliferation assays were performed in order to further characterize the biological effects of r-Rub on SK-Mel-28 cells. At 3 μM, r-Rub inhibited cell migration by 44.4% ± 0.5, while at 3.5 μM it was able to inhibit cell proliferation by 83% ± 6.0. Copyright © 2011 Elsevier Ltd. All rights reserved.

All rights reserved and www.bioline.org.br/ja Estimation of exit ...

African Journals Online (AJOL)

ADOWIE PERE

and www.bioline.org.br/ja. Estimation of exit temperatures in the isentropic compression of real gases. 1 ..... other thermodynamic properties can be calculated within the framework of ... of negative compressibility) has no physical significance.

WWW-intensive concept mapping for metacognition in solving ill-structured problems

NARCIS (Netherlands)

Stoyanov, S.; Stoyanov, Slavi; Kommers, Petrus A.M.

2006-01-01

Concept mapping is one of the most intimate and most dynamic learning support activities that needs still a drastic further evolution of methods and tools. WWW-based concept mapping gains momentum quite fast now and needs a solid reviewing of the various approaches and the empirical effects. This

Specific pesticide-dependent increases in α-synuclein levels in human neuroblastoma (SH-SY5Y) and melanoma (SK-MEL-2) cell lines.

Science.gov (United States)

Chorfa, Areski; Bétemps, Dominique; Morignat, Eric; Lazizzera, Corinne; Hogeveen, Kevin; Andrieu, Thibault; Baron, Thierry

2013-06-01

Epidemiological studies indicate a role of genetic and environmental factors in Parkinson's disease involving alterations of the neuronal α-synuclein (α-syn) protein. In particular, a relationship between Parkinson's disease and occupational exposure to pesticides has been repeatedly suggested. Our objective was to precisely assess changes in α-syn levels in human neuroblastoma (SH-SY5Y) and melanoma (SK-MEL-2) cell lines following acute exposure to pesticides (rotenone, paraquat, maneb, and glyphosate) using Western blot and flow cytometry. These human cell lines express α-syn endogenously, and overexpression of α-syn (wild type or mutated A53T) can be obtained following recombinant adenoviral transduction. We found that endogenous α-syn levels in the SH-SY5Y neuroblastoma cell line were markedly increased by paraquat, and to a lesser extent by rotenone and maneb, but not by glyphosate. Rotenone also clearly increased endogenous α-syn levels in the SK-MEL-2 melanoma cell line. In the SH-SY5Y cell line, similar differences were observed in the α-syn adenovirus-transduced cells, with a higher increase of the A53T mutated protein. Paraquat markedly increased α-syn in the SK-MEL-2 adenovirus-transduced cell line, similarly for the wild-type or A53T proteins. The observed differences in the propensities of pesticides to increase α-syn levels are in agreement with numerous reports that indicate a potential role of exposure to certain pesticides in the development of Parkinson's disease. Our data support the hypothesis that pesticides can trigger some molecular events involved in this disease and also in malignant melanoma that consistently shows a significant but still unexplained association with Parkinson's disease.

Impact of image segmentation on high-content screening data quality for SK-BR-3 cells

Directory of Open Access Journals (Sweden)

Li Yizheng

2007-09-01

Full Text Available Abstract Background High content screening (HCS is a powerful method for the exploration of cellular signalling and morphology that is rapidly being adopted in cancer research. HCS uses automated microscopy to collect images of cultured cells. The images are subjected to segmentation algorithms to identify cellular structures and quantitate their morphology, for hundreds to millions of individual cells. However, image analysis may be imperfect, especially for "HCS-unfriendly" cell lines whose morphology is not well handled by current image segmentation algorithms. We asked if segmentation errors were common for a clinically relevant cell line, if such errors had measurable effects on the data, and if HCS data could be improved by automated identification of well-segmented cells. Results Cases of poor cell body segmentation occurred frequently for the SK-BR-3 cell line. We trained classifiers to identify SK-BR-3 cells that were well segmented. On an independent test set created by human review of cell images, our optimal support-vector machine classifier identified well-segmented cells with 81% accuracy. The dose responses of morphological features were measurably different in well- and poorly-segmented populations. Elimination of the poorly-segmented cell population increased the purity of DNA content distributions, while appropriately retaining biological heterogeneity, and simultaneously increasing our ability to resolve specific morphological changes in perturbed cells. Conclusion Image segmentation has a measurable impact on HCS data. The application of a multivariate shape-based filter to identify well-segmented cells improved HCS data quality for an HCS-unfriendly cell line, and could be a valuable post-processing step for some HCS datasets.

Změny využití krajiny v environmentálních souvislostech Slovácka - případová studie Vlčnovska

Czech Academy of Sciences Publication Activity Database

Trojan, Jakub; Milička, R.

2015-01-01

Roč. 2, č. 2 (2015), s. 43-46 ISSN 1337-9054 Institutional support: RVO:68145535 Keywords : land use * landscape * Slovacko region Subject RIV: DE - Earth Magnetism, Geodesy, Geography http://www.sevs.sk/sites/default/files/images/Dokumenty/01_vedecky_obzor_ekologia_201502.pdf

20 let od rozsudku Bosman Věc C - 415/1993. EU:C:1995:463

Czech Academy of Sciences Publication Activity Database

Hamerník, Pavel

2016-01-01

Roč. 5, č. 1 (2016), s. 43-47 ISSN 2453-7705 Institutional support: RVO:68378122 Keywords : sports law * football * Court of Arbitration for Sport Subject RIV: AG - Legal Sciences http://www.supcourt.gov.sk/data/files/1257_bulletin-2016-v-rocnik-c-1.pdf

ANTI-INFLAMMATORY EFFECTS OF CHAMOMILE ESSENTIAL OIL IN MICE

Czech Academy of Sciences Publication Activity Database

Fabian, D.; Juhás, Štefan; Bukovska, A.; Bujňáková, D.; Grešáková, L.; Koppel, J.

2011-01-01

Roč. 44, č. 3 (2011), s. 111-116 ISSN 1335-3683 Institutional research plan: CEZ:AV0Z50450515 Keywords : inflammation * carrageenan paw oedema * TNBS colitis Subject RIV: EB - Genetics ; Molecular Biology http://www.cvzv.sk/slju/11_3/Fabian-SJAS-3-2011.pdf

Záměr Wittgensteinova Traktátu (1). Předmluva a motto

Czech Academy of Sciences Publication Activity Database

Glombíček, Petr

2014-01-01

Roč. 21, č. 3 (2014), s. 363-380 ISSN 1335-0668 Institutional support: RVO:67985955 Keywords : Ferdinand Kürnberger * new wittgenstein * Paul Ernst * Tractatus * Wittgenstein Subject RIV: AA - Philosophy ; Religion http://www.klemens.sav.sk/fiusav/doc/organon/2014/3/363-380.pdf

Využití laserových modelů terénu v geomorfologickém výzkumu

Czech Academy of Sciences Publication Activity Database

Kolejka, Jaromír; Tejkal, M.

2011-01-01

Roč. 11, č. 1 (2011), s. 7-17 ISSN 1337-6799 Institutional support: RVO:68145535 Keywords : ground and airborne laser scanning * DTM * land form research application Subject RIV: DE - Earth Magnetism, Geodesy, Geography http://www.asg.sav.sk/gfsb/v0111/gfsb0110101.pdf

The activity and isoforms of NADP-malic enzyme in Nicotiana benthamiana plants under biotic stress

Czech Academy of Sciences Publication Activity Database

Doubnerová, V.; Jirásková, A.; Janošková, M.; Müller, Karel; Baťková, Petra; Synková, Helena; Čeřovská, Noemi; Ryšlavá, H.

2007-01-01

Roč. 26, č. 4 (2007), s. 281-289 ISSN 0231-5882 Institutional research plan: CEZ:AV0Z50380511 Keywords : NADP * malic enzyme isoforms * Nicotiana benthamiana Subject RIV: EF - Botanics Impact factor: 1.286, year: 2007 http://www.gpb.sav.sk/2007-4.htm

Povrchová úprava abrazivních nástrojů nové generace

Czech Academy of Sciences Publication Activity Database

Brožek, Vlastimil; Neufuss, Karel; Pokorný, P.; Vokáč, M.

2016-01-01

Roč. 9, č. 1 (2016), s. 50-53 ISSN 1338-0524 Institutional support: RVO:61389021 Keywords : Abrasive tools * plasma spraying * abrasive coatings Subject RIV: JK - Corrosion ; Surface Treatment of Materials http://www.tribotechnika.sk/tribotechnika-12016/povrchova-uprava-abrazivnich-nastroju-nove-generace.html

Celodřevěné tesařské spoje

Czech Academy of Sciences Publication Activity Database

Hasníková, Hana; Kunecký, Jiří; Fajman, P.

2015-01-01

Roč. 9, 1/2 (2015), s. 12-15 ISSN 1802-2030 R&D Projects: GA MK(CZ) DF12P01OVV004 Keywords : all-wooden joints * traditional technology * historical timber structures Subject RIV: AL - Art, Architecture, Cultural Heritage http://www.casopisstavebnictvi.cz/online/

Situs Blog Pribadi www.dianrainbow.blogspot.com dan Minat Menggunakan Jilbab (Studi Korelasional Pengaruh Situs Blog Pribadi www.dianrainbow.blogspot.com Terhadap Minat Menggunakan Jilbab Pada Mahasiswi Fakultas Keguruan Ilmu Pendidikan Universitas Muhammadyah Sumatera Utara).

OpenAIRE

Padang, Putri Sri Wahyuni

2014-01-01

The study entitled The Site of Personal Blog www.dianrainbow.blogspot.com and Interest of Using a Hijab (The Study of Correlational About Influence The Site of Personal Blog www.dianrainbow.blogspot.com Against The Interest of Using a Hijab On Coed Faculty of teacher training Education in North Sumatra Muhammadiyah University). Researchers used several theories relevant to research that is: The Uses and Gratifications Theory, Communications Technology, The Internet, Blogs and The Site of ...

Creador de WWW: "ICANN no deberia estar controlada solo por EEUU"

CERN Document Server

Barros, X

2003-01-01

"El creador del sistema de intercambio de informacion World Wide Web (www), Tim Berners Lee, que participa hoy en la inauguracion de la Cumbre Mundial de la Sociedad de la Informacion, dijo que el registro de nombres de dominio en Internet no deberia depender unicamente de Estados Unidos" (1 page).

When Educational Material Is Delivered: A Mixed Methods Content Validation Study of the Information Assessment Method.

Science.gov (United States)

Badran, Hani; Pluye, Pierre; Grad, Roland

2017-03-14

The Information Assessment Method (IAM) allows clinicians to report the cognitive impact, clinical relevance, intention to use, and expected patient health benefits associated with clinical information received by email. More than 15,000 Canadian physicians and pharmacists use the IAM in continuing education programs. In addition, information providers can use IAM ratings and feedback comments from clinicians to improve their products. Our general objective was to validate the IAM questionnaire for the delivery of educational material (ecological and logical content validity). Our specific objectives were to measure the relevance and evaluate the representativeness of IAM items for assessing information received by email. A 3-part mixed methods study was conducted (convergent design). In part 1 (quantitative longitudinal study), the relevance of IAM items was measured. Participants were 5596 physician members of the Canadian Medical Association who used the IAM. A total of 234,196 ratings were collected in 2012. The relevance of IAM items with respect to their main construct was calculated using descriptive statistics (relevance ratio R). In part 2 (qualitative descriptive study), the representativeness of IAM items was evaluated. A total of 15 family physicians completed semistructured face-to-face interviews. For each construct, we evaluated the representativeness of IAM items using a deductive-inductive thematic qualitative data analysis. In part 3 (mixing quantitative and qualitative parts), results from quantitative and qualitative analyses were reviewed, juxtaposed in a table, discussed with experts, and integrated. Thus, our final results are derived from the views of users (ecological content validation) and experts (logical content validation). Of the 23 IAM items, 21 were validated for content, while 2 were removed. In part 1 (quantitative results), 21 items were deemed relevant, while 2 items were deemed not relevant (R=4.86% [N=234,196] and R=3.04% [n

Rola pielęgniarki w opiece nad pacjentem z atopowym zapaleniem skóry = Nurse’s role in taking care of a patient with atopic dermatitis

Directory of Open Access Journals (Sweden)

Karolina Filipska

2016-01-01

3Wydział Kultury Fizycznej, Zdrowia i Turystyki, Uniwersytet Kazimierza Wielkiego w Bydgoszczy   Słowa kluczowe: atopowe zapalenie skóry, psychologiczne aspekty chorób, świąd, rola pielęgniarki. Keywords: atopic dermatitis, psychological aspects of diseases, itching, nurse’s role.   Streszczenie Wstęp. Atopowe zapalenie skóry (AZS, ang. atopic dermatitis jest chorobą alergiczną o przewlekłym i nawracającym przebiegu. Toczący się proces chorobowy dotyczy naskórka i skóry właściwej. AZS to najpowszechniej występująca przewlekła choroba zapalna dzieci, której patogeneza nie jest do końca poznana. Uznaje się, że na rozwój choroby składają się czynniki genetyczne, immunologiczne, oraz środowiskowe. Cel. Przedstawienie roli pielęgniarki w opiece nad pacjentem z atopowym zapaleniem skóry. Materiał i metody. Dokonano przeglądu 43 doniesień naukowych – artykuły badawcze i poglądowe oraz literatura współczesna - obejmujących swą tematyką rolę pielęgniarki w opiece nad pacjentem z atopowym zapaleniem skóry. Posługując się słowami kluczowymi: atopowe zapalenie skóry, psychologiczne aspekty chorób, świąd rola pielęgniarki przeszukano bazy bibliograficzne  Ebsco, ScienceDirect, SpringerLink, Medline. Wyniki. Zadania pielęgnacyjno-opiekuńcze wynikają z poszczególnych symptomów AZS. Wśród założeń opieki pielęgniarskiej wymienia się: zmniejszenie świądu i suchości skóry;  zminimalizowanie zaburzeń sennych; obniżenie ryzyka wtórych nadkażeń bakteryjnych, wirusowych lub grzybiczych; oraz kompleksowa edukacja chorego i jego rodziny w celu szybszej rekonwalescencji i wydłużenia okresów remisji. Wnioski. AZS wpływa negatywnie na domenę fizyczną, psychiczną i społeczną chorego. Ze względu na swoją przewlekłość oraz szerokie roz­powszechnienie należy do jednego z największych wyzwań zarówno dla pielęgniarki jak i całego zespołu terapeutycznego. Skuteczne leczenie dermatologiczne, w

Polonium 210Po activities in human blood of patients with ischaemic heart disease from Gda?sk in Poland

OpenAIRE

Bory?o, Alicja; Skwarzec, Bogdan; Roma?czyk, Grzegorz; Siebert, Janusz

2013-01-01

The determination of polonium 210Po in human blood samples is presented and discussed in this paper. The human blood samples were collected from patients of Medical University of Gda?sk with ischaemic heart disease (morbus ischaemicus cordis, MIC). The polonium concentrations in analyzed human blood samples are very differentiated. 210Po is of particular interest in public health and although is present in the environment in extremely low amounts, it is easily bioaccumulated to the human body...

Estudo piloto com Eco 3D das modificações geométricas do VE após infarto do miocárdio

Directory of Open Access Journals (Sweden)

Marcelo Luiz Campos Vieira

2013-07-01

Full Text Available FUNDAMENTO: Remodelamento ventricular esquerdo (RVE após IAM caracteriza fator de mau prognóstico. Há pouca informação na literatura sobre o RVE analisado com ecocardiografia tridimensional (ECO 3D OBJETIVO: Analisar com ECO 3D as modificações geométricas e volumétricas do ventrículo esquerdo (VE seis meses após IAM em pacientes submetidos a tratamento primário percutâneo. MÉTODOS: Estudo prospectivo com ECO 3D de 21 indivíduos (16 homens, 56 ± 12 anos, acometidos por IAM com elevação do segmento ST. Foi feita a análise morfofuncional (VE com ECO 3D (volumes, FEVE, índice de esfericidade 3D até sete dias e seis meses após o IAM. RVE foi considerado para aumento > 15% do volume diastólico final do VE (VDFVE após seis meses do IAM, comparado ao VDFVE até sete dias do evento. RESULTADOS: Oito (38% pacientes apresentaram RVE. Medidas ecocardiográficas (n = 21 pacientes: I- até sete dias do IAM: 1- VDFVE: 92,3 ± 22,3 mL; 2- FEVE: 0,51 ± 0,01; 3- índice de esfericidade: 0,38 ± 0,05; II- após seis meses: 1- VDFVE: 107,3 ± 26,8 mL; 2- FEVE: 0,59 ± 0,01; 3- índice de esfericidade: 0,31 ± 0,05. Coeficiente de correlação (r entre índice de esfericidade até sete dias do IAM e VDFVE aos seis meses (n = 8 após o IAM: r: 0,74, p = 0,0007; (r entre índice de esfericidade após seis meses do IAM e VDFVE aos seis meses do IAM: r: 0,85, p < 0,0001. CONCLUSÃO: Nesta série, foi observado RVE em 38% dos pacientes seis meses após IAM. O índice de esfericidade tridimensional foi associado à ocorrência de RVE.

The potential of immobilized artificial membrane chromatography to predict human oral absorption.

Science.gov (United States)

Tsopelas, Fotios; Vallianatou, Theodosia; Tsantili-Kakoulidou, Anna

2016-01-01

The potential of immobilized artificial membrane (IAM) chromatography to estimate human oral absorption (%HOA) was investigated. For this purpose, retention indices on IAM stationary phases reported previously by our group or measured by other authors under similar conditions were used to model %HOA data, compiled from literature sources. Considering the pH gradient in gastrointestinal tract, the highest logkw(IAM) values were considered, obtained either at pH7.4 or 5.5, defined as logkw(IAM)(best). Non linear models were established upon introduction of additional parameters and after exclusion of drugs which are substrates either to efflux or uptake transporters. The best model included Abraham's hydrogen-bond acidity parameter, molecular weight as well as the positively and negatively charged molecular fractions. For reasons of comparison between IAM chromatography and traditional lipophilicity, corresponding models were derived by replacing IAM retention factors with octanol-water distribution coefficients (logD). An overexpression of electrostatic interactions with phosphate anions was observed in the case of IAM retention as expressed by the negative contribution of the positively charged fraction F(+). The same parameter is statistically significant also in the logD model, but with a positive sign, indicating the attraction of basic drugs in the negatively charged inner membrane. To validate the obtained models a blind test set of 22 structurally diverse drugs was used, whose logkw(IAM)(best) values were determined and analyzed in the present study under similar conditions. IAM retention factors were further compared with MDCK cell lines permeability data taken from literature for a set of validation drugs. The overexpression of electrostatic interactions with phosphate anions on IAM surface was also evident in respect to MDCK permeability. In contrast to the clear classification between drugs with high and poor (or intermediate) absorption provided by MDCK

Elementary analysis and energetic potential of the municipal sewage sludges from the Gdańsk and Kościerzyna WWTPs

Directory of Open Access Journals (Sweden)

Ostojski Arkadiusz

2018-01-01

Full Text Available This paper aims to present municipal sewage sludge (MSS elementary analysis and energetic potential based on measurement of heat of combustion (higher heating value HHV and calculation of calorific values (lower heating value LHV. The analysis takes into the consideration water content in sewage sludge, at different utilization stages, in wastewater treatment plants in Gdańsk Wschód and Kościerzyna – Pomeranian Voivodeship. The study yielded the following results (in % dry matter: ash 19÷31 %, C - 31÷36 %, H - 5÷6 %, N - 4÷6 %, O - 28÷32 %, S – 1 %. Calorific value of stabilized sludges in Gdańsk was on average 13.8÷15 MJ/kg. In case of sludges not undergoing digestion from Kościerzyna WWTP, the calorific value was at the level of 17.5 MJ/kg. Thus, sewage sludges are good energy carriers. High water content though is the problem, as it lowers the useful effect of heat. There is no alternative for thermal sewage sludge neutralization, which is in conformity with valid Polish National Waste Management Plan (KPGO 2022.

The influence of question design on the response to self-assessment in www.elearnSCI.org

DEFF Research Database (Denmark)

Liu, N; Li, X-W; Zhou, M-W

2015-01-01

STUDY DESIGN: This is an interventional training session. OBJECTIVE: The objective of this study was to investigate the difference in response to self-assessment questions in the original and an adjusted version for a submodule of www.elearnSCI.org for student nurses. SETTING: The study was condu......STUDY DESIGN: This is an interventional training session. OBJECTIVE: The objective of this study was to investigate the difference in response to self-assessment questions in the original and an adjusted version for a submodule of www.elearnSCI.org for student nurses. SETTING: The study...... was conducted in a teaching hospital affiliated to Peking University, China. METHODS: In all, 28 student nurses divided into two groups (groups A and B; 14 in each) received a print-out of a Chinese translation of the slides from the 'Maintaining skin integrity following spinal cord injury' submodule in www.elearnSCI...... be avoided because it would increase the number of correct answers arrived at by guessing. When using multiple-answer MCQs, it is recommended that the questions asked should be in accordance with the content within the www.elearnSCI.org....

The Apoptotic Effect of Ursolic Acid on SK-Hep-1 Cells is Regulated by the PI3K/Akt, p38 and JNK MAPK Signaling Pathways

Directory of Open Access Journals (Sweden)

Wan-Ling Chuang

2016-04-01

Full Text Available Ursolic acid (UA is a pentacyclic triterpene acid that is present in a wide variety of medicinal herbs and edible plants. This study investigated the effect of UA on apoptosis and proliferation of hepatocellular carcinoma SK-Hep-1 cells. After treatment of SK-Hep-1 cells with different concentrations of UA, we observed that cell viability was reduced in a dose- and time-dependent manner. Furthermore, there was a dose-dependent increase in the percentage of cells in the sub-G1 and G2/M phases, with cells treated with 60 μM showing the highest percentages of cells in those phases. UA-induced chromatin condensation of nuclei was observed by using DAPI staining. The western blot results revealed that exposure to UA was associated with decreased expression of the anti-apoptotic proteins Mcl-1, Bcl-xL, Bcl-2, and TCTP and increased expression of apoptosis-related proteins TNF-α, Fas, FADD, Bax, cleaved caspase-3, caspase-8, caspase-9, and PARP. Immunocytochemistry staining showed that treatment with UA resulted in increased expression of caspase-3. Moreover, exposure to UA resulted in the inhibition of the PI3K/Akt and p38 MAPK signaling pathways. These findings suggest that UA inhibits the proliferation of SK-Hep-1 cells and induces apoptosis.

A High Molecular-Mass Anoxybacillus sp. SK3-4 Amylopullulanase: Characterization and Its Relationship in Carbohydrate Utilization

Directory of Open Access Journals (Sweden)

Kian Mau Goh

2013-05-01

Full Text Available An amylopullulanase of the thermophilic Anoxybacillus sp. SK3-4 (ApuASK was purified to homogeneity and characterized. Though amylopullulanases larger than 200 kDa are rare, the molecular mass of purified ApuASK appears to be approximately 225 kDa, on both SDS-PAGE analyses and native-PAGE analyses. ApuASK was stable between pH 6.0 and pH 8.0 and exhibited optimal activity at pH 7.5. The optimal temperature for ApuASK enzyme activity was 60 °C, and it retained 54% of its total activity for 240 min at 65 °C. ApuASK reacts with pullulan, starch, glycogen, and dextrin, yielding glucose, maltose, and maltotriose. Interestingly, most of the previously described amylopullulanases are unable to produce glucose and maltose from these substrates. Thus, ApuASK is a novel, high molecular-mass amylopullulanase able to produce glucose, maltose, and maltotriose from pullulan and starch. Based on whole genome sequencing data, ApuASK appeared to be the largest protein present in Anoxybacillus sp. SK3-4. The α-amylase catalytic domain present in all of the amylase superfamily members is present in ApuASK, located between the cyclodextrin (CD-pullulan-degrading N-terminus and the α-amylase catalytic C-terminus (amyC domains. In addition, the existence of a S-layer homology (SLH domain indicates that ApuASK might function as a cell-anchoring enzyme and be important for carbohydrate utilization in a streaming hot spring.

Improved Coast Guard Communications Using Commercial Satellites and WWW Technology: Slide Presentation

Science.gov (United States)

1997-06-18

The slides in this file amplify a paper that was presented at International Mobile Satellite Conference, (IMSC-97), Pasadena CA on 18 June 1997. The text of that presentation can be found at http://www.bts.gov/NTL/data/imsc.pdf.

Synthesis of carbon-11 labeled 1-(3,4-dimethoxybenzyl)-2,2-dimethyl-1,2,3,4-tetrahydroisoquinolinium derivatives as new potential PET SK{sub Ca} channel imaging agents

Energy Technology Data Exchange (ETDEWEB)

Gao Mingzhang; Wang Min [Department of Radiology, Indiana University School of Medicine, 1345 West 16th Street, L-3 Room 202, Indianapolis, IN 46202 (United States); Zheng Qihuang [Department of Radiology, Indiana University School of Medicine, 1345 West 16th Street, L-3 Room 202, Indianapolis, IN 46202 (United States)], E-mail: qzheng@iupui.edu

2008-02-15

Small conductance Ca{sup 2+}-activated K{sup +} (SK{sub Ca}) channels play an important role in many functions such as neuronal communication and behavioral plasticity, secretion, and cell proliferation. SK{sub Ca} channel modulation is associated with various brain, heart, and cancer diseases. N-methyl-laudanosine and its structurally related derivatives, substituted 1-(3,4-dimethoxybenzyl)-2,2-dimethyl-1,2,3,4-tetrahydroisoquinoliniums, are reversible and selective SK{sub Ca} channel blockers. Carbon-11 labeled N-methyl-laudanosine and its tetrahydroisoquinolinium derivatives may serve as new probes for positron emission tomography (PET) to image SK{sub Ca} channels in the brain, heart, and cancer. The key intermediates, substituted isoquinolines (3a-c), were synthesized using a modification of the Pomeranz-Fritsch procedure. The precursors, substituted 1-(3,4-dimethoxybenzyl)-2-methyl-1,2,3,4-tetrahydroisoquinolines (8a-c), and their corresponding reference standards, substituted 1-(3,4-dimethoxybenzyl)-2,2-dimethyl-1,2,3,4-tetrahydroisoquinoliniums (9a-c), were synthesized from compounds 3a-c with 3,4-dimethoxybenzyl chloride (2) in multiple steps with moderate to excellent chemical yields. The precursor 6,7-dimethoxy-1-(3,4-dimethoxybenzyl)-2-methyl-1,2,3, 4-tetrahydroisoquinoline (10) was commercially available, and the methylation of compound 10 with methyl iodide provided N-methyl-laudanosine (11). The target quaternary ammonium tracers, carbon-11 labeled 1-(3,4-dimethoxybenzyl)-2,2-dimethyl-1,2,3,4-tetrahydroisoquinoliniums ([{sup 11}C]9a-c and [{sup 11}C]11), were prepared by N-[{sup 11}C]methylation of the tertiary amine precursors (8a-c and 10) with [{sup 11}C]methyl triflate and isolated by a simplified solid-phase extraction (SPE) purification using a SiO{sub 2} or cation-exchange CM Sep-Pak cartridge in 40-65% radiochemical yields.

Seed oil composition of Acacia nilotica (L. Delile from Iran / Skład oleju z nasion Acacia nilotica (L. Delile rosnącej w Iranie

Directory of Open Access Journals (Sweden)

Abbasian Karim

2016-03-01

Full Text Available Wstęp: Acacia nilotica (L. Delile należy do rodziny Fabaceae, podrodziny Mimosoideae; otrzymuje się z niej gumę arabską. W południowym Iranie są spożywane pieczone młode strąki i nasiona tej rośliny Cel: Badano skład oleju z dojrzałych nasion A. nilotica zebranych z naturalnych stanowisk na południu Iranu w celu określenia jego przydatności do spożycia przez ludzi i zwierzęta. Metody: Wyekstrahowany olej analizowano metodą chromatografii gazowej sprzężonej ze spektrometrią mas (GC/MS. Wyniki: Zawartość oleju w jadalnych nasionach wynosiła 3.4% (v/w świeżej masy. Olej zawierał rzadko spotykany fitosterol, sześć kwasów tłuszczowych, dziewięć węgolwodorów i jeden diterpenoid; związki te stanowiły łącznie około 83.5% oleju. Głównymi składnikami oleju były: fitosterol, 26-ethylcholesta-5,25(Z-dien-3.β-ol (20.8% oraz nasycone i nienasycone kwasy tłuszczowe. Zawartość pozostałych składników nie przekroczyła 5%. Wniosek: Olej z nasion omawianego gatunku może być nowym naturalnym środkiem odżywczym dla ludzi.

Sense, Reference, Speech Acts, Norms and Other Issues

Czech Academy of Sciences Publication Activity Database

Koťátko, Petr

2015-01-01

Roč. 22, č. 4 (2015), s. 546-576 ISSN 1335-0668 Institutional support: RVO:67985955 Keywords : meaning * sense * normativity * speech acts * conventions * communicative intentions * rigid designation * explicite performatives Subject RIV: AA - Philosophy ; Religion http://www.klemens.sav.sk/fiusav/doc/organon/2015/4/546-576.pdf

Who's Afraid of the Big, Bad Folk?

Czech Academy of Sciences Publication Activity Database

Feinberg, Joseph Grim

2013-01-01

Roč. 61, č. 5 (2013), s. 548-560 ISSN 1335-1303 Institutional support: RVO:67985955 Keywords : tradition * folklore * folklore studies * reconceptualization * authenticity * the politics of folklore Subject RIV: AJ - Letters, Mass-media, Audiovision http://www.uet.sav.sk/files/etno5-2013-text-web.pdf

The Discussion of Subjective Quality of Working Life Indicators

Czech Academy of Sciences Publication Activity Database

Vinopal, Jiří

2012-01-01

Roč. 44, č. 3 (2012), s. 385-401 ISSN 0049-1225 Institutional support: RVO:68378025 Keywords : Job Satisfaction * Quality of Working Life * Work Satisfaction Subject RIV: AO - Sociology, Demography Impact factor: 0.240, year: 2012 http://www.sav.sk/journals/uploads/06251222Vinopal%203-2012.pdf

Terminology and Labelling Words by Subject in Monolingual Dictionaries – What Do Domain Labels Say to Dictionary Users?

Czech Academy of Sciences Publication Activity Database

Nová, Jana; Mžourková, Hana

2017-01-01

Roč. 68, č. 2 (2017), s. 296-304 ISSN 0021-5597 Institutional support: RVO:68378092 Keywords : terminology * terms * lexicography * monolingual dictionary * e- dictionary * domain labels * Czech Subject RIV: AI - Linguistics OBOR OECD: Linguistics http://www.juls.savba.sk/ediela/jc/2017/2/jc17-02.pdf

Supplier evaluation system of the wood processing enterprise in the region of the CZ, SK, HU and AT

OpenAIRE

Muselíková, Vladislava

2015-01-01

The Bachelor thesis Supplier evaluation system of the wood processing enterprise in the region of the CR, the SK, HU and AT deals with the analysis of the current supplier evaluation system in IKEA Industry company in Malacky. The theoretical part is based on literature review and contains a description of the purchasing process and methodology for selection and evaluation of suppliers. The practical part is devoted to the analysis of the Supplier Classification in IKEA. The main output of th...

The presence of c-erbB-2 gene product-related protein in culture medium conditioned by breast cancer cell line SK-BR-3

International Nuclear Information System (INIS)

Alper, O.; Yamaguchi, K.; Hitomi, J.; Honda, S.; Matsushima, T.; Abe, K.

1990-01-01

The Mr 185,000 glycoprotein encoded by human c-erbB-2/neu/HER2 gene, termed c-erbB-2 gene product, shows a close structural similarity with epidermal growth factor receptor and is now regarded to be a growth factor receptor for an as yet unidentified ligand. Abundant c-erbB-2 mRNA was demonstrated by Northern blot studies in the human breast cancer cell line SK-BR-3. Cellular radiolabeling experiments followed by immunoprecipitation with three different anti-c-erbB-2 gene product antibodies, recognizing extracellular domain, kinase domain, and carboxyl-terminal portion, respectively, demonstrated the production of a large amount of c-erbB-2 gene product which had the capacity to be phosphorylated. Immunization of mice with concentrated culture medium conditioned by SK-BR-3 cells always generated antibodies against c-erbB-2 gene product, demonstrating that this culture medium contained substance(s) immunologically indistinguishable from c-erbB-2 gene product. This observation was supported by the successful development of a monoclonal antibody against c-erbB-2 gene product, GFD-OA-p185-1, by immunizing mice with this culture medium. The biochemical nature of the substance(s) present in the culture medium was further characterized. When the culture medium conditioned by [35S]cysteine-labeled SK-BR-3 cells was immunoprecipitated by three different anti-c-erbB-2 gene product antibodies, only the antibody recognizing extracellular domain precipitated the [35S]-labeled protein with a molecular weight of 110,000, namely p110. The newly developed monoclonal antibody also immunoprecipitated this protein

Analysis of CPolSK-based FSO system working in space-to-ground channel

Science.gov (United States)

Su, Yuwei; Sato, Takuro

2018-03-01

In this article, the transmission performance of a circle polarization shift keying (CPolSK)-based free space optical (FSO) system working in space-to-ground channel is analyzed. Formulas describing the optical polarization distortion caused by the atmospheric turbulence and the communication qualities in terms of signal-to-noise-ratio (SNR), bit-error-ratio (BER) and outage probability of the proposed system are derived. Based on the Stokes parameters data measured by a Japanese optical communication satellite, we evaluate the space-to-ground FSO link and simulate the system performance under a varying regime of turbulence strength. The proposed system provides a more efficient way to compensate scintillation effects in a comparison with the on-off-keying (OOK)-based FSO system. These results are useful to the designing and evaluating of a deep space FSO communication system.

[Preparation of the database and the Internet (WWW) homepage for regulations on chemicals in Japan].

Science.gov (United States)

Yamamoto, M; Morita, M; Kaminuma, T

1999-01-01

We prepared a database on chemical regulations in Japan. The regulations consist of "The Law concerning the Examination and Regulation of Manufacture, etc., of Chemical Substances", "Poisonous and Deleterious Substances", Control Law", "Waterworks Law", "Law for the Control of Household Products containing Harmful Substances", and Pesticide Residues in Food Sanitation Law". We also set up a World Wide Web (WWW) homepage containing an explanation of the law as well as chemical names, CAS registry numbers, and standards. The WWW pages contain lists of chemicals and the retrieval page for the database.

Wear and Mechanical Behaviour of Various Polymethylmethacrylate Bone Cements

Czech Academy of Sciences Publication Activity Database

Balko, J.; Ballóková, B.; Jakubéczyová, D.; Hvizdoš, P.; Hloch, Sergej; Kloc, J.; Monka, P.

2013-01-01

Roč. 13, č. 1 (2013), s. 34-43 ISSN 1335-8987 Institutional support: RVO:68145535 Keywords : bone cements * mixing * pin-on-plate * porosity * nano-hardness Subject RIV: JQ - Machines ; Tools http://www.imr.saske.sk/pmp/issue/1-2013/PMP_Vol13_No1_p_034-043.pdf

Aplikace plazmových nástřiků kovových a keramických povlaků

Czech Academy of Sciences Publication Activity Database

Pokorný, P.; Brožek, Vlastimil

2013-01-01

Roč. 6, č. 4 (2013), s. 22-23 ISSN 1338-0524 Institutional support: RVO:61389021 Keywords : Plasma spraying * coating technology * alumina coatings * basalt coatings * zirkonia coatings * water stabilized plasma Subject RIV: CA - Inorganic Chemistry http://www.tribotechnika.sk/tribotechnika-42013/aplikace-plazmovych-nastriku-kovovych-a-keramickych-povlaku.html

No-gold-standard evaluation of image-acquisition methods using patient data.

Science.gov (United States)

Jha, Abhinav K; Frey, Eric

2017-02-11

Several new and improved modalities, scanners, and protocols, together referred to as image-acquisition methods (IAMs), are being developed to provide reliable quantitative imaging. Objective evaluation of these IAMs on the clinically relevant quantitative tasks is highly desirable. Such evaluation is most reliable and clinically decisive when performed with patient data, but that requires the availability of a gold standard, which is often rare. While no-gold-standard (NGS) techniques have been developed to clinically evaluate quantitative imaging methods, these techniques require that each of the patients be scanned using all the IAMs, which is expensive, time consuming, and could lead to increased radiation dose. A more clinically practical scenario is where different set of patients are scanned using different IAMs. We have developed an NGS technique that uses patient data where different patient sets are imaged using different IAMs to compare the different IAMs. The technique posits a linear relationship, characterized by a slope, bias, and noise standard-deviation term, between the true and measured quantitative values. Under the assumption that the true quantitative values have been sampled from a unimodal distribution, a maximum-likelihood procedure was developed that estimates these linear relationship parameters for the different IAMs. Figures of merit can be estimated using these linear relationship parameters to evaluate the IAMs on the basis of accuracy, precision, and overall reliability. The proposed technique has several potential applications such as in protocol optimization, quantifying difference in system performance, and system harmonization using patient data.

2018-05-11T19:26:48Z https://www.ajol.info/index.php/all/oai oai:ojs ...

African Journals Online (AJOL)

2018-05-11T19:26:48Z https://www.ajol.info/index.php/all/oai ... standards and confidentiality of HIV/AIDS status in the workplace — a South African case ... Article application/pdf https://www.ajol.info/index.php/ajar/article/view/7294 African ...

Identity and access management business performance through connected intelligence

CERN Document Server

Osmanoglu, Ertem

2013-01-01

Identity and Access Management: Controlling Your Network provides you with a practical, in-depth walkthrough of how to plan, assess, design, and deploy IAM solutions. This book breaks down IAM into manageable components to ease systemwide implementation. The hands-on, end-to-end approach includes a proven step-by-step method for deploying IAM that has been used successfully in over 200 deployments. The book also provides reusable templates and source code examples in Java, XML, and SPML.Focuses on real-word implementations Provides end-to-end coverage of IAM from business drivers, requirements

A Model for Spheroid versus Monolayer Response of SK-N-SH Neuroblastoma Cells to Treatment with 15-Deoxy-PGJ2

Directory of Open Access Journals (Sweden)

Dorothy I. Wallace

2016-01-01

Full Text Available Researchers have observed that response of tumor cells to treatment varies depending on whether the cells are grown in monolayer, as in vitro spheroids or in vivo. This study uses data from the literature on monolayer treatment of SK-N-SH neuroblastoma cells with 15-deoxy-PGJ2 and couples it with data on growth rates for untreated SK-N-SH neuroblastoma cells grown as multicellular spheroids. A linear model is constructed for untreated and treated monolayer data sets, which is tuned to growth, death, and cell cycle data for the monolayer case for both control and treatment with 15-deoxy-PGJ2. The monolayer model is extended to a five-dimensional nonlinear model of in vitro tumor spheroid growth and treatment that includes compartments of the cell cycle (G1,S,G2/M as well as quiescent (Q and necrotic (N cells. Monolayer treatment data for 15-deoxy-PGJ2 is used to derive a prediction of spheroid response under similar treatments. For short periods of treatment, spheroid response is less pronounced than monolayer response. The simulations suggest that the difference in response to treatment of monolayer versus spheroid cultures observed in laboratory studies is a natural consequence of tumor spheroid physiology rather than any special resistance to treatment.

A WWW-based information system on resistance of bacteria to antibiotics.

Science.gov (United States)

Schindler, J; Schindler, Z; Schindler, J

1998-01-01

The information system on resistance of bacteria to antibiotics (WARN--World Antibiotic Resistance Network) is implemented as a WWW server at Charles University in Prague (http:/(/)www.warn.cas.cz). Its main goal is to give information about problems of antibiotic resistance of bacteria and to process data on isolated strains. The WARN web-site contains six main topics. Four of them form the core of the system: Topics of Interest bring information on selected timely topics in antibiotic resistance--pneumococci, staphylococci, beta-lactamases, glycopeptide--and aminoglycoside resistance. Global Monitor brings references and reports on resistance in the world as well as recommended method of surveillance. The topic Data contains raw data on strains in particular countries and hospitals. Data can be viewed in their original form as a list of records (strains) or processed to provide statistics about the resistance rates in the selected country or hospital respectively. The topic Search allows one to search for one or several terms in the whole document. Counts of accessed pages show, that there is a standing demand for information about the serious problems of antibiotic therapy of infectious diseases.

Upper Campanian-Maastrichtian chronostratigraphy of the Skælskør-1 core, Denmark

DEFF Research Database (Denmark)

Thibault, Nicolas Rudolph; Anderskouv, Kresten; Bjerager, Morten

2015-01-01

The lithostratigraphy, calcareous nannofossil biostratigraphy, carbon- and oxygen-isotope stratigraphy and gamma-ray profile are presented for the Skælskør-1 core, eastern Denmark. The correlation of carbon isotopes to Gubbio (Italy) and ODP Site 762C (Indian Ocean) provides...... the chronostratigrahical framework of the core through a tie to magnetostratigraphy. Two new carbon-isotope excursions are defined for the uppermost Maastrichtian of the core and prove useful for long-distance correlation. Twenty stratigraphic tie-points are used for correlation of the upper Campanian......-Maastrichtian interval by combining carbon-isotope and gamma-ray variations. Significant dissimilarities in the gamma-ray profiles of the Danish Basin cores preclude the sole use of this tool for basin-scale correlations. Bulk oxygen-isotopes and semi-quantitative abundance changes in the warm-water calcareous...

MirZ: an integrated microRNA expression atlas and target prediction resource.

Science.gov (United States)

Hausser, Jean; Berninger, Philipp; Rodak, Christoph; Jantscher, Yvonne; Wirth, Stefan; Zavolan, Mihaela

2009-07-01

MicroRNAs (miRNAs) are short RNAs that act as guides for the degradation and translational repression of protein-coding mRNAs. A large body of work showed that miRNAs are involved in the regulation of a broad range of biological functions, from development to cardiac and immune system function, to metabolism, to cancer. For most of the over 500 miRNAs that are encoded in the human genome the functions still remain to be uncovered. Identifying miRNAs whose expression changes between cell types or between normal and pathological conditions is an important step towards characterizing their function as is the prediction of mRNAs that could be targeted by these miRNAs. To provide the community the possibility of exploring interactively miRNA expression patterns and the candidate targets of miRNAs in an integrated environment, we developed the MirZ web server, which is accessible at www.mirz.unibas.ch. The server provides experimental and computational biologists with statistical analysis and data mining tools operating on up-to-date databases of sequencing-based miRNA expression profiles and of predicted miRNA target sites in species ranging from Caenorhabditis elegans to Homo sapiens.

‘Close to the city centre, close to the university’. Are there symptoms of studentification in Gdańsk, Poland?

OpenAIRE

Grabkowska Maja; Frankowski Jan

2016-01-01

Students are increasingly recognised as important actors of urban change in contemporary cities. The article presents an analysis of incipient studentification processes in Gdańsk. Its general aim is to reveal patterns of students’ presence and activity which translate into spatial and socio-economic transformations of a post-socialist city at the level of neighbourhoods. The study consists of a survey on students’ residential behaviour, complemented by field and desk research. According to t...

Etteheited räsivad pidu / Henri Reeder, Ly Rääsk, Heli Jürgenson ... [jt.] ; intervjueerinud Anneli Aasmäe

Index Scriptorium Estoniae

2009-01-01

Küsimustele tänavusele üldlaulu- ja üldtantsupeole minekust ja peo repertuaari raskusest vastavad Aruküla noortekoori laulja Henri Reeder, Äksi segakoori dirigent Ly Rääsk, üldlaulupeo segakooride liigijuht Heli Jürgenson, Laulu- ja Tantsupeo SA muusikatoimetaja Ave Sopp, Laulu- ja Tantsupeo SA tantsutoimetaja Kadri Tiis , Lüganuse segakoori dirigent Priit-Andres Pärtna ja kolme tantsurühma juhendaja Vändrast Kädi Pärnoja

The Effects of Instruction on the Frequency and Characteristics of Involuntary Autobiographical Memories.

Science.gov (United States)

Barzykowski, Krystian; Niedźwieńska, Agnieszka

2016-01-01

The present study investigated the effects of experimental instruction on the retrieval of involuntary autobiographical memories (IAMs). In previous studies of IAMs, participants were either instructed to record only memories (henceforth, the restricted group) or any thoughts (henceforth, the unrestricted group). However, it is unknown whether these two different types of instructions influence the retrieval of IAMs. The most recent study by Vannucci and her colleagues directly addressed this question and demonstrated that the frequency and phenomenological characteristics of IAMs strongly depended on the type of instruction received. The goal of the present study was to replicate these results while addressing some limitations of the Vannucci et al. study and to test three possible mechanisms proposed to explain the effect of instructions on the retrieval of IAMs. Our results accord well with the data presented by Vannucci et al. When participants were instructed to record only IAMs (the restricted group), they reported more memories and rated them as being retrieved in a more goal-oriented fashion. Their memories also were less clear, vivid, detailed and were less frequently accompanied by physiological reactions, compared to memories reported by the participants in the unrestricted group. In addition, the events to which the memories referred were rated as more unusual and personal by the restricted group. These results are consistent with the assumption that retrieval of IAMs depends on the type of instructions used in a study. In addition, our results suggest that one of the main mechanisms underlying the higher frequency of IAMs in the restricted group may be participants' ability to monitor the stream of consciousness and to extract autobiographical content from this flow. Further implications of the effect of instructions for IAMs research are discussed.

The Effects of Instruction on the Frequency and Characteristics of Involuntary Autobiographical Memories.

Directory of Open Access Journals (Sweden)

Krystian Barzykowski

Full Text Available The present study investigated the effects of experimental instruction on the retrieval of involuntary autobiographical memories (IAMs. In previous studies of IAMs, participants were either instructed to record only memories (henceforth, the restricted group or any thoughts (henceforth, the unrestricted group. However, it is unknown whether these two different types of instructions influence the retrieval of IAMs. The most recent study by Vannucci and her colleagues directly addressed this question and demonstrated that the frequency and phenomenological characteristics of IAMs strongly depended on the type of instruction received. The goal of the present study was to replicate these results while addressing some limitations of the Vannucci et al. study and to test three possible mechanisms proposed to explain the effect of instructions on the retrieval of IAMs. Our results accord well with the data presented by Vannucci et al. When participants were instructed to record only IAMs (the restricted group, they reported more memories and rated them as being retrieved in a more goal-oriented fashion. Their memories also were less clear, vivid, detailed and were less frequently accompanied by physiological reactions, compared to memories reported by the participants in the unrestricted group. In addition, the events to which the memories referred were rated as more unusual and personal by the restricted group. These results are consistent with the assumption that retrieval of IAMs depends on the type of instructions used in a study. In addition, our results suggest that one of the main mechanisms underlying the higher frequency of IAMs in the restricted group may be participants' ability to monitor the stream of consciousness and to extract autobiographical content from this flow. Further implications of the effect of instructions for IAMs research are discussed.

Ichnofabric and substrate consistency in Upper Turonian carbonates of the Bohemian Cretaceous Basin (Czech Republic)

Czech Academy of Sciences Publication Activity Database

Mikuláš, Radek

2006-01-01

Roč. 57, č. 2 (2006), s. 79-90 ISSN 1335-0552 R&D Projects: GA ČR GA205/04/0151 Institutional research plan: CEZ:AV0Z30130516 Keywords : Cretaceous * ichnofossils * firmground Subject RIV: EG - Zoology Impact factor: 0.364, year: 2006 http://www.geologicacarpathica.sk/src/main.php

Trápení může být kultivací. Ale přestává tak být trápením?

Czech Academy of Sciences Publication Activity Database

Peregrin, Jaroslav

2017-01-01

Roč. 72, č. 7 (2017), s. 581-585 ISSN 0046-385X Institutional support: RVO:67985955 Keywords : metaphysical realism * science * truth * correspondence Subject RIV: AA - Philosophy ; Religion OBOR OECD: Philosophy, History and Philosophy of science and technology http://www.klemens.sav.sk/fiusav/doc/filozofia/2017/7/581-585.pdf

Priming involuntary autobiographical memories in the lab.

Science.gov (United States)

Barzykowski, Krystian; Niedźwieńska, Agnieszka

2018-02-01

Involuntary autobiographical memories (IAMs) are recollections of personal past that frequently and spontaneously occur in daily life. Initial studies by Mace (2005) showed that deliberately reminiscing about a certain lifetime period (e.g., high school) significantly increased the number of different IAMs from the same period in subsequent days, suggesting that priming may play a significant role in the retrieval of IAMs in everyday life. In the present study, we used a modified experimental paradigm, originally used by Schlagman and Kvavilashvili (2008), to study IAMs under well-controlled laboratory conditions. Participants completed a monotonous vigilance task twice and reported the occurrence of any spontaneous thoughts that were later classed as IAMs or other thoughts. Priming was manipulated by having experimental participants reminiscing about high school period between the two vigilance tasks and control participants playing simple games. Results showed that participants in the experimental group reported IAMs relating to high school period more frequently during the second vigilance task than those in the control group. In the experimental group, the number of high school memories was marginally higher in the second vigilance task compared to the first vigilance task with the medium effect size, but this within subjects effect was not significant in the control group. Finally, priming also enhanced the retrieval of more remote IAMs in the experimental group compared to the control group. These results suggest that priming may play a significant role in the activation and recall of IAMs and open up interesting avenues for future research.

The treatment of climate science in Integrated Assessment Modelling: integration of climate step function response in an energy system integrated assessment model.

Science.gov (United States)

Dessens, Olivier

2016-04-01

Integrated Assessment Models (IAMs) are used as crucial inputs to policy-making on climate change. These models simulate aspect of the economy and climate system to deliver future projections and to explore the impact of mitigation and adaptation policies. The IAMs' climate representation is extremely important as it can have great influence on future political action. The step-function-response is a simple climate model recently developed by the UK Met Office and is an alternate method of estimating the climate response to an emission trajectory directly from global climate model step simulations. Good et al., (2013) have formulated a method of reconstructing general circulation models (GCMs) climate response to emission trajectories through an idealized experiment. This method is called the "step-response approach" after and is based on an idealized abrupt CO2 step experiment results. TIAM-UCL is a technology-rich model that belongs to the family of, partial-equilibrium, bottom-up models, developed at University College London to represent a wide spectrum of energy systems in 16 regions of the globe (Anandarajah et al. 2011). The model uses optimisation functions to obtain cost-efficient solutions, in meeting an exogenously defined set of energy-service demands, given certain technological and environmental constraints. Furthermore, it employs linear programming techniques making the step function representation of the climate change response adapted to the model mathematical formulation. For the first time, we have introduced the "step-response approach" method developed at the UK Met Office in an IAM, the TIAM-UCL energy system, and we investigate the main consequences of this modification on the results of the model in term of climate and energy system responses. The main advantage of this approach (apart from the low computational cost it entails) is that its results are directly traceable to the GCM involved and closely connected to well-known methods of

Protective Effects of Streblus asper Leaf Extract on H2O2-Induced ROS in SK-N-SH Cells and MPTP-Induced Parkinson’s Disease-Like Symptoms in C57BL/6 Mouse

Directory of Open Access Journals (Sweden)

Kanathip Singsai

2015-01-01

Full Text Available This study investigated the effects of Streblus asper leaf extract (SA on reactive oxygen species (ROS in SK-N-SH cell culture and on motor functions and behaviors in MPTP-treated C57BL/6 mice. SK-N-SH cell viability after incubation with SA for 24 h was measured by MTT assay. Intracellular ROS levels of SK-N-SH cells were quantified after pretreatment with SA (0, 200, 600, and 1000 µg/mL in the presence of H2O2 (300 µM. Male C57BL/6 mice were force-fed with water or 200 mg/kg/day SA for 32 days. Intraperitoneal injection of MPTP was used to induce Parkinson’s disease-like symptoms. Catalepsy, beam balance ability, olfactory discrimination, social recognition, and spontaneous locomotor activity were assessed on days 19, 21, 23, 26, and 32, respectively. In cell culture, SA at 200, 600, and 1000 µg/mL significantly decreased ROS levels in H2O2-treated SK-N-SH cells. MPTP-treated C57BL/6 mice showed a significant change in all parameters tested when compared to the control group. Pretreatment and concurrent treatment with 200 mg/kg/day SA could antagonize the motor and cognitive function deficits induced by MPTP. The results show that SA possesses anti-Parkinson effects in MPTP-treated C57BL/6 mice and that reduction in ROS levels might be one of the mechanisms.

Antioxidant mechanism of mitochondria-targeted plastoquinone SkQ1 is suppressed in aglycemic HepG2 cells dependent on oxidative phosphorylation

Czech Academy of Sciences Publication Activity Database

Ježek, J.; Engstová, Hana; Ježek, Petr

2017-01-01

Roč. 1858, č. 9 (2017), s. 750-762 ISSN 0005-2728 R&D Projects: GA ČR(CZ) GA17-01813S Institutional support: RVO:67985823 Keywords : mitochondria-targeted antioxidant SkQ1 * mitochondrial Complex I superoxide formation * mitochondrial Complex III superoxide formation * HepG2 cell s * NAD(P)H fluorescence lifetime imaging microscopy Subject RIV: ED - Physiology OBOR OECD: Cell biology Impact factor: 4.932, year: 2016

[The Outpatient Clinic for Adolescent Risk-taking and Self-harm behaviors (AtR!Sk) - A Pioneering Approach of Outpatient Early Detection and Intervention of Borderline Personality Disorder].

Science.gov (United States)

Kaess, Michael; Ghinea, Denisa; Fischer-Waldschmidt, Gloria; Resch, Franz

2017-07-01

The Outpatient Clinic for Adolescent Risk-taking and Self-harm behaviors (AtR!Sk) - A Pioneering Approach of Outpatient Early Detection and Intervention of Borderline Personality Disorder Self-harm and risk-taking behaviors are frequently occurring problems in adolescents' everyday life and commonly challenge the present child and adolescent health-care system. Those behaviors are typical features of borderline-personality disorder (BPD), a severe mental disorder that is associated with immense psychological strain, increased risk of mortality and poor psychosocial functioning. Despite controversy in the past, recent evidence shows that BPD is a valid and reliable diagnosis in adolescence. Consequently, specified and effective intervention programs for this age group are necessary. Instead, present health-care services for children and adolescents in Germany are usually characterized by long waiting periods for specialized outpatient treatments and unnecessary expanses of unnecessary long inpatient stays. Alternatively, and in order to prevent serious long-term consequences, new concepts - integrated in an ambulatory setting and close to patients' daily routines - should focus on early detection and treatment of adolescents at-risk presenting with borderline personality features. The specialist outpatient clinic AtR!Sk at the University Hospital Heidelberg ensures a low-threshold initial contact service, comprehensive and accurate diagnosis of BPD features, and rapidly "tailored" therapy for young people presenting with any types of risk-taking and self-harm behavior. AtR!Sk - as a pioneering approach in south Germany - provides evidence-based early detection and intervention for adolescent BPD.

351.pdf | mar2007 | jbiosci | www.ias.ac.in | | http: | Indian Academy ...

Indian Academy of Sciences (India)

Home; http: www.ias.ac.in; jbiosci; mar2007; 351.pdf. 404! error. The page your are looking for can not be found! Please check the link or use the navigation bar at the top. YouTube; Twitter; Facebook; Blog. Academy News. IAS Logo. Summer Research Fellowship Programme 2018. Posted on 16 December 2017.

Niewirusowy transfer genów do komórek skóry – wybrane metody = Non-viral gene transfer into skin cells – selected methods

Directory of Open Access Journals (Sweden)

Ewelina Wędrowska

2016-01-01

3Department of Pathobiochemistry and Clinical Chemistry, Nicolaus Copernicus University Collegium Medicum, Bydgoszcz, Poland       Streszczenie   Wprowadzenie: Skóra jako największy i najłatwiej dostępny narząd stanowi atrakcyjny cel dla terapii genowej, która od wielu lat budzi ogromne nadzieje środowiska naukowego. Jednakże, próby terapii przeprowadzone z wykorzystaniem wektorów wirusowych wykazały szereg wad i ograniczeń m.in. obserwowano indukcję odpowiedzi immunologicznej, losową integrację transgenu z genomem gospodarza i/lub niską wydajność jego ekspresji. Dlatego, wciąż poszukuje się alternatywnych, skuteczniejszych i jednocześnie bezpieczniejszych metod transferu genów. Atrakcyjnej alternatywy upatruje się w metodach niewirusowych. Cel pracy: Przedstawienie wybranych metod niewirusowego transferu genów wykorzystywanych w terapii genowej chorób skóry. Skrócony opis stanu wiedzy: Terapia genowa chorób skóry obejmuje wykorzystanie wektorów plazmidowych jako nośnika genów terapeutycznych, a także metod ich dostarczania do komórek takich jak: elektroporacja, mikroiniekcja, sonikacja, wykorzystanie nośników lipidowych i polimerów kationowych. Podsumowanie: Niewirusowe metody transferu genów oferują pewne zalety włączając niską toksyczność, brak infekcyjności oraz łatwość i niskie koszty produkcji w porównaniu z technikami wirusowymi. Niewirusowe metody wydają się być obiecującym narzędziem terapii genowej chorób skóry w szczególności nowotworów tego narządu.   Słowa kluczowe: plazmid, transfer genów, skóra, wirus, terapia genowa.     Summary Introduction: Skin, the largest and most accessible organ of the human body is considered as an ideal gene therapy target. However, various types of viral vectors used in classical gene therapy have a number of disadvantages, such as possibility of immune response induction, random integration of inserts into the host genome or low expression efficiency

Anthocyanins Protect SK-N-SH Cells Against Acrolein-Induced Toxicity by Preserving the Cellular Redox State.

Science.gov (United States)

Belkacemi, Abdenour; Ramassamy, Charles

2016-01-01

In Alzheimer's disease (AD) and in mild cognitive impairment (MCI) patients, by-products of lipid peroxidation such as acrolein accumulated in vulnerable regions of the brain. We have previously shown that acrolein is a highly reactive and neurotoxic aldehyde and its toxicity involves the alteration of several redox-sensitive pathways. Recently, protein-conjugated acrolein in cerebrospinal fluid has been proposed as a biomarker to distinguish between MCI and AD. With growing evidence of the early involvement of oxidative stress in AD etiology, one would expect that a successful therapy should prevent brain oxidative damage. In this regard, several studies have demonstrated that polyphenol-rich extracts exert beneficial effect on cognitive impairment and oxidative stress. We have recently demonstrated the efficacy of an anthocyanin formulation (MAF14001) against amyloid-β-induced oxidative stress. The aim of this study is to investigate the neuroprotective effect of MAF14001 as a mixture of anthocyanins, a particular class of polyphenols, against acrolein-induced oxidative damage in SK-N-SH neuronal cells. Our results demonstrated that MAF14001, from 5μM, was able to efficiently protect SK-N-SH cells against acrolein-induced cell death. MAF14001 was able to lower reactive oxygen species and protein carbonyl levels induced by acrolein. Moreover, MAF1401 prevented glutathione depletion and positively modulated, in the presence of acrolein, some oxidative stress-sensitive pathways including the transcription factors NF-κB and Nrf2, the proteins γ-GCS and GSK3β, and the protein adaptator p66Shc. Along with its proven protective effect against amyloid-β toxicity, these results demonstrate that MAF14001 could target multiple mechanisms and could be a promising agent for AD prevention.

NASA Parts Selection List (NPSL) WWW Site http://nepp.nasa.gov/npsl

Science.gov (United States)

Brusse, Jay

2000-01-01

The NASA Parts Selection List (NPSL) is an on-line resource for electronic parts selection tailored for use by spaceflight projects. The NPSL provides a list of commonly used electronic parts that have a history of satisfactory use in spaceflight applications. The objective of this www site is to provide NASA projects, contractors, university experimenters, et al with an easy to use resource that provides a baseline of electronic parts from which designers are encouraged to select. The NPSL is an ongoing resource produced by Code 562 in support of the NASA HQ funded NASA Electronic Parts and Packaging (NEPP) Program. The NPSL is produced as an electronic format deliverable made available via the referenced www site administered by Code 562. The NPSL does not provide information pertaining to patented or proprietary information. All of the information contained in the NPSL is available through various other public domain resources such as US Military procurement specifications for electronic parts, NASA GSFC's Preferred Parts List (PPL-21), and NASA's Standard Parts List (MIL-STD975).

A standardized crisis management model for self-harming and suicidal individuals with three or more diagnostic criteria of borderline personality disorder: The Brief Admission Skåne randomized controlled trial protocol (BASRCT).

Science.gov (United States)

Liljedahl, Sophie I; Helleman, Marjolein; Daukantaité, Daiva; Westrin, Åsa; Westling, Sofie

2017-06-15

Brief Admission is a crisis and risk management strategy in which self-harming and suicidal individuals with three or more diagnostic criteria of borderline personality disorder self-admit to hospital at times of increasing risk when other efforts to stay safe are failing. Standardized in the current randomized controlled trial, the intensity of Brief Admission Skåne is implemented in durations of three days, with a maximum frequency of three times a month. Brief Admission is integrated into existing treatment plans in advance of crises to prevent reliance on general psychiatric admissions for risk management, as these may be lengthy, unstructured, and of uncertain therapeutic value. The overall objective of the Brief Admission Skåne randomized controlled trial is to determine if Brief Admission can replace general psychiatric admission for self-harming and suicidal individuals with complex mental illness at times of escalating risk. Other objectives of the study are to evaluate whether Brief Admission increases daily functioning and enhances coping, reduces psychiatric symptoms including frequency and severity of self-harm and suicidal behaviours. A final objective is to determine if Brief Admission is an effective crisis management model for this population. Participants are randomized at an individual level to either Brief Admission Skåne plus Treatment as Usual or Treatment As Usual. Based on a priori power analyses, N = 124 participants will be recruited to the study. Data collection is in progress, and will continue until June 2018. All participant data are single-blinded and will be handled with intention-to-treat analysis. Based on the combined clinical experience of our international research group, the Brief Admission Skåne randomized controlled trial upon which the current protocol is based represents the first initiative to standardize, implement and evaluate Brief Admission amongst self-harming and suicidal individuals, including those with

Use of carabids for the post-market environmental monitoring of genetically modified crops

Czech Academy of Sciences Publication Activity Database

Skoková Habuštová, Oxana; Svobodová, Zdeňka; Cagáň, Ľ.; Sehnal, František

2017-01-01

Roč. 9, č. 4 (2017), č. článku 121. E-ISSN 2072-6651 R&D Projects: GA MŠk(CZ) 7AMB14SK096 Grant - others:projekt VEGA(SK) 1/0732/14; GA ČR(CZ) L200961652 Institutional support: RVO:60077344 Keywords : Carabidae * surrogate * post-market environmental monitoring Subject RIV: GF - Plant Pathology, Vermin, Weed, Plant Protection OBOR OECD: GM technology (crops and livestock), livestock cloning, marker assisted selection, diagnostics (DNA chips and biosensing devices for the early/accurate detection of diseases) biomass feedstock production technologies, biopharming Impact factor: 3.030, year: 2016 http://www.mdpi.com/2072-6651/9/4/121

RSS (http://www.iaees.org/publications/journals/arthropods/rss.xml

Directory of Open Access Journals (Sweden)

Arthropods (ISSN 2224-4255

Full Text Available Arthropods ISSN 2224-4255 URL: http://www.iaees.org/publications/journals/arthropods/online-version.asp RSS: http://www.iaees.org/publications/journals/arthropods/rss.xml E-mail: arthropods@iaees.org Editor-in-Chief: WenJun Zhang Aims and Scope ARTHROPODS (ISSN 2224-4255 is an international journal devoted to the publication of articles on various aspects of arthropods, e.g., ecology, biogeography, systematics, biodiversity (species diversity, genetic diversity, et al., conservation, control, etc. The journal provides a forum for examining the importance of arthropods in biosphere (both terrestrial and marine ecosystems and human life in such fields as agriculture, forestry, fishery, environmental management and human health. The scope of Arthropods is wide and embraces all arthropods-insects, arachnids, crustaceans, centipedes, millipedes, and other arthropods. Articles/short communications on new taxa (species, genus, families, orders, etc. and new records of arthropods are particularly welcome. Authors can submit their works to the email box of this journal, arthropods@iaees.org. All manuscripts submitted to this journal must be previously unpublished and may not be considered for publication elsewhere at any time during review period of this journal. Authors are asked to read Author Guidelines before submitting manuscripts. In addition to free submissions from authors around the world, special issues are also accepted. The organizer of a special issue can collect submissions (yielded from a research project, a research group, etc. on a specific research topic, or submissions of a scientific conference for publication of special issue.

The Trace Fossil Chondrites in Uppermost Jurasic-Lower Cretaceous Deep Cavity Fills from the Western Carpathians, Czech Republic

Czech Academy of Sciences Publication Activity Database

Uchman, A.; Mikuláš, Radek; Houša, Václav

2003-01-01

Roč. 54, č. 3 (2003), s. 1-7 ISSN 1335-0552 R&D Projects: GA ČR GA205/00/0118 Institutional research plan: CEZ:AV0Z3013912 Keywords : jurassic * Cretaceous * trace fossils Subject RIV: DB - Geology ; Mineralogy Impact factor: 0.397, year: 2003 http://www.geologicacarpathica.sk/src/main.php

Hodnoty a vysvětlení

Czech Academy of Sciences Publication Activity Database

Tomeček, Marek

2013-01-01

Roč. 20, Suppl. 1 (2013), s. 196-205 ISSN 1335-0668 R&D Projects: GA ČR(CZ) GAP401/11/0371 Institutional support: RVO:67985955 Keywords : ethics * explanation * judgment * pragmatics * semantics * value Subject RIV: AA - Philosophy ; Religion http://www.klemens.sav.sk/fiusav/doc/organon/prilohy/2013/1/196-205.pdf

Metamorphosed carbonates of Krkonoše Mountains and Paleozoic evolution of Sudetic terranes (NE Bohemia, Czech Republic)

Czech Academy of Sciences Publication Activity Database

Hladil, Jindřich; Patočka, František; Kachlík, V.; Melichar, R.; Hubačík, M.

2003-01-01

Roč. 54, č. 5 (2003), s. 281-297 ISSN 1335-0552 R&D Projects: GA AV ČR IAA3111102 Institutional research plan: CEZ:AV0Z3013912 Keywords : Cambrium * carbonates * Krkonoše Subject RIV: DB - Geology ; Mineralogy Impact factor: 0.397, year: 2003 http://www.geologicacarpathica.sk/src/main.php

Carcino-embryonic antigen in monitoring the growth of human colon adenocarcinoma tumour cells SK-CO-1 and HT-29 in vitro and in nude mice

DEFF Research Database (Denmark)

Sölétormos, G; Fogh, J M; Sehested-Hansen, B

1997-01-01

A set of experimental model systems were designed to investigate (a) the inter-relationship between growth of two human cancer cell lines (SK-CO-1, HT-29) and carcino-embryonic antigen (CEA) kinetics; and (b) whether neoplastic growth or CEA concentration is modulated by human growth hormone (hGH...

10Be exposure age chronology of the last glaciation of the Roháčská Valley in the Western Tatra Mountains, central Europe

Science.gov (United States)

Engel, Zbyněk; Mentlík, Pavel; Braucher, Régis; Křížek, Marek; Pluháčková, Markéta; Arnold, Maurice; Aumaître, Georges; Bourlès, Didier; Keddadouche, Karim; Aster Team; Arnold, Maurice; Aumaître, Georges; Bourlès, Didier; Keddadouche, Karim

2017-09-01

10Be exposure ages from moraines and bedrock sites in the Roháčská Valley provide chronology of the last glaciation in the largest valley of the Western Tatra Mts., the Western Carpathians. The minimum apparent exposure age of 19.4 ± 2.1 ka obtained for the oldest sampled boulder and the mean age of 18.0 ± 0.8 ka calculated for the terminal moraine indicate that the oldest preserved moraine was probably deposited at the time of the global Last Glacial Maximum (LGM). The age of this moraine coincides with the termination of the maximum glacier expansion in other central European ranges, including the adjacent High Tatra Mts. and the Alps. The equilibrium line altitude (ELA) of the LGM glacier in the Roháčská Valley, estimated at 1400-1410 m a.s.l., was 50-80 m lower than in the eastern part of the range, indicating a positive ELA gradient from west to east among the north-facing glaciers in the Tatra Mts. Lateglacial glacier expansion occurred no later than 13.4 ± 0.5 ka and 11.9 ± 0.5 ka, as indicated by the mean exposure ages calculated for re-advance moraines. This timing is consistent with the exposure age chronology of the last Lateglacial re-advance in the High Tatra Mts., Alps and lower mountain ranges in central Europe. The ELA in the Roháčská Valley estimated at 1690-1770 m a.s.l. in this period was located 130-300 m lower than in the north-facing valleys in the High Tatra Mts. 10Be exposure ages obtained for a rock glacier constrains the timing of this landform stabilization in the Salatínska Valley and provides the first chronological evidence for the Lateglacial activity of rock glaciers in the Carpathians.

Developments in damage assessment by Marie Skłodowska-Curie TRUSS ITN project

Science.gov (United States)

González, A.

2017-05-01

The growth of cities, the impacts of climate change and the massive cost of providing new infrastructure provide the impetus for TRUSS (Training in Reducing Uncertainty in Structural Safety), a €3.7 million Marie Skłodowska-Curie Action Innovative Training Network project funded by EU’s Horizon 2020 programme, which aims to maximize the potential of infrastructure that already exists (http://trussitn.eu). For that purpose, TRUSS brings together an international, inter-sectoral and multidisciplinary collaboration between five academic and eleven industry institutions from five European countries. The project covers rail and road infrastructure, buildings and energy and marine infrastructure. This paper reports progress in fields such as advanced sensor-based structural health monitoring solutions - unmanned aerial vehicles, optical backscatter reflectometry, monitoring sensors mounted on vehicles, … - and innovative algorithms for structural designs and short- and long-term assessments of buildings, bridges, pavements, ships, ship unloaders, nuclear components and wind turbine towers that will support infrastructure operators and owners in managing their assets.

PENGARUH TERPAAN INFORMASI RISET MELALUI WEBSITE www.ppet.lipi.go.id TERHADAP SIKAP MAHASISWA MENGENAI PENELITIAN

Directory of Open Access Journals (Sweden)

Noorfiya Umniyati

2017-06-01

Full Text Available Penelitian ini bertujuan untuk mengukur pengaruh terpaan informasi riset di Pusat Penelitian Elektronika dan Telekomunikasi LIPI melalui website www.ppet.lipi.go.id terhadap sikap mahasiswa mengenai penelitian. Tujuan penelitian ini untuk mengetahui besarnya pengaruh jumlah waktu yang digunakan dalam mengakses informasi terhadap sikap mahasiswa mengenai penelitian, isi pesan terhadap sikap mahasiswa mengenai penelitian, dan hubungan individu dengan media terhadap sikap mahasiswa mengenai penelitian. Penelitian ini menggunakan metode kuantitatif dengan analisis jalur. Hasil penelitian ini menunjukan bahwa secara keseluruhan terpaan informasi riset melalui website www.ppet.lipi.go.id berpengaruh secara signifikan terhadap sikap mahasiswa Teknik Telekomunikasi Telkom University mengenai penelitian. Secara parsial, hasil penelitian menunjukkan bahwa variabel jumlah waktu yang digunakan dalam informasi dan variabel hubungan individu dengan media memberikan pengaruh yang siginifikan terhadap sikap mahasiswa mengenai penelitian. Sedangkan variabel isi pesan tidak memberikan pengaruh yang siginifikan karena memberikan pengaruh yang sedikit. Kesimpulan pada penelitian ini menunjukan bahwa secara keseluruhan informasi riset telah melakukan terpaan cukup besar terhadap sikap mahasiswa jurusan Teknik Telekomunikasi Telkom University mengenai penelitian yang mengakses website www.ppet.lipi.go.id.

Finančná analýza podniku Choceňská mlékárna, s.r.o.

OpenAIRE

Zigo, Michal

2011-01-01

The bachelor thesis assesses a financial position of the company Choceňská mlékárna, s.r.o. with the help of financial analysis tools such as horizontal and vertical analyses, parallel and pyramidal system of financial ratios, creditworthy and bankruptcy models, and economic value added in the horizon of five years. Theoretical-methodological part describes the financial analysis as a tool for an assessment of the financial position of the company and it further defines the evaluation apparat...

High-sensitive LC-MS/MS method for the simultaneous determination of mirodenafil and its major metabolite, SK-3541, in human plasma: application to microdose clinical trials of mirodenafil.

Science.gov (United States)

Cho, Doo-Yeoun; Bae, Soo Hyeon; Shon, Ji-Hong; Bae, Soo Kyung

2013-03-01

A high-sensitivity LC/MS/MS method was developed and validated for the simultaneous determination of mirodenafil and its major metabolite, SK-3541, in human plasma. Mirodenafil, SK-3541, and udenafil as an internal standard were extracted from plasma samples with methyl tert-butyl ether. Chromatographic separation was performed on a Luna phenyl-hexyl column (100 × 2.0 mm) with an isocratic mobile phase consisting of 5 mM ammonium formate and ACN (23:77, v/v) at a flow rate of 0.35 mL/min. Detection and quantification were performed using a mass spectrometer in selected reaction monitoring mode with positive ESI at m/z 532.3 → 296.1 for mirodenafil, m/z 488.1 → 296.1 for SK-3541, and m/z 517.3 → 283.2 for udenafil. The calibration curves were linear over a concentration range of 2-500 pg/mL using 0.5 mL plasma for the microdose of mirodenafil (100 μg). Analytical method validation of the clinical dose (100 mg), with a calibration curve range of 2-500 ng/mL using 0.025-mL plasma, was also conducted. The other LC-MS/MS conditions were similar to those used for the microdosing. Each method was applied successfully to pharmacokinetic studies after a microdose or clinical dose of mirodenafil to six healthy Korean male volunteers. © 2013 WILEY-VCH Verlag GmbH & Co. KGaA, Weinheim.

Cyrilometodějské a byzantské reminiscence na jednání Prvního přípravného Slovanského sjezdu,

Czech Academy of Sciences Publication Activity Database

Havlíková, Lubomíra

2010-01-01

Roč. 3, - (2010), s. 55-61 ISSN 1337-8740 R&D Projects: GA MŠk(CZ) MEB0810026 Institutional research plan: CEZ:AV0Z90920516 Keywords : Cyrilo-Methodian tradition * Byzantinism * Preparatory Slav Congress 1908 Subject RIV: AB - History http://www.ukm.ff.ukf.sk/wp-content/uploads/files/listy2010-3.pdf

Možnosti studia antropogenních změn říční sítě na příkladech z povodí Sázavy a Svitavy

Czech Academy of Sciences Publication Activity Database

Svobodová, E.; Kirchner, Karel

2013-01-01

Roč. 47, č. 3 (2013), s. 172-174 ISSN 0044-4863 Institutional support: RVO:68145535 Keywords : anthropogenic changes * river bed * quantification human impact * protected areas Subject RIV: DE - Earth Magnetism, Geodesy, Geography http://www.elis.sk/index.php?page=shop.browse&category_id=41&option=com_virtuemart&Itemid=1&vmcchk=1&Itemid=1

What does že jo (and že ne) mean in spoken dialogue

Czech Academy of Sciences Publication Activity Database

Komrsková, Zuzana

2017-01-01

Roč. 68, č. 2 (2017), s. 229-237 ISSN 0021-5597 R&D Projects: GA ČR GA15-01116S Institutional support: RVO:68378092 Keywords : spoken languge * spoken corpus * tag question * responze word Subject RIV: AI - Linguistics OBOR OECD: Linguistics http://www.juls.savba.sk/ediela/jc/2017/2/jc17-02.pdf

Coping Strategies for Sexual Harassment in Higher Education: ,An Official Action May Harm you in the End More than if Someone Slaps your Butt”.

Czech Academy of Sciences Publication Activity Database

Vohlídalová, Marta

2015-01-01

Roč. 47, č. 3 (2015), s. 297-316 ISSN 0049-1225 R&D Projects: GA MŠk(CZ) LE12003 Institutional support: RVO:68378025 Keywords : sexual harassment * gender * power Subject RIV: AO - Sociology, Demography Impact factor: 0.275, year: 2015 http://www.sav.sk/journals/uploads/06291133Vohlidalova%20-%20zalomena_MV.pdf

Myslet, tj. myslet ve dvou: Yves Aulas a Levinas

Czech Academy of Sciences Publication Activity Database

Bierhanzl, Jan

2011-01-01

Roč. 7, č. 4 (2011), s. 1-8 ISSN 1336-6556 R&D Projects: GA ČR(CZ) GAP401/10/1164 Institutional research plan: CEZ:AV0Z90090514 Keywords : mental disease * ethics * speech * thinking * philosophy Subject RIV: AA - Philosophy ; Religion http://www.ostium.sk/index.php?mod=magazine&act=show&aid=370

MSeqDR mvTool: A mitochondrial DNA Web and API resource for comprehensive variant annotation, universal nomenclature collation, and reference genome conversion.

Science.gov (United States)

Shen, Lishuang; Attimonelli, Marcella; Bai, Renkui; Lott, Marie T; Wallace, Douglas C; Falk, Marni J; Gai, Xiaowu

2018-06-01

Accurate mitochondrial DNA (mtDNA) variant annotation is essential for the clinical diagnosis of diverse human diseases. Substantial challenges to this process include the inconsistency in mtDNA nomenclatures, the existence of multiple reference genomes, and a lack of reference population frequency data. Clinicians need a simple bioinformatics tool that is user-friendly, and bioinformaticians need a powerful informatics resource for programmatic usage. Here, we report the development and functionality of the MSeqDR mtDNA Variant Tool set (mvTool), a one-stop mtDNA variant annotation and analysis Web service. mvTool is built upon the MSeqDR infrastructure (https://mseqdr.org), with contributions of expert curated data from MITOMAP (https://www.mitomap.org) and HmtDB (https://www.hmtdb.uniba.it/hmdb). mvTool supports all mtDNA nomenclatures, converts variants to standard rCRS- and HGVS-based nomenclatures, and annotates novel mtDNA variants. Besides generic annotations from dbNSFP and Variant Effect Predictor (VEP), mvTool provides allele frequencies in more than 47,000 germline mitogenomes, and disease and pathogenicity classifications from MSeqDR, Mitomap, HmtDB and ClinVar (Landrum et al., 2013). mvTools also provides mtDNA somatic variants annotations. "mvTool API" is implemented for programmatic access using inputs in VCF, HGVS, or classical mtDNA variant nomenclatures. The results are reported as hyperlinked html tables, JSON, Excel, and VCF formats. MSeqDR mvTool is freely accessible at https://mseqdr.org/mvtool.php. © 2018 Wiley Periodicals, Inc.

Mechanizmy regulacji odpowiedzi immunologicznej w zwierzęcym modelu alergicznego kontaktowego zapalenia skóry [Mechanisms involved in the regulation of immune response in animal model of allergic contact dermatitis

Directory of Open Access Journals (Sweden)

Anna Strzępa

2014-09-01

Full Text Available Streszczenie Alergiczne kontaktowe zapalenie skóry jest klasycznym przykładem późnej reakcji nadwrażliwości typu IV, którą mediują limfocyty efektorowe CD4+ Th1. Rozwój alergicznego kontaktowego zapalenia skóry (ACD jest następstwem ekspozycji na działanie małocząsteczkowych substancji (hapteny. Obecnie ACD jest jedną z najczęstszych chorób zawodowych. Występowanie alergii kontaktowej na co najmniej jeden czynnik w krajach Europy Zachodniej i Ameryki Północnej dochodzi do 19,5% dla różnych grup wiekowych. Klasyczna egzematyczna postać ACD manifestuje się jako rumień, naciek, nadmierne rogowacenie, obrzęk i pęcherze, którym towarzyszy świąd. Modelem zwierzęcym ACD jest reakcja nadwrażliwości kontaktowej (CS. Składa się ona z dwóch następujących po sobie etapów: indukcja (faza aferentna i wywołanie (faza eferentna. W trakcie pierwszego kontaktu z haptenem powstają swoiste limfocyty efektorowe (Tef, które są rekrutowane do miejsca ponownej ekspozycji na hapten. W tym artykule przedstawiono mechanizmy immunologiczne leżące u podstaw ACD, opierając się na modelu CS.

Use of solar parabolic cookers (SK-14) in Nepal

Energy Technology Data Exchange (ETDEWEB)

Shrestha, S. [Asia Network for Small Scale Bioresources, Kathmandu (Nepal)

2000-07-01

Solar Cooker is a device that uses only sunlight to cook food and pasteurise water. Solar cooker can be used along with other cooking devices to save cost, fuel and the time spent in gathering fuelwood. Solar cooking enables individual families to do without commercially sold fuel and help save money. In Nepal, supply of energy is one of the major problems for both urban and rural households. Increase in population, high migration, expensive fuel bills, environmental degradation, and unsafe drinking water have resulted in the keen interest from people of Nepal in the use of solar energy. The increasing number of tourists and trekkers are now one of the major sources of income and many people are engaged in running hotels, lodges, and restaurants. This has also increased the fuel demand. This paper highlights the current energy situation of Nepal, the technical details of solar parabolic cooker (SK-14), its uses throughout Nepal, strategies adopted by various organisations for its promotion. A lot of effort have been made by various organisations, educational, governmental and health related institutions in order to introduce solar cooking programs in villages of Nepal. The parameters, which have influenced the adoption of this technology in Nepal are also mentioned. Various awareness programs and the government subsidy program are playing considerable role in dissemination of such technologies. The promotion activities with the objective of mass awareness have long term effect and sustainable rather than instant business. Continued efforts to create awareness, development of models as well as proper promotion and dissemination are required. (au)

Preparation of Ginsenoside Rg3 and Protection against H2O2-Induced Oxidative Stress in Human Neuroblastoma SK-N-SH Cells

Directory of Open Access Journals (Sweden)

Gang Li

2014-01-01

Full Text Available The aim of this study is to evaluate the protection of ginsenoside Rg3 against oxidative stress in human neuroblastoma SK-N-SH cells. 20(R-ginsenoside Rg3 (20(R-Rg3 and 20(S-ginsenoside Rg3 (20(S-Rg3 were prepared by the method of chemical degradation and column chromatography, and the structure of the two compounds was characterized by 1H-NMR and 13C-NMR spectroscopy. MTT assay and LDH leakage assay were used to determine the cell viability and the oxidative stress cellular model was established by means of H2O2 (600 μM for 4 h. We also investigated the changes of intracellular MDA content, SOD activity, and ROS formation after the treatment of ginsenoside Rg3 for 20 h. The results indicated that both 20 (R-Rg3 and 20 (S-Rg3 had obvious protection against H2O2-induced oxidative stress in SK-N-SH cells. Moreover, 20(R-Rg3 exhibited better antioxidant activity than 20(S-Rg3 in vitro. These findings are expected to provide some implication for further research and application of ginsenoside Rg3 in neuroprotection.

Strategi Branding Portal Online Www.tripriau.com Dalam Membangun Brand Awareness Sebagai Portal Online Pariwisata Provinsi Riau

OpenAIRE

Rahmadhani, Yuri; Lubis, Evawani Elysa

2017-01-01

Online portal www.tripriau.com online portal is one of the online portal in Riau Province that has its own uniqueness. These portals contain local content and the potential of tourism in the province of Riau. Since its establishment, www.tripriau.com do branding strategy in order to build brand awareness or trust the reader to be known as a tourism-themed online portal. As the selection of brand name Trip Riau, Riau Guide My tagline, as well as the implementation of travel instagram photo con...

Modifying the frequency and characteristics of involuntary autobiographical memories.

Science.gov (United States)

Vannucci, Manila; Batool, Iram; Pelagatti, Claudia; Mazzoni, Giuliana

2014-01-01

Recent studies have shown that involuntary autobiographical memories (IAMs) can be elicited in the laboratory. Here we assessed whether the specific instructions given to participants can change the nature of the IAMs reported, in terms of both their frequency and their characteristics. People were either made or not made aware that the aim of the study was to examine IAMs. They reported mental contents either whenever they became aware of them or following a predetermined schedule. Both making people aware of the aim of the study and following a fixed schedule of interruptions increased significantly the number of IAMs reported. When aware of the aim of the study, participants reported more specific memories that had been retrieved and rehearsed more often in the past. These findings demonstrate that the number and characteristics of memories depend on the procedure used. Explanations of these effects and their implications for research on IAMs are discussed.

Modifying the frequency and characteristics of involuntary autobiographical memories.

Directory of Open Access Journals (Sweden)

Manila Vannucci

Full Text Available Recent studies have shown that involuntary autobiographical memories (IAMs can be elicited in the laboratory. Here we assessed whether the specific instructions given to participants can change the nature of the IAMs reported, in terms of both their frequency and their characteristics. People were either made or not made aware that the aim of the study was to examine IAMs. They reported mental contents either whenever they became aware of them or following a predetermined schedule. Both making people aware of the aim of the study and following a fixed schedule of interruptions increased significantly the number of IAMs reported. When aware of the aim of the study, participants reported more specific memories that had been retrieved and rehearsed more often in the past. These findings demonstrate that the number and characteristics of memories depend on the procedure used. Explanations of these effects and their implications for research on IAMs are discussed.

Priming involuntary autobiographical memories in the lab

OpenAIRE

Barzykowski, Krystian; Niedźwieńska, Agnieszka

2018-01-01

Involuntary autobiographical memories (IAMs) are recollections of personal past that frequently and spontaneously occur in daily life. Initial studies by Mace. Priming involuntary autobiographical memories. Showed that deliberately reminiscing about a certain lifetime period (e.g., high school) significantly increased the number of different IAMs from the same period in subsequent days, suggesting that priming may play a significant role in the retrieval of IAMs in everyday life. In the prese...

Porovnávací obraz lexikálnej zásoby slovenčiny a češtiny v doterajšom lingvistickom spracovaní. I. Začiatky lexikálnej komparácie

Czech Academy of Sciences Publication Activity Database

Nábělková, Mira

2015-01-01

Roč. 80, 5/6 (2015), s. 276-306 ISSN 0037-6981 R&D Projects: GA ČR GAP406/11/2304 Institutional support: RVO:68378092 Keywords : Czech-Slovak lexical comparison * reduplication * footnote lexical explanation * dictionary * lexicography Subject RIV: AI - Linguistics http://www.juls.savba.sk/ediela/sr/2015/5-6/sr15-5-6.pdf

Hranice percepčnej teórie emócií

Czech Academy of Sciences Publication Activity Database

Hvorecký, Juraj

2011-01-01

Roč. 18, Supplement 1 (2011), s. 102-114 ISSN 1335-0668 Institutional support: RVO:67985955 Keywords : embodied appraisals * non-emotional mental states * emotions * expressions of emotions Subject RIV: AA - Philosophy ; Religion OBOR OECD: Philosophy, History and Philosophy of science and technology http://www.klemens.sav.sk/fiusav/doc/organon/prilohy/2011/1/102-114.pdf

Barbarská keramika z kontextů se stratigrafickými vztahy k římskému zdivu v trati Neurissen v Mušově

Czech Academy of Sciences Publication Activity Database

Knápek, Radka; Šedo, Ondrej

2015-01-01

Roč. 109, prosinec (2015), s. 347-377 ISSN 1336-6637 Institutional support: RVO:68081758 Keywords : Roman period * Moravia * Burgstall * Barbarian pottery * Roman masonry Subject RIV: AC - Archeology, Anthropology, Ethnology http://www.snm.sk/swift_data/source/archeologicke_muzeum/zborniky/z25/ZbornikSlovenskehoNarodnehoMuzeaArcheologia25_2015_347_377.pdf?58d9245f977e3

Politika odvolání jako inovativní nástroj prosazování transparentnosti a občanské účasti ve slovenské a polské místní samosprávě

Czech Academy of Sciences Publication Activity Database

Smith, Michael

2011-01-01

Roč. 43, č. 4 (2011), s. 338-361 ISSN 0049-1225 R&D Projects: GA MV VG20102013029 Institutional research plan: CEZ:AV0Z70280505 Keywords : local recall * recall referendum * local government Subject RIV: AO - Sociology, Demography Impact factor: 0.191, year: 2011 http://www.sav.sk/journals/uploads/08240943Smith%20-%20OK.pdf

Mähren zur Zeit der Markomannenkriege. Forschungsstand und neue Probleme

Czech Academy of Sciences Publication Activity Database

Tejral, Jaroslav

2017-01-01

Roč. 61, červenec (2017), s. 149-188 ISSN 0560-2793 Institutional support: RVO:68081758 Keywords : Marcomannic wars * Moravia * Roman fort at Mušov * dating of Roman military presence * the end of the Roman occupation Subject RIV: AC - Archeology, Anthropology, Ethnology OBOR OECD: Archaeology http://www.cevnad.sav.sk/aktivita_1_1/SZ_61.pdf

Remarks on Gödel's Code as a Hash Function

Czech Academy of Sciences Publication Activity Database

Mikuš, M.; Savický, Petr

2010-01-01

Roč. 47, č. 3 (2010), s. 67-80 ISSN 1210-3195 R&D Projects: GA ČR GAP202/10/1333 Institutional research plan: CEZ:AV0Z10300504 Keywords : Gödel numbering function * hash function * rational reconstruction * integer relation algorithm Subject RIV: BA - General Mathematics http://www.sav.sk/journals/uploads/0317151904m-s.pdf

Dezintegrácia hliníka a medi pulzujúcim vodným prúdom

Czech Academy of Sciences Publication Activity Database

Lehocká, D.; Klich, Jiří; Foldyna, Josef; Hloch, Sergej; Zeleňák, Michal; Cárach, J.; Andrej, A.

2014-01-01

Roč. 17, č. 6 (2014), s. 1-6 ISSN 0562-1887 R&D Projects: GA MŠk ED2.1.00/03.0082 Institutional support: RVO:68145535 Keywords : pulsating water jet * disintegration * aluminium * cooper Subject RIV: JQ - Machines ; Tools http://www.engineering.sk/index.php/strojarstvo-extra/1927-dezintegracia-hlinika-a-medi-pulzujucim-vodnym-prudom-

Felicjan Sławoj-Składkowski (1885-1962): The only known doctor-soldier-politician with an outdoor-wooden-toilet named after him.

Science.gov (United States)

Ohry, Avi

2017-05-01

Felicjan Sławoj-Składkowski was a Polish physician, General and politician who served as Polish Minister of Internal Affairs and was the last Prime Minister of Poland before the Second World War. The lack of basic sanitation in many of Poland's villages caused him to issue a decree that every household in Poland must have a latrine in working order. Wooden sheds were built in the backyards, subsequently named 'sławojkis'.

Analysis and Risk Evaluation on the Case of Alteration, Revitalization and Conversion of a Historic Building in Gdańsk

Science.gov (United States)

Grzyl, Beata; Kristowski, Adam; Miszewska-Urbańska, Emilia

2017-10-01

Each investment plan, including the one concerning a building, is exposed to the consequences of various types of threats taking place. Therefore, in the case of some large-scale, atypical and complicated building ventures, some actions included in the procedure of risk management should be taken (identifications, analysis, measurements, control and supervision of the risk). This will allow for the risk to be eliminated or limited. While preparing a building venture, an investor does not possess full information about the course of events on each stage of investment completion. The identification of the above-mentioned unknowns, subjecting them to quantification and specifying the method of dealing with them, allows an investor to increase the effectiveness of the intended plan. The enterprise discussed in this article and analyzed in the context of risk, concerns alteration, revitalization and conversion for office purposes of two buildings located in Gdańsk at 1 and 2 Lastadia Street. These buildings are situated on the area of historical urban layout of Gdańsk, in the northern-eastern part of Stare Przedmieście District (Old Suburb), about 800 meters south from Dlugi Targ Street and 200 meters west from The Old Motława River. The investor is “Gdańskie Melioracje Ltd.”, a limited liability company, which belongs to the Council of Gdańsk. In order to increase the effectiveness of the intended investment venture, while organizing the investment process, the investor commissioned preparation of an analysis and risk evaluation connected with the above-mentioned intention. Based on an on-site visit, the opinions of experts, who have been involved in the process of the preparation of the investment, studies of the available monographies about the technical condition of the buildings at 1 and 2 Lastadia Street and their own experiences, the authors identified 54 types of relevant risks, which have been systematized into 10 subject groups (among others

Neuronal uptake and neuroprotective effect of curcumin-loaded PLGA nanoparticles on the human SK-N-SH cell line.

Science.gov (United States)

Doggui, Sihem; Sahni, Jasjeet Kaur; Arseneault, Madeleine; Dao, Lé; Ramassamy, Charles

2012-01-01

Curcumin, a natural polyphenolic pigment present in the spice turmeric (Curcuma longa), is known to possess a pleiotropic activity such as antioxidant, anti-inflammatory, and anti-amyloid-β activities. However, these benefits of curcumin are limited by its poor aqueous solubility and oral bioavailability. In the present study, a polymer-based nanoparticle approach has been utilized to deliver drugs to neuronal cells. Curcumin was encapsulated in biodegradable poly (lactide-co-glycolide) (PLGA) based-nanoparticulate formulation (Nps-Cur). Dynamic laser light scattering and transmission electronic microscopy analysis indicated a particle diameter ranging from 80 to 120 nm. The entrapment efficiency was 31% with 15% drug-loading. In vitro release kinetics of curcumin from Nps-Cur revealed a biphasic pattern with an initial exponential phase followed by a slow release phase. Cellular internalization of Nps-Cur was confirmed by fluorescence and confocal microscopy with a wide distribution of the fluorescence in the cytoplasm and within the nucleus. The prepared nanoformulation was characterized for cellular toxicity and biological activity. Cytotoxicity assays showed that void PLGA-nanoparticles (Nps) and curcumin-loaded PLGA nanoparticles (Nps-Cur) were nontoxic to human neuroblastoma SK-N-SH cells. Moreover, Nps-Cur was able to protect SK-N-SH cells against H2O2 and prevent the elevation of reactive oxygen species and the consumption of glutathione induced by H2O2. Interestingly, Nps-Cur was also able to prevent the induction of the redox-sensitive transcription factor Nrf2 in the presence of H2O2. Taken together, these results suggest that Nps-Cur could be a promising drug delivery strategy to protect neurons against oxidative damage as observed in Alzheimer's disease.

The NtAMI1 gene functions in cell division of tobacco BY-2 cells in the presence of indole-3-acetamide.

Science.gov (United States)

Nemoto, Keiichirou; Hara, Masamitsu; Suzuki, Masashi; Seki, Hikaru; Muranaka, Toshiya; Mano, Yoshihiro

2009-01-22

Tobacco (Nicotiana tabacum) Bright Yellow-2 (BY-2) cells can be grown in medium containing indole-3-acetamide (IAM). Based on this finding, the NtAMI1 gene, whose product is functionally equivalent to the AtAMI1 gene of Arabidopsis thaliana and the aux2 gene of Agrobacterium rhizogenes, was isolated from BY-2 cells. Overexpression of the NtAMI1 gene allowed BY-2 cells to proliferate at lower concentrations of IAM, whereas suppression of the NtAMI1 gene by RNA interference (RNAi) caused severe growth inhibition in the medium containing IAM. These results suggest that IAM is incorporated into plant cells and converted to the auxin, indole-3-acetic acid, by NtAMI1.

Neuroglobin overexpression plays a pivotal role in neuroprotection through mitochondrial raft-like microdomains in neuroblastoma SK-N-BE2 cells.

Science.gov (United States)

Garofalo, Tina; Ferri, Alberto; Sorice, Maurizio; Azmoon, Pardis; Grasso, Maria; Mattei, Vincenzo; Capozzi, Antonella; Manganelli, Valeria; Misasi, Roberta

2018-04-01

Since stressing conditions induce a relocalization of endogenous human neuroglobin (NGB) to mitochondria, this research is aimed to evaluate the protective role of NGB overexpression against neurotoxic stimuli, through mitochondrial lipid raft-associated complexes. To this purpose, we built a neuronal model of oxidative stress by the use of human dopaminergic neuroblastoma cells, SK-N-BE2, stably overexpressing NGB by transfection and treated with 1-methyl-4-phenylpyridinium ion (MPP+). We preliminary observed the redistribution of NGB to mitochondria following MPP+ treatment. The analysis of mitochondrial raft-like microdomains revealed that, following MPP+ treatment, NGB translocated to raft fractions (Triton X-100-insoluble), where it interacts with ganglioside GD3. Interestingly, the administration of agents capable of perturbating microdomain before MPP+ treatment, significantly affected viability in SK-N-BE2-NGB cells. The overexpression of NGB was able to abrogate the mitochondrial injuries on complex IV activity or mitochondrial morphology induced by MPP+ administration. The protective action of NGB on mitochondria only takes place if the mitochondrial lipid(s) rafts-like microdomains are intact, indeed NGB fails to protect complex IV activity when purified mitochondria were treated with the lipid rafts disruptor methyl-β-cyclodextrin. Thus, our unique in vitro model of stably transfected cells overexpressing endogenous NGB allowed us to suggest that the role in neuroprotection played by NGB is reliable only through interaction with mitochondrial lipid raft-associated complexes. Copyright © 2018 Elsevier Inc. All rights reserved.

Numerical modeling of two-phase transonic flow

Czech Academy of Sciences Publication Activity Database

Halama, Jan; Benkhaldoun, F.; Fořt, Jaroslav

2010-01-01

Roč. 80, č. 88 (2010), s. 1624-1635 ISSN 0378-4754 Grant - others:GA ČR(CZ) GA201/08/0012 Program:GA Institutional research plan: CEZ:AV0Z20760514 Keywords : two - phase flow * condensation * fractional step method Subject RIV: BK - Fluid Dynamics Impact factor: 0.812, year: 2010 http://www.sciencedirect.com/science?_ob=MImg&_imagekey=B6V0T-4VNK68X-2-R&_cdi=5655&_user=640952&_pii=S0378475409000421&_origin=search&_coverDate=04%2F30%2F2010&_sk=999199991&view=c&wchp=dGLzVlb-zSkWb&md5=5ba607428fac339a3e5f67035d3996d0&ie=/sdarticle.pdf

Psychologiczne aspekty chorób alergicznych: trudności dorosłych pacjentów z astmą oskrzelową i atopowym zapaleniem skóry

Directory of Open Access Journals (Sweden)

Paulina Albińska

2014-12-01

Full Text Available Celem pracy jest zaprezentowanie przeglądu badań na temat psychologicznego funkcjonowania dorosłych cierpiących na choroby alergiczne. Artykuł koncentruje się na dorosłych ze względu na istnienie małej liczby prac naukowych dotyczących zmiany manifestacji symptomów u pacjentów z wyżej wymienionymi chorobami, która może być traktowana jako pierwsze i ostatnie stadium marszu alergicznego, ponieważ jego objawowa manifestacja u dzieci zwykle przybiera postać atopowego zapalenia skóry, podczas gdy u dorosłych jest znana jako astma oskrzelowa. Analiza odpowiada na pytanie, czy wspólnej, alergiczno-zapalnej etiologii tych schorzeń odpowiadają podobieństwa doświadczanych trudności psychologicznych. Omówienie odwołuje się do polskiej i zagranicznej literatury przedmiotu i uwzględnia kluczowe aspekty chorób psychosomatycznych – astmy i atopowego zapalenia skóry – czyli trudności ze snem, depresję, lęk, inne zaburzenia afektywne, zaburzenia zachowania i trudności poznawcze. Współwystępowanie zaburzeń psychicznych i somatycznych u chorych na alergię to niepodważalny dowód integralności somy i psyche, co rzadko dostrzegają osoby odpowiedzialne za system opieki zdrowotnej. Ignorują one tym samym ważny element procesu diagnostyczno-terapeutycznego, istotny dla wyzdrowienia pacjentów z astmą i atopowym zapaleniem skóry.

Observations of the anisotropy in the cosmic microwave background by the FIRS, SK93, and MSAM-I experiments

Science.gov (United States)

Kowitt, Matt; Cheng, Ed; Silverberg, Bob; Ganga, Ken; Page, Lyman; Jarosik, Norm; Netterfield, Barth; Wilkinson, Dave; Meyer, Stephan; Inman, Casey;

Arthropods (http://www.iaees.org/publications/journals/arthropods/online-version.asp

Directory of Open Access Journals (Sweden)

arthropods@iaees.org

Full Text Available Arthropods ISSN 2224-4255 URL: http://www.iaees.org/publications/journals/arthropods/online-version.asp RSS: http://www.iaees.org/publications/journals/arthropods/rss.xml E-mail: arthropods@iaees.org Editor-in-Chief: WenJun Zhang Aims and Scope ARTHROPODS (ISSN 2224-4255 is an international journal devoted to the publication of articles on various aspects of arthropods, e.g., ecology, biogeography, systematics, biodiversity (species diversity, genetic diversity, et al., conservation, control, etc. The journal provides a forum for examining the importance of arthropods in biosphere (both terrestrial and marine ecosystems and human life in such fields as agriculture, forestry, fishery, environmental management and human health. The scope of Arthropods is wide and embraces all arthropods-insects, arachnids, crustaceans, centipedes, millipedes, and other arthropods. Articles/short communications on new taxa (species, genus, families, orders, etc. and new records of arthropods are particularly welcome. Authors can submit their works to the email box of this journal, arthropods@iaees.org. All manuscripts submitted to this journal must be previously unpublished and may not be considered for publication elsewhere at any time during review period of this journal. Authors are asked to read Author Guidelines before submitting manuscripts. In addition to free submissions from authors around the world, special issues are also accepted. The organizer of a special issue can collect submissions (yielded from a research project, a research group, etc. on a specific research topic, or submissions of a scientific conference for publication of special issue.

www.elearnSCI.org: a global educational initiative of ISCoS.

Science.gov (United States)

Chhabra, H S; Harvey, L A; Muldoon, S; Chaudhary, S; Arora, M; Brown, D J; Biering-Sorensen, F; Wyndaele, J J; Charlifue, S; Horsewell, J; Ducharme, S; Green, D; Simpson, D; Glinsky, J; Weerts, E; Upadhyay, N; Aito, S; Wing, P; Katoh, S; Kovindha, A; Krassioukov, A; Weeks, C; Srikumar, V; Reeves, R; Siriwardane, C; Hasnan, N; Kalke, Y B; Lanig, I

2013-03-01

To develop a web-based educational resource for health professionals responsible for the management of spinal cord injury (SCI). The resource:www.elearnSCI.org is comprised of seven learning modules, each subdivided into various submodules. Six of the seven modules address the educational needs of all disciplines involved in comprehensive SCI management. The seventh module addresses prevention of SCI. Each submodule includes an overview, activities, self-assessment questions and references. Three hundred and thirty-two experts from The International Spinal Cord Society (ISCoS) and various affiliated societies from 36 countries were involved in developing the resource through 28 subcommittees. The content of each submodule was reviewed and approved by the Education and Scientific Committees of ISCoS and finally by an Editorial Committee of 23 experts. The content of the learning modules is relevant to students and to new as well as experienced SCI healthcare professionals. The content is applicable globally, has received consumer input and is available at no cost. The material is presented on a website underpinned by a sophisticated content-management system, which allows easy maintenance and ready update of all the content. The resource conforms to key principles of e-learning, including appropriateness of curriculum, engagement of learners, innovative approaches, effective learning, ease of use, inclusion, assessment, coherence, consistency, transparency, cost effectiveness and feedback. www.elearnSCI.org provides a cost effective way of training healthcare professionals that goes beyond the textbook and traditional face-to-face teaching.

Automatic Mirroring of the IRAF FTP and WWW Archives

Science.gov (United States)

Fitzpatrick, Mike; Tody, Doug; Terrett, David L.

Large FTP archives have long used mirrors (copies of the network archive maintained on remote hosts) to decrease the load on a particular server or shorten the network path to provide faster download times. Little has been done however to simplify mirroring of WWW (World Wide Web) pages, although many projects and users now rely on Web pages at least as heavily as anonymous FTP services. With the dramatically increasing use of the global Internet in the past year, the network has become overloaded, and network access, especially overseas, is often very slow during peak hours. We present a strategy based on host-independent URLs which allows Web pages to be automatically mirrored to both remote Web hosts and CD-ROMs. Issues affecting a site wishing to mirror a remote archive are discussed.

Liquefied Natural Gas Storage of Variable Composition / Magazynowanie Skroplonego Gazu Ziemnego O Zmiennym Składzie

Science.gov (United States)

Łaciak, Mariusz

2015-03-01

Thanks to the increasing diversification of LNG supply sources, being a result of the growing number of LNG liquefaction installations over the World, increase of short-term trade contracts and general trend to globally liberalize gas markets, reception terminals have to cope with the broad range of qualitatively diversified LNG deliveries from various sources. Different LNG deliveries potentially have different density caused by different gas composition. Although the LNG composition depends on LNG source, it mainly consists of methane, ethane, propane, butane and trace nitrogen. When a new supply of LNG is transported to the tank, the LNG composition and temperature in the tank can be different from LNG as delivered. This may lead to the liquid stratification in the tank, and consequently the rollover. As a result, LNG rapidly evaporates and the pressure in the tank increases. More and more restrictive safety regulations require fuller understanding of the formation and evolution of layers. The paper is focused on the analysis of liquid stratification in the tank which may take place when storing LNG, and which process leads to the rapid evaporation of considerable quantities of LNG. The aim was to attempt modeling of the process of liquid stratification in an LNG tank. The paper is closed with the results of modelling. Dzięki rosnącej dywersyfikacji źródeł dostaw LNG, spowodowanej zwiększającą się liczbą instalacji skraplania gazu na całym świecie, wzrostem ilości kontraktów krótkoterminowych w handlu i ogólnej tendencji do globalnej liberalizacja rynków gazu, terminale do odbioru muszą radzić sobie z coraz większą gamą różnych jakościowo dostaw LNG z różnych źródeł. Różne dostawy LNG mają potencjalnie inną gęstość dzięki różnym składom gazu. Chociaż kompozycja LNG zależy od źródła, to przede wszystkim składa się z metanu, etanu, propanu, butanu i w śladowych ilościach z azotu. Gdy nowa dostawa LNG jest

[Medical information systems in the internet : current data about the dermatologic web site www.dermis.net].

Science.gov (United States)

Diepgen, T L; Tanko, Z; Weisshaar, E; Matvijets, A; Simon, M

2009-12-01

www.dermis.net was established in 1994 as a dermatological information system with now more than 4,000 pages and over 7,500 dermatological images in an atlas. 1,200 dermatological diagnoses and medical information with 1,100 synonyms can be searched by body location and in alphabetical order. Additionally, there are seven information modules about skin cancer, atopic dermatitis, rosacea, skin care, eczema, fungal diseases and hemorrhoids with links to other medical pages like Cochrane Library. Pediatric skin diseases are covered in PeDOIA. www.dermis.net is meanwhile available in German, English, Spanish, Portuguese, French and Turkish language. Current contents of this information system and user behavior are presented in this paper.

Zircon and baddeleyite from the economic ultramafic-mafic Noril'sk-1 intrusion (Russia): Hf-isotope constraints on source composition

Science.gov (United States)

Malitch, K. N.; Belousova, E. A.; Badanina, I. Yu.; Griffin, W. L.

2012-04-01

The ultramafic-mafic Noril'sk-1 intrusion in the northwestern part of the Siberian Craton (Russia) represents one of three known Noril'sk-type, ore-bearing intrusions, which host one of the world's major economic sulphide platinum-group-element (PGE)-Cu-Ni deposits. Zircon and baddeleyite dated previously both by SHRIMP (i.e. 248.0 ± 3.7 Ma, Campbell et al. 1992) and ID-TIMS (251.1 ± 3.6 Ma, Kamo et al. 1996) have been restricted to one lithology (e.g. leucogabbro) of the Noril'sk-1 intrusion. To better constrain the age of igneous event and sources involved in its generation our multi-technique study utilized ten rock samples characteristic of unmineralized and mineralized lithologies. The rocks investigated comprise (from top to bottom) gabbro-diorite (sample N1-1), leucogabbro (N1-3), olivine-free gabbro (N1-2 and N1-4), olivine-bearing gabbro (N1-5), olivine gabbro (N1-6), plagiowehrlite and plagiodunite (N1-7), taxitic-textured rocks comprising melanotroctolite, olivine gabbro with relics of ultramafic rocks (N1-8, N1-9) and contact fine-grained gabbro (N1-10). Sulphide PGE-Cu-Ni ores occur in ultramafic (N1-7) and taxitic-textured rocks (N1-8 and N1-9), which have thickness of about 17 m, whereas the low-sulphide horizon of about 1 m thick occurs in the upper part of intrusion (N1-3). In situ U-Pb analyses of zircon from these rocks, combined with detailed study of crystal morphology and internal structure, identify four zircon populations (Malitch et al. 2012). The U-Pb ages of baddeleyite and the defined zircon populations cover a significant time span, from Late Paleozoic to Early Mesozoic (e.g., 290 ± 2.8; 261.3 ± 1.6; 245.7 ± 1.1; 236.5 ± 1.8 and 226.7 ± 0.9 Ma). The established distribution of U-Pb ages implies that crystallization of baddeleyite and zircon corresponds to several stages of protracted evolution of ultramafic-mafic magmas at deep-seated staging chambers and/or probably characterizes interaction of distinct magmas during formation

Active and Passive Supplier Assessment Program (ASAP & PSAP) WWW Sites http://nepp.nasa.gov/imd/asap http://nepp.nasa.gov/imd/psap

Science.gov (United States)

Brusse, Jay

2000-01-01

The Active and Passive Supplier Assessment Programs (ASAP and PSAP) WWW Sites provide general information to the electronic parts community regarding the availability of electronic parts. They also provide information to NASA regarding modifications to commonly used procurement specifications and test methods. The ASAP and PSAP www sites are ongoing resources produced by Code 562 in support of the NASA HQ funded NASA Electronic Parts and Packaging (NEPP) Program. These WWW sites do not provide information pertaining to patented or proprietary information. All of the information contained in these www sites is available through various other public domain resources such as US Military Qualified Producers Listings (QPLs) and Qualified Manufacturer Listings (QMLs) and industry working groups such as the Electronics Industry Alliance (EIA) and the Space Parts Working Group (SPWG).

#IAmMan: A Communication Proces

OpenAIRE

de Carné de Carnavalet, Caroline Marie Karine; Ricka, Sille Holm; Langlois, Magali; Nau, Frauke

2016-01-01

The purpose of this project is to test and analyse the reception of a campaign within the intended target audience. After having acquired preknowledge about the target group and area of subject, the project use the method of conducting qualitative interviews for gathering empirical knowledge about the reception within the target audience. After doing so the project takes a more theoretical analytical approach by applying Schröder’s Multidimensional model to our new empirical knowledge. The pr...

e73.pdf.pdf | 92 | OnlineResources | jgenet | www.ias.ac.in | http ...

Indian Academy of Sciences (India)

Home; public; Volumes; jgen; 092; online; http; www.ias.ac.in; jgenet; OnlineResources; 92; e73.pdf.pdf. 404! error. The page your are looking for can not be found! Please check the link or use the navigation bar at the top. YouTube; Twitter; Facebook; Blog. Academy News. IAS Logo. 29th Mid-year meeting. Posted on 19 ...

RSS (http://www.iaees.org/publications/journals/environsc/rss.xml

Directory of Open Access Journals (Sweden)

Environmental Skeptics and Critics (ISSN 2224-4263

Full Text Available Environmental Skeptics and Critics ISSN 2224-4263 URL: http://www.iaees.org/publications/journals/environsc/online-version.asp RSS: http://www.iaees.org/publications/journals/environsc/rss.xml E-mail: environsc@iaees.org Editor-in-Chief: WenJun Zhang Aims and Scope The more truth is debated, the clearer it becomes. Science will not proceed without debate and controversy. Wide and in-depth debate and controversy on human's knowledge, attitudes, policies and practices on the environment determines the future of our planet. There are numerous controversial and potentially controversial issues on environmental sciences and practices. ENVIRONMENTAL SKEPTICS and CRITICS (ISSN 2224-4263 is an international journal devoted to the publication of skeptical and critical articles/short communications/letters on theories, viewpoints, methodologies, practices, policies, etc., in ecological and environmental areas. The journal provides a forum for questioning, disputing, arguing, challenging, criticizing and judging known theories, methdologies, practices, and policies, etc., or presenting different ideas. The scope of Environmental Skeptics and Critics is wide and embraces all controversial, non-conclusive or unexplained issues in ecological and environmental areas. Authors can submit their works to the email box of this journal, environsc@iaees.org. All manuscripts submitted to this journal must be previously unpublished and may not be considered for publication elsewhere at any time during review period of this journal. Authors are asked to read Author Guidelines before submitting manuscripts. In addition to free submissions from authors around the world, special issues are also accepted. The organizer of a special issue can collect submissions (yielded from a research project, a research group, etc. on a specific research topic, or submissions of a scientific conference for publication of special issue.

Research on Cache Placement in ICN

Directory of Open Access Journals (Sweden)

Yu Zhang

2017-08-01

Full Text Available Ubiquitous in-network caching is one of key features of Information Centric Network, together with receiver-drive content retrieval paradigm, Information Centric Network is better support for content distribution, multicast, mobility, etc. Cache placement strategy is crucial to improving utilization of cache space and reducing the occupation of link bandwidth. Most of the literature about caching policies considers the overall cost and bandwidth, but ignores the limits of node cache capacity. This paper proposes a G-FMPH algorithm which takes into ac-count both constrains on the link bandwidth and the cache capacity of nodes. Our algorithm aims at minimizing the overall cost of contents caching afterwards. The simulation results have proved that our proposed algorithm has a better performance.

Paleontologický výzkum v permokarbonu podkrkonošské pánve

Czech Academy of Sciences Publication Activity Database

Šimůnek, Z.; Stárková, M.; Zajíc, Jaroslav; Mikuláš, Radek; Drábková, J.

2010-01-01

Roč. 2009, - (2010), s. 167-171 ISSN 0514-8057 Institutional research plan: CEZ:AV0Z30130516 Keywords : Krkonoše-Piedmont Basin * Carboniferous * Permian * fauna * flora * palynomorphs * ichnofossils Subject RIV: DB - Geology ; Mineralogy http://www.geology.cz/zpravy/obsah/2009/2009-45.pdf

Assessment of cadmium and lead mobility in the rhizosphere using voltammetry and electrospray ionization mass spectroscopy

Czech Academy of Sciences Publication Activity Database

Šestáková, Ivana; Jaklová Dytrtová, Jana; Jakl, M.; Navrátil, Tomáš

2011-01-01

Roč. 5, č. 3 (2011), s. 347-355 ISSN 1109-9577 R&D Projects: GA AV ČR IAA400400806 Institutional research plan: CEZ:AV0Z40400503; CEZ:AV0Z40550506 Keywords : cadmium * electrochemical impedance spectroscopy (EIS) * oxalic acid Subject RIV: CG - Electrochemistry http://www.library.sk/i2/i2.entry.cls?ictx=cav&language=2&op=esearch

Geochemical discrimination of metasedimentary sequences in the Krkonoše-Jizera Terrane (West Sudetes, Bohemian Massif): paleotectonic and stratigraphic constraints

Czech Academy of Sciences Publication Activity Database

Winchester, J. A.; Patočka, František; Kachlík, V.; Melzer, M.; Nawakowski, C.; Crowley, Q. G.; Floyd, P. A.

2003-01-01

Roč. 54, č. 5 (2003), s. 267-280 ISSN 1335-0552 R&D Projects: GA AV ČR IAA3111102 Grant - others:CZ-XE(XE) PACE TMR Network ERBFMRXCT97-0136 Institutional research plan: CEZ:AV0Z3013912 Keywords : geochemistry * metasediments * tectonic setting Subject RIV: DD - Geochemistry Impact factor: 0.397, year: 2003 http://www.geologicacarpathica.sk/src/main.php

Mirror Neurons, Embodied Cognitive Agents and Imitation Learning

Czech Academy of Sciences Publication Activity Database

Wiedermann, Jiří

2003-01-01

Roč. 22, č. 6 (2003), s. 545-559 ISSN 1335-9150 R&D Projects: GA ČR GA201/02/1456 Institutional research plan: CEZ:AV0Z1030915 Keywords : complete agents * mirror neurons * embodied cognition * imitation learning * sensorimotor control Subject RIV: BA - General Mathematics Impact factor: 0.254, year: 2003 http://www.cai.sk/ojs/index.php/cai/article/view/468

Preparation and characterization of polyurethane - Fe powder composites

Czech Academy of Sciences Publication Activity Database

Špírková, Milena; Bureš, R.; Fáberová, M.; Trchová, Miroslava; Strachota, Adam; Kaprálková, Ludmila

2011-01-01

Roč. 11, 3/4 (2011), s. 290-299 ISSN 1335-8987 R&D Projects: GA ČR GAP108/10/0195 Institutional research plan: CEZ:AV0Z40500505 Keywords : polyurethanes * polybutadiene diol * Fe powder Subject RIV: CD - Macromolecular Chemistry http://www.imr.saske.sk/pmp/issue/3-4-2011/PMP_Vol11_No3-4_p_290-299.pdf

Upper mantle xenoliths from the Pliocene Kozákov volcano (NE Bohemia): P–T–fO2 and geochemical constraints

Czech Academy of Sciences Publication Activity Database

Konečný, P.; Ulrych, Jaromír; Schovánek, P.; Huraiová, M.; Řanda, Zdeněk

2006-01-01

Roč. 57, č. 5 (2006), s. 379-396 ISSN 1335-0552 R&D Projects: GA AV ČR IAA3013403 Institutional research plan: CEZ:AV0Z30130516; CEZ:AV0Z10480505 Keywords : Bohemian Massif * Cenozoic volcanism * ultramafic xenoliths * spinel lherzolite * harzburgite Subject RIV: DB - Geology ; Mineralogy Impact factor: 0.364, year: 2006 http://www.geologicacarpathica.sk/src/main.php

Práce a dílo. Levinas, Arendtová a Marxismus

Czech Academy of Sciences Publication Activity Database

Bierhanzl, Jan

2017-01-01

Roč. 72, č. 1 (2017), s. 46-53 ISSN 0046-385X R&D Projects: GA ČR(CZ) GA16-23046S Institutional support: RVO:67985955 Keywords : labor * work * fabrication * action * speech * Levinas Subject RIV: AA - Philosophy ; Religion OBOR OECD: Philosophy, History and Philosophy of science and technology http://www.klemens.sav.sk/fiusav/doc/filozofia/2017/1/46-53.pdf

Structure changes in two chosen metallic materials exposed to molten LiF-NaF eutectic mixture – model of corrosion behaviour

Czech Academy of Sciences Publication Activity Database

Král, Lubomír; Čermák, Jiří; Matal, O.; Šimo, T.; Nesvadba, L.; Jílek, M.

2009-01-01

Roč. 47, č. 2 (2009), s. 63-73 ISSN 0023-432X R&D Projects: GA MPO 2A-1TP1/067 Institutional research plan: CEZ:AV0Z20410507 Keywords : steels and nickel alloys * corrosion * diffusion Subject RIV: JF - Nuclear Energetics Impact factor: 1.345, year: 2007 http://www.kovmat.sav.sk/abstract.php?rr=47&cc=2&ss=63

Misky s omfalem v živote barbarských společností doby římské

Czech Academy of Sciences Publication Activity Database

Knápek, Radka; Šedo, Ondrej

2016-01-01

Roč. 110, prosinec (2016), s. 221-279 ISSN 1336-6637 Institutional support: RVO:68081758 Keywords : Sun cults * Bronze age * Roman period * Germanic ceramics * Moravia Subject RIV: AC - Archeology, Anthropology, Ethnology OBOR OECD: Archaeology http://www.snm.sk/swift_data/source/archeologicke_muzeum/zborniky/z_26/23.%20Knapek%20-%20Sedo.pdf?59351c81a4d18

Silicification of quartz arenites overlain by volcaniclastic deposits: an alternative to silcrete formation

Czech Academy of Sciences Publication Activity Database

Malý, Karel; Cajz, Vladimír; Adamovič, Jiří; Zachariáš, J.

2006-01-01

Roč. 57, č. 6 (2006), s. 461-472 ISSN 1335-0552 R&D Projects: GA AV ČR IAA3013302 Institutional research plan: CEZ:AV0Z30130516 Keywords : quartzite * silcrete * dealkalization * Ohře Rift * silicification * dense tuff * quartz overgrowths Subject RIV: DB - Geology ; Mineralogy Impact factor: 0.364, year: 2006 http://www.geologicacarpathica.sk/src/main.php

Behaviour of timber and steel fibre reinforced concrete composite constructions with screwed connections

Czech Academy of Sciences Publication Activity Database

Caldová, E.; Blesák, L.; Wald, F.; Kloiber, Michal; Urushadze, Shota; Vymlátil, P.

2014-01-01

Roč. 59, č. 4 (2014), s. 639-659 ISSN 1336-4561 R&D Projects: GA MŠk(CZ) LO1219; GA ČR(CZ) GAP105/10/2159 Keywords : timber * steel fibre reinforced concrete (SFRC) * screws * numerical model Subject RIV: JN - Civil Engineering Impact factor: 0.364, year: 2014 http://www.woodresearch.sk/ articles .php?volume=12&issue=47

Inhibitions of mTORC1 and 4EBP-1 are key events orchestrated by Rottlerin in SK-Mel-28 cell killing.

Science.gov (United States)

Daveri, E; Maellaro, E; Valacchi, G; Ietta, F; Muscettola, M; Maioli, E

2016-09-28

Earlier studies demonstrated that Rottlerin exerts a time- and dose-dependent antiproliferative effect on SK-Mel-28 melanoma cells during 24 h of treatment, but cytotoxicity due to cell death began only after a 48 h exposure. In the current study, in order to identify the type of cell death in this cell line, which is notoriously refractory to most anticancer therapies, and to clarify the underlying mechanisms of this delayed outcome, we searched for apoptotic, necrotic/necroptotic and autophagic traits in Rottlerin-exposed cells. Although SK-Mel-28 cells are both apoptosis and autophagy competent, Western blotting analysis, caspase activity assay, nuclear imaging and the effects of autophagy, apoptosis and necroptosis inhibitors, indicated that Rottlerin cytotoxicity was due to none of the aforementioned death mechanisms. Nevertheless, in growth arrested cells, the death did occur after a prolonged treatment and most likely ensued from the observed blockage of protein synthesis that reached levels expected to be incompatible with cell survival. From a mechanistic point of view, we ascribed this effect to the documented inhibition of mTORC1 activity; mTORC1 inhibition on the one hand led to a not deadly, rather protective autophagic response but, on the other hand caused a near complete arrest of protein synthesis. Interestingly, no cytotoxicity was found towards normal skin fibroblasts, which only resulted mildly growth arrested by the drug. Copyright © 2016 Elsevier Ireland Ltd. All rights reserved.

Process optimization and photostability of silymarin nanostructured lipid carriers: effect on UV-irradiated rat skin and SK-MEL 2 cell line.

Science.gov (United States)

Singh, Pooja; Singh, Mahendra; Kanoujia, Jovita; Arya, Malti; Saraf, Shailendra K; Saraf, Shubhini A

2016-10-01

The objective of the present work was to formulate a novel stable delivery system which would not only overcome the solubility issue of silymarin, but also help to increase the therapeutic value by better permeation, anticancer action and reduced toxicity. This was envisaged through the recent developments in nanotechnology, combined with the activity of the phytoconstituent silymarin. A 2(3) full factorial design based on three independent variables was used for process optimization of nanostructured lipid carriers (NLC). Developed formulations were evaluated on the basis of particle size, morphology, in vitro drug release, photostability and cell line studies. Optimized silymarin-NLC was incorporated into carbopol gel and further assessed for rheological parameters. Stable behaviour in presence of light was proven by photostability testing of formulation. Permeability parameters were significantly higher in NLC as compared to marketed phytosome formulation. The NLC based gel described in this study showed faster onset, and prolonged activity up to 24 h and better action against edema as compared to marketed formulation. In case of anticancer activity of silymarin-NLC against SK-MEL 2 cell lines, silymarin-NLC proved to possess anticancer activity in a dose-dependent manner (10-80 μM) and induced apoptosis at 80 μM in SK-MEL 2 cancer cells. This work documents for the first time that silymarin can be formulated into nanostructured lipoidal carrier system for enhanced permeation, greater stability as well as anticancer activity for skin.

Lessons from Afar: A Review of www.daisakuikeda.org, Official Website of Daisaku Ikeda

Science.gov (United States)

Arauz, Luis

2012-01-01

Daisaku Ikeda (1928- ) is a Buddhist leader, peace builder, school founder, and poet. His own biography and lifework provide a model for how one can transform adversity into alternative opportunities for some of the most disenfranchised students. Scrutinizing Ikeda's official website (www.daisakuikeda.org) reveals an extensive collection of his…

Bullying and defending behavior: The role of explicit and implicit moral cognition.

Science.gov (United States)

Pozzoli, Tiziana; Gini, Gianluca; Thornberg, Robert

2016-12-01

Research on bullying has highlighted the role of morality in explaining the different behavior of students during bullying episodes. However, the research has been limited to the analysis of explicit measures of moral characteristics and moral reasoning, whereas implicit measures have yet to be fully considered. To overcome this limitation, this study investigated the association between bullying and defending, on one hand, and both explicit (moral disengagement, self-importance of moral values) and implicit (immediate affect toward moral stimuli [IAMS]) moral components, on the other hand. Young adolescents (N=279, mean age=11years, 9months, 44.4% girls) completed a series of self-report scales and individually performed a computer task investigating the IAMS. Two hierarchical regressions (bootstrapping method) were performed. Results showed that moral disengagement was associated with bullying and defending behavior at high levels of IAMS, however not when IAMS was low. In contrast, self-importance of moral values was not significantly associated to the two behaviors when IAMS was high whereas both associations were significant at low levels of IAMS. These results significantly expand previous knowledge about the role of morality in bullying and defending behavior. In particular, they highlight the role of the interaction between explicit and implicit moral dimensions in predicting bullying and defending behaviors. Copyright © 2016 Society for the Study of School Psychology. Published by Elsevier Ltd. All rights reserved.

Quantitative structure-retention relationship studies using immobilized artificial membrane chromatography I: amended linear solvation energy relationships with the introduction of a molecular electronic factor.

Science.gov (United States)

Li, Jie; Sun, Jin; Cui, Shengmiao; He, Zhonggui

2006-11-03

Linear solvation energy relationships (LSERs) amended by the introduction of a molecular electronic factor were employed to establish quantitative structure-retention relationships using immobilized artificial membrane (IAM) chromatography, in particular ionizable solutes. The chromatographic indices, log k(IAM), were determined by HPLC on an IAM.PC.DD2 column for 53 structurally diverse compounds, including neutral, acidic and basic compounds. Unlike neutral compounds, the IAM chromatographic retention of ionizable compounds was affected by their molecular charge state. When the mean net charge per molecule (delta) was introduced into the amended LSER as the sixth variable, the LSER regression coefficient was significantly improved for the test set including ionizable solutes. The delta coefficients of acidic and basic compounds were quite different indicating that the molecular electronic factor had a markedly different impact on the retention of acidic and basic compounds on IAM column. Ionization of acidic compounds containing a carboxylic group tended to impair their retention on IAM, while the ionization of basic compounds did not have such a marked effect. In addition, the extra-interaction with the polar head of phospholipids might cause a certain change in the retention of basic compounds. A comparison of calculated and experimental retention indices suggested that the semi-empirical LSER amended by the addition of a molecular electronic factor was able to reproduce adequately the experimental retention factors of the structurally diverse solutes investigated.

Factors to keep in mind when introducing virtual microscopy.

Science.gov (United States)

Glatz-Krieger, Katharina; Spornitz, Udo; Spatz, Alain; Mihatsch, Michael J; Glatz, Dieter

2006-03-01

Digitization of glass slides and delivery of so-called virtual slides (VS) emulating a real microscope over the Internet have become reality due to recent improvements in technology. We have implemented a virtual microscope for instruction of medical students and for continuing medical education. Up to 30,000 images per slide are captured using a microscope with an automated stage. The images are post-processed and then served by a plain hypertext transfer protocol (http)-server. A virtual slide client (vMic) based on Macromedia's Flash MX, a highly accepted technology available on every modern Web browser, has been developed. All necessary virtual slide parameters are stored in an XML file together with the image. Evaluation of the courses by questionnaire indicated that most students and many but not all pathologists regard virtual slides as an adequate replacement for traditional slides. All our virtual slides are publicly accessible over the World Wide Web (WWW) at http://vmic.unibas.ch . Recently, several commercially available virtual slide acquisition systems (VSAS) have been developed that use various technologies to acquire and distribute virtual slides. These systems differ in speed, image quality, compatibility, viewer functionalities and price. This paper gives an overview of the factors to keep in mind when introducing virtual microscopy.

HmtDB 2016: data update, a better performing query system and human mitochondrial DNA haplogroup predictor.

Science.gov (United States)

Clima, Rosanna; Preste, Roberto; Calabrese, Claudia; Diroma, Maria Angela; Santorsola, Mariangela; Scioscia, Gaetano; Simone, Domenico; Shen, Lishuang; Gasparre, Giuseppe; Attimonelli, Marcella

2017-01-04

The HmtDB resource hosts a database of human mitochondrial genome sequences from individuals with healthy and disease phenotypes. The database is intended to support both population geneticists as well as clinicians undertaking the task to assess the pathogenicity of specific mtDNA mutations. The wide application of next-generation sequencing (NGS) has provided an enormous volume of high-resolution data at a low price, increasing the availability of human mitochondrial sequencing data, which called for a cogent and significant expansion of HmtDB data content that has more than tripled in the current release. We here describe additional novel features, including: (i) a complete, user-friendly restyling of the web interface, (ii) links to the command-line stand-alone and web versions of the MToolBox package, an up-to-date tool to reconstruct and analyze human mitochondrial DNA from NGS data and (iii) the implementation of the Reconstructed Sapiens Reference Sequence (RSRS) as mitochondrial reference sequence. The overall update renders HmtDB an even more handy and useful resource as it enables a more rapid data access, processing and analysis. HmtDB is accessible at http://www.hmtdb.uniba.it/. © The Author(s) 2016. Published by Oxford University Press on behalf of Nucleic Acids Research.

CLIPZ: a database and analysis environment for experimentally determined binding sites of RNA-binding proteins.

Science.gov (United States)

Khorshid, Mohsen; Rodak, Christoph; Zavolan, Mihaela

2011-01-01

The stability, localization and translation rate of mRNAs are regulated by a multitude of RNA-binding proteins (RBPs) that find their targets directly or with the help of guide RNAs. Among the experimental methods for mapping RBP binding sites, cross-linking and immunoprecipitation (CLIP) coupled with deep sequencing provides transcriptome-wide coverage as well as high resolution. However, partly due to their vast volume, the data that were so far generated in CLIP experiments have not been put in a form that enables fast and interactive exploration of binding sites. To address this need, we have developed the CLIPZ database and analysis environment. Binding site data for RBPs such as Argonaute 1-4, Insulin-like growth factor II mRNA-binding protein 1-3, TNRC6 proteins A-C, Pumilio 2, Quaking and Polypyrimidine tract binding protein can be visualized at the level of the genome and of individual transcripts. Individual users can upload their own sequence data sets while being able to limit the access to these data to specific users, and analyses of the public and private data sets can be performed interactively. CLIPZ, available at http://www.clipz.unibas.ch, aims to provide an open access repository of information for post-transcriptional regulatory elements.

IkusaSA. Integrated Assessment for Sustainability

CSIR Research Space (South Africa)

Scholes, RJ

2012-10-01

Full Text Available , have intended and unintended consequences across a range of important issues. The IkusaSA model system comprises: ? A South African national IAM nested within one or more ?state-of-the-art? global IAMs that predict trade, climate change and human... the country and internationally. The IkusaSA mission is to establish Integrated Assessment Modeling (IAM) in South Africa. The goal is to put in place the tools for an integrated planning approach and provide effective information sharing mechanisms...

Implantação da linha de cuidado do infarto agudo do miocárdio no município de Belo Horizonte

Directory of Open Access Journals (Sweden)

Milena Soriano Marcolino

2013-04-01

Full Text Available FUNDAMENTO: A criação de sistemas ou linhas de cuidado ao infarto agudo do miocárdio (IAM tem o objetivo de otimizar o atendimento ao paciente, desde o diagnóstico precoce até o tratamento adequado e em tempo hábil. OBJETIVO: Avaliar a implantação da linha de cuidado do IAM, em Belo Horizonte, Minas Gerais, e seu impacto na mortalidade hospitalar por IAM. MÉTODOS: A linha de cuidado do IAM foi implantada em Belo Horizonte entre 2010 e 2011 com intuito de ampliar o acesso dos pacientes do sistema público de saúde ao tratamento preconizado pelas diretrizes vigentes. As equipes das unidades de pronto atendimento foram treinadas e foi implantado sistema de tele-eletrocardiografia nessas unidades. Os desfechos primários deste estudo observacional retrospectivo foram o número de internações e a mortalidade hospitalar por IAM, de 2009 a 2011. RESULTADOS: No período avaliado, 294 profissionais foram treinados e 563 ECGs foram transmitidos das unidades de pronto atendimento para as unidades coronarianas. Houve redução importante da taxa de mortalidade hospitalar (12,3% em 2009 versus 7,1% em 2011, p < 0,001, enquanto o número de internações por IAM permaneceu estável. Ocorreu aumento do custo médio de internação (média R$ 2.480,00 versus R$ 3.501,00, p < 0,001, aumento da proporção de internações contemplando diárias de terapia intensiva (32,4% em 2009 versus 66,1% em 2011, p < 0,001 e de pacientes internados em hospitais de alta complexidade (47,0% versus 69,6%, p < 0,001. CONCLUSÃO: A implantação da linha de cuidado do IAM permitiu maior acesso da população ao tratamento adequado e, consequentemente, redução na mortalidade hospitalar por IAM.

The opposing effects of calmodulin, adenosine 5 prime -triphosphate, and pertussis toxin on phorbol ester induced inhibition of atrial natriuretic factor stimulated guanylate cyclase in SK-NEP-1 cells

Energy Technology Data Exchange (ETDEWEB)

Sekiya, M.; Frohlich, E.D.; Cole, F.E. (Alton Ochsner Medical Foundation, New Orleans, LA (USA))

1991-01-01

In the present study, we investigated the effects of calmodulin, adenosine 5{prime}-triphosphate (ATP) and pertussis toxin (PT) on phorbol ester (PMA) induced inhibition of ANF-stimulated cyclic GMP formation in cells from the human renal cell line, SK-NEP-1. PMA inhibited ANF-stimulated guanylate cyclase activity in particulate membranes by about 65%. Calmodulin reversed this inhibition in a dose dependent manner. ATP potentiated Mg++ but not Mn++ supported guanylate cyclase activity. In PMA treated membranes, ATP potentiating effects were abolished. PMA also inhibited ANF-stimulated cGMP accumulation, but pretreatment with PT prevented this PMA inhibition. PT did not affect basal or ANF-stimulated cGMP accumulation. In conclusion, these results demonstrated that PMA inhibited ANF stimulation of particulate guanylate cyclase in opposition to the activating effects of calmodulin or ATP in SK-NEP-1 cells. The protein kinase C inhibitory effects appeared to be mediated via a PT-sensitive G protein.

Numerical simulation of gas-contaminated refrigerant two-phase flow through

Czech Academy of Sciences Publication Activity Database

Vinš, Václav; Hrubý, Jan; Vacek, V.

2010-01-01

Roč. 53, 23-24 (2010), s. 5430-5439 ISSN 0017-9310 R&D Projects: GA ČR GA101/09/1633 Institutional research plan: CEZ:AV0Z20760514 Keywords : capillary tube * henry’s law * non-condensing gases Subject RIV: BJ - Thermodynamics Impact factor: 1.898, year: 2010 http://www.sciencedirect.com/science?_ob=MImg&_imagekey=B6V3H-50N9C3K-8-2X&_cdi=5731&_user=640952&_pii=S0017931010003819&_origin=search&_coverDate=11%2F30%2F2010&_sk=999469976&view=c&wchp=dGLzVtz-zSkWA&md5=3b8d5c97caaa70e52da990c8ffac4421&ie=/sdarticle.pdf

Crop modelling for integrated assessment of risk to food production from climate change

DEFF Research Database (Denmark)

Ewert, F.; Rötter, R.P.; Bindi, M.

2015-01-01

. However, progress on the number of simulated crops, uncertainty propagation related to model parameters and structure, adaptations and scaling are less advanced and lagging behind IAM demands. The limitations are considered substantial and apply to a different extent to all crop models. Overcoming...... climate change risks to food production and to which extent crop models comply with IAM demands. Considerable progress has been made in modelling effects of climate variables, where crop models best satisfy IAM demands. Demands are partly satisfied for simulating commonly required assessment variables...

Wpływ regularnej aktywności fizycznej na skład ciała i ciśnienie tętnicze dzieci ze szkoły sportowej

Directory of Open Access Journals (Sweden)

Małgorzata Stańczyk

2013-06-01

Full Text Available Wstęp: Trening fizyczny uważany jest za czynnik wpływający na parametry antropometryczne i ciśnienie tęt‑ nicze. Twierdzi się, że osoby regularnie ćwiczące mają lepsze wskaźniki składu ciała oraz niższe wartości ciśnienia tętniczego krwi w porównaniu z osobami nieuprawiającymi sportu. Cel: Ocena wpływu regularnej rocznej aktywności fizycznej prowadzonej w szkole sportowej na skład ciała oraz wartości ciśnienia tętnicze‑ go u dzieci 14-letnich (II klasa gimnazjum. Materiał i metodyka: W badaniu wzięło udział 25 dzieci z gim‑ nazjum sportowego. Dzieci badano dwukrotnie w odstępie 12 miesięcy. Analizie poddano zmianę parame‑ trów antropometrycznych, składu ciała metodą impedancji bioelektrycznej oraz wartości ciśnienia krwi. Wyniki: W całej grupie zaobserwowano wzrost wartości centylowych ciśnienia skurczowego krwi (p < 0,05, przede wszystkim u chłopców. W zakresie ciśnienia rozkurczowego nie zanotowano istotnych różnic. Skład ciała zmienił się niekorzystnie u wszystkich badanych – wzrósł udział tłuszczu (13% vs 20%, p < 0,05, a przy‑ rost masy tłuszczowej był wyższy u dziewczynek (6% vs 3%, p < 0,05. Centyl BMI istotnie statystycznie wzrósł w grupie dziewczynek (37 vs 49, p < 0,05, u chłopców nie uległ zmianie. Wnioski: Aktywność fizyczna proponowana przez szkołę sportową nie poprawia stanu odżywienia 13–14-letnich dziewcząt i chłopców, u których obserwuje się istotne zwiększenie w organizmie zawartości tkanki tłuszczowej. Szkolna aktywność fizyczna nie powoduje obniżenia ciśnienia tętniczego wśród młodzieży w wieku 13–14 lat w odniesieniu do norm wiekowych. W zakresie ciśnienia skurczowego w grupie chłopców zaobserwowano nawet wyższe wartości centylowe.

Mayflies of the Caucasus Mountains. II. Description of the first representative of the subgenus Helvetoraeticus Bauernfeind & Soldán, 2012 (Heptageniidae: Ecdyonurus)

Czech Academy of Sciences Publication Activity Database

Kluge, N. J.; Godunko, Roman J.; Apanaskevich, D. A.

2013-01-01

Roč. 3608, č. 1 (2013), s. 51-66 ISSN 1175-5326 R&D Projects: GA ČR GA206/08/1389 Grant - others:Ministerstvo školství(CZ) MOBILITY 7AMB12SK144 Institutional support: RVO:60077344 Keywords : Ephemeroptera * new species * Georgia Subject RIV: EG - Zoology Impact factor: 1.060, year: 2013 http://www.mapress.com/zootaxa/2013/f/z03608p066f.pdf

The Era of Global Disputes and Mass Media Distortions. Dialogue on Recognition, Justice and Democracy

Czech Academy of Sciences Publication Activity Database

Bittar, E.; Hrubec, Marek

2017-01-01

Roč. 8, č. 2 (2017), s. 146-154 ISSN 1338-130X Grant - others:AV ČR(CZ) StrategieAV21/15 Program:StrategieAV Institutional support: RVO:67985955 Keywords : global conflicts * international law * justice * mass media * recognition * democracy Subject RIV: AA - Philosophy ; Religion OBOR OECD: Political science https://www.communicationtoday.sk/era-global-disputes-mass-media-distortions-dialogue-recognition-justice-democracy-interview-marek-hrubec/

The Privatisation of State Housing Stock in the Czech Republic – a Path Dependent Process?

Czech Academy of Sciences Publication Activity Database

Sládek, Jan

2013-01-01

Roč. 45, č. 3 (2013), s. 267-289 ISSN 0049-1225 R&D Projects: GA ČR GA403/09/1915 Institutional research plan: CEZ:AV0Z70280505 Institutional support: RVO:68378025 Keywords : privatisation of housing * urban theory * post-communist countries Subject RIV: AO - Sociology, Demography Impact factor: 0.212, year: 2013 http://www.sav.sk/journals/uploads/07171227Sladek%20-%20studia.pdf

Coexisting Miocene Alkaline Volcanic Series Associated with the Cheb-Domažlice Graben (W Bohemia): Geochemical Characteristics

Czech Academy of Sciences Publication Activity Database

Ulrych, Jaromír; Štěpánková, Jana; Lloyd, F. E.; Balogh, K.

2003-01-01

Roč. 54, č. 1 (2003), s. 53-64 ISSN 1335-0552 R&D Projects: GA ČR GA205/99/0907 Grant - others:Hungarian Academy of Sciences Foundation(HU) T 014961 Institutional research plan: CEZ:AV0Z3013912 Keywords : W Bohemia * Miocene volkanism * geochemistry Subject RIV: DB - Geology ; Mineralogy Impact factor: 0.397, year: 2003 http://www.geologicacarpathica.sk/src/main.php

Česká postindustriální krajina

Czech Academy of Sciences Publication Activity Database

Kolejka, Jaromír

2012-01-01

Roč. 46, č. 1 (2012), s. 38-43 ISSN 0044-4863 R&D Projects: GA AV ČR IAA300860903 Institutional support: RVO:68145535 Keywords : post-industrial landscapes * identification process * typology * Czech Republic Subject RIV: DE - Earth Magnetism, Geodesy, Geography http://www.elis.sk/index.php?page=shop.product_details&flypage=flypage.tpl&product_id=2956&category_id=101&option=com_virtuemart&Itemid=1

Information on web-site of the State protection of nature

International Nuclear Information System (INIS)

Rajtar, R.

2005-01-01

Statna ochrana prirody SR (SOP SR - State protection of nature of the Slovak Republic) is professional organisation with all-Slovak operation, which operation is aimed on provision of professional activities for service of state administration in protection of nature and landscape. Structure of the SOP SR, their operation and information presented on the web site of the SOP SR (www.sopsr.sk) are described

Vliv podmínek šíření trhliny na dimenzi fraktálu lomové plochy

Czech Academy of Sciences Publication Activity Database

Němec, Ondřej; Dlouhý, Ivo; Strnadel, B.

2003-01-01

Roč. 41, č. 3 (2003), s. 177-192 ISSN 0023-432X R&D Projects: GA ČR GA106/01/0342; GA AV ČR IAA2041003 Institutional research plan: CEZ:AV0Z2041904 Keywords : tempered microalloyed steel * fractography * fracture toughness Subject RIV: JL - Materials Fatigue , Friction Mechanics Impact factor: 0.563, year: 2003 http://www.kovmat.sav.sk/km3-03.htm

Survivin knockdown increased anti-cancer effects of (-)-epigallocatechin-3-gallate in human malignant neuroblastoma SK-N-BE2 and SH-SY5Y cells.

Science.gov (United States)

Hossain, Md Motarab; Banik, Naren L; Ray, Swapan K

2012-08-01

Neuroblastoma is a solid tumor that mostly occurs in children. Malignant neuroblastomas have poor prognosis because conventional chemotherapeutic agents are hardly effective. Survivin, which is highly expressed in some malignant neuroblastomas, plays a significant role in inhibiting differentiation and apoptosis and promoting cell proliferation, invasion, and angiogenesis. We examined consequences of survivin knockdown by survivin short hairpin RNA (shRNA) plasmid and then treatment with (-)-epigallocatechin-3-gallate (EGCG), a green tea flavonoid, in malignant neuroblastoma cells. Our Western blotting and laser scanning confocal immunofluorescence microscopy showed that survivin was highly expressed in malignant neuroblastoma SK-N-BE2 and SH-SY5Y cell lines and slightly in SK-N-DZ cell line. Expression of survivin was very faint in malignant neuroblastoma IMR32 cell line. We transfected SK-N-BE2 and SH-SY-5Y cells with survivin shRNA, treated with EGCG, and confirmed knockdown of survivin at mRNA and protein levels. Survivin knockdown induced morphological features of neuronal differentiation, as we observed following in situ methylene blue staining. Combination of survivin shRNA and EGCG promoted neuronal differentiation biochemically by increases in the expression of NFP, NSE, and e-cadherin and also decreases in the expression of Notch-1, ID2, hTERT, and PCNA. Our in situ Wright staining and Annexin V-FITC/PI staining showed that combination therapy was highly effective in inducing, respectively, morphological and biochemical features of apoptosis. Apoptosis occurred with activation of caspase-8 and cleavage of Bid to tBid, increase in Bax:Bcl-2 ratio, mitochondrial release of cytochrome c, and increases in the expression and activity of calpain and caspase-3. Combination therapy decreased migration of cells through matrigel and inhibited proliferative (p-Akt and NF-κB), invasive (MMP-2 and MMP-9), and angiogenic (VEGF and b-FGF) factors. Also, in vitro

Stržový systém v Bosonožském hájku – jedinečný geomorfologický fenomén západně od Brna

Czech Academy of Sciences Publication Activity Database

Kirchner, Karel; Münster, P.; Máčka, Z.

2011-01-01

Roč. 18, č. 2 (2011), s. 32-35 ISSN 1212-6209 Institutional research plan: CEZ:AV0Z30860518 Keywords : gully networks * loess * Bosonožský hájek area * Brno region Subject RIV: DE - Earth Magnetism, Geodesy, Geography

Finanční analýza podniku Drůbežářský závod Klatovy a.s.

OpenAIRE

Kohoutová, Kateřina

2010-01-01

This bachelor thesis deals with the financial analysis of Drůbežářský závod Klatovy a.s. during the period 2005-2009. The goal of the thesis is to evaluate the economic situation of the corporation and find out its competitive strength. A part of the project is the methodology which qualifies concepts and indicators and creates bases for the practical part. In the practical part of the project horizontal and vertical analysis of balance sheet and profit and loss statement with comments are pe...

Polonium 210Po activities in human blood of patients with ischaemic heart disease from Gdańsk in Poland.

Science.gov (United States)

Boryło, Alicja; Skwarzec, Bogdan; Romańczyk, Grzegorz; Siebert, Janusz

The determination of polonium 210 Po in human blood samples is presented and discussed in this paper. The human blood samples were collected from patients of Medical University of Gdańsk with ischaemic heart disease ( morbus ischaemicus cordis , MIC ). The polonium concentrations in analyzed human blood samples are very differentiated. 210 Po is of particular interest in public health and although is present in the environment in extremely low amounts, it is easily bioaccumulated to the human body. The study shows that the amount of 210 Po that is incorporated into the human body depends on the food habits and some difference in its levels could be observed between smokers and non-smokers.

Antimicrobial activity of Xylopia aethiopica, Aframomum melegueta ...

African Journals Online (AJOL)

poisoning and/or food spoilage. The microorganisms were Bacillus subtilis IAM1069, Bacillus cereus IFO 13494, Staphylococcus aureus FDA 209p, Escherichia coli NRIC 1023, Salmonella typhimurium IFO12529, Lactobacillus plantarum IAM 1041, Pediococcus acidilactici-M, Leuconostoc mesenteroides- M, Lactobacillus ...

The interaction between the light source dose and caspase-dependent and -independent apoptosis in human SK-MEL-3 skin cancer cells following photodynamic therapy with zinc phthalocyanine: A comparative study.

Science.gov (United States)

Doustvandi, Mohammad Amin; Mohammadnejad, Fateme; Mansoori, Behzad; Mohammadi, Ali; Navaeipour, Farzaneh; Baradaran, Behzad; Tajalli, Habib

2017-11-01

The aim of this study is to determine the behavior of relative expression of Bcl-2, caspase-8, caspase-9, and caspase-3 genes of/in SK-MEL-3 cancer cells and explore molecular mechanisms responsible for the apoptosis response during an in vitro photodynamic therapy (PDT) with Zinc Phthalocyanine (ZnPc) using different doses of the light source. In this study, firstly the cytotoxic effects of ZnPc-PDT on SK-MEL-3 cells were evaluated. By irradiating the laser, ZnPc induced a significant amount of apoptosis on SK-MEL-3 cells in three IC 50 s including 0.064±0.01, 0.043±0.01, and 0.036±0.01μg/mL at the doses of 8, 16, and 24J/cm 2 , respectively. Moreover, flow cytometry and QRT-PCR experiments were done. The high percentage of apoptotic cells was seen in the early apoptosis stage. The expression of Bcl-2 and caspase-8 genes at all doses of laser experienced an obvious reduction in comparison to the control group. On the other hand, although the expression of caspase-9 and caspase-3 genes remains almost constant at 8J/cm 2 , but they faced an increment at 16 and 24J/cm 2 doses. These data reveal caspase-dependent apoptosis in high and caspase-independent apoptosis in low doses of laser. Based on the results of present work, it can be suggested that the dose of the light source is a key factor in induction of caspase-dependent and caspase-independent apoptosis pathways following PDT. Copyright © 2017. Published by Elsevier B.V.

Biochanin A induces anticancer effects in SK-Mel-28 human malignant melanoma cells via induction of apoptosis, inhibition of cell invasion and modulation of NF-κB and MAPK signaling pathways.

Science.gov (United States)

Xiao, Peng; Zheng, Bowen; Sun, Jiaming; Yang, Jia

2017-11-01

The present study aimed to investigate the antitumor activity of Biochanin A in SK-Mel-28 human malignant melanoma cells. An MTT assay was used to study the cytotoxic effects of Biochanin A. In vitro wound healing and invasion assays were used to investigate the effects on cell migration and invasion. Fluorescence microscopy using acridine orange/propidium iodide was used to study effects on cell morphology and apoptosis. Nuclear factor (NF)-κB and mitogen-activated protein kinase (MAPK) protein expression levels were determined by western blot analysis. The results indicated that Biochanin A significantly inhibited the growth of SK-Mel-28 cells in a dose and time dependent manner. Treatment of the cells with Biochanin A induced apoptosis in a dose dependent manner. Additionally, Biochanin A led to inhibition of cell migration and invasion in a dose-dependent manner and upregulated the expression of key proteins in the NF-κB and MAPK signaling pathways.

Application of an Integrated Assessment Model to the Kevin Dome site, Montana

Energy Technology Data Exchange (ETDEWEB)

Nguyen, Minh [Univ. of Wyoming, Laramie, WY (United States); Zhang, Ye [Univ. of Wyoming, Laramie, WY (United States); Carey, James William [Los Alamos National Lab. (LANL), Los Alamos, NM (United States); Stauffer, Philip H. [Los Alamos National Lab. (LANL), Los Alamos, NM (United States)

2017-10-30

The objectives of the Integrated Assessment Model is to enable the Fault Swarm algorithm in the National Risk Assessment Partnership, ensure faults are working in the NRAP-IAM tool, calculate hypothetical fault leakage in NRAP-IAM, and compare leakage rates to Eclipse simulations.

Między brakiem a nadmiarem. Z Ireną Grudzińską-Gross rozmawia Joanna Tokarska-Bakir

Directory of Open Access Journals (Sweden)

Joanna Tokarska-Bakir

2012-12-01

Full Text Available Between overabundance and scarcity. Joanna Tokarska-Bakir in an interview with Irena Grudzińska Gross This conversation with Irena Grudzińska-Gross starts a series of interviews in “Studia Litteraria et Historica”, which motto is the title of the essay of Jan Stanisław Bystroń “On subjects I was advised not to pursue”. Among these subjects that Irena Grudzińska-Gross names are: war, family history, women.  Grudzińska-Gross tells also about the reactions to “Złote Żniwa” - a book that she wrote together with Jan Tomasz Gross, and about academic work of people of Eastern Europe living in the United States. One part of the interview concerns also a “collective hypnosis”, that Americans underwent after the 9/11 World Trade Center Attack and the price, that Susan Sontag had to pay for being critical about American militarism.   Między brakiem a nadmiarem. Z Ireną Grudzińską-Gross rozmawia Joanna Tokarska-Bakir Rozmowa z Ireną Grudzińską-Gross otwiera cykl wywiadów “Studia Litteraria et Historica”, których mottem jest tytuł eseju Jana Stanisława Bystronia: “Tematy, które mi odradzano”. Wśród “odradzanych” tematów, które wymienia Irena Grudzińska-Gross są między innymi: wojna, historia rodzinna, kobiety. Grudzińska-Gross opowiada także o reakcjach na książkę “Złote żniwa”, którą napisała wraz z Janem Tomaszem Grossem oraz o pracy akademickiej osób z Europy Wschodniej w Stanach Zjednoczonych. Część rozmowy dotyczy także “zbiorowej hipnozy”, której ulegli mieszkańcy USA po ataku 11 września 2001 na World Trade Center i ceny, jaką musiała zapłacić Susan Sontag za krytykę amerykańskiego militaryzmu.

Biomimetic chromatographic analysis of selenium species: Application for the estimation of their pharmacokinetic properties

Energy Technology Data Exchange (ETDEWEB)

Tsopelas, Fotios [National Technical University of Athens, Laboratory of Inorganic and Analytical Chemistry, School of Chemical Engineering, Athens (Greece); University of Athens, Laboratory of Pharmaceutical Chemistry, School of Pharmacy, Athens (Greece); Tsantili-Kakoulidou, Anna [University of Athens, Laboratory of Pharmaceutical Chemistry, School of Pharmacy, Athens (Greece); Ochsenkuehn-Petropoulou, Maria [National Technical University of Athens, Laboratory of Inorganic and Analytical Chemistry, School of Chemical Engineering, Athens (Greece)

2010-07-15

The retention behavior of selenites, selenates, seleno-dl-methionine, selenocystine, selenocystamine, selenourea, dimethyl selenide, and dimethyl diselenide was investigated by means of biomimetic liquid chromatography. For this purpose, two immobilized artificial membrane (IAM) columns, namely, IAM.PC.DD2 and IAM.PC.MG, and two immobilized plasma protein columns, human serum albumin (HSA) and {alpha}{sub 1}-acid glycoprotein (AGP) columns, were employed using different mobile phase conditions in respect to pH and buffer composition. In general, satisfactory interrelations between retention factors obtained with the two IAM stationary phases and HSA/AGP columns were obtained. Large differences were observed between biomimetic retention factors and octanol-water logD values, since the latter fail to describe electrostatic interactions. In contrast, despite the column diversity, the net retention outcome on all four biomimetic columns was quite similar, especially in the presence of phosphate-buffered saline, which by its effective shielding alleviates the differences between the stationary phases. Of the two IAM columns, IAM.PC.DD2 showed better performance when compared with HSA and AGP columns as well as to octanol-water partitioning. Biomimetic chromatographic indices were further used to estimate the percentage of human oral absorption and plasma protein binding of the eight selenium species investigated, according to equations previously reported in the literature. The estimated values of human oral absorption imply moderate absorption only for dimethyl diselenide, which also may exhibit considerable plasma protein binding. Moderate affinity for plasma proteins should also be expected for dimethyl selenide and selenocystamine. (orig.)

Contribution of diffusion-weighted MR imaging in follow-up of inflammatory appendiceal mass: Preliminary results and review of the literature

International Nuclear Information System (INIS)

Özdemir, Oğuzhan; Metin, Yavuz; Metin, Nurgül Orhan; Küpeli, Ali; Kalcan, Süleyman; Taşçı, Filiz

2016-01-01

We aimed to search the contribution of diffusion-weighted imaging (DWI) in follow-up of patients with acute appendicitis associated inflammatory appendiceal mass (IAM). DWI was used as a monitoring imaging method to assess the response of medical treatment. 19 patients (mean age, 37+–13.1; age range, 19–69; M/F: 10/9), presented with clinical, laboratory and computed tomography (CT) findings suggestive of IAM were enrolled prospectively in this study. CT and DWI images were evaluated by two radiologists in consensus. b values 0, 500 and 1000 s/mm 2 were used, and DWI images were analysed both qualitatively and quantitatively. Laboratory parameters were C-reactive protein value and white blood cell count. During follow-up changes in the diameter of IMA and laboratory parameters were correlated with ADC values. Conservative treatment with interval appendectomy and a total conservative approach without surgery were the treatment options during follow-up. We found statistically significant correlation between the ADC values, maximum IAM diameter and laboratory parameters. During follow-up five surgical procedures were performed: one patient underwent surgery for cecal adenocarcinoma and four underwent interval appendectomy. One patient developed acute relapse of IAM at the sixth month of follow-up. DWI may be used with a significant success for follow-up of patients with IAM. As a monitoring imaging method, DWI may also aid in determining of most appropriate timing for interval appendectomy as well as may help in diagnosing alternative diagnoses (e.g. malignancy and inflammatory bowel disease) that can mimic IAM

Survivin knockdown increased anti-cancer effects of (−)-epigallocatechin-3-gallate in human malignant neuroblastoma SK-N- BE2 and SH-SY5Y cells

Science.gov (United States)

Hossain, Md. Motarab; Banik, Naren L.; Ray, Swapan K.

2012-01-01

Neuroblastoma is a solid tumor that mostly occurs in children. Malignant neuroblastomas have poor prognosis because conventional chemotherapeutic agents are hardly effective. Survivin, which is highly expressed in some malignant neuroblastomas, plays a significant role in inhibiting differentiation and apoptosis and promoting cell proliferation, invasion, and angiogenesis. We examined consequences of survivin knockdown by survivin short hairpin RNA (shRNA) plasmid and then treatment with (−)-epigallocatechin-3-gallate (EGCG), a green tea flavonoid, in malignant neuroblastoma cells. Our Western blotting and laser scanning confocal immunofluorescence microscopy showed that survivin was highly expressed in malignant neuroblastoma SK-N-BE2 and SH-SY5Y cell lines and slightly in SK-N-DZ cell line. Expression of survivin was very faint in malignant neuroblastoma IMR32 cell line. We transfected SK-N-BE2 and SH-SY-5Y cells with survivin shRNA, treated with EGCG, and confirmed knockdown of survivin at mRNA and protein levels. Survivin knockdown induced morphological features of neuronal differentiation, as we observed following in situ methylene blue staining. Combination of survivin shRNA and EGCG promoted neuronal differentiation biochemically by increases in expression of NFP, NSE, and e-cadherin and also decreases in expression of Notch-1, ID2, hTERT, and PCNA. Our in situ Wright staining and Annexin V-FITC/PI staining showed that combination therapy was highly effective in inducing, respectively, morphological and biochemical features of apoptosis. Apoptosis occurred with activation of caspase-8 and cleavage of Bid to tBid, increase in Bax:Bcl-2 ratio, mitochondrial release of cytochrome c, and increases in expression and activity of calpain and caspase-3. Combination therapy decreased migration of cells through matrigel and inhibited proliferative (p-Akt and NF-κB), invasive (MMP-2 and MMP-9), and angiogenic (VEGF and b-FGF) factors. Also, in vitro network

Why don’t Eastern Europeans Work Part-time?

Czech Academy of Sciences Publication Activity Database

Fialová, Kamila

2017-01-01

Roč. 65, č. 2 (2017), s. 125-142 ISSN 0013-3035 R&D Projects: GA ČR(CZ) GA14-15008S Institutional support: RVO:68378025 Keywords : part-time employment * business cycle * labour market institutions Subject RIV: AH - Economics OBOR OECD: Applied Economics, Econometrics Impact factor: 0.720, year: 2016 https://www.sav.sk/journals/uploads/0410121902%2017%20Fialov%C3%A1%20+%20RS.pdf

The expansion and occurrence of the Amur sleeper (Perccottus glenii) in eastern Slovakia

Czech Academy of Sciences Publication Activity Database

Koščo, J.; Lusk, Stanislav; Halačka, Karel; Lusková, Věra

2003-01-01

Roč. 52, č. 3 (2003), s. 329-336 ISSN 0139-7893 R&D Projects: GA AV ČR IBS6093007; GA AV ČR KSK6005114 Grant - others:VEGA(SK) 1/9209/02 Institutional research plan: CEZ:AV0Z6093917 Keywords : Perccottus glenii * invasion * Tisa drainage area Subject RIV: EH - Ecology, Behaviour Impact factor: 0.494, year: 2003 http://www.ivb.cz/folia/52/3/329-336.pdf

Využití porózního hydrogelu jako 3D scaffoldu pro růst leukemických B lymfocytů

Czech Academy of Sciences Publication Activity Database

Studená, R.; Horák, Daniel; Baloun, J.; Plichta, Zdeněk; Pospíšilová, S.

2017-01-01

Roč. 30, Supplementum 1 (2017), S184-S186 ISSN 0862-495X. [Brněnské onkologické dny /41./ a Konference pro nelékařské zdravotnické pracovníky /31./. Brno, 26.04.2017-28.04.2017] Institutional support: RVO:61389013 Keywords : hematooncology * leukemia * hydrogel Subject RIV: CD - Macromolecular Chemistry OBOR OECD: Polymer science http://www.linkos.cz/files/klinicka-onkologie/213.pdf

Pressure effect on magnetic and insulator-metal transition of La.sub.0.67./sub.Pb.sub.0.33./sub.Mn.sub.0.9./sub.Co.sub.0.1./sub.O.sub.2.97./sub. ceramic

Czech Academy of Sciences Publication Activity Database

Mihalik, M.; Zentková, M.; Antoňák, M.; Arnold, Zdeněk; Kamarád, Jiří; Skorokhod, Yuriy; Gritzner, G.; Kiss, L. F.

2012-01-01

Roč. 32, č. 1 (2012), s. 145-149 ISSN 0895-7959. [Conference of the European High Pressure Research Group (EHPRG) /49./. Budapest, 28.08.2011-02.09.2011] Grant - others:VEGA(SK) 2/0057/27 Institutional research plan: CEZ:AV0Z10100521 Keywords : magnetic transition: insulator-metal transition * hydrostatic pressure * manganite Subject RIV: BM - Solid Matter Physics ; Magnetism Impact factor: 0.901, year: 2012 www.tandfonline.com

The Sacrifice and the Ludic Stances Reflected Through the Theatre Practice of the 20th Century

Czech Academy of Sciences Publication Activity Database

Koubová, Alice

2017-01-01

Roč. 72, č. 6 (2017), s. 451-462 ISSN 0046-385X R&D Projects: GA ČR(CZ) GA16-23046S Institutional support: RVO:67985955 Keywords : performative turn * performance * sacrifice * ludic stance * play * postmodern condition * Brecht * Benjamin * Grotowski Subject RIV: AA - Philosophy ; Religion OBOR OECD: Philosophy , History and Philosophy of science and technology http://www.klemens.sav.sk/fiusav/doc/filozofia/2017/6/451-462.pdf

Modulation of notch signaling pathway to prevent H2O2/menadione-induced SK-N-MC cells death by EUK134.

Science.gov (United States)

Kamarehei, Maryam; Yazdanparast, Razieh

2014-10-01

The brain in Alzheimer's disease is under increased oxidative stress, and this may have a role in the pathogenesis and neural death in this disorder. It has been verified that numerous signaling pathways involved in neurodegenerative disorders are activated in response to reactive oxygen species (ROS). EUK134, a synthetic salen-manganese antioxidant complex, has been found to possess many interesting pharmacological activities awaiting exploration. The present study is to characterize the role of Notch signaling in apoptotic cell death of SK-N-MC cells. The cells were treated with hydrogen peroxide (H2O2) or menadione to induce oxidative stress. The free-radical scavenging capabilities of EUK134 were studied through the MTT assay, glutathione peroxidase (GPx) enzyme activity assay, and glutathione (GSH) Levels. The extents of lipid peroxidation, protein carbonyl formation, and intracellular ROS levels, as markers of oxidative stress, were also studied. Our results showed that H2O2/menadione reduced GSH levels and GPx activity. However, EUK134 protected cells against ROS-induced cell death by down-regulation of lipid peroxidation and protein carbonyl formation as well as restoration of antioxidant enzymes activity. ROS induced apoptosis and increased NICD and HES1 expression. Inhibition of NICD production proved that Notch signaling is involved in apoptosis through p53 activation. Moreover, H2O2/menadione led to Numb protein down-regulation which upon EUK134 pretreatment, its level increased and subsequently prevented Notch pathway activation. We indicated that EUK134 can be a promising candidate in designing natural-based drugs for ROS-induced neurodegenerative diseases. Collectively, ROS activated Notch signaling in SK-N-MC cells leading to cell apoptosis.

Why are we not flooded by involuntary autobiographical memories? Few cues are more effective than many.

Science.gov (United States)

Vannucci, Manila; Pelagatti, Claudia; Hanczakowski, Maciej; Mazzoni, Giuliana; Paccani, Claudia Rossi

2015-11-01

Recent research on involuntary autobiographical memories (IAMs) has shown that these memories can be elicited and studied in the laboratory under controlled conditions. Employing a modified version of a vigilance task developed by Schlagman and Kvavilashvili (Mem Cogn 36:920-932, 2008) to elicit IAMs, we investigated the effects of varying the frequency of external cues on the number of IAMs reported. During the vigilance task, participants had to detect an occasional target stimulus (vertical lines) in a constant stream of non-target stimuli (horizontal lines). Participants had to interrupt the task whenever they became aware of any task-unrelated mental contents and to report them. In addition to line patterns, participants were exposed to verbal cues and their frequency was experimentally manipulated in three conditions (frequent cues vs. infrequent cues vs. infrequent cues plus arithmetic operations). We found that, compared to infrequent cues, both conditions with frequent cues and infrequent cues plus arithmetic operations decreased the number of IAMs reported. The comparison between the three experimental conditions suggests that this reduction was due to the greater cognitive load in conditions of frequent cues and infrequent cue plus arithmetic operations. Possible mechanisms involved in this effect and their implications for research on IAMs are discussed.

The Skælskør structure in eastern Denmark – wrench-related anticline or primary Late Cretaceous sea-floor topography?

DEFF Research Database (Denmark)

Surlyk, Finn; Boldreel, Lars Ole; Lykke-Andersen, Holger

2010-01-01

seismic studies of the Chalk Group in Øresund and Kattegat have shown that similar highs actually represent topographic highs on the Late Cretaceous – Danian seafloor formed by strong contourparallel bottom currents. Reflection seismic data collected over the Skælskør structure in order to test...... the Ringkøbing Fyn High into the Danish Basin. The elevated position is maintained due to reduced subsidence as compared with the Danish Basin north of the high. The hypothesis of wrench tectonics as origin can be refuted. The seismic data show that the upper part of the Chalk Group is characterised by irregular...

RSS (http://www.iaees.org/publications/journals/nb/rss.xml

Directory of Open Access Journals (Sweden)

Network Biology (ISSN 2220-8879

Full Text Available Network Biology ISSN 2220-8879 URL: http://www.iaees.org/publications/journals/nb/online-version.asp RSS: http://www.iaees.org/publications/journals/nb/rss.xml E-mail: networkbiology@iaees.org Editor-in-Chief: WenJun Zhang Aims and Scope NETWORK BIOLOGY (ISSN 2220-8879; CODEN NBEICS is an open access, peer-reviewed international journal that considers scientific articles in all different areas of network biology. It is the transactions of the International Society of Network Biology. It dedicates to the latest advances in network biology. The goal of this journal is to keep a record of the state-of-the-art research and promote the research work in these fast moving areas. The topics to be covered by Network Biology include, but are not limited to: •Theories, algorithms and programs of network analysis •Innovations and applications of biological networks •Ecological networks, food webs and natural equilibrium •Co-evolution, co-extinction, biodiversity conservation •Metabolic networks, protein-protein interaction networks, biochemical reaction networks, gene networks, transcriptional regulatory networks, cell cycle networks, phylogenetic networks, network motifs •Physiological networks •Network regulation of metabolic processes, human diseases and ecological systems •Social networks, epidemiological networks •System complexity, self-organized systems, emergence of biological systems, agent-based modeling, individual-based modeling, neural network modeling, and other network-based modeling, etc. We are also interested in short communications that clearly address a specific issue or completely present a new ecological network, food web, or metabolic or gene network, etc. Authors can submit their works to the email box of this journal, networkbiology@iaees.org. All manuscripts submitted to this journal must be previously unpublished and may not be considered for publication elsewhere at any time during review period of this journal

www.kerntechnik.info = annual meeting on nuclear technology on the web

International Nuclear Information System (INIS)

Anon.

2009-01-01

The ANNUAL MEETING ON NUCLEAR TECHNOLOGY can be found under the new Internet address of www.kerntechnik.info as of now. The Web site offers systematic access to all important information and features about this largest European specialized meeting of its kind. Pages showing the program of the Conference with its plenary session, topical sessions, technical sessions, and the ''Nuclear Power Campus'' and ''Competency Workshop'' special events, are updated continuously. In addition, contributions to the technical sessions may be submitted on line at an early point in time; registrating for the meeting as well as booking hotel accommodation are also possible on line. The next ANNUAL MEETING ON NUCLEAR TECHNOLOGY will be held at the Berlin Congress Center in Berlin/Germany on May 4-6, 2010. (orig.)

Decomposing passenger transport futures : Comparing results of global integrated assessment models

NARCIS (Netherlands)

Edelenbosch, O. Y.; McCollum, D. L.; van Vuuren, Detlef; Bertram, C.; Carrara, S.; Daly, H.; Fujimori, S.; Kitous, A.; Kyle, P.; Ó Broin, E.; Karkatsoulis, P.; Sano, F.

The transport sector is growing fast in terms of energy use and accompanying greenhouse gas emissions. Integrated assessment models (IAMs) are used widely to analyze energy system transitions over a decadal time frame to help inform and evaluating international climate policy. As part of this, IAMs

Evaluation of email alerts in practice: Part 2. Validation of the information assessment method.

Science.gov (United States)

Pluye, Pierre; Grad, Roland M; Johnson-Lafleur, Janique; Bambrick, Tara; Burnand, Bernard; Mercer, Jay; Marlow, Bernard; Campbell, Craig

2010-12-01

The information assessment method (IAM) permits health professionals to systematically document the relevance, cognitive impact, use and health outcomes of information objects delivered by or retrieved from electronic knowledge resources. The companion review paper (Part 1) critically examined the literature, and proposed a 'Push-Pull-Acquisition-Cognition-Application' evaluation framework, which is operationalized by IAM. The purpose of the present paper (Part 2) is to examine the content validity of the IAM cognitive checklist when linked to email alerts. A qualitative component of a mixed methods study was conducted with 46 doctors reading and rating research-based synopses sent on email. The unit of analysis was a doctor's explanation of a rating of one item regarding one synopsis. Interviews with participants provided 253 units that were analysed to assess concordance with item definitions. The content relevance of seven items was supported. For three items, revisions were needed. Interviews suggested one new item. This study has yielded a 2008 version of IAM. © 2010 Blackwell Publishing Ltd.

RTO/RC ITER plasma performance: inductive and steady-state operation

International Nuclear Information System (INIS)

Mukhovatov, V.; Boucher, D.; Fujisawa, N.; Shimada, M.; Vayakis, G.; Janeschitz, G.; Matsumoto, H.; Leonov, V.; Polevoy, A.

2000-01-01

The plasma performance in two design options of the reduced-technical objectives/reduced cost (RTO/RC) ITER, i.e. IAM (intermediate aspect ratio machine) and LAM (low aspect ratio machine) is analysed. It is shown that Q=P fus /P aux ∼10 can be obtained in both options at inductively driven ELMy H-mode operation. The operation domain in LAM is found to be marginally larger than that in IAM. The non-inductive operation with Q approx.= 5 will be possible in both machines, provided a large amount of power with a high current drive efficiency is applied, or substantial improvement of the energy confinement time relative to the ELMy H-mode (H H =1.2-1.4) is obtained. The required values of H H and β N are marginally smaller in IAM. The IAM-like machine, ITER-FEAT (fusion energy advanced tokamak), proposed for a detailed engineering design is discussed in brief. (author)

2018-05-15T22:36:01Z https://www.ajol.info/index.php/index/oai oai ...

African Journals Online (AJOL)

They are aware that the bees collect nectar and pollen and also know that the ... Even though the indigenous people recognize stingless bee honey as highly ... Article application/pdf https://www.ajol.info/index.php/jgsa/article/view/48073 ...

Lycopene inhibits reactive oxygen species production in SK-Hep-1 cells and attenuates acetaminophen-induced liver injury in C57BL/6 mice.

Science.gov (United States)

Bandeira, Ana Carla Balthar; da Silva, Talita Prato; de Araujo, Glaucy Rodrigues; Araujo, Carolina Morais; da Silva, Rafaella Cecília; Lima, Wanderson Geraldo; Bezerra, Frank Silva; Costa, Daniela Caldeira

2017-02-01

Our aim was to investigate the antioxidant potential of lycopene in different experimental liver models: in vitro, to evaluate the influence of lycopene on reactive oxygen species (ROS) production mediated by the PKC pathway and in vivo, to evaluate the protective effects of lycopene in an experimental model of hepatotoxicity. The in vitro study assessed the lycopene antioxidant potential by the quantification of ROS production in SK-Hep-1 cells unstimulated or stimulated by an activator of the PKC pathway. The role of NADPH oxidase was evaluated by measuring its inhibition potential using an inhibitor of this enzyme. In the in vivo study, male C57BL/6 mice received lycopene (10 or 100 mg/kg by oral gavage) and 1 h later, acetaminophen (APAP) (500 mg/kg) was administrated. Lycopene decreased ROS production in SK-Hep-1 cells through inhibition of NADPH oxidase, brought about in the PKC pathway. Lycopene improved hepatotoxicity acting as an antioxidant, reduced GSSG and regulated tGSH and CAT levels, reduced oxidative damage primarily by decreasing protein carbonylation, promoted the downregulation of MMP-2 and reduced areas of necrosis improving the general appearance of the lesion in C57BL/6 mice. Lycopene is a natural compound that was able to inhibit the production of ROS in vitro and mitigate the damage caused by APAP overdose in vivo. Copyright © 2016 Elsevier Ireland Ltd. All rights reserved.

Postavení OPEC v mezinárodních hospodářských vztazích

OpenAIRE

Košteková, Eva

2008-01-01

Bakalárska práca sa týka Organizácie krajín vyvážajúcich ropu.Cieľom práce je zhodnotiť postavenie OPEC od jeho vzniku, charakterizovať význam tejto organizácie a popísať zapojenie OPEC vo svetovej ekonomike.V prvej časti práce je základná charakteristika OPEC. Druhá časť práce skúma vývoj postavenia OPEC od jeho vzniku v roku 1960 do roku 2000 so zameraním na ropné šoky. Tretia časť práce sa zaoberá postavením OPEC v treťom miléniu, vzťahmi s EÚ a obnoviteľnými zdrojmi energie....

Fast imaging employing steady-state acquisition (FIESTA) MRI to investigate cerebrospinal fluid (CSF) within dural reflections of posterior fossa cranial nerves.

Science.gov (United States)

Noble, David J; Scoffings, Daniel; Ajithkumar, Thankamma; Williams, Michael V; Jefferies, Sarah J

2016-11-01

There is no consensus approach to covering skull base meningeal reflections-and cerebrospinal fluid (CSF) therein-of the posterior fossa cranial nerves (CNs VII-XII) when planning radiotherapy (RT) for medulloblastoma and ependymoma. We sought to determine whether MRI and specifically fast imaging employing steady-state acquisition (FIESTA) sequences can answer this anatomical question and guide RT planning. 96 posterior fossa FIESTA sequences were reviewed. Following exclusions, measurements were made on the following scans for each foramen respectively (left, right); internal acoustic meatus (IAM) (86, 84), jugular foramen (JF) (83, 85) and hypoglossal canal (HC) (42, 45). A protocol describes measurement procedure. Two observers measured distances for five cases and agreement was assessed. One observer measured all the remaining cases. IAM and JF measurement interobserver variability was compared. Mean measurement difference between observers was -0.275 mm (standard deviation 0.557). IAM and JF measurements were normally distributed. Mean IAM distance was 12.2 mm [95% confidence interval (CI) 8.8-15.6]; JF was 7.3 mm (95% CI 4.0-10.6). The HC was difficult to visualize on many images and data followed a bimodal distribution. Dural reflections of posterior fossa CNs are well demonstrated by FIESTA MRI. Measuring CSF extension into these structures is feasible and robust; mean CSF extension into IAM and JF was measured. We plan further work to assess coverage of these structures with photon and proton RT plans. Advances in knowledge: We have described CSF extension beyond the internal table of the skull into the IAM, JF and HC. Oncologists planning RT for patients with medulloblastoma and ependymoma may use these data to guide contouring.

Effect of and satisfaction with www.elearnSCI.org for training of nurse students: a submodule pilot study.

Science.gov (United States)

Liu, N; Li, X W; Zhou, M W; Krassioukov, A V; Biering-Sørensen, F

2014-10-01

Interventional training session. To investigate the effect and satisfaction with didactic training using printed text of a submodule of www.elearnSCI.org for nurse students and to assess the answers of each question. A Peking University teaching hospital. Twenty-eight nurse students in two groups (14 in each) were involved. Only group A received a translated print-out of the slides from the 'Nursing management' submodule in www.elearnSCI.org for 1-h self-study before the class. At the beginning of class, both groups were tested using the self assessment questions. Then, a lecture according to the content of this submodule was carried out and afterwards both groups answered the self assessment questions again. Finally, both groups filled in a training course satisfaction questionnaire. At the beginning of the class, the mean score (max 9) of the self assessment in group A was 7.1 ± 1.1, which was significantly higher than that in group B (4.9 ± 1.7, P = 0.001). After the lecture, the mean score of the self assessment in group A had insignificantly increased to 7.4 ± 1.3, whereas in group B it increased significantly to 6.9 ± 0.8 (P org to nurse students. The training satisfaction of this submodule within the www.elearnSCI.org is favorable.

TSSer: an automated method to identify transcription start sites in prokaryotic genomes from differential RNA sequencing data.

Science.gov (United States)

Jorjani, Hadi; Zavolan, Mihaela

2014-04-01

Accurate identification of transcription start sites (TSSs) is an essential step in the analysis of transcription regulatory networks. In higher eukaryotes, the capped analysis of gene expression technology enabled comprehensive annotation of TSSs in genomes such as those of mice and humans. In bacteria, an equivalent approach, termed differential RNA sequencing (dRNA-seq), has recently been proposed, but the application of this approach to a large number of genomes is hindered by the paucity of computational analysis methods. With few exceptions, when the method has been used, annotation of TSSs has been largely done manually. In this work, we present a computational method called 'TSSer' that enables the automatic inference of TSSs from dRNA-seq data. The method rests on a probabilistic framework for identifying both genomic positions that are preferentially enriched in the dRNA-seq data as well as preferentially captured relative to neighboring genomic regions. Evaluating our approach for TSS calling on several publicly available datasets, we find that TSSer achieves high consistency with the curated lists of annotated TSSs, but identifies many additional TSSs. Therefore, TSSer can accelerate genome-wide identification of TSSs in bacterial genomes and can aid in further characterization of bacterial transcription regulatory networks. TSSer is freely available under GPL license at http://www.clipz.unibas.ch/TSSer/index.php

Jak vzniká něco nového? Založení a transcendence

Czech Academy of Sciences Publication Activity Database

Puc, Jan

2017-01-01

Roč. 72, č. 4 (2017), s. 259-270 ISSN 0046-385X R&D Projects: GA ČR(CZ) GAP401/11/1747 Institutional support: RVO:67985955 Keywords : institution * transcendence * creativity * temporality * emergence * novelty * Husserl * Patočka * Merleau-Ponty * Bergson * phenomenology * expressivity Subject RIV: AA - Philosophy ; Religion OBOR OECD: Philosophy, History and Philosophy of science and technology http://www.klemens.sav.sk/fiusav/doc/filozofia/2017/4/259-270.pdf

Optical coherence tomography--a new imaging method in ophthalmology.

Science.gov (United States)

Svorenova, I; Strmen, P; Olah, Z

2010-01-01

An improvement of examination methods in ophthalmology, technical digitalisation and knowledge of validity of examinations in various diseases contributes to early diagnostics, thereby leading to an opportunity for early treatment of eye disorders. Standard introduction of the so-called optical coherence tomography into the ophthamological clinical practice facilitated new options for a detailed analysis of pathological processes in the particular layers of the retina (Fig. 2, Ref. 5). Full Text (Free, PDF) www.bmj.sk.

Lessons Learned from the ECML/PKDD Discovery Challenge on the Atherosclerosis Risk Factors Data

Czech Academy of Sciences Publication Activity Database

Berka, Petr; Rauch, Jan; Tomečková, Marie

2007-01-01

Roč. 26, č. 3 (2007), s. 329-344 ISSN 1335-9150 R&D Projects: GA MŠk(CZ) 1M06014; GA ČR GA201/05/0325 Grant - others:GA VŠE(CZ) 25/05 Institutional research plan: CEZ:AV0Z10300504 Keywords : atherosclerosis risk * data mining * discovery challenge Subject RIV: IN - Informatics, Computer Science Impact factor: 0.349, year: 2007 http://www.cai.sk/ojs/index.php/cai/article/view/313

Childcare Preferences of Parents in the Czech Republic and the Slovak Republic

Czech Academy of Sciences Publication Activity Database

Lutherová, S.; Maříková, Hana; Válková, J.

2017-01-01

Roč. 49, č. 3 (2017), s. 285-308 ISSN 0049-1225 R&D Projects: GA ČR GA15-07898S Institutional support: RVO:68378025 Keywords : childcare * family policies * gender equality Subject RIV: AO - Sociology, Demography OBOR OECD: Social topics ( Women ´s and gender studies; Social issues; Family studies; Social work) Impact factor: 0.283, year: 2016 http://www.sav.sk/journals/uploads/06231002Lutherova%20-%20zalomena%20OK.pdf

Hydraulic conditions of water flow in seminatural fish pass, A case study of the Skórka barrage on the Głomia river

Directory of Open Access Journals (Sweden)

Mateusz Hämmerling

2017-06-01

Full Text Available The article presents results of a field study of the fish pass located within the Skórka barrage on the Głomia river. The aim of the study was to identify water flow conditions in particular chambers of the fish pass. On the basis of results of the field study, the hydraulic conditions of water flow through the fish pass were determined and referred to the optimum performance parameters of the construction. The results obtained make a basis for discussion of possible problems related to construction and operation of the fish passes resembling „close to nature” structures.

3'-Hydroxy-3,4'-dimethoxyflavone blocks tubulin polymerization and is a potent apoptotic inducer in human SK-MEL-1 melanoma cells.

Science.gov (United States)

Estévez-Sarmiento, Francisco; Said, Mercedes; Brouard, Ignacio; León, Francisco; García, Celina; Quintana, José; Estévez, Francisco

2017-11-01

Flavonoids are naturally occurring polyphenolic compounds and are among the most promising anticancer agents. A series of flavonols and their 3-methyl ether derivatives were synthesized and assessed for cytotoxicity. It was found that 3'-hydroxy-3,4'-dimethoxyflavone (flavonoid 7a) displayed strong cytotoxicity against human SK-MEL-1 melanoma cells and blocked tubulin polymerization, but had no significant cytotoxic effects against quiescent or proliferating human peripheral blood mononuclear cells. Our analyses showed that flavonoid 7a induces G 2 -M cell cycle arrest and apoptosis in melanoma cells which is associated with cytochrome c release and activation of both extrinsic and intrinsic apoptotic pathways of cell death. Copyright © 2017 Elsevier Ltd. All rights reserved.

Jón Ólafsson (ed., Lýðræðistilraunir. Ísland í hruni og endurreisn [Democratic experiments. Iceland in collapse and renaissance] (Reykjavík: Háskólaútgáfan, 2014

Directory of Open Access Journals (Sweden)

Guðmundur Heiðar Frímannsson

2015-03-01

Full Text Available Review of the following book: Jón Ólafsson (ed., Lýðræðistilraunir. Ísland í hruni og endurreisn [Democratic experiments. Iceland in collapse and renaissance], (Reykjavík: Háskólaútgáfan, 2014

TcruziDB, an Integrated Database, and the WWW Information Server for the Trypanosoma cruzi Genome Project

Directory of Open Access Journals (Sweden)

Degrave Wim

1997-01-01

Full Text Available Data analysis, presentation and distribution is of utmost importance to a genome project. A public domain software, ACeDB, has been chosen as the common basis for parasite genome databases, and a first release of TcruziDB, the Trypanosoma cruzi genome database, is available by ftp from ftp://iris.dbbm.fiocruz.br/pub/genomedb/TcruziDB as well as versions of the software for different operating systems (ftp://iris.dbbm.fiocruz.br/pub/unixsoft/. Moreover, data originated from the project are available from the WWW server at http://www.dbbm.fiocruz.br. It contains biological and parasitological data on CL Brener, its karyotype, all available T. cruzi sequences from Genbank, data on the EST-sequencing project and on available libraries, a T. cruzi codon table and a listing of activities and participating groups in the genome project, as well as meeting reports. T. cruzi discussion lists (tcruzi-l@iris.dbbm.fiocruz.br and tcgenics@iris.dbbm.fiocruz.br are being maintained for communication and to promote collaboration in the genome project

Next-to-leading order electroweak corrections to off-shell WWW production at the LHC arXiv

CERN Document Server

Schönherr, Marek

Triboson processes allow for a measurement of the triple and quartic couplings of the Standard Model gauge bosons, which can be used to constrain anomalous gauge couplings. In this paper we calculate the next-to-leading order electroweak corrections to fully off-shell $W^-W^+W^+$ production, namely the production of a $\\ell_1^-\\ell_2^+\\ell_3^+\\bar{\

RSS (http://www.iaees.org/publications/journals/ces/rss.xml

Directory of Open Access Journals (Sweden)

Computational Ecology and Software (ISSN 2220-721X

Full Text Available Computational Ecology and Software ISSN 2220-721X URL: http://www.iaees.org/publications/journals/ces/online-version.asp RSS: http://www.iaees.org/publications/journals/ces/rss.xml E-mail: ces@iaees.org Editor-in-Chief: WenJun Zhang Aims and Scope COMPUTATIONAL ECOLOGY AND SOFTWARE (ISSN 2220-721X is an open access, peer-reviewed online journal that considers scientific articles in all different areas of computational ecology. It is the transactions of the International Society of Computational Ecology. The journal is concerned with the ecological researches, constructions and applications of theories and methods of computational sciences including computational mathematics, computational statistics and computer science. It features the simulation, approximation, prediction, recognition, and classification of ecological issues. Intensive computation is one of the major stresses of the journal. The journal welcomes research articles, short communications, review articles, perspectives, and book reviews. The journal also supports the activities of the International Society of Computational Ecology. The topics to be covered by CES include, but are not limited to: •Computation intensive methods, numerical and optimization methods, differential and difference equation modeling and simulation, prediction, recognition, classification, statistical computation (Bayesian computing, randomization, bootstrapping, Monte Carlo techniques, stochastic process, etc., agent-based modeling, individual-based modeling, artificial neural networks, knowledge based systems, machine learning, genetic algorithms, data exploration, network analysis and computation, databases, ecological modeling and computation using Geographical Information Systems, satellite imagery, and other computation intensive theories and methods. •Artificial ecosystems, artificial life, complexity of ecosystems and virtual reality. •The development, evaluation and validation of software and

2018-04-06T22:56:04Z https://www.ajol.info/index.php/all/oai oai:ojs ...

African Journals Online (AJOL)

Variable speed induction motor drives without mechanical speed sensors at the ... the magnitude and spatial orientation of the fundamental magnetic flux in the ... Article application/pdf https://www.ajol.info/index.php/ijest/article/view/63713 ...

Survivin knockdown increased anti-cancer effects of (−)-epigallocatechin-3-gallate in human malignant neuroblastoma SK-N-BE2 and SH-SY5Y cells

International Nuclear Information System (INIS)

Hossain, Md. Motarab; Banik, Naren L.; Ray, Swapan K.

2012-01-01

Neuroblastoma is a solid tumor that mostly occurs in children. Malignant neuroblastomas have poor prognosis because conventional chemotherapeutic agents are hardly effective. Survivin, which is highly expressed in some malignant neuroblastomas, plays a significant role in inhibiting differentiation and apoptosis and promoting cell proliferation, invasion, and angiogenesis. We examined consequences of survivin knockdown by survivin short hairpin RNA (shRNA) plasmid and then treatment with (−)-epigallocatechin-3-gallate (EGCG), a green tea flavonoid, in malignant neuroblastoma cells. Our Western blotting and laser scanning confocal immunofluorescence microscopy showed that survivin was highly expressed in malignant neuroblastoma SK-N-BE2 and SH-SY5Y cell lines and slightly in SK-N-DZ cell line. Expression of survivin was very faint in malignant neuroblastoma IMR32 cell line. We transfected SK-N-BE2 and SH-SY-5Y cells with survivin shRNA, treated with EGCG, and confirmed knockdown of survivin at mRNA and protein levels. Survivin knockdown induced morphological features of neuronal differentiation, as we observed following in situ methylene blue staining. Combination of survivin shRNA and EGCG promoted neuronal differentiation biochemically by increases in the expression of NFP, NSE, and e-cadherin and also decreases in the expression of Notch-1, ID2, hTERT, and PCNA. Our in situ Wright staining and Annexin V-FITC/PI staining showed that combination therapy was highly effective in inducing, respectively, morphological and biochemical features of apoptosis. Apoptosis occurred with activation of caspase-8 and cleavage of Bid to tBid, increase in Bax:Bcl-2 ratio, mitochondrial release of cytochrome c, and increases in the expression and activity of calpain and caspase-3. Combination therapy decreased migration of cells through matrigel and inhibited proliferative (p-Akt and NF-κB), invasive (MMP-2 and MMP-9), and angiogenic (VEGF and b-FGF) factors. Also, in vitro

Intraarterial Microdosing, a Novel Drug Development Approach, Proof-of-Concept PET Study in Rats

Science.gov (United States)

Burt, Tal; Rouse, Douglas C.; Lee, Kihak; Wu, Huali; Layton, Anita T.; Hawk, Thomas C.; Weitzel, Douglas H.; Chin, Bennett B.; Cohen-Wolkowiez, Michael; Chow, Shein-Chung; Noveck, Robert J.

2016-01-01

Intraarterial microdosing (IAM) is a novel drug development approach combining intraarterial drug delivery and microdosing. We aimed to demonstrate that IAM leads to target exposure similar to that of systemic full-dose administration but with minimal systemic exposure. IAM could enable the safe, inexpensive, and early study of novel drugs at the first-in-human stage and the study of established drugs in vulnerable populations. Methods Insulin was administered intraarterially (ipsilateral femoral artery) or systemically to 8 CD IGS rats just before blood sampling or 60-min 18F-FDG uptake PET imaging of ipsilateral and contralateral leg muscles (lateral gastrocnemius) and systemic muscles (spinotrapezius). The 18F-FDG uptake slope analysis was used to compare the interventions. Plasma levels of insulin and glucose were compared using area under the curve calculated by the linear trapezoidal method. A physiologically based computational pharmacokinetics/pharmacodynamics model was constructed to simulate the relationship between the administered dose and response over time. Results 18F-FDG slope analysis found no difference between IAM and systemic full-dose slopes (0.0066 and 0.0061, respectively; 95% confidence interval [CI], −0.024 to 0.029; P = 0.7895), but IAM slope was statistically significantly greater than systemic microdose (0.0018; 95% CI, −0.045 to −0.007; P = 0.0147) and sham intervention (−0.0015; 95% CI, 0.023–0.058; P = 0.0052). The pharmacokinetics/pharmacodynamics data were used to identify model parameters that describe membrane insulin binding and glucose–insulin dynamics. Conclusion Target exposure after IAM was similar to systemic full dose administration but with minimal systemic effects. The computational pharmacokinetics/pharmacodynamics model can be generalized to predict whole-body response. Findings should be validated in larger, controlled studies in animals and humans using a range of targets and classes of drugs. PMID

Young Children's Analogical Reasoning: The Role of Immediate Feedback

Science.gov (United States)

Chiu, Shuhui; Alexander, Patricia A.

2014-01-01

In this study, a computerized measure, Interactive Analogical Measure (IAM), was developed and used to assess young children's ability to reason analogically. The IAM was equipped to provide corrective feedback and the effects of that feedback were tested for experimental and control groups. A group of 5-year-olds (N = 80) participated in the…

Instituto de Astrofísica de Madrid: science fiction or top science?

Science.gov (United States)

Caballero, J. A.

2015-05-01

In Spain, there is an Instituto de Astrofísica de Canarias in Tenerife, an Instituto de Astrofísica de Andalucía in Granada and an Institut d'Estudis Espacials de Catalunya in Barcelona. However, there is not an Instituto de Astrofísica de Madrid (IAM). Actually, Madrilenian astronomers are spread over a number of institutions of quite different origin, size and funding source. The IAM, if it existed, would be a catalyzer of ideas and collaborations, an international meeting point, an engine for high-technology industry in the region, and an excellence centre. Furthermore, the IAM would maximise the efficiency in the use of resources, offer a place for finding synergies between research groups and, especially, have a critical mass for embarking in very large projects in the ground and space. I will expose how, in a smooth and democratic way, an IAM might be built step by step. The process may take decades and, thus, young Madrilenian astronomers shall play a rôle on it.

2018-05-10T13:10:34Z https://www.ajol.info/index.php/all/oai oai:ojs ...

African Journals Online (AJOL)

In the retrobulbar injection group 25 (71.4%) patients had none or mild pains ... an aesthetic techniques are effective and safe for cataract surgery although the ... Article application/pdf https://www.ajol.info/index.php/njcp/article/view/74533 ...

Associations between cognitive abilities and life satisfaction in the oldest-old. Results from the longitudinal population study Good Aging in Skåne

Directory of Open Access Journals (Sweden)

Enkvist Å

2013-07-01

Full Text Available Åsa Enkvist, Henrik Ekström, Sölve Elmståhl Department of Health Sciences, Division of Geriatric Medicine, Lund University, Skåne University Hospital, Malmö, Sweden Introduction: Studies on the associations between cognitive abilities and life satisfaction (LS in the oldest-old are few. The aim of this study was to explore whether abilities in six different cognitive domains could predict LS in the oldest-old 3 years later. Methods: The study population consisted of 681 individuals aged 78–98 years, drawn from the longitudinal population study “Good Aging in Skåne,” which is part of a national survey (The Swedish National Study on Aging and Care. Scores on 13 cognitive tests were related to scores on Neugartens’ LS index A (LSI-A 3 years later. The cognitive tests were added into six different cognitive domains. A multiple regression analysis was constructed for each cognitive domain separately, with scores on the LSI-A as the dependent variable. The model was adjusted stepwise for sex, age, education, functional capacity, and depressive mood. Results: Significant correlations were found between digit cancellation, word recall, verbal fluency (VF A, VF animals, VF occupations, and mental rotations at baseline, as well as LSI-A at follow-up. The domains of spatial abilities (B = 0.453, P = 0.014 and processing speed (B = 0.118, P = 0.020 remained significantly associated with LSI-A 3 years later after adjustment. Conclusion: The cognitive domains of spatial abilities and processing speed predicted LS 3 years later in the oldest-old. Clinical implications are discussed. Keywords: oldest-old, life satisfaction, longitudinal, crystallized and fluid intelligence, cognition

Heat shock protein 90 inhibitor enhances apoptosis by inhibiting the AKT pathway in thermal-stimulated SK-MEL-2 human melanoma cell line.

Science.gov (United States)

Shin, Min Kyung; Jeong, Ki-Heon; Choi, Hyeongwon; Ahn, Hye-Jin; Lee, Mu-Hyoung

2018-02-08

Heat shock proteins (Hsps) are chaperone proteins, which are upregulated after various stresses. Hsp90 inhibitors have been investigated as adjuvant therapies for the treatment of melanoma. Thermal ablation could be a treatment option for surgically unresectable melanoma or congenital nevomelanocytic nevi, however, there is a limitation such as the possibility of recurrence. We evaluated apoptosis in a melanoma cell line treated with the Hsp90 inhibitor 17-Dimethylaminoethylamino-17-demethoxygeldanamycin (17-DMAG), in hyperthermic conditions. SK-MEL-2 cells were stimulated at 43 °C for 1 h and treated with 0, 0.1 and 1 μM 17-DMAG. We evaluated the cell viability using MTT and apoptosis with HSP 90 inhibitor. We studied the protein expression of AKT, phospho-AKT, ERK, phospho-ERK, MAPK, and phospho-MAPK, caspase 3,7,9, and anti-poly (ADP-ribose) polymerase. 17-DMAG significantly inhibited the proliferation of the SK-MEL-2 cells at 37 °C (0.1 μM: 44.47% and 1 μM: 61.23%) and 43 °C (0.1 μM: 49.21% and 1 μM: 63.60%), suggesting synergism between thermal stimulation and 17-DMAG. 17-DMAG treatment increased the frequency of apoptotic cell populations to 2.17% (0.1 μM) and 3.05% (1 μM) in 37 °C controls, and 4.40% (0.1 μM) and 4.97% (1 μM) in the group stimulated at 43 °C. AKT phosphorylation were activated by thermal stimulation and inhibited by 17-DMAG. Hsp90 inhibitor treatment may be clinically applicable to enhance the apoptosis of melanoma cells in hyperthermic condition. Copyright © 2018 Japanese Society for Investigative Dermatology. Published by Elsevier B.V. All rights reserved.

Multi-criteria ranking of energy generation scenarios with Monte Carlo simulation

International Nuclear Information System (INIS)

Baležentis, Tomas; Streimikiene, Dalia

2017-01-01

Highlights: • Two advanced optimization models were applied for EU energy policy scenarios development. • Several advanced MCDA were applied for energy policy scenarios ranking: WASPAS, ARAS, TOPSIS. • A Monte Carlo simulation was applied for sensitivity analysis of scenarios ranking. • New policy insights in terms of energy scenarios forecasting were provided based on research conducted. - Abstract: Integrated Assessment Models (IAMs) are omnipresent in energy policy analysis. Even though IAMs can successfully handle uncertainty pertinent to energy planning problems, they render multiple variables as outputs of the modelling. Therefore, policy makers are faced with multiple energy development scenarios and goals. Specifically, technical, environmental, and economic aspects are represented by multiple criteria, which, in turn, are related to conflicting objectives. Preferences of decision makers need to be taken into account in order to facilitate effective energy planning. Multi-criteria decision making (MCDM) tools are relevant in aggregating diverse information and thus comparing alternative energy planning options. The paper aims at ranking European Union (EU) energy development scenarios based on several IAMs with respect to multiple criteria. By doing so, we account for uncertainty surrounding policy priorities outside the IAM. In order to follow a sustainable approach, the ranking of policy options is based on EU energy policy priorities: energy efficiency improvements, increased use of renewables, reduction in and low mitigations costs of GHG emission. The ranking of scenarios is based on the estimates rendered by the two advanced IAMs relying on different approaches, namely TIAM and WITCH. The data are fed into the three MCDM techniques: the method of weighted aggregated sum/product assessment (WASPAS), the Additive Ratio Assessment (ARAS) method, and technique for order preference by similarity to ideal solution (TOPSIS). As MCDM techniques allow

Survivin knockdown increased anti-cancer effects of (-)-epigallocatechin-3-gallate in human malignant neuroblastoma SK-N-BE2 and SH-SY5Y cells

Energy Technology Data Exchange (ETDEWEB)

Hossain, Md. Motarab [Department of Pathology, Microbiology, and Immunology, University of South Carolina School of Medicine, Columbia, SC (United States); Banik, Naren L. [Department of Neurosciences, Medical University of South Carolina, Charleston, SC (United States); Ray, Swapan K., E-mail: swapan.ray@uscmed.sc.edu [Department of Pathology, Microbiology, and Immunology, University of South Carolina School of Medicine, Columbia, SC (United States)

2012-08-01

Neuroblastoma is a solid tumor that mostly occurs in children. Malignant neuroblastomas have poor prognosis because conventional chemotherapeutic agents are hardly effective. Survivin, which is highly expressed in some malignant neuroblastomas, plays a significant role in inhibiting differentiation and apoptosis and promoting cell proliferation, invasion, and angiogenesis. We examined consequences of survivin knockdown by survivin short hairpin RNA (shRNA) plasmid and then treatment with (-)-epigallocatechin-3-gallate (EGCG), a green tea flavonoid, in malignant neuroblastoma cells. Our Western blotting and laser scanning confocal immunofluorescence microscopy showed that survivin was highly expressed in malignant neuroblastoma SK-N-BE2 and SH-SY5Y cell lines and slightly in SK-N-DZ cell line. Expression of survivin was very faint in malignant neuroblastoma IMR32 cell line. We transfected SK-N-BE2 and SH-SY-5Y cells with survivin shRNA, treated with EGCG, and confirmed knockdown of survivin at mRNA and protein levels. Survivin knockdown induced morphological features of neuronal differentiation, as we observed following in situ methylene blue staining. Combination of survivin shRNA and EGCG promoted neuronal differentiation biochemically by increases in the expression of NFP, NSE, and e-cadherin and also decreases in the expression of Notch-1, ID2, hTERT, and PCNA. Our in situ Wright staining and Annexin V-FITC/PI staining showed that combination therapy was highly effective in inducing, respectively, morphological and biochemical features of apoptosis. Apoptosis occurred with activation of caspase-8 and cleavage of Bid to tBid, increase in Bax:Bcl-2 ratio, mitochondrial release of cytochrome c, and increases in the expression and activity of calpain and caspase-3. Combination therapy decreased migration of cells through matrigel and inhibited proliferative (p-Akt and NF-{kappa}B), invasive (MMP-2 and MMP-9), and angiogenic (VEGF and b-FGF) factors. Also, in vitro

Micropores preparation in A3B5 semiconductors

Czech Academy of Sciences Publication Activity Database

Nohavica, Dušan; Gladkov, Petar; Zelinka, Jiří; Jarchovský, Zdeněk

-, mim. číslo (2007), s. 1-16 ISSN 1335-9053. [Development of Materials Science in Research and Education . Tatranská Štrba, 10.09.2007-14.09.2007] R&D Projects: GA ČR GA202/06/1315; GA MŠk ME 834 Institutional research plan: CEZ:AV0Z20670512 Keywords : porous semiconductors * III-V semiconductors * nanoelectronics Subject RIV: BM - Solid Matter Physics ; Magnetism http://www.mtf.stuba.sk/docs//internetovy_casopis/2007/mimorcis/nohavica.pdf

Doppler flowmetry in preeclampsia.

Science.gov (United States)

Zahumensky, J

2009-01-01

The purpose of this study was to summarize the new published data on the Doppler flowmetry in preeclampsia. We summarize the new published data on the Doppler flowmetry in uteroplacental, fetoplacental and fetal circulation in preeclampsia. The present review summarized the results of clinical research on the Doppler flowmetry in the screening of risk of preclampsia, in the diagnosis of preclampsia and in the fetal risk in preclampsia (Ref. 19). Full Text (Free, PDF) www.bmj.sk.

A Portal to Dutch Academic Heritage: www.academischecollecties.nl

Directory of Open Access Journals (Sweden)

Henriette Reerink

2013-01-01

Full Text Available The UNICUM development project, commissioned by the Dutch Academic Heritage Foundation Stichting Academisch Erfgoed (SAE, has been carried out by the five classic Dutch universities in 2010– 2012. UNICUM, short for ‘University Collections and University Museums’, has received a national government grant to create a digital portal to Dutch academic heritage. The portal, which can be reached via www.academischecollecties.nl, presents both academic archives and museum and library collections. Images, collection metadata and items can be found on one site. The UNICUM idea is inspired by the Online Archive of California. The project is important because it crosses the traditional sector boundaries between museums, libraries and archives, it creates awareness of the opportunities which this cross-sectoral approach offers, and it retains the context of – and the relation between – objects within collections as a whole. Moreover, the joint effort brings to light the importance of creating metadata according to international standards to stimulate re-use and exchange of content. In addition, UNICUM intended to be a technical project in which multi-level descriptions are presented and can be browsed in a structured way (collections linked to objects, and archives linked to separate documents. Now the project is finished, the focus will shift to generating content.

KONSEP TALAK: Versus Situs www. darussalaf.or.id dan Undang- Undang Perkawinan di Indonesia

Directory of Open Access Journals (Sweden)

Sheila Fakhria

2016-05-01

baligh, berakal, mumayyiz yang mengerti dengan apa yang dilakukan. Selain itu, situs ini juga menjelaskan bahwa seorang istri tidak diperkenankan meminta cerai tanpa alasan yang syar’i, sebaliknya seorang istri diperbolehkan meminta untuk berpisah dengan suaminya dengan alasan syar’i diantaranya jika dia membenci kejelekan akhlak, agama, atau fisik suaminya, serta khawatir tidak mampu menegakkan hak-hak suaminya yang wajib ditunaikannya ketika hidup bersamanya. Oleh karena itu perlu dikaji tentang sejauh mana relevansi konsep keabsahan talak antara situs www.darussalaf.or.id dan undang-undang perkawinan di Indonesia.

Anatomical constraints on visualization of the human hippocampus using echo-planar imaging

International Nuclear Information System (INIS)

Asano, Shuichiro; Kirino, Takaaki; Mihara, Ban; Sugishita, Morihiro

2004-01-01

Reliable visualization of the hippocampus on echo-planar imaging (EPI) is essential in analyzing memory function using functional magnetic resonance imaging. However, the hippocampal area is notoriously prone to susceptibility artifacts caused by structures at the skull base, and avoiding such artifacts by appropriately selecting the subjects for a study is of practical importance. To elucidate factors affecting the extent of the artifacts we obtained EPI in a total of 62 hippocampi from 31 healthy volunteers and evaluated various anatomical measurements possibly associated with the quality of the images. The hippocampal head was sufficiently well demonstrated on 40 of 62 images (65%), and there were two parameters that significantly differed between the good (n=40) and poor (n=22) imaging studies: The vertical diameter (DV) of the opening of the internal acoustic meatus (IAM) and the pneumatization rate of the sphenoid sinus (RP-SS). From logistic regression analysis with the stepwise method, in addition to these two factors, the distance between the hippocampal body and IAM (Dhippo-IAM) and the distance between the hippocampal head and the middle cranial fossa at the skull base (Dhippo-base) were extracted. DV-IAM, RP-SS, and Dhippo-base were negatively correlated with the good imaging of the hippocampal head. On the other hand, Dhippo-IAM was positively correlated. These easily measurable parameters will be helpful in selecting subjects and in increasing the efficiency of hippocampal visualization in studies on human memory function. (orig.)

Comparison of microscopic and endoscopic view of the internal acoustic meatus: A cadaveric study.

Science.gov (United States)

Montibeller, Guilherme Ramina; Hendrix, Philipp; Fries, Fabian N; Becker, Kurt W; Oertel, Joachim

2018-04-01

The endoscope is thought to provide an improved exposure of the internal acoustic meatus after retrosigmoid craniotomy for microsurgical resection of intrameatal tumors. The aim of this study is to quantify the differences in internal acoustic meatus (IAM) exposure comparing microscopic and endoscopic visualization. A retrosigmoid approach was performed on 5 cadaver heads. A millimeter gauge was introduced into the internal acoustic meatus, and examinations with a surgical microscope and 0°, 30° and 70° rigid endoscopes were performed. The extent of IAM depth visualized with the microscope and the different angled endoscopes were analyzed. The microscopic view allowed an average IAM depth visualization of 2.8 mm. The endoscope allowed an improved exposure of IAM in all cases. The 0°, 30° and 70° endoscopes permitted an exposure that was respectively 96% (5.5 mm), 139% (6.7 mm) and 200% (8.4 mm) more lateral than the microscopic view. Angled optics, however, provided an image distortion, specifically the 70° endoscope. The endoscope provides a superior visualization of the IAM compared to the microscope when using a retrosigmoid approach. The 30° endoscope represented an ideal compromise of superior visualization with marginal image distortion. Additional implementation of the endoscope into microsurgery of intrameatal tumors likely facilitates complete tumor removal and might spare facial and vestibulocochlear function. Clin. Anat. 31:398-403, 2018. © 2017 Wiley Periodicals, Inc. © 2017 Wiley Periodicals, Inc.

Performance Analysis of Heterodyne-Detected OCDMA Systems Using PolSK Modulation over a Free-Space Optical Turbulence Channel

Directory of Open Access Journals (Sweden)

Fan Bai

2015-10-01

Full Text Available This paper presents a novel model of heterodyne-detected optical code-division multiple-access (OCDMA systems employing polarization shift keying (PolSK modulation over a free-space optical (FSO turbulence channel. In this article, a new transceiver configuration and detailed analytical model for the proposed system are provided and discussed, taking into consideration the potential of heterodyne detection on mitigating the impact of turbulence-induced irradiance fluctuation on the performance of the proposed system under the gamma-gamma turbulence channel. Furthermore, we derived the closed-form expressions for the system error probability and outage probability, respectively. We determine the advantages of the proposed modeling by performing a comparison with a direct detection scheme obtained from an evaluation of link performance under the same environment conditions. The presented work also shows the most significant impact factor that degrades the performance of the proposed system and indicates that the proposed approach offers an optimum link performance compared to conventional cases.

Zasady prezentacji składników pozostałego wyniku całościowego – praktykasprawozdawcza spółek należących do WIG 30 oraz DAX w latach 2012–2013 

Directory of Open Access Journals (Sweden)

Jacek Gad

2015-04-01

Full Text Available Celem artykułu jest wskazanie wpływu nowelizacji MSR 1 z roku 2012 na prezentację składników pozostałego wyniku całościowego przez spółki należące do indeksów WIG 30 oraz DAX. Część teoretyczną artykułu opracowano z wykorzystaniem studiów literatury krajowej i zagranicznej. Część empiryczną opracowano na podstawie informacji prezentowanych w raportach rocznych spółek z warszawskiego indeksu WIG 30 oraz niemieckiego indeksu DAX. Na przestrzeni lat 2012–2013 zmieniła się forma prezentacji składników pozostałego wyniku całościowego. Dotyczy to zarówno spółek z indeksu WIG 30, jak i DAX. Zidentyfikowano cztery główne warianty prezentacji składników pozostałego wyniku całościowego. Zdaniem autora kolejne warianty charakteryzują się rosnącą przejrzystością informacyjną sprawozdania z pozostałego wyniku całościowego. Praktyka sprawozdawcza spółek z indeksu DAX wyprzedza praktykę sprawozdawczą spółek z indeksu WIG 30. Do analizy uzyskanych wyników wykorzystano następujące statystyki opisowe: średnią arytmetyczną, odchylenie standardowe, medianę, percentyle. W ramach badania wykorzystano także wskaźnik podobieństwa struktur.

[Roman Czaja. Die Anfänge preussischer Hansestädte im Lichte der historischen und archäologischen quellen : Danzig/Gdańsk, Elbing/Elbląg, Thorn/Toruń] / Dennis Hormuth

Index Scriptorium Estoniae

Hormuth, Dennis

2013-01-01

Arvustus : Roman Czaja. Die Anfänge preussischer Hansestädte im Lichte der historischen und archäologischen quellen : Danzig/Gdańsk, Elbing/Elbląg, Thorn/Toruń. In: Stadtgründung und Stadterweiterung. Beiträge von Archäologie und Stadtgeschichtsforschung. (=Beiträge zur Geschichte der Städte Mitteleuropas XXII). LInz, 2011. S. 59-74

Agrin-LRP4-MuSK signaling as a therapeutic target for myasthenia gravis and other neuromuscular disorders.

Science.gov (United States)

Ohno, Kinji; Ohkawara, Bisei; Ito, Mikako

2017-10-01

Signal transduction at the neuromuscular junction (NMJ) is compromised in a diverse array of diseases including myasthenia gravis, Lambert-Eaton myasthenic syndrome, Isaacs' syndrome, congenital myasthenic syndromes, Fukuyama-type congenital muscular dystrophy, amyotrophic lateral sclerosis, and sarcopenia. Except for sarcopenia, all are orphan diseases. In addition, the NMJ signal transduction is impaired by tetanus, botulinum, curare, α-bungarotoxin, conotoxins, organophosphate, sarin, VX, and soman to name a few. Areas covered: This review covers the agrin-LRP4-MuSK signaling pathway, which drives clustering of acetylcholine receptors (AChRs) and ensures efficient signal transduction at the NMJ. We also address diseases caused by autoantibodies against the NMJ molecules and by germline mutations in genes encoding the NMJ molecules. Expert opinion: Representative small compounds to treat the defective NMJ signal transduction are cholinesterase inhibitors, which exert their effects by increasing the amount of acetylcholine at the synaptic space. Another possible therapeutic strategy to enhance the NMJ signal transduction is to increase the number of AChRs, but no currently available drug has this functionality.

Antiproliferative effects of Plumbago rosea and its purified constituent plumbagin on SK-MEL 28 melanoma cell lines.

Science.gov (United States)

Anuf, Alexander Ronaldo; Ramachandran, Rajesh; Krishnasamy, Rajaram; Gandhi, P S Sudhakar; Periyasamy, Sureshkumar

2014-10-01

Plumbago rosea is used in traditional systems of medicine for the preparation of formulations used for treating inflammations, cough, bronchitis, and gastrointestinal disorders, and also in conjunction with cancer chemotherapy. In the present study, the cytotoxic and anti-proliferative effects of plumbagin, and the ethanolic root extract of P. rosea (ETPR) was evaluated on SK-MEL 28 melanoma cell lines and human lymphocytes. MTT and apoptotic assays were used for the evaluation of cytotoxic and anti-proliferative effects, respectively. In addition, the effect of Plumbagin and ETPR in down regulation of BCL-2 expression is investigated using RT-PCR analysis. Both plumbagin and ETPR dose-dependently decreased the cell viability more potently in melanoma cell lines. P. rosea extract demonstrated significant synergy in inhibiting BCL-2 expression than plumbagin. Moreover plumbagin showed more toxicity in human lymphocytes. Plumbagin has anti-cancer potential, but the side effects limits its use; yet plumbagin, in combination with other ingredients in Plumbago rosea extract, displays significant synergy leading to a stronger anticancer effect with significantly less toxicity.

Volcanic history and petrography of the Pliocene Etrüsk Stratovolcano, E Turkey

Science.gov (United States)

Oyan, Vural; Keskin, Mehmet; Lebedev, Vladimir; Sharkov, Evgenii; Lustrino, Michele; Mattioli, Michele

2010-05-01

The Pliocene Etrusk volcano, with its 3100 m elevation and ~500 km2 area, is one of the major centers of the collision-related volcanism in E Anatolia. It is located in the northeast of Lake Van, sitting almost on the culmination of the "Lake Van dome" structure forming the vertex of the eastern Turkish high plateau (Sengor et al., 2008). A ~5-km-wide horseshoe-shaped caldera, open to the south, is located in the center of the volcano. Apart from two trace element analyses and two K/Ar dates, there are virtually no data available in the literature on this major eruption center. Our study intends to fill this gap with a detailed petrographical, geochemical and geochronological study. Our new K/Ar age determinations indicate that the main volcanic edifice of the Etrusk volcano was formed in period between 4.3 and 3.9 Ma, with the eruption of several intermediate to acid lavas from a central vent. This phase ended up with the formation of a small collapse caldera that produced pyroclastic material emplaced on the earlier lavas. The final impulse of the volcano activity from the Etrusk volcanic center was the eruption of a post-caldera rhyolitic lava flow from the southern flank of the volcano (~3.8-3.7 Ma). After about 2.7 Myr of magmatic quiescence, during the Quaternary time between ~1 and 0.43 Ma, basalts erupted from the SW flank of the Etrusk volcano. They were generated predominantly from a ~N-S extending fissure, as well as from a scoria cone (Karniyarik hill) and a maar-shaped volcanic center (i.e. Düzgeyikçukuru). Edifice-forming products of the Etrüsk stratovolcano are represented by sanidine-plagioclase-biotite-clinopyroxene-phyric trachytes and plagioclase-clinopyroxene-orthopyroxene-phyric trachyandesites containing sporadic olivine phenocrysts. K-feldspar is the most abundant mineral phase in trachitic lavas of the Etrüsk volcanic system. Post caldera lavas, on the other hand, have relatively more evolved compositions ranging from trachydacite to

State environmental reports of the Slovak Republic on Internet

International Nuclear Information System (INIS)

Kanianska, R.; Fabricius, A.; Marcinatova, L.

2005-01-01

The Slovak Environmental Agency under supervision of the Ministry of Environment of the Slovak Republic (SR) prepare yearly different types of reports with evaluation of state of environment of the Slovak Republic on the basis of verified statistical data which come from records of Statistical Office of the SR, Ministry of Environment of the SR, professional organisation of departments of environment, as well as from data bases of others central executive administration and their special organisations. Single report varies by form, content, structure and scope, for which were designed. They made available for public on the internet web-site http://www.enviroportal.sk/, eventually on the web-site of the Slovak Environmental Agency http://www.sazp.sk/. The following types of reports are published by the Slovak Environmental Agency: State of the Environment Reports of the Slovak Republic; State of the Environment Reports according to the D-P-S-I-R structure (where (Pressure - P, State - S, (Response - R, Driven forces - D, and Impact - I, indicators of the OECD); Report about impacts of economic sectors on the environment of the SR; Sustainable development indicators of the SR on national level. The form of presentation of individual indicators makes it possible to obtain information about present state, trends and fixing of these problems in strategic documents with possibility of their international comparison and access to relevant information on Internet

Aqua/Aura Updated Inclination Adjust Maneuver Performance Prediction Model

Science.gov (United States)

Boone, Spencer

2017-01-01

This presentation will discuss the updated Inclination Adjust Maneuver (IAM) performance prediction model that was developed for Aqua and Aura following the 2017 IAM series. This updated model uses statistical regression methods to identify potential long-term trends in maneuver parameters, yielding improved predictions when re-planning past maneuvers. The presentation has been reviewed and approved by Eric Moyer, ESMO Deputy Project Manager.

Business analysis: The commercial mission of the International Asteroid Mission

Science.gov (United States)

The mission of the International Asteroid Mission (IAM) is providing asteroidal resources to support activities in space. The short term goal is to initiate IAM by mining a near-Earth, hydrous carbonaceous chondrite asteroid to service the nearer-term market of providing cryogenic rocket fuel in low lunar orbit (LLO). The IAM will develop and contract for the building of the transportation vehicles and equipment necessary for this undertaking. The long-term goal is to expand operations by exploiting asteroids in other manners, as these options become commercially viable. The primary business issues are what revenue can be generated from the baseline mission, how much will the mission cost, and how funding for this mission can be raised. These issues are addressed.

Definitive Endoderm Formation from Plucked Human Hair-Derived Induced Pluripotent Stem Cells and SK Channel Regulation

Directory of Open Access Journals (Sweden)

Anett Illing

2013-01-01

Full Text Available Pluripotent stem cells present an extraordinary powerful tool to investigate embryonic development in humans. Essentially, they provide a unique platform for dissecting the distinct mechanisms underlying pluripotency and subsequent lineage commitment. Modest information currently exists about the expression and the role of ion channels during human embryogenesis, organ development, and cell fate determination. Of note, small and intermediate conductance, calcium-activated potassium channels have been reported to modify stem cell behaviour and differentiation. These channels are broadly expressed throughout human tissues and are involved in various cellular processes, such as the after-hyperpolarization in excitable cells, and also in differentiation processes. To this end, human induced pluripotent stem cells (hiPSCs generated from plucked human hair keratinocytes have been exploited in vitro to recapitulate endoderm formation and, concomitantly, used to map the expression of the SK channel (SKCa subtypes over time. Thus, we report the successful generation of definitive endoderm from hiPSCs of ectodermal origin using a highly reproducible and robust differentiation system. Furthermore, we provide the first evidence that SKCas subtypes are dynamically regulated in the transition from a pluripotent stem cell to a more lineage restricted, endodermal progeny.

2018-03-21T13:09:49Z https://www.ajol.info/index.php/all/oai oai:ojs ...

African Journals Online (AJOL)

Abdu, SB Hassan, MR Adamu, HY Yashim, SM Oketona, GF Buck, digestibility, Gmelina arborea, maize cobs, red Sokoto bucks An experiment was conducted to ... info:eu-repo/semantics/publishedVersion Peer-reviewed Article application/pdf https://www.ajol.info/index.php/tjas/article/view/94039 Nigerian Journal of ...

The TeleTOP Implementation Model: Establishing the use of a WWW-based course-management system in a university

NARCIS (Netherlands)

de Boer, Willem; Collis, Betty

2001-01-01

The process that accompanies the decision to make an institutional commitment to new ways of teaching and learning supported by a WWW-based course management system is complex. Such a process is underway in the Faculty of Educational Science and Technology at the University of Twente in the

‘Close to the city centre, close to the university’. Are there symptoms of studentification in Gdańsk, Poland?

Directory of Open Access Journals (Sweden)

Grabkowska Maja

2016-06-01

Full Text Available Students are increasingly recognised as important actors of urban change in contemporary cities. The article presents an analysis of incipient studentification processes in Gdańsk. Its general aim is to reveal patterns of students’ presence and activity which translate into spatial and socio-economic transformations of a post-socialist city at the level of neighbourhoods. The study consists of a survey on students’ residential behaviour, complemented by field and desk research. According to the results, due to the fact that Polish students’ housing and lifestyle choices are limited by their low purchasing power, student-dedicated services have a rather negative impact on the quality of urban space. Furthermore, under these conditions studentification may not be regarded as a stimulus to the gentrification process, which is rather driven by hipsters and affluent foreign students.

Cultural Identity of Citizens of Gdańsk from an Ethnolinguistic Perspective on the Basis of Chosen Texts of the Free City of Danzig

Directory of Open Access Journals (Sweden)

Izabela Olszewska

2015-06-01

Full Text Available Cultural Identity of Citizens of Gdańsk from an Ethnolinguistic Perspective on the Basis of Chosen Texts of the Free City of Danzig As a consequence of the First World War and in the wake of the Treaty of Versailles the Free City of Danzig was established. The image of Danzig identity was created, first of all, by the following ethnic groups: German, Polish and Jewish. Was the Free City of Danzig multicultural or was it German with Polish and Jewish minorities? Did those nationalities live beside each other, did they together, as citizens of Danzig, create a common reality? Is it possible to talk about a uniform culture/identity of Danzig? The aim of this article is an analysis of linguistic image of the world of the citizens of the Free City of Danzig, which has been carried out on the basis of characteristics of the image of relations and cultural differences in the interpretation of Polish community. Yet, the whole image of identity consists of a mosaic of smaller interpretations which, only after being reduced to the lowest common denominator, may give the holistic image of Danzig identity as an image of a common multiple subjectivity. Mutual perception of nationalities inhabiting the area of the Free City of Danzig is the starting point for the discussion on their identity and an attempt to answer the question: did the citizens of Danzig see themselves as one community – exactly the one of Danzig? The analysed research material consists of chosen texts of the local press (in Polish and occasionally in German concerning socio-cultural and political and informative issues. The Polish "Gazeta Gdańska" had been published since 1891 as the first Polish Danzig newspaper in Polish. Its first aim was to integrate Polish circles and to defend the rights of the Polish. "Danziger Neuesten Nachrichten", published since 1894, was the biggest Danzig conservative newspaper in German which influenced public opinion. In the analysis of the linguistic

Joint Polish–Finnish sampling of surface waters around the phosphogypsum waste stacks in Gdańsk and Police from 1 to 3 July 2013 – Results of the expedition

OpenAIRE

Räike, Antti; Koskela, Jarkko; Knuuttila, Seppo; Lehtoranta, Jouni; Pitkänen, Heikki; Risto, Maarit; Vuorinen, Jyrki

2015-01-01

The report describes the results of the joint Polish–Finnish sampling expedition aimed at estimating the possible effects of the two Polish phosphogypsum stacks located in Wislinka (Gdańsk) and Police on the loading of the Baltic Sea and the nearby watercourses. The joint expedition was based on the agreement between the Polish and Finnish Ministers of the Environment in June 2013. The results indicate a clear effect of the phosphogypsum stack on phosphate and total phosphorus concentratio...

Monohalogenated acetamide-induced cellular stress and genotoxicity are related to electrophilic softness and thiol/thiolate reactivity.

Science.gov (United States)

Pals, Justin A; Wagner, Elizabeth D; Plewa, Michael J; Xia, Menghang; Attene-Ramos, Matias S

2017-08-01

Haloacetamides (HAMs) are cytotoxic, genotoxic, and mutagenic byproducts of drinking water disinfection. They are soft electrophilic compounds that form covalent bonds with the free thiol/thiolate in cysteine residues through an S N 2 reaction mechanism. Toxicity of the monohalogenated HAMs (iodoacetamide, IAM; bromoacetamide, BAM; or chloroacetamide, CAM) varied depending on the halogen substituent. The aim of this research was to investigate how the halogen atom affects the reactivity and toxicological properties of HAMs, measured as induction of oxidative/electrophilic stress response and genotoxicity. Additionally, we wanted to determine how well in silico estimates of electrophilic softness matched thiol/thiolate reactivity and in vitro toxicological endpoints. Each of the HAMs significantly induced nuclear Rad51 accumulation and ARE signaling activity compared to a negative control. The rank order of effect was IAM>BAM>CAM for Rad51, and BAM≈IAM>CAM for ARE. In general, electrophilic softness and in chemico thiol/thiolate reactivity provided a qualitative indicator of toxicity, as the softer electrophiles IAM and BAM were more thiol/thiolate reactive and were more toxic than CAM. Copyright © 2017. Published by Elsevier B.V.

SAGE III on ISS Lessons Learned on Thermal Interface Design

Science.gov (United States)

Davis, Warren

2015-01-01

The Stratospheric Aerosol and Gas Experiment III (SAGE III) instrument - the fifth in a series of instruments developed for monitoring vertical distribution of aerosols, ozone, and other trace gases in the Earth's stratosphere and troposphere - is currently scheduled for delivery to the International Space Station (ISS) via the SpaceX Dragon vehicle in 2016. The Instrument Adapter Module (IAM), one of many SAGE III subsystems, continuously dissipates a considerable amount of thermal energy during mission operations. Although a portion of this energy is transferred via its large radiator surface area, the majority must be conductively transferred to the ExPRESS Payload Adapter (ExPA) to satisfy thermal mitigation requirements. The baseline IAM-ExPA mechanical interface did not afford the thermal conductance necessary to prevent the IAM from overheating in hot on-orbit cases, and high interfacial conductance was difficult to achieve given the large span between mechanical fasteners, less than stringent flatness specifications, and material usage constraints due to strict contamination requirements. This paper will examine the evolution of the IAM-ExPA thermal interface over the course of three design iterations and will include discussion on design challenges, material selection, testing successes and failures, and lessons learned.

Trudności terapeutyczne u pacjenta z ciężką postacią młodzieńczego zapalenia skórno-mięśniowego powikłanego uogólnioną wapnicą

Directory of Open Access Journals (Sweden)

Joanna Szymańska-Kałuża

2011-08-01

Full Text Available Młodzieńcze zapalenie skórno-mięśniowe (MZSM to najczęstszaidiopatyczna miopatia zapalna wieku dziecięcego. Do charakterystycznychobjawów tej choroby należą: osłabienie mięśni, głównieobręczy barkowej lub biodrowej, oraz zmiany skórne w postaciobrzęku twarzy, heliotropowego zabarwienia powiek, zmian plamisto-rumieniowych na twarzy i klatce piersiowej. W badaniachlaboratoryjnych typowe dla MZSM są podwyższone wskaźnikiostrej fazy, wysoka aktywność enzymów mięśniowych (aminotransferaz,kinazy kreatynowej oraz dehydrogenazy mleczanowej,a także czasami obecność przeciwciał anty-Jo1. Badanie elektromiograficznewykazuje cechy pierwotnego uszkodzenia mięśni,a w obrazie histopatologicznym wycinka skórno-mięśniowegoodnotowuje się nacieki zapalne. U dzieci często obserwowane sątakże ogniska zwapnień w tkankach miękkich, prowadzące doatrofii mięśni i przykurczów stawowych.Leczeniem I rzutu u pacjentów z MZSM są glikokortykosteroidy,w przypadku nieskuteczności tej terapii stosuje się leki immunosupresyjnelub leki biologiczne, w tym immunoglobuliny.W pracy przedstawiono przypadek pacjenta z ciężkim przebiegiemMZSM powikłanego wapnicą, z uwzględnieniem objawów klinicznychi możliwości leczenia. Omówiono również trudności w doborzenajskuteczniejszej farmakoterapii dla tego pacjenta. U chorego– obecnie 14-letniego chłopca – występowały uogólnione zmianyskórne oraz bardzo gwałtownie narastające liczne złogi soli wapniaw skórze, tkance podskórnej, powięziach i mięśniach, które pojawiły się po 3 latach od wystąpienia pierwszych objawów chorobowych(ryc. 1–8. U chłopca z powodu wybitnie ciężkiego przebieguchoroby prowadzono agresywną konwencjonalną terapię(glikokortykosteroidy, metotreksat, cyklosporyna, pamidronian,która nie przynosiła zadowalających rezultatów i poprawy stanuklinicznego. Na podstawie doniesień z piśmiennictwa światowegopodjęto próbę leczenia

The WWW as a research medium: an illustrative survey on paranormal belief.

Science.gov (United States)

Göritz, A S; Schumacher, J

2000-06-01

Data collected with a short World Wide Web (WWW) survey on paranormal belief, age, sex, locus of control, extraversion, emotional and physical well-being, and mood were compared with findings from recent literature while controlling for effects of self-selection. Each variable was measured with one item. The sample comprised 342 women, 648 men, and 8 participants of unknown sex, of whom 76.7% were self-selected and 23.3% did not select themselves. There was a weak but, given the large sample, significant effect of self-selection regarding paranormal belief (rpb 932 = .08) but no relationships for paranormal belief and the examined variables. In the entire sample, statistically significant correlations ranging from .13 to .07 between paranormal belief and female sex, scores on external locus of control, good mood, extraversion, and emotional well-being corresponded with previous offline results.

Webs on the Web (WOW): 3D visualization of ecological networks on the WWW for collaborative research and education

Science.gov (United States)

Yoon, Ilmi; Williams, Rich; Levine, Eli; Yoon, Sanghyuk; Dunne, Jennifer; Martinez, Neo

2004-06-01

This paper describes information technology being developed to improve the quality, sophistication, accessibility, and pedagogical simplicity of ecological network data, analysis, and visualization. We present designs for a WWW demonstration/prototype web site that provides database, analysis, and visualization tools for research and education related to food web research. Our early experience with a prototype 3D ecological network visualization guides our design of a more flexible architecture design. 3D visualization algorithms include variable node and link sizes, placements according to node connectivity and tropic levels, and visualization of other node and link properties in food web data. The flexible architecture includes an XML application design, FoodWebML, and pipelining of computational components. Based on users" choices of data and visualization options, the WWW prototype site will connect to an XML database (Xindice) and return the visualization in VRML format for browsing and further interactions.

Evaluation of integrated assessment model hindcast experiments: a case study of the GCAM 3.0 land use module

Science.gov (United States)

Snyder, Abigail C.; Link, Robert P.; Calvin, Katherine V.

2017-11-01

Hindcasting experiments (conducting a model forecast for a time period in which observational data are available) are being undertaken increasingly often by the integrated assessment model (IAM) community, across many scales of models. When they are undertaken, the results are often evaluated using global aggregates or otherwise highly aggregated skill scores that mask deficiencies. We select a set of deviation-based measures that can be applied on different spatial scales (regional versus global) to make evaluating the large number of variable-region combinations in IAMs more tractable. We also identify performance benchmarks for these measures, based on the statistics of the observational dataset, that allow a model to be evaluated in absolute terms rather than relative to the performance of other models at similar tasks. An ideal evaluation method for hindcast experiments in IAMs would feature both absolute measures for evaluation of a single experiment for a single model and relative measures to compare the results of multiple experiments for a single model or the same experiment repeated across multiple models, such as in community intercomparison studies. The performance benchmarks highlight the use of this scheme for model evaluation in absolute terms, providing information about the reasons a model may perform poorly on a given measure and therefore identifying opportunities for improvement. To demonstrate the use of and types of results possible with the evaluation method, the measures are applied to the results of a past hindcast experiment focusing on land allocation in the Global Change Assessment Model (GCAM) version 3.0. The question of how to more holistically evaluate models as complex as IAMs is an area for future research. We find quantitative evidence that global aggregates alone are not sufficient for evaluating IAMs that require global supply to equal global demand at each time period, such as GCAM. The results of this work indicate it is

Acceptance of the German e-mental health portal www.psychenet.de: an online survey

Directory of Open Access Journals (Sweden)

Lisa Tlach

2016-07-01

Full Text Available Background. Taking into account the high prevalence of mental disorders and the multiple barriers to the use of mental health services, new forms of fostering patient information, involvement, and self-management are needed to complement existing mental health services. The study aimed at investigating acceptance regarding design and content of the e-mental health portal www.psychenet.de. Methods. An online cross-sectional survey was conducted between May 2013 and May 2015 using a self-administered questionnaire including items on perceived ease of use, perceived usefulness, attitude towards using, and perceived trust. Effects of different participants’ characteristics on the portals’ acceptance were analyzed. Results. The majority of the N = 252 respondents suffered from mental disorders (n = 139 or were relatives from persons with mental disorders (n = 65. The portal was assessed as “good” or “very good” by 71% of the respondents. High levels of agreement (89–96% were shown for statements on the perceived ease of use, the behavioral intention to use the portal, and the trustworthiness of the portal. Lower levels of agreement were shown for some statements on the perceived usefulness of the portals’ content. There were no effects of different participants’ characteristics on the perceived ease of use, the perceived usefulness, the attitude towards using the website and the perceived trust. Discussion. This survey provides preliminary evidence that the e-mental health portal www.psychenet.de appears to be a usable, useful and trustworthy information resource for a broad target group. The behavioral usefulness of the portals’ content might be improved by integrating more activating patient decision aids.

Metallothionein provides zinc-mediated protective effects against methamphetamine toxicity in SK-N-SH cells.

Science.gov (United States)

Ajjimaporn, Amornpan; Swinscoe, John; Shavali, Shaik; Govitrapong, Piyarat; Ebadi, Manuchair

2005-11-30

Methamphetamine (METH) is a drug of abuse and neurotoxin that induces Parkinson's-like pathology after chronic usage by targeting dopaminergic neurons. Elucidation of the intracellular mechanisms that underlie METH-induced dopaminergic neuron toxicity may help in understanding the mechanism by which neurons die in Parkinson's disease. In the present study, we examined the role of reactive oxygen species (ROS) in the METH-induced death of human dopaminergic SK-N-SH cells and further assessed the neuroprotective effects of zinc and metallothionein (MT) against METH-induced toxicity in culture. METH significantly increased the production of reactive oxygen species, decreased intracellular ATP levels and reduced the cell viability. Pre-treatment with zinc markedly prevented the loss of cell viability caused by METH treatment. Zinc pre-treatment mainly increased the expression of metallothionein and prevented the generation of reactive oxygen species and ATP depletion caused by METH. Chelation of zinc by CaEDTA caused a significant decrease in MT expression and loss of protective effects of MT against METH toxicity. These results suggest that zinc-induced MT expression protects dopaminergic neurons via preventing the accumulation of toxic reactive oxygen species and halting the decrease in ATP levels. Furthermore, MT may prevent the loss of mitochondrial functions caused by neurotoxins. In conclusion, our study suggests that MT, a potent scavenger of free radicals is neuroprotective against dopaminergic toxicity in conditions such as drug of abuse and in Parkinson's disease.

Podnikatelský plán lyžařské školy na Klínovci

OpenAIRE

Ketner, Robert

2016-01-01

The goal of the thesis is a business plan that will be used for presentation to shareholders in the company Skiareál Klínovec, s. r. o. and later for communication with the external environment. Content of business plan is marketing, operational and financial plan, personal plan and management organization of the proposed company. Powered by TCPDF (www.tcpdf.org)

Network Biology (http://www.iaees.org/publications/journals/nb/online-version.asp

Directory of Open Access Journals (Sweden)

networkbiology@iaees.org

Full Text Available Network Biology ISSN 2220-8879 URL: http://www.iaees.org/publications/journals/nb/online-version.asp RSS: http://www.iaees.org/publications/journals/nb/rss.xml E-mail: networkbiology@iaees.org Editor-in-Chief: WenJun Zhang Aims and Scope NETWORK BIOLOGY (ISSN 2220-8879; CODEN NBEICS is an open access, peer-reviewed international journal that considers scientific articles in all different areas of network biology. It is the transactions of the International Society of Network Biology. It dedicates to the latest advances in network biology. The goal of this journal is to keep a record of the state-of-the-art research and promote the research work in these fast moving areas. The topics to be covered by Network Biology include, but are not limited to: •Theories, algorithms and programs of network analysis •Innovations and applications of biological networks •Ecological networks, food webs and natural equilibrium •Co-evolution, co-extinction, biodiversity conservation •Metabolic networks, protein-protein interaction networks, biochemical reaction networks, gene networks, transcriptional regulatory networks, cell cycle networks, phylogenetic networks, network motifs •Physiological networks •Network regulation of metabolic processes, human diseases and ecological systems •Social networks, epidemiological networks •System complexity, self-organized systems, emergence of biological systems, agent-based modeling, individual-based modeling, neural network modeling, and other network-based modeling, etc. We are also interested in short communications that clearly address a specific issue or completely present a new ecological network, food web, or metabolic or gene network, etc. Authors can submit their works to the email box of this journal, networkbiology@iaees.org. All manuscripts submitted to this journal must be previously unpublished and may not be considered for publication elsewhere at any time during review period of this journal

A Worldwide Web-portal for Aquatic Mesocosm Facilities: WWW.MESOCOSM.EU

Science.gov (United States)

Berger, S. A.; Nejstgaard, J. C.

2016-02-01

Experimental mesocosms are valuable tools to fill the gap between highly controlled/replicated lab experiments and uncontrolled/non-replicated natural environments such as rivers, lakes and oceans. WWW.MESOCOSM.EU is an open web-portal for leading aquatic mesocosm facilities around the world. It was created within the FP7 EU-project MESOAQUA (A network of leading MESOcosm facilities to advance the studies of future AQUAtic ecosystems from the Arctic to the Mediterranean). The goal of the portal is to increase international knowledge about existing mesocosm facilities, including information on locations, environment, equipment, contacts, research opportunities and mesocosm-based publications. MESOCOSM.EU specifically aims to be a tool to enhance the quality of research by facilitating international cooperative network building, announcement of new research initiatives, transfer of best practice, and dissemination of knowledge, public information and press releases. As an open platform for all aquatic ecosystem scale science (marine and freshwater), MESOCOSM.EU aims to fill the lack of a centralized, coordinating virtual infrastructure for international aquatic mesocosm research, from the mountains to the ocean and from polar to tropical regions.

Identification and characterization of putative conserved IAM ...

African Journals Online (AJOL)

Available putative AMI sequences from a wide array of monocot and dicot plants were identified and the phylogenetic tree was constructed and analyzed. We identified in this tree, a clade that contained sequences from species across the plant kingdom suggesting that AMI is conserved and may have a primary role in plant ...

Identification and characterization of putative conserved IAM ...

African Journals Online (AJOL)

aghomotsegin

2015-01-07

Jan 7, 2015 ... methods used to construct phylogenetic trees. Maximum likelihood method implemented in the PhyML program (v3.0 aLRT) (Guindon and Gascuel, 2003) was used to reconstruct the tree. Due to simplicity as well as accuracy and speed, PhyML has been widely used (>2500 citations in ISI Web of Science) ...

Seeds in Chernobyl: the database on proteome response on radioactive environment

Science.gov (United States)

Klubicová, Katarína; Vesel, Martin; Rashydov, Namik M.; Hajduch, Martin

2012-01-01

Two serious nuclear accidents during the last quarter century (Chernobyl, 1986 and Fukushima, 2011) contaminated large agricultural areas with radioactivity. The database “Seeds in Chernobyl” (http://www.chernobylproteomics.sav.sk) contains the information about the abundances of hundreds of proteins from on-going investigation of mature and developing seed harvested from plants grown in radioactive Chernobyl area. This database provides a useful source of information concerning the response of the seed proteome to permanently increased level of ionizing radiation in a user-friendly format. PMID:23087698

Problematika předpovědi výroby elektrické energie z fotovoltaických farem

Czech Academy of Sciences Publication Activity Database

Pelikán, Emil; Juruš, Pavel

-, č. 2 (2010), s. 47-49 ISSN 1338-0524 R&D Projects: GA ČR GA205/09/1079 Grant - others:GA AV ČR(CZ) M100300904 Institutional research plan: CEZ:AV0Z10300504 Keywords : fotovoltaická energie * predikční metody * krátkodobá předpověď * numerický model počasí Subject RIV: JE - Non-nuclear Energetics, Energy Consumption ; Use http://www.solartechnika.sk/solartechnika-22010/problematika-predpovedi-vyroby-elektricke-energie-z-fotovoltaickych-farem.html

A description of spatial data infrastructure stakeholders in Ghana using the ICA model

CSIR Research Space (South Africa)

Owusu-Banahene, W

2013-11-01

Full Text Available Service, the Electoral Commission and the Ghana Meteorological Services Department. Some private companies, such as Rudan Engineering and GeoTech, were involved in NAFGIM as contractors or agents who worked for the Survey Department. As shown in Table...://www.gisdevelopment.net/proceedings/gisdeco/2004/keynote/ezipf.ht m [Accessed 8 April 2013]. Georgiadou, Y., Puri, S.K. and Sahay, S., (2005), Towards a Potential Research Agenda to Guide the Implementation of Spatial Data Infrastructures ʹ A Case Study from India. International Journal...

Preparation and characterization of Bioglass®-based scaffolds reinforced bypoly-vinyl alcohol/microfibrillated cellulose composite coating

Czech Academy of Sciences Publication Activity Database

Bertolla, Luca; Dlouhý, Ivo; Boccaccini, A. R.

2014-01-01

Roč. 34, č. 14 (2014), s. 3379-3387 ISSN 0955-2219. [Fractography of Advanced Ceramics IV. Smolenice Castle Congres Center, Smolenice SAS, 29.09.13-02.10.13] R&D Projects: GA MŠk(CZ) ED1.1.00/02.0068 EU Projects: European Commission(XE) 264526 - GLACERCO Institutional support: RVO:68081723 Keywords : bioceramcs * bioglass (R) scaffolds * porous materials * polymer coating * composite coating Subject RIV: JI - Composite Materials Impact factor: 2.947, year: 2014 http://www.imr.saske.sk/confer/fac2013/publication.htm

TRAIL Activates a Caspase 9/7-Dependent Pathway in Caspase 8/10-Defective SK-N-SH Neuroblastoma Cells with Two Functional End Points: Induction of Apoptosis and PGE2 Release

Directory of Open Access Journals (Sweden)

Giorgio Zauli

2003-09-01

Full Text Available Most neuroblastoma cell lines do not express apical caspases 8 and 10, which play a key role in mediating tumor necrosis factor-related apoptosis-inducing ligand (TRAIL cytotoxicity in a variety of malignant cell types. In this study, we demonstrated that TRAIL induced a moderate but significant increase of apoptosis in the caspase 8/10-deficient SK-N-SH neuroblastoma cell line, through activation of a novel caspase 9/7 pathway. Concomitant to the induction of apoptosis, TRAIL also promoted a significant increase of prostaglandin E2 (PGE2 release by SKN-SH cells. Moreover, coadministration of TRAIL plus indomethacin, a pharmacological inhibitor of cyclooxygenase (COX, showed an additive effect on SKN-SH cell death. In spite of the ability of TRAIL to promote the phosphorylation of both ERKi/2 and p38/MAPK, which have been involved in the control of COX expression/activity, neither PD98059 nor SB203580, pharmacological inhibitors of the ERKi/2 and p38/MAPK pathways, respectively, affected either PGE2 production or apoptosis induced by TRAIL. Finally, both induction of apoptosis and PGE2 release were completely abrogated by the broad caspase inhibitor z-VAD4mk, suggesting that both biologic end points were regulated in SK-N-SH cells through a caspase 9/7-dependent pathway.

Pengaruh Trust Dan Penerimaan Teknologi Terhadap Minat Konsumen Dalam Pembelian Online (Studi Kasus Www.kaskus.us)

OpenAIRE

Triatma, Adi; Akmila, Fitriati

2012-01-01

This study discusses the impact of trust and the acceptance of technology on consumer intention to purchase on line at www.kaskus.us. The focus of the study was to test whether privacy, security, trust, risk, perceived usefulness and ease of use influence student intention to purchase online. The sample taken are from Accounting Department Universitas Islam Indonesia students who purchase on line at the web site kaskus.us. The data were analyzed using multiple regression and SEM, then calcula...

Pengaruh Trust dan Penerimaan Teknologi terhadap Minat Konsumen dalam Pembelian Online (Studi kasus www.kaskus.us)

OpenAIRE

Triatma, Adi; Akmila, Fitriati

2012-01-01

This study discusses the impact of trust and the acceptance of technology on consumer intention to purchase on line at www.kaskus.us. The focus of the study was to test whether privacy, security, trust, risk, perceived usefulness and ease of use influence student intention to purchase online. The sample taken are from Accounting Department Universitas Islam Indonesia students who purchase on line at the web site kaskus.us. The data were analyzed using multiple regression and SEM, then calcula...

Expression, purification, and analysis of three recombinant ECD disintegrins (r-colombistatins) from P-III class snake venom metalloproteinases affecting platelet aggregation and SK-MEL-28 cell adhesion.

Science.gov (United States)

Suntravat, Montamas; Helmke, Thomas J; Atphaisit, Chairat; Cuevas, Esteban; Lucena, Sara E; Uzcátegui, Nestor L; Sánchez, Elda E; Rodriguez-Acosta, Alexis

2016-11-01

Crotalid venoms are rich sources of components that affect the hemostatic system. Snake venom metalloproteinases are zinc-dependent enzymes responsible for hemorrhage that also interfere with hemostasis. The disintegrin domain is a part of snake venom metalloproteinases, which involves the binding of integrin receptors. Integrins play an essential role in cancer survival and invasion, and they have been major targets for drug development and design. Both native and recombinant disintegrins have been widely investigated for their anti-cancer activities in biological systems as well as in vitro and in vivo systems. Here, three new cDNAs encoding ECD disintegrin-like domains of metalloproteinase precursor sequences obtained from a Venezuelan mapanare (Bothrops colombiensis) venom gland cDNA library have been cloned. Three different N- and C-terminal truncated ECD disintegrin-like domains of metalloproteinases named colombistatins 2, 3, and 4 were amplified by PCR, cloned into a pGEX-4T-1 vector, expressed in Escherichia coli BL21, and tested for inhibition of platelet aggregation and inhibition of adhesion of human skin melanoma (SK-Mel-28) cancer cell lines on collagen I. Purified recombinant colombistatins 2, 3, and 4 were able to inhibit ristocetin- and collagen-induced platelet aggregation. r-Colombistatins 2 showed the most potent inhibiting SK-Mel-28 cancer cells adhesion to collagen. These results suggest that colombistatins may have utility in the development of therapeutic tools in the treatment of melanoma cancers and also thrombotic diseases. Copyright © 2016. Published by Elsevier Ltd.

Environmental Skeptics and Critics (http://www.iaees.org/publications/journals/environsc/online-version.asp

Directory of Open Access Journals (Sweden)

environsc@iaees.org

Full Text Available Environmental Skeptics and Critics ISSN 2224-4263 URL: http://www.iaees.org/publications/journals/environsc/online-version.asp RSS: http://www.iaees.org/publications/journals/environsc/rss.xml E-mail: environsc@iaees.org Editor-in-Chief: WenJun Zhang Aims and Scope The more truth is debated, the clearer it becomes. Science will not proceed without debate and controversy. Wide and in-depth debate and controversy on human's knowledge, attitudes, policies and practices on the environment determines the future of our planet. There are numerous controversial and potentially controversial issues on environmental sciences and practices. ENVIRONMENTAL SKEPTICS and CRITICS (ISSN 2224-4263 is an international journal devoted to the publication of skeptical and critical articles/short communications/letters on theories, viewpoints, methodologies, practices, policies, etc., in ecological and environmental areas. The journal provides a forum for questioning, disputing, arguing, challenging, criticizing and judging known theories, methdologies, practices, and policies, etc., or presenting different ideas. The scope of Environmental Skeptics and Critics is wide and embraces all controversial, non-conclusive or unexplained issues in ecological and environmental areas. Authors can submit their works to the email box of this journal, environsc@iaees.org. All manuscripts submitted to this journal must be previously unpublished and may not be considered for publication elsewhere at any time during review period of this journal. Authors are asked to read Author Guidelines before submitting manuscripts. In addition to free submissions from authors around the world, special issues are also accepted. The organizer of a special issue can collect submissions (yielded from a research project, a research group, etc. on a specific research topic, or submissions of a scientific conference for publication of special issue.

Model confirmation in climate economics

Science.gov (United States)

Millner, Antony; McDermott, Thomas K. J.

2016-01-01

Benefit–cost integrated assessment models (BC-IAMs) inform climate policy debates by quantifying the trade-offs between alternative greenhouse gas abatement options. They achieve this by coupling simplified models of the climate system to models of the global economy and the costs and benefits of climate policy. Although these models have provided valuable qualitative insights into the sensitivity of policy trade-offs to different ethical and empirical assumptions, they are increasingly being used to inform the selection of policies in the real world. To the extent that BC-IAMs are used as inputs to policy selection, our confidence in their quantitative outputs must depend on the empirical validity of their modeling assumptions. We have a degree of confidence in climate models both because they have been tested on historical data in hindcasting experiments and because the physical principles they are based on have been empirically confirmed in closely related applications. By contrast, the economic components of BC-IAMs often rely on untestable scenarios, or on structural models that are comparatively untested on relevant time scales. Where possible, an approach to model confirmation similar to that used in climate science could help to build confidence in the economic components of BC-IAMs, or focus attention on which components might need refinement for policy applications. We illustrate the potential benefits of model confirmation exercises by performing a long-run hindcasting experiment with one of the leading BC-IAMs. We show that its model of long-run economic growth—one of its most important economic components—had questionable predictive power over the 20th century. PMID:27432964

Efficient AM Algorithms for Stochastic ML Estimation of DOA

Directory of Open Access Journals (Sweden)

Haihua Chen

2016-01-01

Full Text Available The estimation of direction-of-arrival (DOA of signals is a basic and important problem in sensor array signal processing. To solve this problem, many algorithms have been proposed, among which the Stochastic Maximum Likelihood (SML is one of the most concerned algorithms because of its high accuracy of DOA. However, the estimation of SML generally involves the multidimensional nonlinear optimization problem. As a result, its computational complexity is rather high. This paper addresses the issue of reducing computational complexity of SML estimation of DOA based on the Alternating Minimization (AM algorithm. We have the following two contributions. First using transformation of matrix and properties of spatial projection, we propose an efficient AM (EAM algorithm by dividing the SML criterion into two components. One depends on a single variable parameter while the other does not. Second when the array is a uniform linear array, we get the irreducible form of the EAM criterion (IAM using polynomial forms. Simulation results show that both EAM and IAM can reduce the computational complexity of SML estimation greatly, while IAM is the best. Another advantage of IAM is that this algorithm can avoid the numerical instability problem which may happen in AM and EAM algorithms when more than one parameter converges to an identical value.

Seasonal dynamics of Pseudocalanus minutus elongatus and Acartia spp. in the southern Baltic Sea (Gdańsk Deep – numerical simulations

Directory of Open Access Journals (Sweden)

L. Dzierzbicka-Głowacka

2006-01-01

Full Text Available A population dynamics model for copepods is presented, describing the seasonal dynamics of Pseudocalanus minutus elongatus and Acartia spp. in the southern Baltic Sea (Gdańsk Deep. The copepod model was coupled with a one-dimensional physical and biological upper layer model for nutrients (total inorganic nitrogen, phosphate, phytoplankton, microzooplankton, and an early juvenile of herring as a predator. In this model, mesozooplankton (herbivorous copepods has been introduced as an animal having definite patterns of growth in successive stages, reproduction and mortality. The populations are represented by 6 cohorts in different developmental stages, thus assuming that recruitment of the next generation occurs after a fixed period of adult life. The copepod model links trophic processes and population dynamics, and simulates individual growth within cohorts and the changes in biomass between cohorts. The simulations of annual cycles of copepods contain one complete generation of Pseudocalanus and two generations of Acartia in the whole column water, and indicate the importance of growth in the older stages of 6 cohorts of each species, to arrive at a total population biomass. The peaks of copepods' biomass are larger at the turn of June and July for Pseudocalanus and smaller in July for Acartia, lagging that of phytoplankton by ca. two mouths, due to the growth of cohorts in successive stages and egg production by females. The numerical results show that the investigated species could not be the main factor limiting the spring phytoplankton bloom in the Gdańsk Deep, because the initial development was slow for Acartia and faster for Pseudocalanus, but the main development formed after the bloom, in both cases. The phytoplankton bloom is very important in the diet of the adults of the copepods, but it is not particularly important for the youngest part of new generation (early nauplii. However, the simulated microzooplankton biomass was

Determination of In-situ Rock Thermal Properties from Geophysical Log Data of SK-2 East Borehole, Continental Scientific Drilling Project of Songliao Basin, NE China

Science.gov (United States)

Zou, C.; Zhao, J.; Zhang, X.; Peng, C.; Zhang, S.

2017-12-01

Continental Scientific Drilling Project of Songliao Basin is a drilling project under the framework of ICDP. It aims at detecting Cretaceous environmental/climate changes and exploring potential resources near or beneath the base of the basin. The main hole, SK-2 East Borehole, has been drilled to penetrate through the Cretaceous formation. A variety of geophysical log data were collected from the borehole, which provide a great opportunity to analyze thermal properties of in-situ rock surrounding the borehole.The geothermal gradients were derived directly from temperature logs recorded 41 days after shut-in. The matrix and bulk thermal conductivity of rock were calculated with the geometric-mean model, in which mineral/rock contents and porosity were required as inputs (Fuchs et. al., 2014). Accurate mineral contents were available from the elemental capture spectroscopy logs and porosity data were derived from conventional logs (density, neutron and sonic). The heat production data were calculated by means of the concentrations of uranium, thorium and potassium determined from natural gamma-ray spectroscopy logs. Then, the heat flow was determined by using the values of geothermal gradients and thermal conductivity.The thermal parameters of in-situ rock over the depth interval of 0 4500m in the borehole were derived from geophysical logs. Statistically, the numerical ranges of thermal parameters are in good agreement with the measured values from both laboratory and field in this area. The results show that high geothermal gradient and heat flow exist over the whole Cretaceous formation, with anomalously high values in the Qingshankou formation (1372.0 1671.7m) and the Quantou formation (1671.7 2533.5m). It is meaningful for characterization of geothermal regime and exploration of geothermal resources in the basin. Acknowledgment: This work was supported by the "China Continental Scientific Drilling Program of Cretaceous Songliao Basin (CCSD-SK)" of China

Human T-lymphotropic virus type 1 Tax protein complexes with P-TEFb and competes for Brd4 and 7SK snRNP/HEXIM1 binding.

Science.gov (United States)

Cho, Won-Kyung; Jang, Moon Kyoo; Huang, Keven; Pise-Masison, Cynthia A; Brady, John N

2010-12-01

Positive transcription elongation factor b (P-TEFb) plays an important role in stimulating RNA polymerase II elongation for viral and cellular gene expression. P-TEFb is found in cells in either an active, low-molecular-weight (LMW) form or an inactive, high-molecular-weight (HMW) form. We report here that human T-lymphotropic virus type 1 (HTLV-1) Tax interacts with the cyclin T1 subunit of P-TEFb, forming a distinct Tax/P-TEFb LMW complex. We demonstrate that Tax can play a role in regulating the amount of HMW complex present in the cell by decreasing the binding of 7SK snRNP/HEXIM1 to P-TEFb. This is seen both in vitro using purified Tax protein and in vivo in cells transduced with Tax expression constructs. Further, we find that a peptide of cyclin T1 spanning the Tax binding domain inhibits the ability of Tax to disrupt HMW P-TEFb complexes. These results suggest that the direct interaction of Tax with cyclin T1 can dissociate P-TEFb from the P-TEFb/7SK snRNP/HEXIM1 complex for activation of the viral long terminal repeat (LTR). We also show that Tax competes with Brd4 for P-TEFb binding. Chromatin immunoprecipitation (ChIP) assays demonstrated that Brd4 and P-TEFb are associated with the basal HTLV-1 LTR, while Tax and P-TEFb are associated with the activated template. Furthermore, the knockdown of Brd4 by small interfering RNA (siRNA) activates the HTLV-1 LTR promoter, which results in an increase in viral expression and production. Our studies have identified Tax as a regulator of P-TEFb that is capable of affecting the balance between its association with the large inactive complex and the small active complex.

Hepatotoxicity after liver irradiation in children and adolescents. Results from the RiSK

Energy Technology Data Exchange (ETDEWEB)

Roesler, Pascal; Christiansen, Hans [Medical School Hannover, Department of Radiotherapy and Special Oncology, Hannover (Germany); Kortmann, Rolf-Dieter [University of Leipzig, Department of Radiotherapy, Leipzig (Germany); Martini, Carmen [University Hospital of Freiburg, Department of Radiotherapy, Freiburg im Breisgau (Germany); Matuschek, Christiane [Heinrich-Heine University of Duesseldorf, Department of Radiotherapy, Medical Faculty, Duesseldorf (Germany); Meyer, Frank [Hospital Augsburg, Department of Radiotherapy, Augsburg (Germany); Ruebe, Christian [University Hospital of Homburg/Saar, Department of Radiotherapy, Homburg/Saar (Germany); Langer, Thorsten [University Hospital of Schleswig-Holstein, Department of Pediatrics, Pediatric Oncology, Campus Luebeck (Germany); Koch, Raphael [University of Muenster, Institute of Biostatistics and Clinical Research, Muenster (Germany); Eich, Hans Theodor; Willich, Normann [University Hospital of Muenster, Department of Radiotherapy, Muenster (Germany); Steinmann, Diana [Medical School Hannover, Department of Radiotherapy and Special Oncology, Hannover (Germany); University Hospital of Muenster, Department of Radiotherapy, Muenster (Germany)

2015-05-01

The aim of this study was to evaluate acute and late radiotherapy-associated hepatotoxicity in consideration of dose-volume effects and liver function in childhood and adolescence. Since 2001, irradiated children and adolescents in Germany have been prospectively documented in the ''Register of Treatment-Associated Late Effects After Radiotherapy of Malignant Diseases in Childhood and Adolescence (RiSK)'' using standardized forms. Toxicity was graded according to the Radiation Therapy Oncology Group (RTOG) criteria. Until April 2012, 1,392 children and adolescents from 62 radiotherapy centers were recruited. In all, 216 patients underwent irradiation of the liver (median age 9 years, range 1-18 years, 70 patients with total-body irradiation, TBI). For 75 % of patients without TBI, information on acute toxicity of the liver was available: 24 patients had acute toxicity of grade 1-4 (grade 1, 2, and 4, in 20, 3, and 1 patient, respectively), including five patients receiving simultaneous hepatotoxic chemotherapy. Information on late toxicity was documented in 465 forms from 216 patients, with a median follow-up of 2 years. A maximum grade of toxicity of ≥ 0 occurred in 18 patients over time (with grade 1, 2, and 3 toxicity occurring in 15, 2, and 1 patient, respectively), including three patients (17 %) with TBI. One of them received simultaneous hepatotoxic chemotherapy. In multivariable analysis, volume-dose correlations showed no statistically noticeable effect on acute or chronic toxicity. Only low hepatotoxicity developed in children after irradiation of various abdominal and thoracic tumors. Due to the low radiation doses to the liver (median liver dose = 5 Gy) and the low toxicities that were consecutively observed, dose-volume curves for liver toxicity could not be established. These findings reflect the cautious attitude of radiation oncologists in terms of attributable liver doses in the treatment of the investigated tumor entities. It

Estudo piloto com Eco 3D das modificações geométricas do VE após infarto do miocárdio 3D Echo pilot study of geometric Left Ventricular changes after acute myocardial infarction

Directory of Open Access Journals (Sweden)

Marcelo Luiz Campos Vieira

2013-01-01

Full Text Available FUNDAMENTO: Remodelamento ventricular esquerdo (RVE após IAM caracteriza fator de mau prognóstico. Há pouca informação na literatura sobre o RVE analisado com ecocardiografia tridimensional (ECO 3D OBJETIVO: Analisar com ECO 3D as modificações geométricas e volumétricas do ventrículo esquerdo (VE seis meses após IAM em pacientes submetidos a tratamento primário percutâneo. MÉTODOS: Estudo prospectivo com ECO 3D de 21 indivíduos (16 homens, 56 ± 12 anos, acometidos por IAM com elevação do segmento ST. Foi feita a análise morfofuncional (VE com ECO 3D (volumes, FEVE, índice de esfericidade 3D até sete dias e seis meses após o IAM. RVE foi considerado para aumento > 15% do volume diastólico final do VE (VDFVE após seis meses do IAM, comparado ao VDFVE até sete dias do evento. RESULTADOS: Oito (38% pacientes apresentaram RVE. Medidas ecocardiográficas (n = 21 pacientes: I- até sete dias do IAM: 1- VDFVE: 92,3 ± 22,3 mL; 2- FEVE: 0,51 ± 0,01; 3- índice de esfericidade: 0,38 ± 0,05; II- após seis meses: 1- VDFVE: 107,3 ± 26,8 mL; 2- FEVE: 0,59 ± 0,01; 3- índice de esfericidade: 0,31 ± 0,05. Coeficiente de correlação (r entre índice de esfericidade até sete dias do IAM e VDFVE aos seis meses (n = 8 após o IAM: r: 0,74, p = 0,0007; (r entre índice de esfericidade após seis meses do IAM e VDFVE aos seis meses do IAM: r: 0,85, p BACKGROUND: Left ventricular remodeling (LVR after AMI characterizes a factor of poor prognosis. There is little information in the literature on the LVR analyzed with three-dimensional echocardiography (3D ECHO. OBJECTIVE: To analyze, with 3D ECHO, the geometric and volumetric modifications of the left ventricle (VE six months after AMI in patients subjected to percutaneous primary treatment. METHODS: Prospective study with 3D ECHO of 21 subjects (16 men, 56 ± 12 years-old, affected by AMI with ST segment elevation. The morphological and functional analysis (LV with 3D ECHO (volumes

Integrated Assessment Model Evaluation

Science.gov (United States)

Smith, S. J.; Clarke, L.; Edmonds, J. A.; Weyant, J. P.

2012-12-01

Integrated assessment models of climate change (IAMs) are widely used to provide insights into the dynamics of the coupled human and socio-economic system, including emission mitigation analysis and the generation of future emission scenarios. Similar to the climate modeling community, the integrated assessment community has a two decade history of model inter-comparison, which has served as one of the primary venues for model evaluation and confirmation. While analysis of historical trends in the socio-economic system has long played a key role in diagnostics of future scenarios from IAMs, formal hindcast experiments are just now being contemplated as evaluation exercises. Some initial thoughts on setting up such IAM evaluation experiments are discussed. Socio-economic systems do not follow strict physical laws, which means that evaluation needs to take place in a context, unlike that of physical system models, in which there are few fixed, unchanging relationships. Of course strict validation of even earth system models is not possible (Oreskes etal 2004), a fact borne out by the inability of models to constrain the climate sensitivity. Energy-system models have also been grappling with some of the same questions over the last quarter century. For example, one of "the many questions in the energy field that are waiting for answers in the next 20 years" identified by Hans Landsberg in 1985 was "Will the price of oil resume its upward movement?" Of course we are still asking this question today. While, arguably, even fewer constraints apply to socio-economic systems, numerous historical trends and patterns have been identified, although often only in broad terms, that are used to guide the development of model components, parameter ranges, and scenario assumptions. IAM evaluation exercises are expected to provide useful information for interpreting model results and improving model behavior. A key step is the recognition of model boundaries, that is, what is inside

APLIKASI E-COMMERCE WWW.KOMPUTERONLINE.COM DENGAN MENGGUNAKAN MYSQL DAN PHP4

Directory of Open Access Journals (Sweden)

Djoni Haryadi Setiabudi

2002-01-01

Full Text Available This research is about the development of the e-commerce www.komputeronline. com website using MySQL as the database server, Apache as the web server and PHP4 as the scripting programming language with Linux as the operating system of the server . This site can be used to do the transaction of the selling computers and its accesorries. The implementation is about shopping mall's facilities (shopping cart for end users and catalog maintenance's facilities for the administrator. The facilities for the end users in the shopping mall are stuff list based on category and type, search, account status, and at the shopping cart part users can change the quantity, or even cancel the ordering. The facilities for the administrator in the catalog maintenance are search users, maintenance users, look at each user's transactions, look at today's transaction, and change the status of transaction from 'pending' to 'shipped'. The testing that has been done on the komputeronline.com database, with 17 users login at the same time, accessing shopping mall database facilities, shows that the database server and the PHP4 scripting program can run well without any problems. Abstract in Bahasa Indonesia : Pada penelitian ini dilakukan pembuatan website e-commerce www.komputeronline. com dengan menggunakan database server MySQL, pada web server Apache, dan perancangan scripting programming yang menggunakan bahasa scripting PHP4 yang berjalan di sistem operasi Linux. Website ini dipergunakan untuk melakukan transaksi penjualan komputer beserta aksesorisnya. Implementasi yang dilakukan pada komputeronline.com antara lain adalah fasilitas shopping mall (shopping cart untuk end user, dan fasilitas pemeliharaan katalog untuk administrator. Fasilitas-fasilitas untuk end user yang diberikan pada shopping mall antara lain adalah daftar barang berdasarkan kategori dan type, search, account status, dan pada bagian shopping cart user dapat mengubah jumlah barang yang dibeli

www.meanders.org na internet com ecoturismo: uma interação comunicacional sustentável?

OpenAIRE

Laudo Kiyohiro Natsui

2002-01-01

A Teia de Alcance Mundial, como é conhecida a www da população que já tem acesso à internet, tem se tornado no Brasil rapidamente expressiva em tempos de mercados globais e, dentro deste contexto, a atividade do ecoturismo é analisada enquanto oferta e mensagem online. Realiza-se um estudo qualitativo exploratório no intuito de discutir a presente oferta ecoturística online e a mensagem propagada via rede. O termo ecoturismo é questionado, assim como as iniciativas que se apropriam da palavra...

Genetic diversity and taxonomy of Sabanejewia balcanica (Osteichthyes: Cobitidae) in the waters of the Czech Republic and Slovakia

Czech Academy of Sciences Publication Activity Database

Bartoňová, Eva; Papoušek, Ivo; Lusková, Věra; Koščo, J.; Lusk, Stanislav; Halačka, Karel; Švátora, M.; Vetešník, Lukáš

2008-01-01

Roč. 57, 1-2 (2008), s. 60-70 ISSN 0139-7893. [Loaches of the genus Cobitis and related genera /3./. Šibenik, 24.09.2006-29.09.2006] R&D Projects: GA MŽP SM/6/3/05 Grant - others:VEGA(SK) 1/2360/05 Institutional research plan: CEZ:AV0Z60930519 Keywords : Balcan spined loach * conservation * cytochrome b * mitochondrial marker Subject RIV: EB - Genetics ; Molecular Biology Impact factor: 0.522, year: 2008 http://www.ivb.cz/folia/57/1-2/060-070_MS1279.pdf

ORF Sequence: NC_006177 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available Symbiobacterium thermophilum IAM 14863] MTLVRDAMIQVEPLSPNDPIFVALQAMRKQRLPFVPVVRSDGTLYGLVTEGDLVRLIYRATRESGESVPHWIRGAGRQVLLVQSVKEVVTRELDTIGPDIPLEDAAELMVRNHRKVLPVVADGRPMGYLMRSAVVDHLIGE

Korelace mezi délkou lyžařské tratě a rychlostí vrcholových slalomářů Correlation between the length of the ski track and the velocity of top slalom skiers

Directory of Open Access Journals (Sweden)

Blaž Lešnik

2007-02-01

Full Text Available Teoreticky je nejlepší co nejkratší lyžařská dráha (lyžařská trať. V praxi je to však těžko proveditelné a kromě toho je to velmi riskantní. Může se proto stát pouze součástí taktiky těch nejlepších soutěžících. Pomocí kinematické analýzy byly stanoveny rozdíly mezi volbou lyžařské dráhy u jednotlivých soutěžících, a to na základě vzorku vrcholových soutěžících ve světovém poháru v Kranjske Gore. Snažili jsme se zjistit, zda soutěžící dosahovali na takové lyžařské dráze vyšší rychlosti, tedy zda dosahovali rychlejšího pohybu mezi slalomovými brankami a tudíž v konečném důsledku i lep ších časových výsledků. V první části našeho výzkumu bylo prokázáno, že žádný ze soutěžících neměl v prvních dvou po sobě následujících obratech extrémně krátkou lyžařskou dráhu. Bylo rovněž zjištěno, že soutěžící s nejkratšími lyžařskými drahami v prvním obratu měli zpravidla nejdelší lyžařské dráhy v obratu druhém a naopak. Na základě těchto zjištění bylo možno tvrdit, že za současných podmínek je mimořádně obtížné, a snad dokonce nemožné, lyžovat tak, aby lyžařský oblouk byl v několika po sobě následujících obratech velmi krátký. Druhá část našeho výzkumu se zaměřila na zjišťování korelace mezi trajektorií lyží a rychlostí lyžování. Výpočty korelací prokázaly statisticky významnou korelaci mezi průměrnou rychlostí lyžování a průměrnou vzdáleností délky lyžařské dráhy od osy y v celém měřeném úseku. Bylo zjištěno, že měřený prostor překonávali soutěžící s kratší, tedy přímější, lyžařskou dráhou rychleji. Theoretically, the shortest possible line of skiing (ski track is the best one. But in practice it is very difficult to carry this out and besides it is very risky. It can therefore be only a part of the tactics of the best competitors. With

The influence of question design on the response to self-assessment in www.elearnSCI.org: a submodule pilot study.

Science.gov (United States)

Liu, N; Li, X-W; Zhou, M-W; Biering-Sørensen, F

2015-08-01

This is an interventional training session. The objective of this study was to investigate the difference in response to self-assessment questions in the original and an adjusted version for a submodule of www.elearnSCI.org for student nurses. The study was conducted in a teaching hospital affiliated to Peking University, China. In all, 28 student nurses divided into two groups (groups A and B; 14 in each) received a print-out of a Chinese translation of the slides from the 'Maintaining skin integrity following spinal cord injury' submodule in www.elearnSCI.org for self-study. Both groups were then tested using the 10 self-assessment multiple-choice questions (MCQs) related to the same submodule. Group A used the original questions, whereas group B received an adjusted questionnaire. The responses to four conventional single-answer MCQs were nearly all correct in both groups. However, in three questions, group A, with the option 'All of the above', had a higher number of correct answers than group B, with multiple-answer MCQs. In addition, in another three questions, group A, using the original multiple-answer MCQs, had fewer correct answers than group B, where it was only necessary to tick a single incorrect answer. Variations in design influence the response to questions. The use of conventional single-answer MCQs should be reconsidered, as they only examine the recall of isolated knowledge facts. The 'All of the above' option should be avoided because it would increase the number of correct answers arrived at by guessing. When using multiple-answer MCQs, it is recommended that the questions asked should be in accordance with the content within the www.elearnSCI.org.

Biological activity and binding of estradiol to SK-Mel 23 human melanoma cells

Directory of Open Access Journals (Sweden)

Sarti M.S.M.V.

2004-01-01

Full Text Available Patients expressing estradiol receptors in melanoma cells have been reported to have a better prognosis. We therefore decided to investigate the in vitro effects of ß-estradiol and tamoxifen on the growth and tyrosinase activity of SK-Mel 23 human melanoma cells. Twenty-four-hour treatment with 0.4 nM ß-estradiol inhibited cell proliferation in 30% (0.70 ± 0.03 x 10(5 cells and increased tyrosinase activity in 50% (7130.5 ± 376.5 cpm/10(5 cells, as compared to untreated cells (1.0 ± 0.05 x 10(5 cells and 4769 ± 25.5 cpm/10(5 cells, respectively. Both responses were completely (100% blocked by 1 µM tamoxifen. Higher concentrations (up to 1.6 nM or longer treatments (up to 72 h did not result in a larger effect of the hormone on proliferation or tyrosinase activity. Competition binding assays demonstrated the presence of binding sites to [2,4,6,7-³H]-ß-estradiol, and that the tritiated analogue was displaced by the unlabeled hormone (1 nM to 100 µM, Kd = 0.14 µM, maximal displacement of 93% or by 10 µM tamoxifen (displacement of 60%. ß-estradiol also increased the phosphorylated state of two proteins of 16 and 46 kDa, after 4-h treatment, as determined by Western blot. The absorbance of each band was 1.9- and 4-fold the controls, respectively, as determined with Image-Pro Plus software. Shorter incubation periods with ß-estradiol did not enhance phosporylation; after 6-h treatment with the hormone, the two proteins returned to the control phosphorylation levels. The growth inhibition promoted by estradiol may explain the better prognosis of melanoma-bearing women as compared to men, and open new perspectives for drug therapy.

Limitations in accurate electron density studies

International Nuclear Information System (INIS)

Wal, R. van der.

1982-01-01

Most of X-ray diffraction studies are devoted to the determination of three-dimensional crystal structures from the electron density distributions. In these cases the density distributions are described by the independent atom model (IAM model), which consists of a superposition of spherically averaged free atom densities, which are smeared by thermal vibrations. During the last few decades studies have been made into the deviations of the density distribution from the IAM model, which enables a study of the chemical binding between atoms. The total density can be described using pseudo-atom multipole models as a superposition of aspherical pseudo-atom densities. A fundamental problem is that the separation of this density into an IAM and a deformation part is not unique. This thesis considers the problem and besides deformation densities from X-ray diffraction also considers the corresponding deformation electric field and deformation potential. (C.F.)

DisseminACTION: disseminating science in the information age (www.action-euproject.eu: a website for researchers and parents)

OpenAIRE

Matteo Mauri

2015-01-01

www.action-euproject.eu is a website designed at the University of Cagliari, by the Department of Surgery, Faculty of Medicine, within the project “ACTION – Aggression in Children: unravelling gene-environment interplay to inform Treatment and InterventiON strategies”, a collaborative project which includes twelve international partners, funded under the 7th Framework Programme for Research, technological Development and Demonstration.Its aim is to properly disseminate official news, events, ...

2018-03-20T01:33:40Z https://www.ajol.info/index.php/all/oai oai:ojs ...

African Journals Online (AJOL)

Ayoola, SO Le poisson chat d'Afrique (Clarias gariepinus) a été exposé à 0.0, 0.10, 0.50, 1.00, 2.0 et 4.5mg / l de la concentration de vert de malachite. ... Article application/pdf https://www.ajol.info/index.php/bahpa/article/view/44051 10.4314/bahpa.v57i1.44051 Bulletin of Animal Health and Production in Africa; Vol 57, No ...

Monocitose é um marcador de risco independente para a doença arterial coronariana

Directory of Open Access Journals (Sweden)

Afiune Neto Abrahão

2006-01-01

Full Text Available OBJETIVOS: Inflamação e ativação das células do sistema imunológico têm participação importante na patogênese da aterosclerose. Este estudo analisa o leucograma que incluiu neutrófilos, eosinófilos, linfócitos, monócitos e basófilos dos pacientes com doença arterial coronariana (DAC crônica e no infarto agudo do miocárdio (IAM. MÉTODOS: Analisamos o leucograma de 232 pacientes não-diabéticos, com idade entre 15 e 88 anos. A DAC estava presente em 142 pacientes (57 com DAC estável e 85 com IAM, diagnosticada angiograficamente, comparada a 90 indivíduos-controle. Os grupos controle e DAC foram comparáveis para a idade, índice de massa corpórea, antecedentes familiares, tabagismo, hipertensão, HDL e LDL (todas variáveis com p > 0,25. RESULTADOS: A análise univariada mostrou maior prevalência de leucocitose na DAC, sendo maior nos pacientes com IAM quando comparados com a DAC estável. O mesmo comportamento foi observado para os monócitos. Porém, a distribuição foi semelhante para as demais células do hemograma. A análise multivariada pelo método da regressão logística, utilizando-se os modelos stepwise (todas variáveis e backward (p < 0,25, mostrou que a monocitose foi variável independente para DAC e para o IAM. CONCLUSÃO: O número de monócitos, um dos mais importantes componentes do processo inflamatório na placa aterosclerótica, foi um marcador de risco independente para a DAC e para o IAM.

Feasibility of a knowledge translation CME program: Courriels Cochrane.

Science.gov (United States)

Pluye, Pierre; Grad, Roland; Granikov, Vera; Theriault, Guyléne; Frémont, Pierre; Burnand, Bernard; Mercer, Jay; Marlow, Bernard; Arroll, Bruce; Luconi, Francesca; Légaré, France; Labrecque, Michel; Ladouceur, Roger; Bouthillier, France; Sridhar, Soumya Bindiganavile; Moscovici, Jonathan

2012-01-01

Systematic literature reviews provide best evidence, but are underused by clinicians. Thus, integrating Cochrane reviews into continuing medical education (CME) is challenging. We designed a pilot CME program where summaries of Cochrane reviews (Courriels Cochrane) were disseminated by e-mail. Program participants automatically received CME credit for each Courriel Cochrane they rated. The feasibility of this program is reported (delivery, participation, and participant evaluation). We recruited French-speaking physicians through the Canadian Medical Association. Program delivery and participation were documented. Participants rated the informational value of Courriels Cochrane using the Information Assessment Method (IAM), which documented their reflective learning (relevance, cognitive impact, use for a patient, expected health benefits). IAM responses were aggregated and analyzed. The program was delivered as planned. Thirty Courriels Cochrane were delivered to 985 physicians, and 127 (12.9%) completed at least one IAM questionnaire. Out of 1109 Courriels Cochrane ratings, 973 (87.7%) conta-ined 1 or more types of positive cognitive impact, while 835 (75.3%) were clinically relevant. Participants reported the use of information for a patient and expected health benefits in 595 (53.7%) and 569 (51.3%) ratings, respectively. Program delivery required partnering with 5 organizations. Participants valued Courriels Cochrane. IAM ratings documented their reflective learning. The aggregation of IAM ratings documented 3 levels of CME outcomes: participation, learning, and performance. This evaluation study demonstrates the feasibility of the Courriels Cochrane as an approach to further disseminate Cochrane systematic literature reviews to clinicians and document self-reported knowledge translation associated with Cochrane reviews. Copyright © 2012 The Alliance for Continuing Education in the Health Professions, the Society for Academic Continuing Medical Education, and

Lesion dose in differentiated thyroid carcinoma metastases after rhTSH or thyroid hormone withdrawal: {sup 124}I PET/CT dosimetric comparisons

Energy Technology Data Exchange (ETDEWEB)

Freudenberg, Lutz Stefan; Jentzen, Walter; Brandau, Wolfgang; Bockisch, Andreas [University of Duisburg/Essen, Department of Nuclear Medicine, Essen (Germany); Petrich, Thorsten; Knapp, Wolfram H. [Hanover University School of Medicine, Department of Nuclear Medicine, Hanover (Germany); Froemke, Cornelia [Hanover University School of Medicine, Institute of Biometry, Hanover (Germany); Marlowe, Robert J. [Spencer-Fontayne Corporation, Jersey City, NJ (United States); Heusner, Till [University of Duisburg/Essen, Department of Diagnostic and Interventional Radiology and Neuroradiology, Essen (Germany)

2010-12-15

Renal radioiodine excretion is {proportional_to}50% faster during euthyroidism versus hypothyroidism. We therefore sought to assess lesion dose/GBq of administered {sup 131}I activity (LDpA) in iodine-avid metastases (IAM) of differentiated thyroid carcinoma (DTC) in athyreotic patients after recombinant human thyroid-stimulating hormone (rhTSH) versus after thyroid hormone withdrawal (THW). We retrospectively compared mean LDpA between groups of consecutive patients (N = 63) receiving {sup 124}I positron emission tomography/computed tomography ({sup 124}I PET/CT) aided by rhTSH (n = 27) or THW (n = 36); we prospectively compared LDpA after these stimulation methods within another individual. Data derived from serial PET scans and one CT scan performed 2-96 h post-{sup 124}I ingestion. A mixed model analysis of covariance (ANCOVA) calculated the treatment groups' mean LDpAs adjusting for statistically significant baseline intergroup differences: non-IAM were more prevalent, median IAM count/patient lower in cervical lymph nodes and higher in distant sites, median stimulated thyroglobulin higher, mean cumulative radioiodine activity greater and prior diagnostic scintigraphy more frequent in the rhTSH patients. Mean LDpAs were: rhTSH group (n = 71 IAM), 30.6 Gy/GBq; THW group (n = 66 IAM), 51.8 Gy/GBq. The difference in group means (rhTSH less THW), -21.2 Gy/GBq, was statistically non-significant (p = 0.1667). However, the 95% confidence interval of that difference (-51.4 to + 9 Gy/GBq) suggested a trend favouring THW. The within-patient comparison found 2.9- to 10-fold higher LDpAs under THW. We found some suggestions, but no statistically significant evidence, that rhTSH administration results in a lower radiation dose to DTC metastases than does THW. A large, well-controlled, prospective within-patient study should resolve this issue. (orig.)

Migration of the guinea pig sperm membrane protein PH-20 from one localized surface domain to another does not occur by a simple diffusion-trapping mechanism.

Science.gov (United States)

Cowan, A E; Myles, D G; Koppel, D E

1991-03-01

The redistribution of membrane proteins on the surface of cells is a prevalent feature of differentiation in a variety of cells. In most cases the mechanism responsible for such redistribution is poorly understood. Two potential mechanisms for the redistribution of surface proteins are: (1) passive diffusion coupled with trapping, and (2) active translocation. We have studied the process of membrane protein redistribution for the PH-20 protein of guinea pig sperm, a surface protein required for sperm binding to the egg zona pellucida (P. Primakoff, H. Hyatt, and D. G. Myles (1985). J. Cell Biol. 101, 2239-2244). PH-20 protein is localized to the posterior head plasma menbrane of the mature sperm cell. Following the exocytotic acrosome reaction, PH-20 protein moves into the newly incorporated inner acrosomal membrane (IAM), placing it in a position favorable for a role in binding sperm to the egg zona pellucida (D. G. Myles, and P. Primakoff (1984), J. Cell Biol. 99, 1634-1641). To analyze the mechanistic basis for this protein migration, we have used fluorescence microscopy and digital image processing to characterize PH-20 protein migration in individual cells. PH-20 protein was observed to move against a concentration gradient in the posterior head plasma membrane. This result argues strongly against a model of passive diffusion followed by trapping in the IAM, and instead suggests that an active process serves to concentrate PH-20 protein toward the boundary separating the posterior head and IAM regions. A transient gradient of PH-20 concentration observed in the IAM suggests that once PH-20 protein reaches the IAM, it is freely diffusing. Additionally, we observed that migration of PH-20 protein was calcium dependent.

Immobilization of α-Amylase from Anoxybacillus sp. SK3-4 on ReliZyme and Immobead Supports

Directory of Open Access Journals (Sweden)

Ummirul Mukminin Kahar

2016-09-01

Full Text Available α-Amylase from Anoxybacillus sp. SK3-4 (ASKA is a thermostable enzyme that produces a high level of maltose from starches. A truncated ASKA (TASKA variant with improved expression and purification efficiency was characterized in an earlier study. In this work, TASKA was purified and immobilized through covalent attachment on three epoxide (ReliZyme EP403/M, Immobead IB-150P, and Immobead IB-150A and an amino-epoxide (ReliZyme HFA403/M activated supports. Several parameters affecting immobilization were analyzed, including the pH, temperature, and quantity (mg of enzyme added per gram of support. The influence of the carrier surface properties, pore sizes, and lengths of spacer arms (functional groups on biocatalyst performances were studied. Free and immobilized TASKAs were stable at pH 6.0–9.0 and active at pH 8.0. The enzyme showed optimal activity and considerable stability at 60 °C. Immobilized TASKA retained 50% of its initial activity after 5–12 cycles of reuse. Upon degradation of starches and amylose, only immobilized TASKA on ReliZyme HFA403/M has comparable hydrolytic ability with the free enzyme. To the best of our knowledge, this is the first report of an immobilization study of an α-amylase from Anoxybacillus spp. and the first report of α-amylase immobilization using ReliZyme and Immobeads as supports.

Quantitative structure-retention relationship studies with immobilized artificial membrane chromatography II: partial least squares regression.

Science.gov (United States)

Li, Jie; Sun, Jin; He, Zhonggui

2007-01-26

We aimed to establish quantitative structure-retention relationship (QSRR) with immobilized artificial membrane (IAM) chromatography using easily understood and obtained physicochemical molecular descriptors and to elucidate which descriptors are critical to affect the interaction process between solutes and immobilized phospholipid membranes. The retention indices (logk(IAM)) of 55 structurally diverse drugs were determined on an immobilized artificial membrane column (IAM.PC.DD2) directly or obtained by extrapolation method for highly hydrophobic compounds. Ten simple physicochemical property descriptors (clogP, rings, rotatory bond, hydro-bond counting, etc.) of these drugs were collected and used to establish QSRR and predict the retention data by partial least squares regression (PLSR). Five descriptors, clogP, rotatory bond (RotB), rings, molecular weight (MW) and total surface area (TSA), were reserved by using the Variable Importance for Projection (VIP) values as criterion to build the final PLSR model. An external test set was employed to verify the QSRR based on the training set with the five variables, and QSRR by PLSR exhibited a satisfying predictive ability with R(p)=0.902 and RMSE(p)=0.400. Comparison of coefficients of centered and scaled variables by PLSR demonstrated that, for the descriptors studied, clogP and TSA have the most significant positive effect but the rotatable bond has significant negative effect on drug IAM chromatographic retention.

A recurrent human papillomavirus integration site at chromosome region 12q14-q15 in SW756 and SK-v cell lines derived from genital tumors

International Nuclear Information System (INIS)

Sastre-Garau, X.; Couturier, J.; Favre, M.; Orth, G.

1995-01-01

The SW756 cell line, derived from an invasive cancer of the uterine cervix, harbours integrated human papillomavirus (HPV) 18 DNA sequences which have been located in chromosome band 12q13. By in situ hybridization experiments with tritiated and digoxigenin-labelled HPV18 probes on R-banded chromosomes, we now localize the integrated viral sequences in 12q14-q15. Interestingly, we have previously localized integrated HPV16 sequences in the same chromosomal region in SK-v cells, derived from a pre-invasive vulvar neoplasia. The chromosomal region 12q14-q15 could thus correspond to a preferential site for the integration of HPV DNA in genital tumors. (authors). 29 refs., 2 figs

Non-native crab Rhithropanopeus harrisii (Gould, 1984 - a new component of the benthic communities in the Gulf of Gdańsk (southern Baltic Sea

Directory of Open Access Journals (Sweden)

Joanna Hegele-Drywa

2014-01-01

Full Text Available The aim of this study was to determine the occurrence, spatial distribution and abundance pattern of the Harris mud crab Rhithropanopeus harrisii in the Gulf of Gdańsk (southern Baltic Sea. Between 2006 and 2010, this species was found at 69 out of 129 sampling stations, at depths from 0 to 20 m. Two main aggregations of the Harris mud crab were established: (1 in Puck Bay (max. density 19 indiv. 100 m-2 and (2 in the Gdynia and Sopot area (max. density 5 indiv. 100 m-2. 920 specimens were collected during the whole sampling period: 150 juveniles, 370 females and 400 males. The minimum measured carapace width was 1.96 mm, the maximum 21.40 mm (mean 9.03 ±4.11 mm.

Globus Identity, Access, and Data Management: Platform Services for Collaborative Science

Science.gov (United States)

Ananthakrishnan, R.; Foster, I.; Wagner, R.

2016-12-01

Globus is software-as-a-service for research data management, developed at, and operated by, the University of Chicago. Globus, accessible at www.globus.org, provides high speed, secure file transfer; file sharing directly from existing storage systems; and data publication to institutional repositories. 40,000 registered users have used Globus to transfer tens of billions of files totaling hundreds of petabytes between more than 10,000 storage systems within campuses and national laboratories in the US and internationally. Web, command line, and REST interfaces support both interactive use and integration into applications and infrastructures. An important component of the Globus system is its foundational identity and access management (IAM) platform service, Globus Auth. Both Globus research data management and other applications use Globus Auth for brokering authentication and authorization interactions between end-users, identity providers, resource servers (services), and a range of clients, including web, mobile, and desktop applications, and other services. Compliant with important standards such as OAuth, OpenID, and SAML, Globus Auth provides mechanisms required for an extensible, integrated ecosystem of services and clients for the research and education community. It underpins projects such as the US National Science Foundation's XSEDE system, NCAR's Research Data Archive, and the DOE Systems Biology Knowledge Base. Current work is extending Globus services to be compliant with FEDRAMP standards for security assessment, authorization, and monitoring for cloud services. We will present Globus IAM solutions and give examples of Globus use in various projects for federated access to resources. We will also describe how Globus Auth and Globus research data management capabilities enable rapid development and low-cost operations of secure data sharing platforms that leverage Globus services and integrate them with local policy and security.

Rule Extraction Based on Extreme Learning Machine and an Improved Ant-Miner Algorithm for Transient Stability Assessment.

Directory of Open Access Journals (Sweden)

Yang Li

Full Text Available In order to overcome the problems of poor understandability of the pattern recognition-based transient stability assessment (PRTSA methods, a new rule extraction method based on extreme learning machine (ELM and an improved Ant-miner (IAM algorithm is presented in this paper. First, the basic principles of ELM and Ant-miner algorithm are respectively introduced. Then, based on the selected optimal feature subset, an example sample set is generated by the trained ELM-based PRTSA model. And finally, a set of classification rules are obtained by IAM algorithm to replace the original ELM network. The novelty of this proposal is that transient stability rules are extracted from an example sample set generated by the trained ELM-based transient stability assessment model by using IAM algorithm. The effectiveness of the proposed method is shown by the application results on the New England 39-bus power system and a practical power system--the southern power system of Hebei province.

Rule Extraction Based on Extreme Learning Machine and an Improved Ant-Miner Algorithm for Transient Stability Assessment.

Science.gov (United States)

Li, Yang; Li, Guoqing; Wang, Zhenhao

2015-01-01

In order to overcome the problems of poor understandability of the pattern recognition-based transient stability assessment (PRTSA) methods, a new rule extraction method based on extreme learning machine (ELM) and an improved Ant-miner (IAM) algorithm is presented in this paper. First, the basic principles of ELM and Ant-miner algorithm are respectively introduced. Then, based on the selected optimal feature subset, an example sample set is generated by the trained ELM-based PRTSA model. And finally, a set of classification rules are obtained by IAM algorithm to replace the original ELM network. The novelty of this proposal is that transient stability rules are extracted from an example sample set generated by the trained ELM-based transient stability assessment model by using IAM algorithm. The effectiveness of the proposed method is shown by the application results on the New England 39-bus power system and a practical power system--the southern power system of Hebei province.

Chronic exposure of Sk-1 hairless mice to narrow-band ultraviolet A (320-355 nm)

International Nuclear Information System (INIS)

Menter, J.M.; Sayre, R.M.; Etemadi, A.A.; Agin, P.P.; Wills, I.

1996-01-01

Several recent investigations collectively suggest that the role of ultraviolet A (UVA) in chronic actinic skin damage may be greater than originally thought. In the present work, the output of a xenon-arc solar-simulator passed through a Bausch and Lomb monochromator in conjunction with a 2-mm Schott WG-320 filter produced narrow-band UVA centered at 338 nm, half-band width 24 nm, I 0 =3.4±0.3 mW/cm 2 . We chronically irradiated 10 SK-1 albino hairless mice 5 times per week for 18 weeks, starting with 1.25 J/cm 2 , for 33 irradiation days, sequentially followed by 1.50 J/cm 2 (34 days), 1.8 J/cm 2 (10 days), 2.0 J/cm 2 (22 days) to afford a total UVA dose of 154.3 J/cm 2 over 99 irradiation days. Erythema was noted clinically by day 6, which persisted throughout the irradiation. During the irradiation period, some scaling, consistent with mild epidermal hyperplasia was noted during irradiation days 37-56. This response later regressed despite continued chronic irradiation. Hematoxylin and eosin examination immediately after the final irradiation revealed a mild inflammatory response, with some dermal restructuring. At the end of the experiment, no significant signs of epidermal hyperplasia or (pre)malignant lesions were seen, although some stratum corneum thickening was noted. Marked dermal collagen damage and moderate elastosis was also evident. We believe that the observed differences in results reported in previous studies are in large part due to differences in light sources and irradiation protocols. (au)

Skład kwasów tłuszczowych i twardość czekolad gorzkich o różnej zawartości miazgi kakaowej = Fatty acid composition and hardness of dark chocolates with different content of cacao mass

Directory of Open Access Journals (Sweden)

Renata Taradejna

2015-09-01

Wydział Nauki o Żywności, Uniwersytet Warmińsko-Mazurski w Olsztynie     Uniwersytet Warmińsko-Mazurski w Olsztynie Katedra Przetwórstwa i Chemii Surowców Roślinnych Pl. Cieszyński 1, 10-726 Olsztyn e-mail: beata.wronowska@uwm.edu.pl     Abstrakt W pracy analizowano zróżnicowanie dostępnych na rynku czekolad gorzkich pod względem składu kwasów tłuszczowych oraz twardości. Materiałem badawczym było 14 czekolad gorzkich pochodzących od różnych firm o zawartości miazgi kakaowej od 45% do 90%. Skład kwasów tłuszczowych oznaczono chromatograficznie, a twardość zmierzono w teście łamania za pomocą uniwersalnej maszyny testującej. Wykazano, że 6 czekolad zawierało w swoim składzie poniżej 65% miazgi kakaowej, nie spełniając wymagań określonych w polskiej normie dla czekolady gorzkiej. Pomimo tego, prawie wszystkie czekolady miały skład kwasów tłuszczowych typowy dla tłuszczu kakaowego; udziały kwasów oleinowego, stearynowego i palmitynowego wynosiły odpowiednio: 31,2-33,1%, 34,1-36,8% i 25,5-29,0%. Tylko w przypadku jednej czekolady stwierdzono wyższy udział kwasu palmitynowego (33,8%, natomiast niższy kwasów oleinowego i stearynowego (odpowiednio 29,4% i 32,9%. Badane czekolady gorzkie cechowały się zróżnicowaną twardością, na co wskazywały wartości siły kształtujące się w szerokim zakresie (24,2-85,6 N. Nie zaobserwowano zależności pomiędzy składem kwasów tłuszczowych a wartością siły potrzebnej do złamania kostki czekolady.   Słowa kluczowe: czekolada gorzka, miazga kakaowa, kwasy tłuszczowe, twardość.       Abstract The study analysed the diversity of commercially available dark chocolate in terms of fatty acid composition and hardness. The research material was 14 bitter chocolate from different companies about the content of cocoa mass from 45% to 90%. The fatty acid composition was determined by chromatography, and the hardness measured by the breaking test with the universal

El infarto agudo de miocardio, un problema de salud pública

OpenAIRE

Alberto Caccavo

2010-01-01

RESUMENEl infarto agudo de miocardio (IAM) es una causa importante de muerte en la Argentina. Lamortalidad intrahospitalaria del IAM en la actualidad es de aproximadamente el 10%, almenos en los centros que participan en registros.Su tratamiento está orientado a la reperfusión de la arteria ocluida con angioplastia primariao trombolíticos. Sin embargo, sólo un pequeño número de hospitales disponen deangioplastia primaria y reciben trombolíticos muchos menos pacientes que los que los requieren...

Získávání informace s použitím webových služeb

Czech Academy of Sciences Publication Activity Database

Klán, Petr

2005-01-01

Roč. 11, č. 10 (2005), s. 12-16 ISSN 1210-9592 R&D Projects: GA MŠk 1N04002 Institutional research plan: CEZ:AV0Z10300504 Keywords : webové služby * programování * PHP * XML Subject RIV: BD - Theory of Information http://www.odbornecasopisy.cz/index.php?id_document=30711

Development and content validation of the information assessment method for patients and consumers.

Science.gov (United States)

Pluye, Pierre; Granikov, Vera; Bartlett, Gillian; Grad, Roland M; Tang, David L; Johnson-Lafleur, Janique; Shulha, Michael; Barbosa Galvão, Maria Cristiane; Ricarte, Ivan Lm; Stephenson, Randolph; Shohet, Linda; Hutsul, Jo-Anne; Repchinsky, Carol A; Rosenberg, Ellen; Burnand, Bernard; Légaré, France; Dunikowski, Lynn; Murray, Susan; Boruff, Jill; Frati, Francesca; Kloda, Lorie; Macaulay, Ann; Lagarde, François; Doray, Geneviève

2014-02-18

Online consumer health information addresses health problems, self-care, disease prevention, and health care services and is intended for the general public. Using this information, people can improve their knowledge, participation in health decision-making, and health. However, there are no comprehensive instruments to evaluate the value of health information from a consumer perspective. We collaborated with information providers to develop and validate the Information Assessment Method for all (IAM4all) that can be used to collect feedback from information consumers (including patients), and to enable a two-way knowledge translation between information providers and consumers. Content validation steps were followed to develop the IAM4all questionnaire. The first version was based on a theoretical framework from information science, a critical literature review and prior work. Then, 16 laypersons were interviewed on their experience with online health information and specifically their impression of the IAM4all questionnaire. Based on the summaries and interpretations of interviews, questionnaire items were revised, added, and excluded, thus creating the second version of the questionnaire. Subsequently, a panel of 12 information specialists and 8 health researchers participated in an online survey to rate each questionnaire item for relevance, clarity, representativeness, and specificity. The result of this expert panel contributed to the third, current, version of the questionnaire. The current version of the IAM4all questionnaire is structured by four levels of outcomes of information seeking/receiving: situational relevance, cognitive impact, information use, and health benefits. Following the interviews and the expert panel survey, 9 questionnaire items were confirmed as relevant, clear, representative, and specific. To improve readability and accessibility for users with a lower level of literacy, 19 items were reworded and all inconsistencies in using a