WorldWideScience

Sample records for dysprosium 171

  1. Synthesis and characterization of tetraphenylporphyrinate of dysprosium route dysprosium acetylacetonate

    International Nuclear Information System (INIS)

    Martinez M, V.

    1992-01-01

    Dysprosium bis (tetraphenylporphyrinate) and bis (dysprosium) Tris (tetraphenylporphyrinate) were synthesized from dysprosium tetraphenylporphyrinate prepared in situ, and characterized by IR, UV-vis, TGA, DTA, EPR and magnetic susceptibility measurements. The double decker compound was obtained by direct oxidation of the HDy(TPP) 2 intermediate. The existence of the radical anion, (TPP) - , in the double decker product was conformed by EPR spectrometry. Dysprosium monoporphyrinate was isolated and characterized by the same techniques. (Author)

  2. On polymorphism of dysprosium trichloride

    Energy Technology Data Exchange (ETDEWEB)

    Zakiryanova, Irina D.; Khokhlov, Vladimir A.; Salyulev, Alexander B.; Korzun, Iraida V. [RAS Ural Branch, Ekaterinburg (Russian Federation). Institute of High-Temperature Electrochemistry

    2015-07-01

    For the first time, the structure of crystalline DyCl{sub 3} over a wide temperature range from room temperature to melting point was studied by Raman spectroscopy. The phonon modes (cm{sup -1}) of dysprosium trichloride (monoclinic crystal lattice of AlCl{sub 3} type, Z = 4, CN = 6) at room temperature are 257 (A{sub 1g}), 201 (E{sub g}), 112 (E{sub g}), 88 (A{sub 1g}), and 63 (E{sub g}). The monoclinic structure of the crystalline DyCl{sub 3} C{sub 2h}{sup 3} symmetry was found to remain constant over the studied temperature range. No polymorphic transformation in the solid state was detected. Gravimetry, calorimetry, and mass spectrometry have been used in addition to support the conclusions made on the basis of Raman spectroscopic data.

  3. On polymorphism of dysprosium trichloride

    International Nuclear Information System (INIS)

    Zakiryanova, Irina D.; Khokhlov, Vladimir A.; Salyulev, Alexander B.; Korzun, Iraida V.

    2015-01-01

    For the first time, the structure of crystalline DyCl 3 over a wide temperature range from room temperature to melting point was studied by Raman spectroscopy. The phonon modes (cm -1 ) of dysprosium trichloride (monoclinic crystal lattice of AlCl 3 type, Z = 4, CN = 6) at room temperature are 257 (A 1g ), 201 (E g ), 112 (E g ), 88 (A 1g ), and 63 (E g ). The monoclinic structure of the crystalline DyCl 3 C 2h 3 symmetry was found to remain constant over the studied temperature range. No polymorphic transformation in the solid state was detected. Gravimetry, calorimetry, and mass spectrometry have been used in addition to support the conclusions made on the basis of Raman spectroscopic data.

  4. Can a dysprosium shortage threaten green energy technologies?

    International Nuclear Information System (INIS)

    Hoenderdaal, Sander; Tercero Espinoza, Luis; Marscheider-Weidemann, Frank; Graus, Wina

    2013-01-01

    Dysprosium, one of the various rare earth elements, is currently for more than 99% mined in China. As China is reducing its exports, new mining projects outside of China are needed to sustain supply and meet future demands. Dysprosium is mainly used in permanent magnets to retain the magnet's strength at elevated temperatures. Therefore, the use of dysprosium doped permanent magnets is preferred in electric vehicles and direct-drive wind turbines. Based on four scenarios it could be shown that dysprosium demand will probably outstrip supply in the short term (up to 2020). Although new mines are being developed, it takes several years for them to become productive. For the long term it is expected that enough dysprosium oxide is available in the earth crust (which is economically feasible to mine with current dysprosium prices) to fulfil the projected demand of dysprosium up to 2050. Recycling of dysprosium can further secure dysprosium supply in the long term by reducing primary dysprosium use by 35% in 2050. Electric vehicles are likely to play a dominant role in future increases in dysprosium demand. Even with the limited market share in 2011, electric vehicles already contribute to 20% of dysprosium use. -- Highlights: ► Dysprosium may hamper the implementation of electric cars and wind mills. ► In the short term (up to 2020) a deficit of dysprosium supply can be expected. ► In the long term (up to 2050) sufficient dysprosium is available. ► Electric vehicles are expected to dominate future dysprosium demand. ► China's dominance in dysprosium supply is likely to decrease by 2020.

  5. Resonance ionization spectroscopy in dysprosium

    Energy Technology Data Exchange (ETDEWEB)

    Studer, D., E-mail: dstuder@uni-mainz.de; Dyrauf, P.; Naubereit, P.; Heinke, R.; Wendt, K. [Johannes Gutenberg-Universität Mainz, Institut für Physik (Germany)

    2017-11-15

    We report on resonance ionization spectroscopy (RIS) of high-lying energy levels in dysprosium. We developed efficient excitation schemes and re-determined the first ionization potential (IP) via analysis of Rydberg convergences. For this purpose both two- and three-step excitation ladders were investigated. An overall ionization efficiency of 25(4) % could be demonstrated in the RISIKO mass separator of Mainz University, using a three-step resonance ionization scheme. Moreover, an extensive analysis of the even-parity 6sns- and 6snd-Rydberg-series convergences, measured via two-step excitation was performed. To account for strong perturbations in the observed s-series, the approach of multichannel quantum defect theory (MQDT) was applied. Considering all individual series limits we extracted an IP-value of 47901.76(5) cm{sup −1}, which agrees with the current literature value of 47901.7(6) cm{sup −1}, but is one order of magnitude more precise.

  6. Nature of the magnetic susceptibility of dysprosium. Paramagnetic susceptibility of dysprosium - yttrium alloys

    International Nuclear Information System (INIS)

    Demidov, V.G.; Levitin, R.Z.; Chistyakov, O.D.

    1976-01-01

    The paramagnetic susceptibility of single crystals of dysprosium-yttirum alloys is measured in the basal plane and along the hexagonal axis. It is shown that the susceptibility of the alloys obeys the Curie-Weiss law, the effective magnetic moments allong the different directions being the same and the paramagnetic Curie temperatures being different. The difference between the paramagnetic Curie temperatures in the basal plane and along the hexagonal axis is independent of the dysprosium concentration in the alloy. As a comparison with the theoretical models of magnetic anisotropy shows, this is an indication that the magnetic anisotropy of dysprosium - yttrium alloys is of a single-ion nature

  7. Semiconductor composition containing iron, dysprosium, and terbium

    Science.gov (United States)

    Pooser, Raphael C.; Lawrie, Benjamin J.; Baddorf, Arthur P.; Malasi, Abhinav; Taz, Humaira; Farah, Annettee E.; Kalyanaraman, Ramakrishnan; Duscher, Gerd Josef Mansfred; Patel, Maulik K.

    2017-09-26

    An amorphous semiconductor composition includes 1 to 70 atomic percent iron, 15 to 65 atomic percent dysprosium, 15 to 35 atomic percent terbium, balance X, wherein X is at least one of an oxidizing element and a reducing element. The composition has an essentially amorphous microstructure, an optical transmittance of at least 50% in at least the visible spectrum and semiconductor electrical properties.

  8. Dysprosium complexes with the tetraphenylporphyrin macrocyclic ligand

    International Nuclear Information System (INIS)

    Martinez M, V.; Padilla, J.; Ramirez, F.M.

    1992-04-01

    In this report, the results obtained on the synthesis, characterization and study of the chemical behavior of dysprosium complex with the acetylacetone chelating agent (Hacac) and the tetraphenylporphyrin macrocyclic ligand (H 2 TFP) are given. Based on the literature but according to our necessities and interest, the appropriate methodology settled down from the synthesis of prime matters until the obtaining and characterization of the products. The acetyl acetonate complex was obtained of mono hydrated dysprosium [Dy(acac) 3 . H 2 0] and trihydrated [Dy(acac) 3 .3 H 2 0], the mono tetra phenyl porphyrinate [Dy(TFP)(acac). 2 ac] the double sandwich of the dysprosium porphyrinate [Dy(TFP) 2 ] and the triple sandwich of the dysprosium porphyrinate [Dy(TFP) 3 . 2 TCB] (TCB = trichlorobenzene). Its were characterized by their melting points, solubility, IR, UV, TGA and DTA both first and besides the techniques already mentioned for NMR'H, RPE and Magnetic susceptibility the three last complexes. From the spectroscopic point of view, IR and RPE its suggested the existence of a complex of inverse mixed valence [Dy(TFP) 2- (TFP) 1- ] for the Dy(TFP) 2 as a result of the existence of the free radical (TFP' 1- and that it was not in none of the other porphyrin compounds. In the NMR'H spectra of the compounds were not observed signals in the region from 0 to 10 ppm that which shows that the dysprosium complexes in special those of the porphyrin type are highly paramagnetic and its could be used as displacement reagents, creators of images and contrast agents of great utility in these days in studies of NMR, technique today by today used in medical diagnoses. (Author)

  9. Heat capacity measurements on dysprosium titanate

    International Nuclear Information System (INIS)

    Kandan, R.; Prabhakara Reddy, B.; Panneerselvam, G.; Nagarajan, K.

    2014-01-01

    Dysprosium titanate is considered as a candidate material for use in the control rods of future nuclear reactors. The Dy 2 TiO 5 compound was prepared by solid-state synthesis and characterized by XRD technique. The high temperature enthalpy increments of dysprosium titanates have been measured for the first time by employing the method of inverse drop calorimetry in the temperature range 748-1645 K by using high temperature drop calorimeter. The calorimeter, the method of measurement and the procedure adopted for enthalpy increment measurements and analysis of the measured data to compute thermodynamic functions have been described elsewhere. The measured enthalpy increments were fitted to polynomial in temperature by using the least squares method. The fit equation in the temperature range from 298 to 1800 K is given

  10. High temperature oxidation kinetics of dysprosium particles

    Energy Technology Data Exchange (ETDEWEB)

    Jaques, Brian J.; Butt, Darryl P., E-mail: DarrylButt@BoiseState.edu

    2015-09-25

    Highlights: • The oxidation behavior of dysprosium particles was studied from 500 to 1000 °C. • Activation energy in initial region found as 8–25 kJ/mol, depending on atmosphere. • Activation energy in intermediate region found as 80–95 kJ/mol. • The oxide grows at the metal–oxide interface. • Generally, the formed oxide behaved as a p-type semiconductor. - Abstract: Rare earth elements have been recognized as critical materials for the advancement of many strategic and green technologies. Recently, the United States Department of Energy has invested many millions of dollars to enhance, protect, and forecast their production and management. The work presented here attempts to clarify the limited and contradictory literature on the oxidation behavior of the rare earth metal, dysprosium. Dysprosium particles were isothermally oxidized from 500 to 1000 °C in N{sub 2}–(2%, 20%, and 50%) O{sub 2} and Ar–20% O{sub 2} using simultaneous thermal analysis techniques. Two distinct oxidation regions were identified at each isothermal temperature in each oxidizing atmosphere. Initially, the oxidation kinetics are very fast until the reaction enters a slower, intermediate region of oxidation. The two regions are defined and the kinetics of each are assessed to show an apparent activation energy of 8–25 kJ/mol in the initial region and 80–95 kJ/mol in the intermediate oxidation reaction region. The effects of varying the oxygen partial pressure on the reaction rate constant are used to show that dysprosium oxide (Dy{sub 2}O{sub 3}) generally acts as a p-type semiconductor in both regions of oxidation (with an exception above 750 °C in the intermediate region)

  11. Can a dysprosium shortage threaten green energy technologies?

    NARCIS (Netherlands)

    Hoenderdaal, S.; Tercero Espinoza, L.; Marschneider-Weidemann, F.; Crijns - Graus, Wina|info:eu-repo/dai/nl/308005015

    2013-01-01

    Dysprosium, one of the various rare earth elements, is currently for more than 99% mined in China. As China is reducing its exports, new mining projects outside of China are needed to sustain supply and meet future demands. Dysprosium is mainly used in permanent magnets to retain the magnet's

  12. Ethanolamine derivatives of dysprosium and holmium

    International Nuclear Information System (INIS)

    Gharia, K.S.; Singh, M.; Mathur, S.; Sankhla, B.S.

    1981-01-01

    The preparation and properties of dysprosium and holmium derivatives of mono-, di- and tri-ethanolamine derivatives are described. Compounds of general formulae: Ln(OPrsup(i)) 2 (mea), Ln(OPrsup(i))(mea) 2 , Ln(mea) 3 , Ln(OPrsup(i))(dea), Ln 2 (dea) 3 , Ln(dea)(deaH) and Ln(tea) (where Ln = Dy or Ho and mea, dea and tea are the anions of respective ethanolamine) were obtained and characterized by elemental analysis and IR spectra. (author)

  13. Synthesis and characterization of tetraphenylporphyrinate of dysprosium route dysprosium acetylacetonate.; Sintesis y caracterizacion de un porfirinato de disprosio via acetilacetonato de disprosio.

    Energy Technology Data Exchange (ETDEWEB)

    Martinez M, V

    1993-12-31

    Dysprosium bis (tetraphenylporphyrinate) and bis (dysprosium) Tris (tetraphenylporphyrinate) were synthesized from dysprosium tetraphenylporphyrinate prepared in situ, and characterized by IR, UV-vis, TGA, DTA, EPR and magnetic susceptibility measurements. The double decker compound was obtained by direct oxidation of the HDy(TPP){sub 2} intermediate. The existence of the radical anion, (TPP){sup -} , in the double decker product was conformed by EPR spectrometry. Dysprosium monoporphyrinate was isolated and characterized by the same techniques. (Author).

  14. Method for producing dysprosium-iron-boron alloy powder

    International Nuclear Information System (INIS)

    Camp, F.E.; Wooden, S.A.

    1989-01-01

    A method for producing a dysprosium-iron alloy adapted for use in the manufacture of rare-earth element containing, iron-boron permanent magnets, the method including providing a particle mixture comprising dysprosium oxide, iron and calcium, compacting the particle mixture to produce a consolidated article, heating the article for a time at temperature to form a metallic compound comprising dysprosium and iron and to form calcium oxide, producing a particle mass of -35 mesh from the compact, washing the particle mass with water at a temperature no greater than 10 0 C to react to the calcium and to the calcium oxide therewith to form a calcium hydroxide, while preventing oxidation of the particle mass, and removing the calcium hydroxide from the particle mass

  15. Synthesis and thermal decomposition study of dysprosium trifluoroacetate

    DEFF Research Database (Denmark)

    Opata, Y. A.; Grivel, J.-C.

    2018-01-01

    A study of the thermal decomposition process of dysprosium trifluoroacetate hydrate under flowing argon is presented. Thermogravimetry, differential thermal analysis, evolved gas analysis and ex-situ x-ray diffraction techniques have been employed in the investigation. Three main stages were...

  16. Magnon contribution to electrical resistance of gadolinium-dysprosium alloy single crystals

    International Nuclear Information System (INIS)

    Nikitin, S.A.; Slobodchikov, S.S.; Solomkin, I.K.

    1978-01-01

    The magnon, phonon and interelectron collision contributions to the electric resistance of single crystals of gadolinium-dysprosium alloys were quantified. A relationship was found to exist between the electric resistance and the variation of the topology of the Fermi surface on melting of gadolinium with dysprosium. It was found that gadolinium-dysprosium alloys, which have no helicoidal magnetic structure in magnetically ordered state, feature a spin-spin helicoidal-type correlations in the paramagnetic field

  17. Compounds of divalent thulium, neodymium, and dysprosium

    International Nuclear Information System (INIS)

    Bochkarev, M.N.; Fedushkin, I.L.; Trifonov, A.A.; Fagin, A.A.; Kirillov, E.N.

    1998-01-01

    Full text: Judging on the Ln(II)/Ln(III) potentials Tm, Nd, and Dy are the first candidates after Sm, Eu, and Yb for the preparation of Ln(II) compounds. The first molecular Tm(II) derivatives, TmI 2 (DME) 3 (I), has been obtained recently by the reduction of TmI 3 with thulium metal in DME (1,2-dimethoxyethane). The tetrahydrofuran (THF) analogue, TmI 2 (THF) 5 , was synthesized similarly. In the case of TmBI 3 and TmCl 3 the same reaction does not occur. The compound I is inert toward naphthalene, anthracene, phenylacetylene, CpH, (Me 3 Si) 2 NH, 2,4,6-t-Bu 3 C 6 H 2 OH, Cp 2 V, Cp 2 Fe, or Cp 3 Er. The reactions of I with PhOH, Ph 3 COH, 3,6-t-Bu 2 C 6 H 2 (OH) 2 -1,2 (Cat), and calixarene (Cal) produce, Ph 3 COTmI 2 (DME) 2 , (Cat)TmI(DME) 2 , and (Cal)TmI, correspondingly. The attempts to use I for preparation of the other Tm(II) complexes failed. In all cases (reactions with C 10 H 8 Li, CpK, [1,3-(Me 3 Si) 2 C 5 H 3 ]MgCl, and [Cp'-SiMe 2 -Ind']K 2 ) the Tm(III) derivatives (respectively, (C 10 H 8 Tm) 2 C 10 H 8 , Cp 3 Tm, [1,3-(Me 3 Si) 2 C 5 H 3 ] 2 TmCl, and Cp'-SiMe 2 -Ind')TmI) were obtained. The new stable Tm(II) complex, PhOTmI(DME) 2 (II), has been synthesized by the reduction of I with potassium metal in DME. The product was isolated as the green crystals with μ eff 4.6 BM. Unlike TmI 3 , NdI 3 and DyI 3 can not be reduced by metallic neodymium, dysprosium or sodium in DME or THF. Re-investigation of the product formed in the reaction of NdCl 3 with a lack of Li and naphthalene which was claimed before as NdCl 2 (THF) 2 has shown that this is a mixture of Nd(III) naphthalene complexes of the type [(NdCl 2 (THF) 2 ]nC 10 H 8 (n = 4- 7) (III). Nevertheless the product may be used instead of NdCl 2 for the preparation of RNdCl 2 type complexes. The reactions of III with t-BuNCH=CHNBu-t (DAD), PhCH=CHCH=CHPh (DBD), and PhCH=CHPh afford (DAD)NdCl 2 (THF) 2 , (DBD)[NdCl 2 (THF) 2 ] 2 , and (PhCHCHPh)[NdCl 2 ] 2 (THF) 3 , respectively. The iodides of Nd

  18. Properties of Polydisperse Tin-doped Dysprosium and Indium Oxides

    Directory of Open Access Journals (Sweden)

    Malinovskaya Tatyana

    2017-01-01

    Full Text Available The results of investigations of the complex permittivity, diffuse-reflectance, and characteristics of crystal lattices of tin-doped indium and dysprosium oxides are presented. Using the methods of spectroscopy and X-ray diffraction analysis, it is shown that doping of indium oxide with tin results in a significant increase of the components of the indium oxide complex permittivity and an appearance of the plasma resonance in its diffuse-reflectance spectra. This indicates the appearance of charge carriers with the concentration of more than 1021 cm−3 in the materials. On the other hand, doping of the dysprosium oxide with the same amount of tin has no effect on its optical and electromagnetic properties.

  19. Charge transfer cross sections for dysprosium and cerium

    Energy Technology Data Exchange (ETDEWEB)

    Adachi, Hajime; Tamura, Koji; Okazaki, Tetsuji; Shibata, Takemasa [Japan Atomic Energy Research Inst., Tokai, Ibaraki (Japan). Tokai Research Establishment

    1998-06-01

    Symmetric resonant charge transfer cross sections between singly ionized ions and the parent atoms were measured for dysprosium and cerium in the impact energy of 200-2000eV. The cross sections were determined from the ratio between the number of ions produced by charge transfer and those in primary ion beam. The primary ion beam was produced by a laser ion source in which their atoms were ionized by laser resonant photo-ionization. The slow ions produced by charge transfer and fast primary ions were detected with Faraday cups. The obtained cross sections were (1.82{+-}0.14) x 10{sup -14} cm{sup 2} for dysprosium and (0.88{+-}0.12) x 10{sup -14} cm{sup 2} for cerium in the above energy range. The difference of these values can mostly be explained by considering the electron configurations of these atoms and ions. (author)

  20. Charge transfer cross sections for dysprosium and cerium

    International Nuclear Information System (INIS)

    Adachi, Hajime; Tamura, Koji; Okazaki, Tetsuji; Shibata, Takemasa

    1998-06-01

    Symmetric resonant charge transfer cross sections between singly ionized ions and the parent atoms were measured for dysprosium and cerium in the impact energy of 200-2000eV. The cross sections were determined from the ratio between the number of ions produced by charge transfer and those in primary ion beam. The primary ion beam was produced by a laser ion source in which their atoms were ionized by laser resonant photo-ionization. The slow ions produced by charge transfer and fast primary ions were detected with Faraday cups. The obtained cross sections were (1.82±0.14) x 10 -14 cm 2 for dysprosium and (0.88±0.12) x 10 -14 cm 2 for cerium in the above energy range. The difference of these values can mostly be explained by considering the electron configurations of these atoms and ions. (author)

  1. Neutron capture measurements and resonance parameters of dysprosium

    Energy Technology Data Exchange (ETDEWEB)

    Shin, S.G.; Kye, Y.U.; Namkung, W.; Cho, M.H. [Pohang University of Science and Technology, Division of Advanced Nuclear Engineering, Pohang, Gyeongbuk (Korea, Republic of); Kang, Y.R.; Lee, M.W. [Dongnam Inst. of Radiological and Medical Sciences, Research Center, Busan (Korea, Republic of); Kim, G.N. [Kyungpook National University, Department of Physics, Daegu (Korea, Republic of); Ro, T.I. [Dong-A University, Department of Physics, Busan (Korea, Republic of); Danon, Y.; Williams, D. [Rensselaer Polytechnic Institute, Department of Mechanical, Aerospace, and Nuclear Engineering, Troy, NY (United States); Leinweber, G.; Block, R.C.; Barry, D.P.; Rapp, M.J. [Naval Nuclear Laboratory, Knolls Atomic Power Laboratory, Schenectady, NY (United States)

    2017-10-15

    Neutron capture yields of dysprosium isotopes ({sup 161}Dy, {sup 162}Dy, {sup 163}Dy, and {sup 164}Dy) were measured using the time-of-flight method with a 16 segment sodium iodide multiplicity detector. The measurements were made at the 25m flight station at the Gaerttner LINAC Center at Rensselaer Polytechnic Institute. Resonance parameters were obtained using the multilevel R-matrix Bayesian code SAMMY. The neutron capture data for four enriched dysprosium isotopes and one natural dysprosium sample were sequentially fitted. New resonances not listed in ENDF/B-VII.1 were observed. There were 29 and 17 new resonances from {sup 161}Dy and {sup 163}Dy isotopes, respectively. Six resonances from {sup 161}Dy isotope, two resonances from {sup 163}Dy, and four resonances from {sup 164}Dy were not observed. The capture resonance integrals of each isotope were calculated with the resulting resonance parameters and those of ENDF/B-VII.1 in the energy region from 0.5 eV to 20 MeV and were compared to the capture resonance integrals with the resonance parameters from ENDF/B-VII.1. A resonance integral value of the natural dysprosium calculated with present resonance parameters was 1405 ± 3.5 barn. The value is ∝ 0.3% higher than that obtained with the ENDF/B-VII.1 parameters. The distributions of the present and ENDF/B-VII.1 neutron widths were compared to a Porter-Thomas distribution. Neutron strength functions for {sup 161}Dy and {sup 163}Dy were calculated with the present resonance parameters and both values were in between the values of ''Atlas of Neutron Resonances'' and ENDF/B-VII.1. The present radiation width distributions of {sup 161}Dy and {sup 163}Dy were fitted with the χ{sup 2} distribution by varying the degrees of freedom. (orig.)

  2. The development of dysprosium-165 hydroxide macroaggregates for radiation synovectomy

    International Nuclear Information System (INIS)

    McLaren, A.B.; Hetherington, E.L.R.; Maddalena, D.J.; Snowden, G.M.

    1988-06-01

    The development of a dysprosium-165 product, Dy-HMA, which is suitable for the radiation synovectomy of arthritic joints is described. Dysprosium-165 is a short-lived (t 1/2 = 139 min) beta-emitter produced by the neutron irradiation of natural dysprosium. Dy-HMA is a suspension of macroaggregated hydroxide particles in saline with the majority of particles in the 3-5 μm range. Studies in rabbits have demonstrated minimal leakage following the intra-articular injection of a knee joint. At 24 hours, the accumulation in the liver is about 0.003% of the injected dose and there is considerably less in other organs and tissue. The use of Dy-HMA has considerable advantages over the presently used yttrium-90 products. The undesired leakage to and subsequent irradiation of other organs is considerably reduced. The period of hospitalisation is reduced from four days to one and the production of 165 Dy in Australia will overcome the difficulties of supply 90 Y from overseas. 21 refs., 1 fig., 18 tabs

  3. Dosimetric properties of dysprosium doped lithium borate glass irradiated by 6 MV photons

    International Nuclear Information System (INIS)

    Ab Rasid, A.; Wagiran, H.; Hashim, S.; Ibrahim, Z.; Ali, H.

    2015-01-01

    Undoped and dysprosium doped lithium borate glass system with empirical formula (70–x) B 2 O 3 –30 Li 2 O–(x) Dy 2 O 3 (x=0.1, 0.3, 0.5, 0.7, 1.0 mol%) were prepared using the melt-quenching technique. The dosimetric measurements were performed by irradiating the samples to 6 MV photon beam using linear accelerator (LINAC) over a dose range of 0.5–5.0 Gy. The glass series of dysprosium doped lithium borate glass produced the best thermoluminescence (TL) glow curve with the highest intensity peak from sample with 1.0 mol% Dy 2 O 3 concentration. Minimum detectable dose was detected at 2.24 mGy, good linearity of regression coefficient, high reproducibility and high sensitivity compared to the undoped glass are from 1.0 mol% dysprosium doped lithium borate glass. The results indicated that the series of dysprosium doped lithium glasses have a great potential to be considered as a thermoluminescence dosimetry (TLD). - Highlights: • TL response of undoped and dysprosium doped lithium borate glass subjected to 6 MV photons irradiation at low dose range. • TL linear response of dysprosium doped lithium borate glass. • The sensitivity of dysprosium doped lithium borate glass is approximately 93 times higher than undoped glass

  4. Elevated temperature study of Nd-Fe-B--based magnets with cobalt and dysprosium additions

    International Nuclear Information System (INIS)

    Gauder, D.R.; Froning, M.H.; White, R.J.; Ray, A.E.

    1988-01-01

    This paper discusses the elevated temperature performance of Nd-Fe-B magnets containing 0--15 wt. % cobalt substitutions for iron and 0--10 wt. % dysprosium substitutions for neodymium. Test samples were prepared using conventional powder metallurgy techniques. Elevated temperature hysteresis loop and open-circuit measurements were performed on the samples to investigate irreversible losses and long term aging losses at 150 0 C. Magnets with high amounts of both cobalt and dysprosium exhibited lower losses of coercivity and magnetization. Dysprosium had more influence on the elevated temperature performance of the material than did cobalt

  5. Study on the electrochemical of the metal deposition from ionic liquids for lithium, titanium and dysprosium

    International Nuclear Information System (INIS)

    Berger, Claudia A.

    2017-01-01

    The thesis was aimed to the characterization of electrochemically deposited film of lithium, titanium and dysprosium on Au(111) from different ionic liquids, finally dysprosium on neodymium-iron-boron magnate for industrial applications. The investigation of the deposits were performed using cyclic voltametry, in-situ scanning tunneling microscopy, electrochemical quartz microbalance, XPS and Auger electron spectroscopy. The sample preparation is described in detail. The deposition rate showed a significant temperature dependence.

  6. A terminal fluoride ligand generates axial magnetic anisotropy in dysprosium complexes

    Energy Technology Data Exchange (ETDEWEB)

    Norel, Lucie [Department of Chemistry, University of California, Berkeley, CA (United States); Univ Rennes, CNRS, ISCR (Institut des Sciences Chimiques de Rennes) - UMR 6226, Rennes (France); Darago, Lucy E.; Chakarawet, Khetpakorn; Gonzalez, Miguel I.; Olshansky, Jacob H.; Long, Jeffrey R. [Department of Chemistry, University of California, Berkeley, CA (United States); Le Guennic, Boris; Rigaut, Stephane [Univ Rennes, CNRS, ISCR (Institut des Sciences Chimiques de Rennes) - UMR 6226, Rennes (France)

    2018-02-12

    The first dysprosium complexes with a terminal fluoride ligand are obtained as air-stable compounds. The strong, highly electrostatic dysprosium-fluoride bond generates a large axial crystal-field splitting of the J=15/2 ground state, as evidenced by high-resolution luminescence spectroscopy and correlated with the single-molecule magnet behavior through experimental magnetic susceptibility data and ab initio calculations. (copyright 2018 Wiley-VCH Verlag GmbH and Co. KGaA, Weinheim)

  7. Terbium and dysprosium complexes luminescence at low temperatures

    Energy Technology Data Exchange (ETDEWEB)

    Meshkova, S B; Kravchenko, T B; Kononenko, L.I.; Poluehktov, N S [AN Ukrainskoj SSR, Odessa. Fiziko-Khimicheskij Inst.

    1979-01-01

    The variation is studied of the luminescence intensity of terbium and dysprosium complexes used in the analysis as solutions are cooled down to the liquid nitrogen temperature. Three groups of methods have been studied: observation of fluorescence of aqueous solutions, precipitate and extract suspensions in organic solvents. The brightest luminescence and greatest increase in luminescence intensity are observed at freezing of complex solvents with 1,2-dioxybenzene-3,5-disulfonic acid (DBSA) and iminodiacetic acid (IDA) and DBSA+EDTA, as well as in the case of benzene extracting of complexes with phenanthroline and salicylic acid. Otherwise the intensity increases 2-14-fold and for the complex of terbium with acetoacetic ester 36-fold.

  8. Dysprosium (holmium) determination in the presence of erbium and dysprosium (holmium, erbium) determination in the presence of cerium

    International Nuclear Information System (INIS)

    Tolubara, A.I.; Kochubej, A.I.; Usatenko, Yu.I.

    1978-01-01

    Effect of salicylic acid upon complex formation in the systems REE - boronsulfoalizarinate, REE - oxine and REE - boronsulfoalizarinate - oxine is investigated. Comparison of optical characteristics of the above systems in the absence and in the presence of salicylic acid is carried out. It is established that in all the cases the effect of salicylic acid depends both on the nature of REE and the ratio of all the components of the system. Under certain conditions the given dependence is observed only for erbium complexes. Extraction-photometric methods of dysprosium and holmium determination in the presence of equal erbium amounts, as well as holmium and erbium determination in the presence of cerium equal amounts is developed

  9. Dysprosium (holmium) determination in the presence of erbium and dysprosium (holmium, erbium) determination in the presence of cerium

    Energy Technology Data Exchange (ETDEWEB)

    Tolubara, A I; Kochubei, A I; Usatenko, Yu I

    1978-01-01

    Effect of salicylic acid upon complex formation in the systems REE - boronsulfoalizarinate, REE - oxine and REE - boronsulfoalizarinate - oxine is investigated. Comparison of optical characteristics of the above systems in the absence and in the presence of salicylic acid is carried out. It is established that in all the cases the effect of salicylic acid depends both on the nature of REE and the ratio of all the components of the system. Under certain conditions the given dependence is observed only for erbium complexes. Extraction-photometric methods of dysprosium and holmium determination in the presence of equal erbium amounts, as well as holmium and erbium determination in the presence of cerium equal amounts is developed.

  10. Isotopic shifts and configuration mixing in the dysprosium II spectrum

    International Nuclear Information System (INIS)

    Aufmuth, P.

    1977-01-01

    Using a photoelectric Fabry-Perot spectrometer with digital data acquisition, the isotopic shifts of all stable dysprosium isotopes (Z = 66, A = 156, 158, 160, 161, 162, 163, 164) have been measured in transitions from the groundstate configuration 4f 10 6s to the excited configurations 4f 9 5d6s, 4f 9 5d 2 , and 4f 10 6p of the spark spectrum. Mass and volume effects have been seperated; the results are compared with arc spectrum measurements. From the volume effect of a pure s-p transition the change of the mean electric quadratic nuclear radius delta 2 > has been calculated. In order to test fine structure calculations of the Dy II spectrum, the isotopic shifts of 29 lines of the isotopes 162 Dy and 164 Dy have been measured. Based on the sharing rule, the reported configuration mixing could be confirmed in principle; for one energy level (E = 22908 K) the asignement has been proved to be false, in the case of three other levels (E = 22467, 22672, and 28885 K) the asignement is doubtfull. For the ground state levels 4f 10 6s 6 I the influence of relativistic effects could be proved; these effects can be interpreted in the framework of a parametric representation of the isotopic shift. The order of magnitude of the crossed second order effects has been estimated. (orig.) [de

  11. Low Field Magnetic and Thermal Hysteresis in Antiferromagnetic Dysprosium

    Directory of Open Access Journals (Sweden)

    Iuliia Liubimova

    2017-06-01

    Full Text Available Magnetic and thermal hysteresis (difference in magnetic properties on cooling and heating have been studied in polycrystalline Dy (dysprosium between 80 and 250 K using measurements of the reversible Villari effect and alternating current (AC susceptibility. We argue that measurement of the reversible Villari effect in the antiferromagnetic phase is a more sensitive method to detect magnetic hysteresis than the registration of conventional B(H loops. We found that the Villari point, recently reported in the antiferromagnetic phase of Dy at 166 K, controls the essential features of magnetic hysteresis and AC susceptibility on heating from the ferromagnetic state: (i thermal hysteresis in AC susceptibility and in the reversible Villari effect disappears abruptly at the temperature of the Villari point; (ii the imaginary part of AC susceptibility is strongly frequency dependent, but only up to the temperature of the Villari point; (iii the imaginary part of the susceptibility drops sharply also at the Villari point. We attribute these effects observed at the Villari point to the disappearance of the residual ferromagnetic phase. The strong influence of the Villari point on several magnetic properties allows this temperature to be ranked almost as important as the Curie and Néel temperatures in Dy and likely also for other rare earth elements and their alloys.

  12. Kinetics of the nitridation of dysprosium during mechanochemical processing

    Energy Technology Data Exchange (ETDEWEB)

    Alanko, Gordon A.; Osterberg, Daniel D.; Jaques, Brian J. [Department of Materials Science and Engineering, College of Engineering, Boise State University, 1910 University Drive, Boise, ID 83725 (United States); Hurley, Michael F. [Department of Materials Science and Engineering, College of Engineering, Boise State University, 1910 University Drive, Boise, ID 83725 (United States); Center for Advanced Energy Studies, 995 University Boulevard, Idaho Falls, ID 83401 (United States); Butt, Darryl P., E-mail: darrylbutt@boisestate.edu [Department of Materials Science and Engineering, College of Engineering, Boise State University, 1910 University Drive, Boise, ID 83725 (United States); Center for Advanced Energy Studies, 995 University Boulevard, Idaho Falls, ID 83401 (United States)

    2015-01-25

    Highlights: • DyN was mechanochemically synthesized by milling pure metal under nitrogen. • Temperature and pressure were monitored to investigate reaction progress. • The effects of metal adhered to media on the impact energetics was measured. • The reactive milling kinetics are described in terms of reactive surface formation. - Abstract: Dysprosium nitride was synthesized by the reactive milling of the rare earth metal under 400 kPa nitrogen gas in a planetary ball mill. The nitrogen consumption rate was calculated from in situ temperature and pressure measurements to find the reaction extent as a function of milling time at milling speeds from 350 to 650 rpm. The results are analyzed in terms of a fundamental milling dynamics model in which the input milling energy is the primary driving force for reaction and the rate limiting step of the nitridation kinetics is the formation of chemically active surfaces. The model differs from traditional gas–solid reactions which are often limited by diffusion of a species through a surface layer or by dissociation of the gas molecule. These results give fresh insight into reactive gas–solid milling kinetics.

  13. Systems of pyridine, piperidine, piperazine, morpholine hydrochlorides-terbium (dysprosium) chloride-water

    International Nuclear Information System (INIS)

    Gajfutdinova, R.K.; Sharafutdinova, A.A.; Murinov, Yu.I.

    1988-01-01

    The isothermal cross section method at 25 and 50 deg C is applied to study pyridine hydrochloride-terbium chloride-water (1) piperidine hydrochloride-dysprosium chloride-water (2), piperazine dihydrochloride-dysprosium chloride-water (3) and morpholine hydrochloride-terbium chloride (4) systems. Solubility isotherma prove the formation of incongruently soluble compound of the TbCl 3 x6C 5 H 5 NxHCl composition systems (1). The individuality of the new solid phase is proved by the chemical and DTA methods. Systems (2-4) are of a simple eutonic type

  14. 17 CFR 171.12 - Settlement.

    Science.gov (United States)

    2010-04-01

    ... 17 Commodity and Securities Exchanges 1 2010-04-01 2010-04-01 false Settlement. 171.12 Section 171... RESPONSIBILITY ACTIONS General Provisions § 171.12 Settlement. At any time before the Commission has reached a... settlement agreement. If, in its view, the settlement is consistent with the public interest, the Commission...

  15. 34 CFR 668.171 - General.

    Science.gov (United States)

    2010-07-01

    ... 34 Education 3 2010-07-01 2010-07-01 false General. 668.171 Section 668.171 Education Regulations of the Offices of the Department of Education (Continued) OFFICE OF POSTSECONDARY EDUCATION, DEPARTMENT OF EDUCATION STUDENT ASSISTANCE GENERAL PROVISIONS Financial Responsibility § 668.171 General. (a...

  16. 22 CFR 171.21 - Declassification review.

    Science.gov (United States)

    2010-04-01

    ... 22 Foreign Relations 1 2010-04-01 2010-04-01 false Declassification review. 171.21 Section 171.21 Foreign Relations DEPARTMENT OF STATE ACCESS TO INFORMATION AVAILABILITY OF INFORMATION AND RECORDS TO THE PUBLIC Executive Order 12958 Provisions § 171.21 Declassification review. (a) Scope. All information...

  17. 22 CFR 171.22 - Appeals.

    Science.gov (United States)

    2010-04-01

    ... 22 Foreign Relations 1 2010-04-01 2010-04-01 false Appeals. 171.22 Section 171.22 Foreign Relations DEPARTMENT OF STATE ACCESS TO INFORMATION AVAILABILITY OF INFORMATION AND RECORDS TO THE PUBLIC Executive Order 12958 Provisions § 171.22 Appeals. Any denial of a mandatory declassification review request...

  18. 14 CFR 171.33 - Reports.

    Science.gov (United States)

    2010-01-01

    ... 14 Aeronautics and Space 3 2010-01-01 2010-01-01 false Reports. 171.33 Section 171.33 Aeronautics... FACILITIES NON-FEDERAL NAVIGATION FACILITIES Nondirectional Radio Beacon Facilities § 171.33 Reports. The owner of each facility to which this subpart applies shall make the following reports, at the times...

  19. 14 CFR 171.53 - Reports.

    Science.gov (United States)

    2010-01-01

    ... 14 Aeronautics and Space 3 2010-01-01 2010-01-01 false Reports. 171.53 Section 171.53 Aeronautics... FACILITIES NON-FEDERAL NAVIGATION FACILITIES Instrument Landing System (ILS) Facilities § 171.53 Reports. The owner of each facility to which this subpart applies shall make the following reports, at the times...

  20. 14 CFR 171.13 - Reports.

    Science.gov (United States)

    2010-01-01

    ... 14 Aeronautics and Space 3 2010-01-01 2010-01-01 false Reports. 171.13 Section 171.13 Aeronautics... FACILITIES NON-FEDERAL NAVIGATION FACILITIES VOR Facilities § 171.13 Reports. The owner of each facility to which this subpart applies shall make the following reports on forms furnished by the FAA, at the times...

  1. 14 CFR 171.213 - Reports.

    Science.gov (United States)

    2010-01-01

    ... 14 Aeronautics and Space 3 2010-01-01 2010-01-01 false Reports. 171.213 Section 171.213... FACILITIES NON-FEDERAL NAVIGATION FACILITIES VHF Marker Beacons § 171.213 Reports. The owner of each facility to which this subpart applies shall make the following reports, at the times indicated, to the...

  2. 14 CFR 171.163 - Reports.

    Science.gov (United States)

    2010-01-01

    ... 14 Aeronautics and Space 3 2010-01-01 2010-01-01 false Reports. 171.163 Section 171.163... FACILITIES NON-FEDERAL NAVIGATION FACILITIES Distance Measuring Equipment (DME) § 171.163 Reports. The owner of each facility to which this subpart applies shall make the following reports on forms furnished by...

  3. 14 CFR 171.117 - Reports.

    Science.gov (United States)

    2010-01-01

    ... 14 Aeronautics and Space 3 2010-01-01 2010-01-01 false Reports. 171.117 Section 171.117... FACILITIES NON-FEDERAL NAVIGATION FACILITIES Simplified Directional Facility (SDF) § 171.117 Reports. The owner of each facility to which this subpart applies shall make the following reports, at the time...

  4. 7 CFR 1150.171 - Reports.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 9 2010-01-01 2009-01-01 true Reports. 1150.171 Section 1150.171 Agriculture... Order Reports, Books and Records § 1150.171 Reports. Each producer marketing milk of that producer's own... collection of the assessment under § 1150.152 shall be required to report at the time for remitting...

  5. 22 CFR 171.13 - Business information.

    Science.gov (United States)

    2010-04-01

    ... 22 Foreign Relations 1 2010-04-01 2010-04-01 false Business information. 171.13 Section 171.13 Foreign Relations DEPARTMENT OF STATE ACCESS TO INFORMATION AVAILABILITY OF INFORMATION AND RECORDS TO THE PUBLIC Freedom of Information Act Provisions § 171.13 Business information. (a) Business information...

  6. 49 CFR 171.3 - Hazardous waste.

    Science.gov (United States)

    2010-10-01

    ... 49 Transportation 2 2010-10-01 2010-10-01 false Hazardous waste. 171.3 Section 171.3... waste. (a) No person may offer for transportation or transport a hazardous waste (as defined in § 171.8... waste for which a manifest is required unless that person: (1) Has marked each motor vehicle used to...

  7. 46 CFR 160.171-9 - Construction.

    Science.gov (United States)

    2010-10-01

    ... 46 Shipping 6 2010-10-01 2010-10-01 false Construction. 160.171-9 Section 160.171-9 Shipping COAST GUARD, DEPARTMENT OF HOMELAND SECURITY (CONTINUED) EQUIPMENT, CONSTRUCTION, AND MATERIALS: SPECIFICATIONS AND APPROVAL LIFESAVING EQUIPMENT Immersion Suits § 160.171-9 Construction. (a) General. Each...

  8. 46 CFR 160.171-11 - Performance.

    Science.gov (United States)

    2010-10-01

    ... 46 Shipping 6 2010-10-01 2010-10-01 false Performance. 160.171-11 Section 160.171-11 Shipping COAST GUARD, DEPARTMENT OF HOMELAND SECURITY (CONTINUED) EQUIPMENT, CONSTRUCTION, AND MATERIALS: SPECIFICATIONS AND APPROVAL LIFESAVING EQUIPMENT Immersion Suits § 160.171-11 Performance. (a) Buoyancy. Each...

  9. 7 CFR 3015.171 - Unused supplies.

    Science.gov (United States)

    2010-01-01

    ..., DEPARTMENT OF AGRICULTURE UNIFORM FEDERAL ASSISTANCE REGULATIONS Property § 3015.171 Unused supplies. (a) If unused supplies exceeding $1,000 in total aggregate market value are left over upon termination or... 7 Agriculture 15 2010-01-01 2010-01-01 false Unused supplies. 3015.171 Section 3015.171...

  10. Exploration of dysprosium: the most critical element for Japan

    Science.gov (United States)

    Watanabe, Y.

    2012-04-01

    Dysprosium (Dy), one of the heavy rare earth elements, is used mainly as an additive for NdFeB permanent magnets which are installed in various modern industrial products such as voice coil motors in computers, factory automation machinery, hybrid and electric vehicles, home electronics, and wind turbine, to improve heat resistance of the magnets. Dy has been produced about 2,000t per year from the ores from ion adsorption type deposits in southern China. However, the produced amount of Dy was significantly reduced in 2011 in China due to reservation of heavy rare earth resources and protection of natural environment, resulting in soaring of Dy price in the world. In order to respond the increasing demand of Dy, unconventional supply sources are inevitably developed, in addition to heavy rare earth enriched ion adsorption type deposits outside China. Heavy rare earth elements including Dy are dominantly hosted in xenotime, fergusonite, zircon, eudialyte, keiviite, kainosite, iimoriite, etc. Concentration of xenotime is found in placer deposits in Malaysia and India, hydrothermal deposits associated with unconformity-type uranium mineralization (Athabasca basin in Canada, Western Australia), iron-oxide fluorite mineralization (South Africa) and Sn-bearing alkaline granite (Brazil). Zircon and fergusontie concentration is found as igneous and hydrothermal products in peralkaline syenite, alkaline granite and pegmatite (e.g., Nechalacho in Canada). Eudialyte concentration is found in some peralkaline syenite bodies in Greenland, Canada, Sweden and Russia. Among these sources, large Dy resources are estimated in the deposits hosted in peralkaline rocks (Nechalacho: 79,000t, Kvanefjeld: 49,000t, Norra Karr: 15,700t, etc.) compared to the present demand of Dy. Thus, Dy will be supplied from the deposits associated with peralkaline and alkaline deposits in future instead of ion adsorption type deposits in southern China.

  11. Dosimetric properties of dysprosium doped lithium borate glass irradiated by 6 MV photons

    Science.gov (United States)

    Ab Rasid, A.; Wagiran, H.; Hashim, S.; Ibrahim, Z.; Ali, H.

    2015-07-01

    Undoped and dysprosium doped lithium borate glass system with empirical formula (70-x) B2O3-30 Li2O-(x) Dy2O3 (x=0.1, 0.3, 0.5, 0.7, 1.0 mol%) were prepared using the melt-quenching technique. The dosimetric measurements were performed by irradiating the samples to 6 MV photon beam using linear accelerator (LINAC) over a dose range of 0.5-5.0 Gy. The glass series of dysprosium doped lithium borate glass produced the best thermoluminescence (TL) glow curve with the highest intensity peak from sample with 1.0 mol% Dy2O3 concentration. Minimum detectable dose was detected at 2.24 mGy, good linearity of regression coefficient, high reproducibility and high sensitivity compared to the undoped glass are from 1.0 mol% dysprosium doped lithium borate glass. The results indicated that the series of dysprosium doped lithium glasses have a great potential to be considered as a thermoluminescence dosimetry (TLD).

  12. In situ characterization of the nitridation of dysprosium during mechanochemical processing

    Energy Technology Data Exchange (ETDEWEB)

    Jaques, Brian J.; Osterberg, Daniel D.; Alanko, Gordon A.; Tamrakar, Sumit; Smith, Cole R.; Hurley, Michael F.; Butt, Darryl P., E-mail: DarrylButt@BoiseState.edu

    2015-01-15

    Highlights: • A nitridation reaction in a high energy planetary ball mill was monitored in situ. • Dysprosium mononitride was synthesized from Dy at low temperatures in short times. • Ideal gas law and in situ temperature and pressure used to assess reaction extent. • It is proposed that reaction rate is proportional to the creation of new surface. - Abstract: Processing of advanced nitride ceramics traditionally requires long durations at high temperatures and, in some cases, in hazardous atmospheres. In this study, dysprosium mononitride (DyN) was rapidly formed from elemental dysprosium in a closed system at ambient temperatures. An experimental procedure was developed to quantify the progress of the nitridation reaction during mechanochemical processing in a high energy planetary ball mill (HEBM) as a function of milling time and intensity using in situ temperature and pressure measurements, SEM, XRD, and particle size analysis. No intermediate phases were formed. It was found that the creation of fresh dysprosium surfaces dictates the rate of the nitridation reaction, which is a function of milling intensity and the number of milling media. These results show clearly that high purity nitrides can be synthesized with short processing times at low temperatures in a closed system requiring a relatively small processing footprint.

  13. A model for additive transport in metal halide lamps containing mercury and dysprosium tri-iodide

    NARCIS (Netherlands)

    Beks, M.L.; Haverlag, M.; Mullen, van der J.J.A.M.

    2008-01-01

    The distribution of additives in a metal halide lamp is examined through numerical modelling. A model for a lamp containing sodium iodide additives has been modified to study a discharge containing dysprosium tri-iodide salts. To study the complex chemistry the method of Gibbs minimization is used

  14. Neutronography of an intermediate phase in dysprosium near the Neel point

    Energy Technology Data Exchange (ETDEWEB)

    Bessergenev, V G; Gogava, V V; Kovalevskaya, Yu A; Mandzhavidze, A G; Fedorov, V M; Shilo, S I

    1985-11-25

    Neutronographical study of dysprosium magnetic structure near the point of magnetic disordering depending on thermal prehistory of the sample is carried out. Intermediate vortex phase transformed then into the helical one is shown to occur from the paramagnetic phase under cooling.

  15. Synthesis and X-ray structure of the dysprosium(III) complex derived ...

    African Journals Online (AJOL)

    Synthesis and X-ray structure of the dysprosium(III) complex derived from the ligand 5-chloro-1 ... Bulletin of the Chemical Society of Ethiopia ... synthesized and its crystal structure determined by single X-ray diffraction at room temperature.

  16. Dysprosium-containing layered double hydroxides nanoparticles intercalated with biologically active species as an approach for theranostic systems

    KAUST Repository

    Arratia-Quijada, Jenny

    2015-10-23

    A layered double hydroxide structure including dysprosium cations was prepared by co-precipitation. The nanoparticles showed a linear relationship with the reciprocal relaxation spin-lattice (T1) time of water protons which is reflected as contrast in aqueous suspensions analyzed by magnetic resonance imaging. The interlayer space of dysprosium containing LDH was successfully intercalated with folate, ibuprofen and gallate ions, which are key molecules for recognition of some cancer cells and treatment of diseases. The paramagnetic property of the dysprosium-containing LDH detected in this work beside the ability to transport drugs open up the opportunity to design theranostic materials in a single crystal phase with nanometric dimensions.

  17. Dysprosium-containing layered double hydroxides nanoparticles intercalated with biologically active species as an approach for theranostic systems

    KAUST Repository

    Arratia-Quijada, Jenny; Sá nchez Jimé nez, Cecilia; Gurinov, Andrei; Pé rez Centeno, Armando; Ceja Andrade, Israel; Carbajal Arí zaga, Gregorio Guadalupe

    2015-01-01

    A layered double hydroxide structure including dysprosium cations was prepared by co-precipitation. The nanoparticles showed a linear relationship with the reciprocal relaxation spin-lattice (T1) time of water protons which is reflected as contrast in aqueous suspensions analyzed by magnetic resonance imaging. The interlayer space of dysprosium containing LDH was successfully intercalated with folate, ibuprofen and gallate ions, which are key molecules for recognition of some cancer cells and treatment of diseases. The paramagnetic property of the dysprosium-containing LDH detected in this work beside the ability to transport drugs open up the opportunity to design theranostic materials in a single crystal phase with nanometric dimensions.

  18. Dysprosium complexes with the tetraphenylporphyrin macrocyclic ligand; Complejos de disprosio con el ligante macrociclico tetrafenilporfirina

    Energy Technology Data Exchange (ETDEWEB)

    Martinez M, V.; Padilla, J.; Ramirez, F.M

    1992-04-15

    In this report, the results obtained on the synthesis, characterization and study of the chemical behavior of dysprosium complex with the acetylacetone chelating agent (Hacac) and the tetraphenylporphyrin macrocyclic ligand (H{sub 2}TFP) are given. Based on the literature but according to our necessities and interest, the appropriate methodology settled down from the synthesis of prime matters until the obtaining and characterization of the products. The acetyl acetonate complex was obtained of mono hydrated dysprosium [Dy(acac){sub 3}. H{sub 2}0] and trihydrated [Dy(acac){sub 3} .3 H{sub 2}0], the mono tetra phenyl porphyrinate [Dy(TFP)(acac). 2 ac] the double sandwich of the dysprosium porphyrinate [Dy(TFP){sub 2}] and the triple sandwich of the dysprosium porphyrinate [Dy(TFP){sub 3}. 2 TCB] (TCB = trichlorobenzene). Its were characterized by their melting points, solubility, IR, UV, TGA and DTA both first and besides the techniques already mentioned for NMR'H, RPE and Magnetic susceptibility the three last complexes. From the spectroscopic point of view, IR and RPE its suggested the existence of a complex of inverse mixed valence [Dy(TFP){sup 2-} (TFP) {sup 1-}] for the Dy(TFP){sub 2} as a result of the existence of the free radical (TFP' {sup 1-} and that it was not in none of the other porphyrin compounds. In the NMR'H spectra of the compounds were not observed signals in the region from 0 to 10 ppm that which shows that the dysprosium complexes in special those of the porphyrin type are highly paramagnetic and its could be used as displacement reagents, creators of images and contrast agents of great utility in these days in studies of NMR, technique today by today used in medical diagnoses. (Author)

  19. Dysprosium complexes with the tetraphenylporphyrin macrocyclic ligand; Complejos de disprosio con el ligante macrociclico tetrafenilporfirina

    Energy Technology Data Exchange (ETDEWEB)

    Martinez M, V; Padilla, J; Ramirez, F M

    1992-04-15

    In this report, the results obtained on the synthesis, characterization and study of the chemical behavior of dysprosium complex with the acetylacetone chelating agent (Hacac) and the tetraphenylporphyrin macrocyclic ligand (H{sub 2}TFP) are given. Based on the literature but according to our necessities and interest, the appropriate methodology settled down from the synthesis of prime matters until the obtaining and characterization of the products. The acetyl acetonate complex was obtained of mono hydrated dysprosium [Dy(acac){sub 3}. H{sub 2}0] and trihydrated [Dy(acac){sub 3} .3 H{sub 2}0], the mono tetra phenyl porphyrinate [Dy(TFP)(acac). 2 ac] the double sandwich of the dysprosium porphyrinate [Dy(TFP){sub 2}] and the triple sandwich of the dysprosium porphyrinate [Dy(TFP){sub 3}. 2 TCB] (TCB = trichlorobenzene). Its were characterized by their melting points, solubility, IR, UV, TGA and DTA both first and besides the techniques already mentioned for NMR'H, RPE and Magnetic susceptibility the three last complexes. From the spectroscopic point of view, IR and RPE its suggested the existence of a complex of inverse mixed valence [Dy(TFP){sup 2-} (TFP) {sup 1-}] for the Dy(TFP){sub 2} as a result of the existence of the free radical (TFP' {sup 1-} and that it was not in none of the other porphyrin compounds. In the NMR'H spectra of the compounds were not observed signals in the region from 0 to 10 ppm that which shows that the dysprosium complexes in special those of the porphyrin type are highly paramagnetic and its could be used as displacement reagents, creators of images and contrast agents of great utility in these days in studies of NMR, technique today by today used in medical diagnoses. (Author)

  20. Dysprosium, the balance problem, and wind power technology

    International Nuclear Information System (INIS)

    Elshkaki, Ayman; Graedel, T.E.

    2014-01-01

    Highlights: • We investigate the impacts of the increasing market share of wind power on the demand and supply of REE. • The analysis is carried out using a dynamic material flow and stock model and three scenarios for Dy supply. • The supply of Dy from all deposits will likely lead to an oversupply of the total REEs, Nd, La, Ce and Y. • The supply of Dy from critical REE or Dy rich deposits will likely lead to an oversupply of Ce and Y only. • Large quantities of thorium will be co-produced as a result of Dy demand that needs to be managed carefully. - Abstract: Wind power technology is one of the cleanest electricity generation technologies that are expected to have a substantial share in the future electricity mix. Nonetheless, the expected increase in the market share of wind technology has led to an increasing concern of the availability, production capacity and geographical concentration of the metals required for the technology, especially the rear earth elements (REE) neodymium (Nd) and the far less abundant dysprosium (Dy), and the impacts associated with their production. Moreover, Nd and Dy are coproduced with other rare earth metals mainly from iron, titanium, zirconium, and thorium deposits. Consequently, an increase in the demand for Nd and Dy in wind power technology and in their traditional applications may lead to an increase in the production of the host metals and other companion REE, with possible implications on their supply and demand. In this regard, we have used a dynamic material flow and stock model to study the impacts of the increasing demand for Nd and Dy on the supply and demand of the host metals and other companion REE. In one scenario, when the supply of Dy is covered by all current and expected producing deposits, the increase in the demand for Dy leads to an oversupply of 255 Gg of total REE and an oversupply of the coproduced REE Nd, La, Ce and Y. In the second and third scenarios, however, when the supply of Dy is

  1. Dysprosium-containing layered double hydroxides nanoparticles intercalated with biologically active species as an approach for theranostic systems

    Energy Technology Data Exchange (ETDEWEB)

    Arratia-Quijada, Jenny [Departamento de Ciencias de la Salud, Centro Universitario Tonalá, Universidad de Guadalajara, Av. Nuevo Periférico No. 555, C.P. 48525, Tonalá, Jalisco (Mexico); Sánchez Jiménez, Cecilia [Departamento de Química, Universidad de Guadalajara, Boulevard Marcelino García Barragán 1421, C.P. 44430, Guadalajara, Jalisco (Mexico); Gurinov, Andrey [Research Resources Center for Magnetic Resonance, St. Petersburg State University, Universitetskiy pr. 26, 198504 St. Petersburg (Russian Federation); NMR Core Lab, King Abdullah University of Science and Technology, Thuwal 23955-6900 (Saudi Arabia); Pérez Centeno, Armando; Ceja Andrade, Israel [Departamento de Física, Universidad de Guadalajara, Boulevard Marcelino García Barragán 1421, C.P. 44430, Guadalajara, Jalisco (Mexico); Carbajal Arízaga, Gregorio Guadalupe, E-mail: gregoriocarbajal@yahoo.com.mx [Departamento de Química, Universidad de Guadalajara, Boulevard Marcelino García Barragán 1421, C.P. 44430, Guadalajara, Jalisco (Mexico)

    2016-01-15

    Graphical abstract: - Highlights: • LDH structure including dysprosium was prepared by co-precipitation. • LDH was capable to produce contrast in the T1 mode of MRI. • LDH were intercalated with folate, ibuprofen and gallate ions. - Abstract: A layered double hydroxide structure including dysprosium cations was prepared by co-precipitation. The nanoparticles showed a linear relationship with the reciprocal relaxation spin-lattice (T1) time of water protons which is reflected as contrast in aqueous suspensions analyzed by magnetic resonance imaging. The interlayer space of dysprosium containing LDH was successfully intercalated with folate, ibuprofen and gallate ions, which are key molecules for recognition of some cancer cells and treatment of diseases. The paramagnetic property of the dysprosium-containing LDH detected in this work beside the ability to transport drugs open up the opportunity to design theranostic materials in a single crystal phase with nanometric dimensions.

  2. Dysprosium-containing layered double hydroxides nanoparticles intercalated with biologically active species as an approach for theranostic systems

    International Nuclear Information System (INIS)

    Arratia-Quijada, Jenny; Sánchez Jiménez, Cecilia; Gurinov, Andrey; Pérez Centeno, Armando; Ceja Andrade, Israel; Carbajal Arízaga, Gregorio Guadalupe

    2016-01-01

    Graphical abstract: - Highlights: • LDH structure including dysprosium was prepared by co-precipitation. • LDH was capable to produce contrast in the T1 mode of MRI. • LDH were intercalated with folate, ibuprofen and gallate ions. - Abstract: A layered double hydroxide structure including dysprosium cations was prepared by co-precipitation. The nanoparticles showed a linear relationship with the reciprocal relaxation spin-lattice (T1) time of water protons which is reflected as contrast in aqueous suspensions analyzed by magnetic resonance imaging. The interlayer space of dysprosium containing LDH was successfully intercalated with folate, ibuprofen and gallate ions, which are key molecules for recognition of some cancer cells and treatment of diseases. The paramagnetic property of the dysprosium-containing LDH detected in this work beside the ability to transport drugs open up the opportunity to design theranostic materials in a single crystal phase with nanometric dimensions.

  3. 21 CFR 17.1 - Scope.

    Science.gov (United States)

    2010-04-01

    ... 21 Food and Drugs 1 2010-04-01 2010-04-01 false Scope. 17.1 Section 17.1 Food and Drugs FOOD AND... Food, Drug, and Cosmetic Act (the act) authorizing civil money penalties for certain violations of the... trial data bank and section 303(f)(4) of the act authorizing civil money penalties for certain...

  4. 48 CFR 207.171-3 - Policy.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 3 2010-10-01 2010-10-01 false Policy. 207.171-3 Section... DEFENSE ACQUISITION PLANNING ACQUISITION PLANNING Acquisition Plans 207.171-3 Policy. DoD policy is to... it is anticipated that a prime contract will be awarded without adequate price competition, and the...

  5. 22 CFR 171.31 - Definitions.

    Science.gov (United States)

    2010-04-01

    ... 22 Foreign Relations 1 2010-04-01 2010-04-01 false Definitions. 171.31 Section 171.31 Foreign Relations DEPARTMENT OF STATE ACCESS TO INFORMATION AVAILABILITY OF INFORMATION AND RECORDS TO THE PUBLIC... Department, including, but not limited to education, financial transactions, medical history, and criminal or...

  6. 48 CFR 203.171-2 - Definition.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 3 2010-10-01 2010-10-01 false Definition. 203.171-2..., DEPARTMENT OF DEFENSE GENERAL IMPROPER BUSINESS PRACTICES AND PERSONAL CONFLICTS OF INTEREST Safeguards 203.171-2 Definition. Covered DoD official as used in this section, is defined in the clause at 252.203...

  7. 14 CFR 171.275 - Reports.

    Science.gov (United States)

    2010-01-01

    ... 14 Aeronautics and Space 3 2010-01-01 2010-01-01 false Reports. 171.275 Section 171.275... Reports. The owner of the ISMLS facility or his maintenance representative must make the following reports... the need for periodic maintenance visits to the facility, monthly reports from the remote monitoring...

  8. 22 CFR 171.12 - Processing requests.

    Science.gov (United States)

    2010-04-01

    ... inform the public concerning actual or alleged Federal Government activity. News media requesters would.... Ordinarily this means a breaking news story of general public interest. Information of historical interest... 22 Foreign Relations 1 2010-04-01 2010-04-01 false Processing requests. 171.12 Section 171.12...

  9. Dysprosium-Catalyzed Growth of Single-Walled Carbon Nanotube Arrays on Substrates

    Directory of Open Access Journals (Sweden)

    Qian Yong

    2009-01-01

    Full Text Available Abstract In this letter, we report that dysprosium is an effective catalyst for single-walled carbon nanotubes (SWNTs growth via a chemical vapor deposition (CVD process for the first time. Horizontally superlong well-oriented SWNT arrays on SiO2/Si wafer can be fabricated by EtOH-CVD under suitable conditions. The structure and properties are characterized by scanning electron microscopy, transition electron microscopy, Raman spectroscopy and atomic force microscopy. The results show that the SWNTs from dysprosium have better structural uniformity and better conductivity with fewer defects. This rare earth metal provides not only an alternative catalyst for SWNTs growth, but also a possible method to generate high percentage of superlong semiconducting SWNT arrays for various applications of nanoelectronic device.

  10. Sandwich-type tetrakis(phthalocyaninato) dysprosium-cadmium quadruple-decker SMM.

    Science.gov (United States)

    Wang, Hailong; Qian, Kang; Wang, Kang; Bian, Yongzhong; Jiang, Jianzhuang; Gao, Song

    2011-09-14

    Homoleptic tetrakis[2,3,9,10,16,17,23,24-octa(butyloxy)phthalocyaninato] dysprosium-cadmium quadruple-decker complex 1 was isolated in relatively good yield of 43% from a simple one-pot reaction. This compound represents the first sandwich-type tetrakis(phthalocyaninato) rare earth-cadmium quadruple-decker SMM that has been structurally characterized. This journal is © The Royal Society of Chemistry 2011

  11. {Delta}I = 2 energy staggering in normal deformed dysprosium nuclei

    Energy Technology Data Exchange (ETDEWEB)

    Riley, M.A.; Brown, T.B.; Archer, D.E. [Florida State Univ., Tallahassee, FL (United States)] [and others

    1996-12-31

    Very high spin states (I{ge}50{Dirac_h}) have been observed in {sup 155,156,157}Dy. The long regular band sequences, free from sharp backbending effects, observed in these dysprosium nuclei offer the possibility of investigating the occurence of any {Delta}I = 2 staggering in normal deformed nuclei. Employing the same analysis techniques as used in superdeformed nuclei, certain bands do indeed demonstrate an apparent staggering and this is discussed.

  12. Analysis of the x-ray spectrum emitted by laser-produced plasma of dysprosium

    International Nuclear Information System (INIS)

    Marcus, Gilad; Louzon, Einat; Henis, Zohar; Maman, Shlomo; Mandelbaum, Pinchas

    2007-01-01

    A detailed analysis of the x-ray spectrum (5-10.2 A ring ) emitted by laser-produced plasma of dysprosium (Dy) is given using ab initio calculations with the HULLAC relativistic code and isoelectronic trends. Resonance 3d-4p, 3d-nf (n=4 to 7), 3p-4s, and 3p-4d transitions of Ni I-like Dy XXXIX and neighboring ion satellite transitions (from Dy XXXIV to Dy XL) are identified

  13. Phosphor Dysprosium-Doped Layered Double Hydroxides Exchanged with Different Organic Functional Groups

    Directory of Open Access Journals (Sweden)

    David Ricardo Martínez Vargas

    2013-01-01

    Full Text Available The layers of a Zn/Al layered double hydroxide (LDH were doped with Dy3+ cations. Among some compositions, the Zn2+ : Al3+ : Dy3+ molar ratio equal to 30 : 9 : 1 presented a single crystalline phase. Organic anions with carboxylic, amino, sulfate, or phosphate functional groups were intercalated as single layers between LDH layers as confirmed by X-ray diffraction and infrared spectroscopy. Photoluminescence spectra of the nitrate intercalated LDH showed a wide emission band with strong intensity in the yellow region (around 574 nm, originated due to symmetry distortion of the octahedral coordination in dysprosium centers. Moreover, a broad red band emission was also detected apparently due to the presence of zinc oxide. The distorted symmetry of the dysprosium coordination environment, also confirmed by X-ray photoelectron spectroscopy analysis, was modified after the intercalation with phenyl phosphonate (PP, aspartate (Asp, adipate (Adip, and serinate (Ser anions; the emission as measured from PL spectra of these LDH was more intense in the blue region (ca. 486 nm, thus indicating an increase in symmetry of dysprosium octahedrons. The red emission band from zinc oxide kept the same intensity after intercalation of dodecyl sulfate (DDS. An additional emission of unknown origin at λ = 767 nm was present in all LDHs.

  14. Synovectomy of the rheumatoid knee using intra-articular injection of dysprosium-165-ferric hydroxide macroaggregates

    International Nuclear Information System (INIS)

    Sledge, C.B.; Zuckerman, J.D.; Shortkroff, S.; Zalutsky, M.R.; Venkatesan, P.; Snyder, M.A.; Barrett, W.P.

    1987-01-01

    One hundred and eleven patients who had seropositive rheumatoid arthritis and persistent synovitis of the knee were treated with intra-articular injection of 270 millicuries of dysprosium-165 bound to ferric hydroxide macroaggregates. A two-year follow-up was available for fifty-nine of the treated knees. Thirty-nine had a good result; nine, a fair result; and eleven, a poor result. Of the twenty-five knees that had Stage-I radiographic changes, nineteen had a good result. Of the thirty-four knees that had Stage-II radiographic changes, twenty showed a good result. Systemic spread of the radioactivity from the injected joint was minimum. The mean whole-body dose was calculated to be 0.3 rad and that to the liver twenty-four hours after injection, 3.2 rads. The results indicated that dysprosium-165-ferric hydroxide macroaggregate is an effective agent for performing radiation synovectomy, particularly in knees that have Stage-I radiographic changes. Because of the minimum rate of systemic spread of the dysprosium-165, it offers a definite advantage over agents that previously have been used

  15. Development and mastering of production of dysprosium hafnate as absorbing material for control rods of promising thermal neutron reactors

    International Nuclear Information System (INIS)

    Zakharov, A.V.; Risovany, V.D.; Muraleva, E.M.; Sokolov, V.F.

    2011-01-01

    The main advantages of dysprosium hafnate as an absorbing material for LWR control rods are the following: -) unlimited radiation resistance; - two absorbing components, Dy and Hf, increasing physical efficiency of the material compared to Dy 2 O 3 -TiO 2 and alloy 80% Ag - 15% In - 5% Cd; -) variability of physical efficiency by changing a composition, but maintaining other performance characteristics of the material; -) high process-ability due to the absence of phase transients and single-phase structure (solid solution); -) production of high density pellets. Lab-scale mastering of dysprosium hafnate pellets production showed a possibility of material synthesis using a solid-phase method, as well as of dysprosium hafnate pellets production by cold pressing and subsequent sintering. Within a whole range of examined compositions (23 mol% - 75 mol% Dy 2 O 3 ), a single-phase material with a highly radiation resistant fluorite-like structure was produced. Experiments on cold pressing and sintering of pellets confirmed a possibility of producing high quality dysprosium hafnate pellets from synthesized powder. A pilot batch of dysprosium hafnate pellets with standard sizes was produced. The standard sizes corresponded to the absorbing elements of the WWER-1000 control rods and met the main requirements to the absorbing element columns. The pilot batch size was approximately 6 kg. Acceptance testing of the pilot batch of dysprosium hafnate pellets was conducted, fulfillment of the requirements of technical conditions was checked and preirradiation properties of the pellets were examined. High quality of the produced pellets was confirmed, thus, demonstrating a real possibility of producing large batches of the dysprosium hafnate pellets. The next step is the production of test absorbing elements and cluster assemblies for the WWER-1000 control rods with their further installation for pilot operation at one of the Russian nuclear power plants

  16. Systematic study on surface and magnetostructural changes in Mn-substituted dysprosium ferrite by hydrothermal method

    Energy Technology Data Exchange (ETDEWEB)

    Rekha, G. [Department of Physics, College of Engineering Guindy, Anna University, Sardar Patel Road, Chennai 600025 (India); Tholkappiyan, R. [Department of Physics, College of Engineering Guindy, Anna University, Sardar Patel Road, Chennai 600025 (India); Department of Physics, College of Science, UAE University, Al-Ain 15551 (United Arab Emirates); Vishista, K., E-mail: raovishista@gmail.com [Department of Physics, College of Engineering Guindy, Anna University, Sardar Patel Road, Chennai 600025 (India); Hamed, Fathalla [Department of Physics, College of Science, UAE University, Al-Ain 15551 (United Arab Emirates)

    2016-11-01

    Highlights: • Garnet type Dy{sub 3}Fe{sub 5-x}Mn{sub x}O{sub 12} (x = 0–0.06) nanoparticles of 88.4–86.8 nm were synthesized by hydrothermal method. • The Dy, Mn, Fe and O elements in the ferrites were confirmed from XPS. • The multiple oxidation states of Fe and Mn ions, bonding energy and cationic distributions of the samples were examined by XPS. • The magnetic property shows ferromagnetic behavior from VSM technique. • The results from these studies are correlated with respect to Mn dopant. - Abstract: Dysprosium iron garnets are of scientific importance because of the wide range of magnetic properties that can be obtained in substituting dysprosium by a rare earth metal. In the present work, the effect of Mn substitution on magnetostructural changes in dysprosium ferrite nanoparticles is studied. Highly crystalline pure and Mn doped dysprosium ferrite nanoparticles were synthesized by hydrothermal method. The samples were calcined at 1100 °C for 2 h in air atmosphere which is followed by characterization using XRD, FT-IR analysis, SEM, XPS and VSM. The average crystallite size of synthesized samples were calculated by X-ray diffraction falls in the range of 88.4–86.8 nm and was found to be in cubic garnet structure. For further investigation of the structure and corresponding changes in the tetrahedral and octahedral stretching vibrational bonds, FT-IR was used. The synthesized samples consist of multiple oxidation (Fe{sup 3+} and Fe{sup 2+}) states for Fe ions and (Mn{sup 3+} and Mn{sup 2+}) Mn ions analyzed in three ways of Fe 2p and Mn 2p spectra from the XPS analysis. With respect to Mn dopant in Dy{sub 3}Fe{sub 5}O{sub 12}, the cationic distributions of elements were discussed from high resolution XPS spectra by peak position and shift, area, width. To find out the porous/void surface morphology of the sample, scanning electron microscopy was used. From XPS analysis, the presence of elements (Dy, Mn, Fe and O) and their composition in the

  17. Synthesis, structural characterization and in vitro testing of dysprosium containing silica particles as potential MRI contrast enhancing agents

    Energy Technology Data Exchange (ETDEWEB)

    Chiriac, L.B.; Trandafir, D.L. [Faculty of Physics & National Magnetic Resonance Center, Babeş-Bolyai University, Cluj-Napoca, RO-400084 (Romania); Interdisciplinary Research Institute on Bio-Nano-Sciences & Faculty of Physics, Babeş-Bolyai University, Cluj-Napoca, RO-400084 (Romania); Turcu, R.V.F. [Faculty of Physics & National Magnetic Resonance Center, Babeş-Bolyai University, Cluj-Napoca, RO-400084 (Romania); Todea, M. [Interdisciplinary Research Institute on Bio-Nano-Sciences & Faculty of Physics, Babeş-Bolyai University, Cluj-Napoca, RO-400084 (Romania); Simon, S., E-mail: simons@phys.ubbcluj.ro [Faculty of Physics & National Magnetic Resonance Center, Babeş-Bolyai University, Cluj-Napoca, RO-400084 (Romania); Interdisciplinary Research Institute on Bio-Nano-Sciences & Faculty of Physics, Babeş-Bolyai University, Cluj-Napoca, RO-400084 (Romania)

    2016-11-01

    Highlights: • Dysprosium containing silica microparticles obtained by freeze and spray drying. • Higher structural units interconnection achieved in freeze vs. spray dried samples. • Dy occurance on the outermost layer of the microparticles evidenced by XPS. • Enhanced MRI contrast observed for freeze dried samples with 5% mol Dy{sub 2}O{sub 3}. - Abstract: The work is focused on synthesis and structural characterization of novel dysprosium-doped silica particles which could be considered as MRI contrast agents. Sol-gel derived silica rich particles obtained via freeze-drying and spray-drying processing methods were structurally characterized by XRD, {sup 29}Si MAS-NMR and XPS methods. The occurrence of dysprosium on the outermost layer of dysprosium containing silica particles was investigated by XPS analysis. The MRI contrast agent characteristics have been tested using RARE-T{sub 1} and RARE-T{sub 2} protocols. The contrast of MRI images delivered by the investigated samples was correlated with their local structure. Dysprosium disposal on microparticles with surface structure characterised by decreased connectivity of the silicate network units favours dark T{sub 2}-weighted MRI contrast properties.

  18. Synthesis, structural characterization and in vitro testing of dysprosium containing silica particles as potential MRI contrast enhancing agents

    International Nuclear Information System (INIS)

    Chiriac, L.B.; Trandafir, D.L.; Turcu, R.V.F.; Todea, M.; Simon, S.

    2016-01-01

    Highlights: • Dysprosium containing silica microparticles obtained by freeze and spray drying. • Higher structural units interconnection achieved in freeze vs. spray dried samples. • Dy occurance on the outermost layer of the microparticles evidenced by XPS. • Enhanced MRI contrast observed for freeze dried samples with 5% mol Dy_2O_3. - Abstract: The work is focused on synthesis and structural characterization of novel dysprosium-doped silica particles which could be considered as MRI contrast agents. Sol-gel derived silica rich particles obtained via freeze-drying and spray-drying processing methods were structurally characterized by XRD, "2"9Si MAS-NMR and XPS methods. The occurrence of dysprosium on the outermost layer of dysprosium containing silica particles was investigated by XPS analysis. The MRI contrast agent characteristics have been tested using RARE-T_1 and RARE-T_2 protocols. The contrast of MRI images delivered by the investigated samples was correlated with their local structure. Dysprosium disposal on microparticles with surface structure characterised by decreased connectivity of the silicate network units favours dark T_2-weighted MRI contrast properties.

  19. Synthesis, characterization and sup 23 Na NMR shift studies of a novel dysprosium(III) crown ether texaphyrin

    Energy Technology Data Exchange (ETDEWEB)

    Sessler, J.L.; Mody, T.D. (Texas Univ., Austin, TX (United States). Dept. of Chemistry); Ramasamy, R.; Sherry, A.D. (Texas Univ., Dallas, TX (United States))

    1992-05-01

    The synthesis and characterization of a novel dysprosium(III) crown-ether texaphyrin (Dy(BCTxp)){sup 2+} is reported. This complex was designed to serve as a ditopic chelate for both dysprosium(III) and sodium cations. {sup 23}Sodium NMR spectroscopic studies indicates that titration of Na{sup +} with increasing concentrations of (Dy(BCTxp)){sup 2+} results in a shift toward higher frequency and gives a net hyperfine shift of 0.86 ppm. Sodium complexation is taking place into the crown subunit in (Dy(BCTxp)){sup 2+} and the degree of complexation is not reduced substantially by the positive charge on the dysprosium(III) portion of this binucleating system.

  20. Dysprosium disilicide nanostructures on silicon(001) studied by scanning tunneling microscopy and transmission electron microscopy

    International Nuclear Information System (INIS)

    Ye Gangfeng; Nogami, Jun; Crimp, Martin A.

    2006-01-01

    The microstructure of self-assembled dysprosium silicide nanostructures on silicon(001) has been studied by scanning tunneling microscopy and transmission electron microscopy. The studies focused on nanostructures that involve multiple atomic layers of the silicide. Cross-sectional high resolution transmission electron microscopy images and fast Fourier transform analysis showed that both hexagonal and orthorhombic/tetragonal silicide phases were present. Both the magnitude and the anisotropy of lattice mismatch between the silicide and the substrate play roles in the morphology and epitaxial growth of the nanostructures formed

  1. Major conformations of the ligand skeleton of a tetranuclear dysprosium (3) tartrate complex

    International Nuclear Information System (INIS)

    Chevela, V.V.; Semenov, V.Eh.; Bezryadin, S.G.; Savitskaya, T.V.; Kolesar, I.R.; Matveev, S.N.; Shamov, G.A.

    1999-01-01

    By the molecular mechanics method (MIND program, stoichiometry was studied and basic conformations of ligand frame of dysprosium (3) tetranuclear complex bis-(d-tartrato) bis-(l-tartrato)tetradysprosiate (3) - anion Dy 4 (d-L) 2 (l-L) 2 4- (1) (d-H 4 L = d-tartaric acid, l-H 4 L = l - tartaric acid) were revealed. It is shown that theoretically calculated mP τ constants for so-called compact conformations of 1, where tartratoligands are in gosh conformation, agree with experimentally obtained constant of paramagnetic birefringence (mP e ) of complex 1 [ru

  2. Incinerator carryover tests with dysprosium as a stand-in for plutonium

    International Nuclear Information System (INIS)

    Hooker, R.L.

    1981-11-01

    A full-scale (5 kg/h) incinerator is being tested with nonradioactive feed materials which simulate SRP-generator combustible transuranic wastes. The incinerator is two-stage and is designed to provide relatively quiescent conditions in the primary chamber where the ash is formed. This feature should minimize entrainment of Pu-bearing particles into the off-gas system. A series of runs have been completed in which incinerator feed was spiked with dysprosium to simulate Pu. Carryover of Dy into the off-gas system was found to be low (about 1/4%). 4 figures, 3 tables

  3. Incorporation of dysprosium ions into PbTiO3 ferroelectric ceramic system

    Directory of Open Access Journals (Sweden)

    A. Peláiz-Barranco

    2015-03-01

    Full Text Available A structural analysis concerning the incorporation of dysprosium into A- and/or B-sites of the lead titanate is shown. The two "boundary" refinements are presented, i.e., Dy2+ substitutes for Pb2+ (Dy3+ substitutes for Ti4+ and Dy3+ substitutes for Pb2+ (Dy3+ substitutes for Ti4+. The results offer quantitative information about the incorporation into both crystallographic sites. The increase of Dy3+ fraction into B-site provides the increase of the Ti4+ atomic displacement along the [001] direction and the tetragonal distortion.

  4. Dicty_cDB: SSB171 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SS (Link to library) SSB171 (Link to dictyBase) ssb171 - - Contig-U02783-1 SSB171F ...nk to dictyBase) Atlas ID ssb171 NBRP ID - dictyBase ID - Link to Contig Contig-U02783-1 Original site URL h

  5. Dosimetric properties of dysprosium doped calcium magnesium borate glass subjected to Co-60 gamma ray

    Energy Technology Data Exchange (ETDEWEB)

    Omar, R. S., E-mail: ratnasuffhiyanni@gmail.com; Wagiran, H., E-mail: husin@utm.my; Saeed, M. A. [Department of Physics, Faculty of Science, Universiti Teknologi Malaysia, 81310 Johor Bahru (Malaysia)

    2016-01-22

    Thermoluminescence (TL) dosimetric properties of dysprosium doped calcium magnesium borate (CMB:Dy) glass are presented. This study is deemed to understand the application of calcium as the modifier in magnesium borate glass with the presence of dysprosium as the activator to be performed as TL dosimeter (TLD). The study provides fundamental knowledge of a glass system that may lead to perform new TL glass dosimetry application in future research. Calcium magnesium borate glass systems of (70-y) B{sub 2}O{sub 3} − 20 CaO – 10 MgO-(y) Dy{sub 2}O{sub 3} with 0.05  mol % ≤ y ≤ 0.7  mol % of dyprosium were prepared by melt-quenching technique. The amorphous structure and TL properties of the prepared samples were determined using powder X-ray diffraction (XRD) and TL reader; model Harshaw 4500 respectively. The samples were irradiated to Co-60 gamma source at a dose of 50 Gy. Dosimetric properties such as annealing procedure, time temperature profile (TTP) setting, optimization of Dy{sub 2}O{sub 3} concentration of 0.5 mol % were determined for thermoluminescence dosimeter (TLD) reader used.

  6. Treatment of rheumatoid synovitis of the knee with intraarticular injection of dysprosium 165-ferric hydroxide macroaggregates

    International Nuclear Information System (INIS)

    Sledge, C.B.; Zuckerman, J.D.; Zalutsky, M.R.

    1986-01-01

    One hundred eight knees of 93 patients with seropositive rheumatoid arthritis and persistent synovitis of the knee were treated with an intraarticular injection of 270 mCi of dysprosium 165 bound to ferric hydroxide macroaggregate. Leakage of radioactivity from the injected joint was minimal. Mean leakage to the venous blood 3 hours after injection was 0.11% of the injected dose; this corresponds to a mean whole body dose of 0.2 rads. Mean leakage to the liver 24 hours after injection was 0.64% of the injected dose; this corresponds to a mean liver dose of 3.2 rads. In 7 additional patients examined, there was negligible or near negligible activity found in the draining inguinal lymph nodes. One-year followup was possible for 74 knees (63 patients). Sixty-one percent of the knees had good results, 23% had fair results, and 16% had poor results. There was a direct correlation between the radiographic stage and response to treatment. In knees with stage I radiographic changes, 72% showed good results; 93% showed improvement. In knees with stage II changes, 59% showed good results; 81% showed improvement. These preliminary results indicate that dysprosium 165-ferric hydroxide macroaggregate is an effective agent for radiation synovectomy. The low leakage rates observed offer a definite advantage over agents previously used

  7. Dual responsive dysprosium-doped hydroxyapatite particles and toxicity reduction after functionalization with folic and glucuronic acids

    Energy Technology Data Exchange (ETDEWEB)

    Sánchez Lafarga, Ana Karen; Pacheco Moisés, Fermín P. [Departamento de Química, Universidad de Guadalajara, Marcelino García Barragán 1421, C.P. 44430, Guadalajara, Jalisco (Mexico); Gurinov, Andrey [Research Resources Center for Magnetic Resonance, Saint Petersburg State University, Universitetskij pr. 26, 198504 St. Petersburg (Russian Federation); Ortiz, Genaro Gabriel [Laboratorio Desarrollo-Envejecimiento, Enfermedades Neurodegenerativas, Centro de Investigación Biomédica de Occidente (CIBO), Instituto Mexicano de Seguro Social (IMSS), Guadalajara, Jalisco (Mexico); Carbajal Arízaga, Gregorio Guadalupe, E-mail: gregoriocarbajal@yahoo.com.mx [Departamento de Química, Universidad de Guadalajara, Marcelino García Barragán 1421, C.P. 44430, Guadalajara, Jalisco (Mexico)

    2015-03-01

    The development of probes for biomedical applications demands materials with low toxicity levels besides fluorescence or magnetic properties to be detected by confocal microscopes or MRI resonators. Several drug delivery systems or other biomedical materials prepared with hydroxyapatite have been proposed, however, toxicity effects might arise when the size of particles is nanometric. In this study, hydroxyapatite functionalized with glucuronic or folic acids presented lower oxidative stress, measured from lipoperoxides and nitric oxide indicators in rats than pure hydroxyapatite. In separated experiments, hydroxyapatite was doped with dysprosium cations by coprecipitation producing a single crystal phase with fluorescent properties easily visualized by confocal microscopy when excited at 488 nm. These particles also presented the ability to modify the proton relaxation time in T1 maps collected by magnetic resonance imaging. These modified hydroxyapatite nanoparticles could be candidates to design bimodal probes with low toxicity. - Highlights: • Hydroxyapatite functionalized with glucuronic acid reduced oxidative stress in rats. • Functionalization with folic acid reduced oxidative stress in rats. • Dysprosium doping does not affect the crystalline structure of hydroxyapatite. • Dysprosium doped particles are visible in fluorescent microscope. • Dysprosium doped particles act as MRI contrast agents.

  8. Kinetic stability of the dysprosium(3) complex with tetraazaporphine in acetic acid-water and acetic acid-methanol mixtures

    International Nuclear Information System (INIS)

    Khelevina, O.G.; Vojnov, A.A.

    1999-01-01

    Water-soluble dysprosium tetraazaporphine with acetylacetonate-ion as extraligand is synthesized for the first time. Its kinetic stability in acetic acid solutions is investigated. It is shown that the complex is dissociated with formation of free tetraazaporphine. Kinetic parameters of dissociation reaction are determined [ru

  9. Dual responsive dysprosium-doped hydroxyapatite particles and toxicity reduction after functionalization with folic and glucuronic acids

    International Nuclear Information System (INIS)

    Sánchez Lafarga, Ana Karen; Pacheco Moisés, Fermín P.; Gurinov, Andrey; Ortiz, Genaro Gabriel; Carbajal Arízaga, Gregorio Guadalupe

    2015-01-01

    The development of probes for biomedical applications demands materials with low toxicity levels besides fluorescence or magnetic properties to be detected by confocal microscopes or MRI resonators. Several drug delivery systems or other biomedical materials prepared with hydroxyapatite have been proposed, however, toxicity effects might arise when the size of particles is nanometric. In this study, hydroxyapatite functionalized with glucuronic or folic acids presented lower oxidative stress, measured from lipoperoxides and nitric oxide indicators in rats than pure hydroxyapatite. In separated experiments, hydroxyapatite was doped with dysprosium cations by coprecipitation producing a single crystal phase with fluorescent properties easily visualized by confocal microscopy when excited at 488 nm. These particles also presented the ability to modify the proton relaxation time in T1 maps collected by magnetic resonance imaging. These modified hydroxyapatite nanoparticles could be candidates to design bimodal probes with low toxicity. - Highlights: • Hydroxyapatite functionalized with glucuronic acid reduced oxidative stress in rats. • Functionalization with folic acid reduced oxidative stress in rats. • Dysprosium doping does not affect the crystalline structure of hydroxyapatite. • Dysprosium doped particles are visible in fluorescent microscope. • Dysprosium doped particles act as MRI contrast agents

  10. 14 CFR 171.109 - Performance requirements.

    Science.gov (United States)

    2010-01-01

    ... communications to that due to the identification signal is approximately 9:1. (iii) The audio frequency... interfere in any way with the basic SDF function. (ii) The identification signal must be produced by Class... standards and tolerances contained in § 171.111(j). (d) The monitor system must provide a warning to the...

  11. Watt-level dysprosium fiber laser at 315 μm with 73% slope efficiency

    Science.gov (United States)

    Woodward, R. I.; Majewski, M. R.; Bharathan, G.; Hudson, D. D.; Fuerbach, A.; Jackson, S. D.

    2018-04-01

    Rare-earth-doped fiber lasers are emerging as promising high-power mid-infrared sources for the 2.6-3.0 {\\mu}m and 3.3-3.8 {\\mu}m regions based on erbium and holmium ions. The intermediate wavelength range, however, remains vastly underserved, despite prospects for important manufacturing and defense applications. Here, we demonstrate the potential of dysprosium-doped fiber to solve this problem, with a simple in-band pumped grating-stabilized linear cavity generating up to 1.06 W at 3.15 {\\mu}m. A slope efficiency of 73% with respect to launched power (77% relative to absorbed power) is achieved: the highest value for any mid-infrared fiber laser to date, to the best of our knowledge. Opportunities for further power and efficiency scaling are also discussed.

  12. Proton NMR relaxivity of blood samples in the presence of some gadolinium and dysprosium compounds

    International Nuclear Information System (INIS)

    Coroiu, I.; Darabont, Al.; Bogdan, M.

    1999-01-01

    The use of some new compounds in MRI tissue and blood characterisation based on nuclear spin relaxation time measurements cannot be sustained until the molecular sources of these variations are understood. Tissues and blood are complex molecular systems with complex NMR properties. A better comprehension of the molecular basis of relaxation offers the possibility to predict the changes expected for a given pathology. The purpose of this contribution is to evidence the different relaxation characteristics of some gadolinium and dysprosium compounds in the presence and absence of the blood and to give a possible explanation about the molecular processes that cause occurrence of changes. Some gadolinium and dysprosium compounds such as: Gd-CIT (gadolinium citrate), Dy-DTPA (DTPA-diethylenetriamine pentaacetic acid), iron oxide - gadolinium oxide (or dysprosium oxide)- dextran complexes were prepared. The longitudinal T 1 -1 and transverse T 2 -1 'relaxation rates' measurements have been carried out as a function of molar concentrations. All measurements have been made at room temperature (about 25 deg.C) and the proton Larmor frequency ν o = 90 MHz. The pulsed NMR spectrometer utilised was a commercial Bruker SXP4/100 spectrometer. Transverse relaxation rate measurements have been made using the Carr-Purcell method, while longitudinal relaxation rate measurements using the inversion recovery pulse sequence, 180 angle-τ-90 angle. The accuracy was about 2-3% for the longitudinal relaxation rates and about 5-7% for the transverse relaxation rates. R 1 and R 2 relaxivities, in mM -1 s -1 were determined from the least square determination of the slopes of plots 1/T 1,2 versus compound molar concentration, using at least five independent measurements at several concentrations between 0 and 2 mM. Increased R 2 relaxivity observed for dysprosium compounds in the blood presence can be explained by PRE effect. The largest gain in R 2 relaxivity seems to imply a noncovalent

  13. Investigation on rare earth magnets recycling by organophosphoric extractant encapsulated polymeric beads for separation of dysprosium

    International Nuclear Information System (INIS)

    Yadav, Kartikey K.; Singh, D.K.; Kain, V.

    2017-01-01

    Rare earth elements (REEs) are a basic requirement of the electronics and new industries including green technology. In the present work an organophosphoric extractant encapsulating polyethersulfone (PES) beads has been developed and employed for dysprosium (Dy) separation from aqueous stream. Polyethersulfonic beads encapsulating PC88A were prepared by phase inversion method. During the synthesis of the beads, preparatory parameters were also optimized to obtain best suited beads which were subsequently characterized for their encapsulation capacity and micro structural investigation. The results obtained in the present investigation suggested that PES/PVAJPC88A composite beads could be used for separation of rare earths from aqueous medium obtained from the solubilisation of magnetic scrap materials

  14. Design and validation of a photon insensitive multidetector neutron spectrometer based on Dysprosium activation foils

    International Nuclear Information System (INIS)

    Gómez-Ros, J.M.; Bedogni, R.; Palermo, I.; Esposito, A.; Delgado, A.; Angelone, M.; Pillon, M.

    2011-01-01

    This communication describes a photon insensitive passive neutron spectrometer consisting of Dysprosium (Dy) activation foils located along three perpendicular axes within a single moderating polyethylene sphere. The Monte Carlo code MCNPX 2.6 was used to optimize the spatial arrangement of the detectors and to derive the spectrometer response matrix. Nearly isotropic response in terms of neutron fluence for energies up to 20 MeV was obtained by combining the readings of the detectors located at the same radius value. The spectrometer was calibrated using a previously characterized 14 MeV neutron beam produced in the ENEA Frascati Neutron Generator (FNG). The overall uncertainty of the spectrometer response matrix at 14 MeV, assessed on the basis of this experiment, was ±3%.

  15. Influence of modifiers on the separation of dysprosium from neodymium using organophosphorus acid derivates

    Energy Technology Data Exchange (ETDEWEB)

    Elwert, Tobias; Schwarz, Sabrina; Goldmann, Daniel [TU Clausthal, Clausthal-Zellerfeld (Germany). Lehrstuhl fuer Rohstoffaufbereitung und Recycling

    2016-01-15

    The aim of this study was to investigate the applicability of three organophosphorus acid derivates (D2EHPA, EHEHPA and Cyanex 572) for the separation of terbium and dysprosium from praseodymium and neodymium from NdFeB magnets in chloride solution. A special focus was put on the effect of phase modifiers. The investigations revealed that all extractants show in general a similar extraction behavior but the extraction is shifted to higher pH values in the order D2EHPA < EHEHPA < Cyanex 572. Therefore, and due to higher realizable loadings, EHEHPA and Cyanex 572 are more suitable for the investigated separation problem than D2EHPA. Whereas EHEHPA requires 1-decanol as phase modifier, Cyanex 572 can be employed without modifier addition.

  16. Automated spectrofluorimetric determinations of terbium and dysprosium in rare earth mixtures

    Energy Technology Data Exchange (ETDEWEB)

    Lyle, S.J.; Za' tar, N. (Kent Univ., Canterbury (UK))

    1983-12-01

    Several methods involving the use of water-soluble binary and ternary complexes have been proposed for the spectrofluorimetric determination based on terbium(III) emission at 545 nm. These are terbium(III) with (A) ethylenediamine-N,N'-bis(o-hydroxyphenylacetic acid), (B) o-hydroxyphenyliminodiacetic acid, (C) EDTA + 5-sulphosalicylic acid, (D) EDTA + 1,2-dihydroxybenzene-3,5-disulphonic acid disodium salt (Tiron), and (E) iminodiacetic acid (IDA) + Tiron. Two of the reagent mixtures (D and E) can also be used for the fluorimetric determination of dysprosium(III) at 582 nm. A comparison has been made of these methods in order to select the most satisfactory procedure with respect to selectivity, sensitivity and suitability for adaption to automatic operation. Results are given and discussed.

  17. Spectrographic determination of dysprosium in doped crystals of calcium sulfate used for dosimetric material

    International Nuclear Information System (INIS)

    Grigoletto, T.; Lordello, A.R.

    1984-01-01

    A spectrographic method is described for the quantitative determination of dysprosium in doped crystals of calcium sulphate. The consequences of the changes in some parameters of the excitation conditions, such as arc current, electrode type and total or partial burning of sample, in the analytical results are discussed. Matrix effects are investigated. Variations in the intensity of the spectral lines are verified by recording the spectrum in distinct photographic plates. The role of internal standard in analytical reproducibility and in counterbalance of the variations in the arc current and in the weight of sample is studied. Accuracy is estimated by comparative analysis of two calcium sulphate samples by X-Ray Fluorescence, Neutron Activation and Inductive Coupled Plasma Emission Spectroscopy. (M.A.C.) [pt

  18. Use of dispersive liquid-liquid microextraction for simultaneous preconcentration of samarium, europium, gadolinium and dysprosium

    International Nuclear Information System (INIS)

    Mallah, M.H.; Atomic Energy Organization of Iran, Tehran; Shemirani, F.; Ghannadi Maragheh, M.

    2008-01-01

    A new preconcentration method of dispersive liquid-liquid microextraction (DLLME) was developed for simultaneous preconcentration of samarium, europium, gadolinium and dysprosium. DLLME technique was successfully used as a sample preparation method. In this preconcentration method, an appropriate mixture of extraction solvent, disperser solvent was injected rapidly into an aqueous solution containing Sm, Eu, Gd and Dy after complex formation using chelating reagent of the 1-(2-pyridylazo)-2-naphthol (PAN). After phase separation, 0.5 mL of the settled phase containing enriched analytes was determined by inductively coupled plasma optical emission spectrometry (ICP-OES). The main factors affected the preconcentration of Sm, Eu, Gd and Dy were extraction and dispersive solvent type and their volume, extraction time, volume of chelating agent (PAN), centrifuge speed and drying temperature of the samples. Under the best operating condition simultaneous preconcentration factors of 80, 100, 103 and 78 were obtained for Sm, Eu, Gd and Dy, respectively. (author)

  19. A model for additive transport in metal halide lamps containing mercury and dysprosium tri-iodide

    International Nuclear Information System (INIS)

    Beks, M L; Haverlag, M; Mullen, J J A M van der

    2008-01-01

    The distribution of additives in a metal halide lamp is examined through numerical modelling. A model for a lamp containing sodium iodide additives has been modified to study a discharge containing dysprosium tri-iodide salts. To study the complex chemistry the method of Gibbs minimization is used to decide which species have to be taken into account and to fill lookup tables with the chemical composition at different combinations of elemental abundance, lamp pressure and temperature. The results from the model with dysprosium additives were compared with earlier results from the lamp containing sodium additives and a simulation of a pure mercury lamp. It was found that radial segregation creates the conditions required for axial segregation. Radial segregation occurs due to the unequal diffusion of atoms and molecules. Under the right conditions convection currents in the lamp can cause axial demixing. These conditions depend on the ratio of axial convection and radial diffusion as expressed by the Peclet number. At a Peclet number of unity axial segregation is most pronounced. At low Peclet numbers radial segregation is at its worst, while axial segregation is not present. At large Peclet numbers the discharge becomes homogeneously mixed. The degree of axial segregation at a Peclet number of unity depends on the temperature at which the additive under consideration fully dissociates. If the molecules dissociate very close to the walls no molecules are transported by the convective currents in the lamp, and hence axial segregation is limited. If they dissociate further away from the walls in the area where the downward convective currents are strongest, more axial segregation is observed

  20. Electrochemical behaviour of dysprosium in the eutectic LiCl-KCl at W and Al electrodes

    International Nuclear Information System (INIS)

    Castrillejo, Y.; Bermejo, M.R.; Barrado, A.I.; Pardo, R.; Barrado, E.; Martinez, A.M.

    2005-01-01

    The electrochemical behaviour of DyCl 3 was studied in the eutectic LiCl-KCl at different temperatures. The cathodic reaction can be written:Dy(III)+3e-bar Dy(0)which can be divided in two very close cathodic steps:Dy(III)+1e-bar Dy(II)andDy(II)+2e-bar Dy(0)Transient electrochemical techniques, such as cyclic voltammetry, chronopotentiometry, and chronoamperometry were used in order to study the reaction mechanism and the transport parameters of electroactive species at a tungsten electrode. The results showed that in the eutectic LiCl-KCl, electrocrystallization of dysprosium seems to be the controlling electrochemical step. Chronoamperometric studies indicated instantaneous nucleation of dysprosium with three dimensional growth of the nuclei whatever the applied overpotential.Mass transport towards the electrode is a simple diffusion process, and the diffusion coefficient of the electroactive species, i.e. Dy(III), has been calculated. The validity of the Arrhenius law was also verified by plotting the variation of the logarithm of the diffusion coefficient versus 1/T.In addition, the electrode reactions of the LiCl-KCl-DyCl 3 solutions at an Al wire were also investigated by cyclic voltammetry and open circuit chronopotentiometry. The redox potential of the Dy(III)/Dy couple at the Al electrode was observed at more positive potentials values than those at the inert electrode. This potential shift was thermodynamically analyzed by a lowering of activity of Dy in the metal phase due to the formation of intermetallic compounds

  1. Dysprosium lithium borate glass mircrospheres for radiation synovectomy: The in vitro and in vivo performance evaluation

    Energy Technology Data Exchange (ETDEWEB)

    Zhao Di; Yu Jing [Institute of Bioengineering and Information Technology Materials, Center for Advanced Materials and Nano-Biomedicine, Tongji University, Shanghai, 200092 (China); Huang Wenhai, E-mail: whhuang@tongji.edu.cn [Institute of Bioengineering and Information Technology Materials, Center for Advanced Materials and Nano-Biomedicine, Tongji University, Shanghai, 200092 (China); Zhou Nai; Wang Deping [Institute of Bioengineering and Information Technology Materials, Center for Advanced Materials and Nano-Biomedicine, Tongji University, Shanghai, 200092 (China); Yin Wei [Institute of Isotope Research, Sinitic Academy of Atomic Energy, Beijing 102413 (China); Chen Yaqing [The Sixth People' s Hospital, Shanghai 200233 (China)

    2010-08-30

    The radioactive dysprosium lithium borate glass (DyLB) microspheres with different glass compositions were prepared for radiation synovectomy. The biodegradability and biocompatibility of these DyLB microspheres were evaluated in vitro and in vivo. The DyLB microspheres studied in this work were partially biodegradable in a simulated body fluid (SBF), with the final weight loss of the microspheres in the range of 24.6% and 55.0% (wt.%) after 8 days of immersion. The ICP results revealed that the dissolution of lithium significantly decreased from 100% to 53.7% with increasing content of Dy{sub 2}O{sub 3} in the microspheres from 18% to 22% (wt.%, from S-1 to S-3). However, for all of the three samples, nearly all of the dysprosium (> 99.997%, wt.%) remained in the microspheres, in the form of insoluble phosphates and carbonates, which was proved by the SEM and EDX analyses. The degradation of DyLB microspheres in SBF gradually decreased with immersion time and eventually reached equilibrium after 7 days of immersion. Compared to the other two samples, the S-3 sample with the lowest Dy{sup 3+} dissolution (about 0.002%) was considered more secure for clinical application. Furthermore, the S-3 DyLB microspheres exhibited good biocompatibility, since neither tissue damage nor inflammation was observed, after they were implanted in the liver of rat for two weeks. After neutron activation, the radionuclide purity of radioactive S-3 DyLB microspheres was 99.999%, which were suitable for radiation synovectomy.

  2. Photoluminescence study on amino functionalized dysprosium oxide-zinc oxide composite bifunctional nanoparticles

    Energy Technology Data Exchange (ETDEWEB)

    Joseph, Aswathy; Praveen, G.L; Abha, K.; Lekha, G.M [Department of Chemistry, University of Kerala, Kariavattom, Kerala 695581 (India); George, Sony, E-mail: emailtosony@gmail.com [Department of Chemistry, University of Kerala, Kariavattom, Kerala 695581 (India)

    2012-08-15

    An organic dispersion of 9-15 nm size stable dysprosium oxide incorporated zinc oxide nanocomposites exhibiting luminescence in the visible region has been synthesised by a wet chemical precipitation technique at room temperature. Tetraethoxysilane TEOS [(C{sub 2}H{sub 5}O){sub 4}Si], (3-aminopropyl) trimethoxysilane (APTS) and a 1:1 mixture of TEOS-APTS have been used as capping agents to control the particle size as well as to achieve uniform dispersion of composite nanoparticles in methanol medium. X-ray diffractometer (XRD) analysis reveals the formation phase of amino-functionalised colloidal dysprosium oxide incorporated ZnO composite nanoparticles to be of zincite structure. The Transmission Electron Microscopy (TEM) images show that the particles are spheroids in shape, having average crystalline sizes ranging from 9 to 15 nm. The photoluminescence (PL) observed in these composites has been attributed to the presence of near band edge excitonic emission and existence of defect centres. The time correlated single photon counting studies of the composite nanoparticles exhibited three decay pathways. The enhanced PL emission intensity of solid state fluorescence spectra of samples is attributed to the absence of vibrational relaxation process. - Highlights: Black-Right-Pointing-Pointer Nano-composites are synthesised using a one step wet chemical precipitation method. Black-Right-Pointing-Pointer A significant fluorescence life time of 8.25 ns is obtained for the nano-composite. Black-Right-Pointing-Pointer Nano-composite particles exhibited pale yellow fluorescence rather than blue. Black-Right-Pointing-Pointer Vibrational cascade free enhanced fluorescence is obtained for the dry sample.

  3. 36 CFR 406.171-406.999 - [Reserved

    Science.gov (United States)

    2010-07-01

    ... 36 Parks, Forests, and Public Property 3 2010-07-01 2010-07-01 false [Reserved] 406.171-406.999 Section 406.171-406.999 Parks, Forests, and Public Property AMERICAN BATTLE MONUMENTS COMMISSION... BATTLE MONUMENTS COMMISSION §§ 406.171-406.999 [Reserved] ...

  4. 40 CFR 205.171 - Selective enforcement auditing (SEA) requirements.

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 24 2010-07-01 2010-07-01 false Selective enforcement auditing (SEA) requirements. 205.171 Section 205.171 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED... § 205.171 Selective enforcement auditing (SEA) requirements. ...

  5. 14 CFR 171.269 - Marker beacon performance requirements.

    Science.gov (United States)

    2010-01-01

    ... 14 Aeronautics and Space 3 2010-01-01 2010-01-01 false Marker beacon performance requirements. 171.269 Section 171.269 Aeronautics and Space FEDERAL AVIATION ADMINISTRATION, DEPARTMENT OF... Landing System (ISMLS) § 171.269 Marker beacon performance requirements. ISMLS marker beacon equipment...

  6. 46 CFR 171.100 - Shaft tunnels and stern tubes.

    Science.gov (United States)

    2010-10-01

    ... 46 Shipping 7 2010-10-01 2010-10-01 false Shaft tunnels and stern tubes. 171.100 Section 171.100... PERTAINING TO VESSELS CARRYING PASSENGERS Additional Subdivision Requirements § 171.100 Shaft tunnels and... passengers on an international voyage. (b) The watertight seal in the bulkhead between the stern tube space...

  7. 17 CFR 171.28 - Participation by Commission staff.

    Science.gov (United States)

    2010-04-01

    ... staff. 171.28 Section 171.28 Commodity and Securities Exchanges COMMODITY FUTURES TRADING COMMISSION..., Membership Denial and Registration Actions § 171.28 Participation by Commission staff. The Division of.... The Commission shall by order establish a supplementary briefing schedule for the Commission staff and...

  8. 45 CFR 2490.171-2490.999 - [Reserved

    Science.gov (United States)

    2010-10-01

    ... 45 Public Welfare 4 2010-10-01 2010-10-01 false [Reserved] 2490.171-2490.999 Section 2490.171-2490.999 Public Welfare Regulations Relating to Public Welfare (Continued) JAMES MADISON MEMORIAL... CONDUCTED BY THE JAMES MADISON MEMORIAL FELLOWSHIP FOUNDATION §§ 2490.171-2490.999 [Reserved] ...

  9. 22 CFR 171.40 - Purpose and scope.

    Science.gov (United States)

    2010-04-01

    ... 22 Foreign Relations 1 2010-04-01 2010-04-01 false Purpose and scope. 171.40 Section 171.40... PUBLIC Ethics in Government Act Provisions § 171.40 Purpose and scope. This subpart sets forth the... 2634, require that high-level Federal officials disclose publicly their personal financial interests. ...

  10. 46 CFR 171.118 - Automatic ventilators and side ports.

    Science.gov (United States)

    2010-10-01

    ... 46 Shipping 7 2010-10-01 2010-10-01 false Automatic ventilators and side ports. 171.118 Section 171.118 Shipping COAST GUARD, DEPARTMENT OF HOMELAND SECURITY (CONTINUED) SUBDIVISION AND STABILITY... Bulkhead or Weather Deck § 171.118 Automatic ventilators and side ports. (a) An automatic ventilator must...

  11. 49 CFR 28.171-28.999 - [Reserved

    Science.gov (United States)

    2010-10-01

    ... 49 Transportation 1 2010-10-01 2010-10-01 false [Reserved] 28.171-28.999 Section 28.171-28.999 Transportation Office of the Secretary of Transportation ENFORCEMENT OF NONDISCRIMINATION ON THE BASIS OF HANDICAP IN PROGRAMS OR ACTIVITIES CONDUCTED BY THE DEPARTMENT OF TRANSPORTATION §§ 28.171-28.999 [Reserved] ...

  12. Simultaneous determination of dysprosium, holmium and erbium in high purity rare earth oxides by second order derivative spectrophotometry

    International Nuclear Information System (INIS)

    Anbu, M.; Prasada Rao, T.; Iyer, C. S. P.; Damodaran, A. D.

    1996-01-01

    High purity individual rare earth oxides are increasingly used as major components in lasers (Y 2 O 3 ), phosphors (YVO 3 , Eu 2 O 3 ), magnetic bubble memory films (Gd 2 O 3 ) and refractive-index lenses and fibre optics (La 2 O 3 ). The determination of individual lanthanides in high purity rare earth oxides is a more important and difficult task. This paper reports the utilization of higher order derivative spectrophotometry for the simultaneous determination of dysprosium, holmium and erbium in high purity rare earth oxides. The developed procedure is simple, reliable and allows the determination of 0.001 to 0.2% of dysprosium, holmium and erbium in several rare earth. (author). 9 refs, 2 figs, 2 tabs

  13. Mixed (phthalocyaninato)(Schiff-base) di-dysprosium sandwich complexes. Effect of magnetic coupling on the SMM behavior.

    Science.gov (United States)

    Wang, Hailong; Liu, Chenxi; Liu, Tao; Zeng, Suyuan; Cao, Wei; Ma, Qi; Duan, Chunying; Dou, Jianmin; Jiang, Jianzhuang

    2013-11-21

    Reaction between Schiff-base ligand and half-sandwich complex M(Pc)(acac) led to the isolation of new sandwich-type mixed (phthalocyaninato)(Schiff-base) di-lanthanide compounds M2(Pc)2(L)H2O (M = Dy, Gd) (1, 2) [H2Pc = metal free phthalocyanine, Hacac = acetylacetone, H2L = N,N'-bis(3-methyloxysalicylidene)benzene-1,2-diamine] with the triple-decker molecular structure clearly revealed by single crystal X-ray diffraction analysis. For the comparative studies, sandwich triple-decker analogues with pure Schiff-base ligand M2(L)3H2O (M = Dy, Gd) (3, 4) were also prepared. Dynamic magnetic measurement result reveals the single-molecule magnet (SMM) nature of the di-dysprosium derivative 1, while the static magnetic investigation over both pure and the diamagnetic diluted samples of this compound discloses the interionic ferromagnetic coupling between the two dysprosium ions, which in turn effectively suppresses the QTM and enhances the energy barrier of this SMM. Nevertheless, comparative studies over the static magnetic properties of the di-dysprosium triple-decker complexes 1 and 3 indicate the stronger magnetic coupling between the two lanthanide ions in mixed (phthalocyaninato)(Schiff-base) species than in the pure Schiff-base triple-decker analogue, suggesting the special coordination sphere around the dysprosium ions in the former compound over the latter one on the more intense inter-ionic ferromagnetic coupling. As a very small step towards understanding the structure-property relationship, the present result will be surely helpful for the design and synthesis of the multinuclear lanthanide-based SMMs with good properties.

  14. Evaluating United States and world consumption of neodymium, dysprosium, terbium, and praseodymium in final products

    Science.gov (United States)

    Hart, Matthew

    This paper develops scenarios of future rare-earth-magnet metal (neodymium, dysprosium, terbium, and praseodymium) consumption in the permanent magnets used in wind turbines and hybrid electric vehicles. The scenarios start with naive base-case scenarios for growth in wind-turbine and hybrid-electric-vehicle sales over the period 2011 to 2020, using historical data for each good. These naive scenarios assume that future growth follows time trends in historical data and does not depend on any exogenous variable. Specifically, growth of each technological market follows historical time trends, and the amount of rare earths used per unit of technology remains fixed. The chosen reference year is 2010. Implied consumptions of the rare earth magnet metals are calculated from these scenarios. Assumptions are made for the material composition of permanent magnets, the market share of permanent-magnet wind turbines and vehicles, and magnet weight per unit of technology. Different scenarios estimate how changes in factors like the material composition of magnets, growth of the economy, and the price of a substitute could affect future consumption. Each scenario presents a different method for reducing rare earth consumption and could be interpreted as potential policy choices. In 2010, the consumption (metric tons, rare-earth-oxide equivalent) of each rare-earth-magnet metal was as follows. Total neodymium consumption in the world for both technologies was 995 tons; dysprosium consumption was 133 tons; terbium consumption was 50 tons; praseodymium consumption was zero tons. The base scenario for wind turbines shows there could be strong, exponential growth in the global wind turbine market. New U.S. sales of hybrid vehicles would decline (in line with the current economic recession) while non-U.S. sales increase through 2020. There would be an overall increase in the total amount of magnetic rare earths consumed in the world. Total consumption of each rare earth in the short

  15. Spectrographic determination of dysprosium dopant in calcium sulphate used as dosimetric material

    International Nuclear Information System (INIS)

    Grigoletto, T.

    1982-01-01

    A spectrographic method is described for the quantitative determination of dysprosium in doped crystals of calcium sulphate. The consequences of the changes in some parameters of the excitation conditions, such as arc current, electrode type and total or partial burning of sample, in the analytical results are discussed. Matrix effects are investigated by comparison among analytical curves obtained from three different methods of standard preparations. Variations in the intensity of the spectral lines are verificated by recording the spectrum in distinct photographic plates (SA-1). The role of internal standard in analytical reproducibility and in counterbalance of the variations in the arc current and in the weight of sample are studied. The great similarity in excitation behavior of many of the rare earths is used to provide a high degree of internal standardization. Precision studies show a standard deviation of about + - 2,4 percent by use of lanthanum as an internal standard. Accuracy is estimate by comparative analysis of two calcium sulphate samples by X-Rays Fluorescence, Neutron Activation and Inductive Coupled Plasma (ICP) Emission Spectroscopy. (Author) [pt

  16. Combustion of gadolinium and dysprosium chelates as a cellular integrity marker in MR imaging

    International Nuclear Information System (INIS)

    Ericsson, A.; Bach-Gansmo, T.; Niklasson, F.; Hemmingsson, A.

    1995-01-01

    A combination of gadolinium (Gd) and dysprosium (Dy) chelates was investigated as a potential marker of cell-membrane integrity by means of a double-contrast effect in MR imaging. Blood samples with varying hematocrit (Hct) levels containing intact or lysed cells were used as model systems. With intact cells, the agents were assumed to be distributed solely extracellularly and the highest Hct studied (69%) was assumed to mimic the ratio of extracellular to intracellular water in tissue. The combined effect on image intensity of Gd (in a concentration corresponding to 0.2 mmol/kg b.w. in humans) and Dy (0.6 mmol/kg b.w.) applied simultaneously was a marked difference in signal intensity between samples with intact and lysed cells in both the T1- and T2-weighted spin-echo images with a corresponding increase in the contrast-to-noise ratio. This was the result of a T1 reduction caused by Gd with a negligible Dy susceptibility effect in areas with lysed cells. On the other hand, the Dy susceptibility effect (i.e. reduced apparent T2) dominated in areas with intact cells. Thus, the combination of Gd and Dy may serve as a marker of cell-membrane integrity in MR examinations. (orig.)

  17. Isolation of {sup 163}Ho from dysprosium target material by HPLC for neutrino mass measurements

    Energy Technology Data Exchange (ETDEWEB)

    Mocko, Veronika; Taylor, Wayne A.; Nortier, Francois M.; Engle, Jonathan W.; Pollington, Anthony D.; Kunde, Gerd J.; Rabin, Michael W.; Birnbaum, Eva R. [Los Alamos National Laboratory, Los Alamos, NM (United States). Chemistry Div.; Barnhart, Todd E.; Nickles, Robert J. [Univ. Wisconsinn, Madison, WI (United States). Dept. of Medical Physics

    2015-07-01

    The rare earth isotope {sup 163}Ho is of interest for neutrino mass measurements. This report describes the isolation of {sup 163}Ho from a proton-irradiated dysprosium target and its purification. A Dy metal target was irradiated with 16 MeV protons for 10 h. After target dissolution, {sup 163}Ho was separated from the bulk Dy via cation-exchange high performance liquid chromatography using 70 mmol dm{sup -3} α-hydroxyisobutyric acid as the mobile phase. Subsequent purification of the collected Ho fraction was performed to remove the α-hydroxyisobutyrate chelating agent and to concentrate the Ho in a low ionic strength aqueous matrix. The final solution was characterized by MC-ICP-MS to determine the {sup 163}Ho/{sup 165}Ho ratio, {sup 163}Ho and the residual Dy content. The HPLC purification process resulted in a decontamination factor 1.4 x 10{sup 5} for Dy. The isolated Ho fraction contained 24.8 ± 1.3 ng of {sup 163}Ho corresponding to holmium recovery of 72 ± 3%.

  18. Nuclear statistics of dysprosium resonance parameters in the energy range 10 - 1000 eV

    International Nuclear Information System (INIS)

    Shin, S. G.; Kye, Y. U.; Cho, M. H.; Kim, G. N.; Namkung, W.; Lee, M. W.; Kang, Y. R.; Roe, T. I.

    2016-01-01

    A resonance parameter analysis is often performed in the Resolved Resonance Region (RRR) in order to estimate the average level spacing, distribution of the reduced widths and so on. Neutron Capture experiments on dysprosium isotopes were performed at the electron linear accelerator (LINAC) facility of the Rensselear Polytechnic Institute (RPI) in the neutron energy region from 10 eV to 1 keV. The following nuclear statistics of the resonance parameters will be discussed in this paper. The D 0 for 161 Dy and 163 Dy were judged to be constant up to 120.6 and 163.9 eV, respectively. It was assumed that the D 0 of 162 Dy and 164 Dy is constant up to 1000 eV because they have few resonances. The results were compared with the values from Reference 11 as shown in Figure 1. Statistical distributions of reduced neutron were investigated for the three isotopes in the region from 0 to 1000 eV; 161 Dy, 162 Dy, and 163 Dy, but not for 164 Dy because of a few number of resonances. The reduced neutron widths Γ n 0 were divided by the unweighted average reduced neutron width < Γ n 0 > for each isotope. A cumulative distribution of these unitless ratios is compared with the integral of the Porter-Thomas distribution (χ 2 distribution with one degree of freedom). The results agree reasonably with the Porter Thomas distributions.

  19. Self-organized dysprosium-directed alginate hydrogels and its chemical features

    Energy Technology Data Exchange (ETDEWEB)

    Ma, Qianmin [School of Chemistry and Environment, South China Normal University, Guangzhou 510006 (China); Gao, Jinwei [Institute for Advanced Materials, Academy of Advanced Optoelectronics, South China Normal University, Guangzhou 510006 (China); Peng, Huojun [School of Chemistry and Environment, South China Normal University, Guangzhou 510006 (China); Wang, Qianming, E-mail: qmwang@scnu.edu.cn [Key Laboratory of Theoretical Chemistry of Environment, Ministry of Education, School of Chemistry and Environment, South China Normal University, Guangzhou 510006 (China); School of Chemistry and Environment, South China Normal University, Guangzhou 510006 (China); Guangzhou Key Laboratory of Materials for Energy Conversion and Storage, Guangzhou 510006 (China)

    2016-09-15

    Rational use of self-organized materials may contribute in developing new structures and devices in practical technology. Synthetic metallo-supramolecular gels are generally designed with transitional metal-directed process. However, the assembly of both lanthanide and sodium alginate in macromolecular systems would find a new way of utilizing its physical properties. The stimuli-responsive molecule (alginate) could firmly form stable hydrogels upon the encapsulation of dysprosium ions. In addition, the immobilization of YVO{sub 4}: Eu{sup 3+} nanoparticle in the soft matrix has been achieved and it has never been explored in the fabrication of phosphor-incorporated luminescent alginate gels. The key feature of the present soft matter is that its red emission could be switched off in the presence of sodium ascorbate and the results may have a tremendous impact on the extension of photophysical application based on soft nanoscale devices. - Highlights: • Dy{sup 3+} can be used for the gelation of the dissolved alginate. • Lanthanide hydrogels could exhibit red emissions under excitations. • Luminescence could be switched “off” in the presence of sodium ascorbate.

  20. Optical properties of zinc borotellurite glass doped with trivalent dysprosium ion

    Science.gov (United States)

    Ami Hazlin, M. N.; Halimah, M. K.; Muhammad, F. D.; Faznny, M. F.

    2017-04-01

    The zinc borotellurite doped with dysprosium oxide glass samples with chemical formula {[(TeO2) 0 . 7(B2O3) 0 . 3 ] 0 . 7(ZnO) 0 . 3 } 1 - x(Dy2O3)x (where x=0.01, 0.02, 0.03, 0.04 and 0.05 M fraction) were prepared by using conventional melt quenching technique. The structural and optical properties of the proposed glass systems were characterized by using X-ray diffraction (XRD) spectroscopy, Fourier Transform Infrared (FTIR) spectroscopy, and UV-VIS spectroscopy. The amorphous nature of the glass systems is confirmed by using XRD technique. The infrared spectra of the glass systems indicate three obvious absorption bands which are assigned to BO3 and TeO4 vibrational groups. Based on the absorption spectra obtained, the direct and indirect optical band gaps, as well as the Urbach energy were calculated. It is observed that both the direct and indirect optical band gaps increase with the concentration of Dy3+ ions. On the other hand, the Urbach energy is observed to decrease as the concentration of Dy3+ ions increases.

  1. The liquid membrane for extraction of Yttrium and Dysprosium from Acid Nitric

    International Nuclear Information System (INIS)

    Johny, W.S.; Raldi-Artono-Koestoer; Kris-Tri-Basuki; Sudibyo

    1996-01-01

    The determination of surfactant in liquid membrane has been done. The surfactant is span-80 (sorbitol-monooleate), the liquid membrane phase was the organic phase (O), the internal liquid phase (W) with ratio O/W = 1, and surfactant. The organic phase using D 2 EHPA in the kerosene and the internal liquid phase using aqua des or acid nitric. The determination of surfactant with variation of span-80 (0,25 - 2%) in the liquid membrane volume. The speed of stirrer was 3500 rpm in 20 minute. The ratio of liquid membrane phase form and external phase (aqua des or acid nitric) was 1, the speed of stirrer was 350 rpm in 10 minute (permeation process). The liquid phase and the liquid membrane phase was separated and then determinated the volume of liquid membrane, the result of percentage of span-80 was 0,25 % volume. The extraction of yttrium and dysprosium in 2 M HNO 3 was Kd y = 2.945 and Kd D y = 0.019

  2. 46 CFR 67.171 - Deletion; requirement and procedure.

    Science.gov (United States)

    2010-10-01

    ... 46 Shipping 2 2010-10-01 2010-10-01 false Deletion; requirement and procedure. 67.171 Section 67...; Requirement for Exchange, Replacement, Deletion, Cancellation § 67.171 Deletion; requirement and procedure. (a... provided in § 67.161, and the vessel is subject to deletion from the roll of actively documented vessels...

  3. 40 CFR 141.171 - Criteria for avoiding filtration.

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 22 2010-07-01 2010-07-01 false Criteria for avoiding filtration. 141.171 Section 141.171 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) WATER PROGRAMS (CONTINUED) NATIONAL PRIMARY DRINKING WATER REGULATIONS Enhanced Filtration and Disinfection...

  4. 40 CFR 265.171 - Condition of containers.

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 25 2010-07-01 2010-07-01 false Condition of containers. 265.171... DISPOSAL FACILITIES Use and Management of Containers § 265.171 Condition of containers. If a container... transfer the hazardous waste from this container to a container that is in good condition, or manage the...

  5. 40 CFR 264.171 - Condition of containers.

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 25 2010-07-01 2010-07-01 false Condition of containers. 264.171... Use and Management of Containers § 264.171 Condition of containers. If a container holding hazardous... leak, the owner or operator must transfer the hazardous waste from this container to a container that...

  6. 12 CFR 410.171-410.999 - [Reserved

    Science.gov (United States)

    2010-01-01

    ... 12 Banks and Banking 4 2010-01-01 2010-01-01 false [Reserved] 410.171-410.999 Section 410.171-410.999 Banks and Banking EXPORT-IMPORT BANK OF THE UNITED STATES ENFORCEMENT OF NONDISCRIMINATION ON THE BASIS OF HANDICAP IN PROGRAMS OR ACTIVITIES CONDUCTED BY EXPORT-IMPORT BANK OF THE UNITED STATES §§ 410...

  7. Custom Coordination Environments for Lanthanoids: Tripodal Ligands Achieve Near-Perfect Octahedral Coordination for Two Dysprosium-Based Molecular Nanomagnets.

    Science.gov (United States)

    Lim, Kwang Soo; Baldoví, José J; Jiang, ShangDa; Koo, Bong Ho; Kang, Dong Won; Lee, Woo Ram; Koh, Eui Kwan; Gaita-Ariño, Alejandro; Coronado, Eugenio; Slota, Michael; Bogani, Lapo; Hong, Chang Seop

    2017-05-01

    Controlling the coordination sphere of lanthanoid complexes is a challenging critical step toward controlling their relaxation properties. Here we present the synthesis of hexacoordinated dysprosium single-molecule magnets, where tripodal ligands achieve a near-perfect octahedral coordination. We perform a complete experimental and theoretical investigation of their magnetic properties, including a full single-crystal magnetic anisotropy analysis. The combination of electrostatic and crystal-field computational tools (SIMPRE and CONDON codes) allows us to explain the static behavior of these systems in detail.

  8. Experimental and theoretical approach on the optical properties of zinc borotellurite glass doped with dysprosium oxide

    Science.gov (United States)

    Halimah, M. K.; Ami Hazlin, M. N.; Muhammad, F. D.

    2018-04-01

    A series of glass samples with chemical formula {[(TeO2)0.7(B2O3)0.3]0.7(ZnO)0.3}1 - x(Dy2O3)x where x = 0.01, 0.02, 0.03, 0.04 and 0.05 M fraction were synthesized through conventional melt-quenching method. The most common way to fabricate a glass material is by fusion of two or more component oxides followed by their quenching. This technique is known as melt-quenching technique. Kaur et al. (2016) [1] highlighted that the melt-quenching method able to enhance the mechanical properties like hardness and flexural strength of the material. The nature of the glass systems is proven to be amorphous based on the XRD pattern. The FTIR spectra of the glass systems confirm the existence of five bands which are assigned for the BO4, BO3, TeO4 and TeO3 vibrational groups. The density of the glass systems is increased with the addition of Dy2O3 while the molar volume is found to be inversely proportional to the density of the proposed glass. The optical properties of the glasses are determined through the absorption spectra obtained from the UV-VIS spectrophotometer. From the absorption spectra, the indirect and direct optical band gaps and the Urbach energy are found to be inversely proportional to each other. As the molar fraction of the Dy2O3 increased, the optical band gaps are observed to increase as opposed to the Urbach energy. For this glass system, the values of refractive index, electronic polarizability, oxide ion polarizability and the optical basicity are found to decrease as the addition of the dysprosium oxide is increased. From the emission spectra, two intense blue and yellow emission bands are observed, which correspond to the 4F9/2 → 6H15/2 and 4F9/2 → 6H13/2 transitions of Dy3 + ions respectively. The CIE chromaticity coordinates of the zinc borotellurite glass systems are found to be located in the white light region. Generation of white light The generation of the white light can be achieved by using two emission bands which comprise of the yellow

  9. Textured dysprosium and gadolinium poles for high-field, short-period hybrid undulators

    International Nuclear Information System (INIS)

    Murokh, Alex; Solovyov, Vyacheslav; Agustsson, Ron; O'Shea, Finn H.; Chubar, Oleg; Chen, Yung; Grandsaert, Thomas

    2014-01-01

    We discuss the feasibility of enhancement of the gap field in a short-period hybrid undulator by using pole inserts with the saturation inductance B s , over that of iron, 2 T. Dysprosium metal, with the saturation inductance of 3.4 T below 90 K, and Gadolinium with B s =2.7 T, appear as good candidates as the optimized pole material. However, due to the high magnetic anisotropy of Dy, such a high level of magnetization can only be realized when the external field lies in the basal plane. This implies that the pole has to be single-crystalline or highly textured. Considering that growing large, >10mm, Dy single crystals is difficult, we propose secondary recrystallization as a method to induce the required texture in thin Dy and Gd foils. The textured foils can be stacked to produce pole inserts of the desired geometry and orientation. Results of small-scale processing and magnetic measurements of thin (20–60 μ) foils provide evidence that the required texture quality can be achieved by a relatively simple sequence of heat-treatments and cold rolling. The advantage of textured Dy and Gd poles is demonstrated in a several period test undulator. -- Highlights: • Textured rare-earth materials for use as undulator pole materials. • We measure the development of texture in Dy and Gd. • We compare the rare-earth materials with high saturation steel in undulators. • Thin sheets of Dy and Gd materials perform similar to single crystals

  10. Electrocatalytic approach for the efficiency increase of electrolytic hydrogen production: Proof-of-concept using platinum-dysprosium alloys

    International Nuclear Information System (INIS)

    Santos, D.M.F.; Šljukić, B.; Sequeira, C.A.C.; Macciò, D.; Saccone, A.; Figueiredo, J.L.

    2013-01-01

    Development of electrocatalytic materials for the hydrogen evolution reaction (HER) is attempted with the aim of reducing the water electrolysis overpotential and increasing its efficiency. Using linear scan voltammetry measurements of the hydrogen discharge enables evaluation of the electrocatalytic activity for the HER of platinum–dysprosium (Pt–Dy) intermetallic alloy electrodes of different compositions. Understanding of materials electrocatalytic performance is based on determination of several crucial kinetic parameters, including the Tafel coefficients, b, charge transfer coefficients, α, exchange current densities, j 0 , and activation energies, E a . Influence of temperature on HER is investigated by performing studies at temperatures ranging from 25 °C to 85 °C. The effect of the Dy amount in the efficiency of the HER on the Pt–Dy alloys is analysed. Results demonstrate that Dy can substantially increase the electrocatalytic activity of the Pt alloys, in comparison to the single Pt electrode. Efforts are made to correlate the microstructure of the alloys with their performance towards the HER. - Highlights: ► Development of electrocatalysts to increase efficiency of electrolytic hydrogen production. ► Synthesis and evaluation of composition and morphology of platinum–dysprosium (Pt–Dy) alloys. ► Hydrogen evolution reaction on Pt–Dy alloys electrodes studied using linear scan voltammetry in alkaline medium. ► Pt–Dy alloy with equiatomic composition enhances kinetics of hydrogen discharge compared to single Pt

  11. The application of x-ray spectrometry to isotopic-source activation analysis of dysprosium and holmium

    International Nuclear Information System (INIS)

    Pillay, A.E.; Mboweni, R.C.M.

    1990-01-01

    A novel aspect of activation analysis is described for the determination of dysprosium and holmium at low concentrations. The method involves the measurement of K x-rays from radionuclides produced by thermal neutron activation using a 1 mg 252 Cf source. The basis for elemental selection depends largely on the demand for analysis and on the existence of favourable nuclear properties for the production of a practicable x-ray yield. A full appraisal of the analytical potential of the method is presented with particular emphasis on its application to geological matrices. The sensitivity was optimised by employing a detector that was particularly effective at photon energies below 150 keV. Analytical conditions are demonstrated for the elements of interest over a wide range of concentrations in small powdered samples. The investigation formed the basis of a feasibility study to establish if the application could be developed for the routine off-line determination of dysprosium and holmium using an isotopic-neutron source. (author)

  12. Reduction of titanocene dichloride with dysprosium: access to a stable titanocene(ii) equivalent for phosphite-free Takeda carbonyl olefination.

    Science.gov (United States)

    Bousrez, G; Déchamps, I; Vasse, J-L; Jaroschik, F

    2015-05-28

    The reduction of titanocene dichloride with dysprosium yields a new titanocene(ii) equivalent without the need for further stabilising ligands. This reagent can be employed in combination with dithioacetals for the olefination of different carbonyl groups and allows for a simplified all-in-one procedure.

  13. Acute dysprosium toxicity to Daphnia pulex and Hyalella azteca and development of the biotic ligand approach

    Energy Technology Data Exchange (ETDEWEB)

    Vukov, Oliver, E-mail: vuko3930@mylaurier.ca [Biology Department, Wilfrid Laurier University, Waterloo, Ontario N2L 3C5 (Canada); Smith, D. Scott [Chemistry Department, Wilfrid Laurier University, Waterloo, Ontario N2L 3C5 (Canada); McGeer, James C. [Biology Department, Wilfrid Laurier University, Waterloo, Ontario N2L 3C5 (Canada)

    2016-01-15

    The toxicological understanding of rare earth elements (REEs) in the aquatic environment is very limited but of increasing concern. The objective of this research is to compare the toxicological effect of the REE dysprosium to the freshwater invertebrates Daphnia pulex and Hyalella azteca and in the more sensitive organism, understand the toxicity modifying influence of Ca, Na, Mg, pH and dissolved organic matter (DOM). Standard methods (Environment Canada) were followed for testing and culture in media of intermediate hardness (60 mg CaCO{sub 3} mg/L) at pH 7.8 with Ca at 0.5, Na 0.5, Mg 0.125 (mM) and 23 °C. Acute toxicity tests were done with <24 h old neonates for 48 h in the case of D. pulex and with 2–9 days old offspring for 96 h tests with Hyalella. The potential protective effect of cationic competition was tested with Ca (0.5–2.0 mM), Na (0.5–2.0 mM) and Mg (0.125–0.5 mM). The effect of pH (6.5–8.0) and Suwannee River DOM complexation (at dissolved organic carbon (DOC) concentrations of 9 and 13 mg C/L) were evaluated. Dissolved Dy concentrations were lower than total (unfiltered) indicating precipitation, particularly at higher concentrations. Acute toxicity of Dy to H. azteca and D. pulex revealed Hyalella to be 1.4 times more sensitive than Daphnia. Additions of Ca and Na but not Mg provided significant protection against Dy toxicity to Hyalella. Similarly, low pH was associated with reduction in toxicity. Exposures which were pH buffered with and without MOPS were significantly different and indicated that MOPS enhanced Dy toxicity. DOM also mitigated Dy toxicity. Biotic ligand based parameters (Log K values) were calculated based on free ion relationships as determined by geochemical equilibrium modeling software (WHAM ver. 7.02). The log K value for Dy{sup 3+} toxicity to Hyalella was 7.75 while the protective influence of Ca and Na were 3.95 and 4.10, respectively. This study contributes data towards the development of site specific

  14. Synthesis and characterization of phosphors based on calcium and magnesium silicates doped with europium and dysprosium

    International Nuclear Information System (INIS)

    Misso, Agatha Matos

    2016-01-01

    Ca and Mg silicates based phosphors were prepared by sol-gel method combined with the molten salts process. The gel of silica was obtained from Na 2 SiO 3 solution by using europium, dysprosium, calcium and magnesium chloride solutions. Therefore, those chlorides were homogeneously dispersed into the gel. The obtained gel was dried and heat treated to 900° C for 1h to allow the fusion of the present salts. Then it was water washed until negative test for Cl - , and dried. The reduction of the europium to Eu 2+ was performed under atmosphere of 5% of H 2 and 95% of Ar to 900° C for 3h, to reach CaMgSi 2 O 6 :Eu 2+ and CaMgSi 2 O 6 :Eu 2+ :Dy 3+ phosphors. Diopside was identified as main crystalline phase and quartz, as secondary phase from XRD (X-ray diffraction) patterns. SEM (scanning electron microscopy) micrographs, of the samples showed needles, spheres, leaves and rods of particles and agglomerates. Thermal analysis (TGA-DTGA) curves revealed that the crystallization temperature of CaMgSi 2 O 6 :Eu 2+ lies around 765° C. Photoluminescence spectroscopy of the phosphors was studied based on interconfigurational 4f N → 4f N-1 5d transition of Eu 2+ ion. The spectra of excitation showed 4f N → 4f N-1 5d transition of Eu 2+ ion broad band, related to the ligand to metal charge transfer transition (LMCT) O 2- (2p) → Eu 3+ in the 250 nm region, when the emission is monitored at 583,5 nm. It also presents the 4f ↔ 4f transitions of Eu 3+ ion bands, showing the 7 F 0 → 5 L 6 transition at 393 nm. From emission spectra with excitation monitored at 393 nm, it can be observed fine peaks between 570 and 750 nm which are characteristics of 5 D 0 → 7 F J (J = 0 - 5) transition of Eu 3+ ion, indicating that the Eu 3+ ion occupies a site with center of inversion. Finally, the obtained results indicate that the developed method is suitable to synthesize CaMgSi 2 O 6 :Eu 2+ and CaMgSi 2 O 6 :Eu 2+ :Dy 3+ phosphors, as it has been proposed. (author)

  15. Luminescence properties of dysprosium doped calcium magnesium silicate phosphor by solid state reaction method

    Energy Technology Data Exchange (ETDEWEB)

    Sahu, Ishwar Prasad, E-mail: ishwarprasad1986@gmail.com [School of Studies in Physics & Astrophysics, Pt. Ravishankar Shukla University, Raipur, C.G. 492010 (India); Chandrakar, Priya; Baghel, R.N.; Bisen, D.P.; Brahme, Nameeta [School of Studies in Physics & Astrophysics, Pt. Ravishankar Shukla University, Raipur, C.G. 492010 (India); Tamrakar, Raunak Kumar [Department of Applied Physics, Bhilai Institute of Technology, Durg, C.G. 491001 (India)

    2015-11-15

    Dysprosium doped calcium magnesium silicate (CaMgSi{sub 2}O{sub 6}:Dy{sup 3+}) white light emitting phosphor was synthesized by solid state reaction process. The crystal structure of sintered phosphor was monoclinic structure with space group C2/c. Chemical composition of the sintered CaMgSi{sub 2}O{sub 6}:Dy{sup 3+} phosphor was confirmed by EDX. The prepared CaMgSi{sub 2}O{sub 6}:Dy{sup 3+} phosphor was excited from 352 nm and their corresponding emission spectra were recorded at blue (470 nm), yellow (570 nm) and red (675 nm) line due to the {sup 4}F{sub 9/2} → {sup 6}H{sub 15/2}, {sup 4}F{sub 9/2} → {sup 6}H{sub 13/2}, {sup 4}F{sub 9/2} → {sup 6}H{sub 11/2} transitions of Dy{sup 3+} ions. The combination of these three emissions constituted as white light confirmed by the Commission Internationale de L'Eclairage (CIE) chromatic coordinate diagram. The possible mechanism of the white light emitting long lasting CaMgSi{sub 2}O{sub 6}:Dy{sup 3+} phosphor was also investigated. Investigation on afterglow property show that phosphor held fast and slow decay process. The peak of mechanoluminescence (ML) intensity increases linearly with increasing impact velocity of the moving piston. Thus the present investigation indicates that the local piezoelectricity-induced electron bombardment model is responsible to produce ML in prepared CaMgSi{sub 2}O{sub 6}:Dy{sup 3+} phosphor. - Highlights: • The crystal structure of CaMgSi{sub 2}O{sub 6}:Dy{sup 3+} phosphor is consistent with standard monoclinic structure. • CIE coordinates of CaMgSi{sub 2}O{sub 6}:Dy{sup 3+} phosphor is suitable as white light emitting phosphor. • The local piezoelectricity-induced electron bombardment model is responsible to produce ML in CaMgSi{sub 2}O{sub 6}:Dy{sup 3+} phosphor.

  16. An ICP AES method for determination of dysprosium and terbium in high purity yttrium oxide

    International Nuclear Information System (INIS)

    Rupawate, V.H.; Hareendran, K.N.; Roy, S.B.

    2011-01-01

    High purity yttrium finds interesting application in astronavigation, luminescence, nuclear energy and metallurgical industries. Most of these applications require yttrium oxide of highest purity. Consequently there is a need for production of high purity yttrium oxide. Separation and purification of yttrium from other rare earths is a challenging task due to their close chemical properties. Liquid-liquid extraction and ion exchange have been widely used in the production of yttrium oxide of highest purity. Determination of impurities, especially other rare earths, in ppm level is required for process development and chemical characterization of the high purity Y 2 O 3 . Many methods have been described in literature. However since the advent of ICP AES much work in this area has been carried out by this technique. This paper describes the work done for determination of dysprosium (Dy) and terbium (Tb) in yttrium oxide using a high resolution sequential ICP AES. Emission spectra of rare earth elements are very complex and due to this complexity it is important to select spectral interference free analyte lines for determination of rare earths in rare earth matrix. For the determination of Dy and Tb in Y 2 O 3 , sensitive lines of Dy and Tb are selected from the instrument wavelength table and spectral interference free emission lines for the determination is selected by scanning around the selected wavelengths using 5 g/L Y solution and 5 mg/L standard solutions of Dy and Tb prepared in 4% nitric acid. It is found 353.170 nm line of Dy and 350.917 nm line Tb is suitable for quantitative determination. The signal to background ratio increases with increase in matrix concentration, i.e. from 1 to 5 mg/L. The optimum forward power is determined and it is found to be 1100W for Dy and 1000W for Tb. The instrument is calibrated using matrix matched standards containing 5g/L of Y matrix. Samples are dissolved in nitric acid and Y concentration is maintained at 5g/L. Two

  17. Acute dysprosium toxicity to Daphnia pulex and Hyalella azteca and development of the biotic ligand approach

    International Nuclear Information System (INIS)

    Vukov, Oliver; Smith, D. Scott; McGeer, James C.

    2016-01-01

    The toxicological understanding of rare earth elements (REEs) in the aquatic environment is very limited but of increasing concern. The objective of this research is to compare the toxicological effect of the REE dysprosium to the freshwater invertebrates Daphnia pulex and Hyalella azteca and in the more sensitive organism, understand the toxicity modifying influence of Ca, Na, Mg, pH and dissolved organic matter (DOM). Standard methods (Environment Canada) were followed for testing and culture in media of intermediate hardness (60 mg CaCO 3 mg/L) at pH 7.8 with Ca at 0.5, Na 0.5, Mg 0.125 (mM) and 23 °C. Acute toxicity tests were done with <24 h old neonates for 48 h in the case of D. pulex and with 2–9 days old offspring for 96 h tests with Hyalella. The potential protective effect of cationic competition was tested with Ca (0.5–2.0 mM), Na (0.5–2.0 mM) and Mg (0.125–0.5 mM). The effect of pH (6.5–8.0) and Suwannee River DOM complexation (at dissolved organic carbon (DOC) concentrations of 9 and 13 mg C/L) were evaluated. Dissolved Dy concentrations were lower than total (unfiltered) indicating precipitation, particularly at higher concentrations. Acute toxicity of Dy to H. azteca and D. pulex revealed Hyalella to be 1.4 times more sensitive than Daphnia. Additions of Ca and Na but not Mg provided significant protection against Dy toxicity to Hyalella. Similarly, low pH was associated with reduction in toxicity. Exposures which were pH buffered with and without MOPS were significantly different and indicated that MOPS enhanced Dy toxicity. DOM also mitigated Dy toxicity. Biotic ligand based parameters (Log K values) were calculated based on free ion relationships as determined by geochemical equilibrium modeling software (WHAM ver. 7.02). The log K value for Dy 3+ toxicity to Hyalella was 7.75 while the protective influence of Ca and Na were 3.95 and 4.10, respectively. This study contributes data towards the development of site specific water quality

  18. K-electron capture probability in 171Lu

    International Nuclear Information System (INIS)

    Mishra, N.R.; Vara Prasad, N.V.S.; Chandrasekhara Rao, M.V.S.; Satyanarayana, G.; Sastry, D.L.; Chintalapudi, S.N.

    1999-01-01

    The K-electron capture probability in the decay of 171 Lu to the 835.06 keV level of the daughter nucleus 171 Yb is measured to be 0.822 ± 0.027 involving two transitions, in agreement with the theoretical value 0.833. The experimental value is seen to be consistent with the mass prediction of the relationship due to Wapstra and Bos. (author)

  19. Dual responsive dysprosium-doped hydroxyapatite particles and toxicity reduction after functionalization with folic and glucuronic acids.

    Science.gov (United States)

    Sánchez Lafarga, Ana Karen; Pacheco Moisés, Fermín P; Gurinov, Andrey; Ortiz, Genaro Gabriel; Carbajal Arízaga, Gregorio Guadalupe

    2015-03-01

    The development of probes for biomedical applications demands materials with low toxicity levels besides fluorescence or magnetic properties to be detected by confocal microscopes or MRI resonators. Several drug delivery systems or other biomedical materials prepared with hydroxyapatite have been proposed, however, toxicity effects might arise when the size of particles is nanometric. In this study, hydroxyapatite functionalized with glucuronic or folic acids presented lower oxidative stress, measured from lipoperoxides and nitric oxide indicators in rats than pure hydroxyapatite. In separated experiments, hydroxyapatite was doped with dysprosium cations by coprecipitation producing a single crystal phase with fluorescent properties easily visualized by confocal microscopy when excited at 488nm. These particles also presented the ability to modify the proton relaxation time in T1 maps collected by magnetic resonance imaging. These modified hydroxyapatite nanoparticles could be candidates to design bimodal probes with low toxicity. Copyright © 2014 Elsevier B.V. All rights reserved.

  20. Magnetic anisotropy of dysprosium(III) in a low-symmetry environment: a theoretical and experimental investigation.

    Science.gov (United States)

    Bernot, Kevin; Luzon, Javier; Bogani, Lapo; Etienne, Mael; Sangregorio, Claudio; Shanmugam, Muralidharan; Caneschi, Andrea; Sessoli, Roberta; Gatteschi, Dante

    2009-04-22

    A mixed theoretical and experimental approach was used to determine the local magnetic anisotropy of the dysprosium(III) ion in a low-symmetry environment. The susceptibility tensor of the monomeric species having the formula [Dy(hfac)(3)(NIT-C(6)H(4)-OEt)(2)], which contains nitronyl nitroxide (NIT-R) radicals, was determined at various temperatures through angle-resolved magnetometry. These results are in agreement with ab initio calculations performed using the complete active space self-consistent field (CASSCF) method, validating the predictive power of this theoretical approach for complex systems containing rare-earth ions, even in low-symmetry environments. Susceptibility measurements performed with the applied field along the easy axis eventually permitted a detailed analysis of the temperature and field dependence of the magnetization, providing evidence that the Dy ion transmits an antiferromagnetic interaction between radicals but that the Dy-radical interaction is ferromagnetic.

  1. Watt-level dysprosium fiber laser at 3.15  μm with 73% slope efficiency.

    Science.gov (United States)

    Woodward, R I; Majewski, M R; Bharathan, G; Hudson, D D; Fuerbach, A; Jackson, S D

    2018-04-01

    Rare-earth-doped fiber lasers are emerging as promising high-power mid-infrared sources for the 2.6-3.0 μm and 3.3-3.8 μm regions based on erbium and holmium ions. The intermediate wavelength range, however, remains vastly underserved, despite prospects for important manufacturing and defense applications. Here, we demonstrate the potential of dysprosium-doped fiber to solve this problem, with a simple in-band pumped grating-stabilized linear cavity generating up to 1.06 W at 3.15 μm. A slope efficiency of 73% with respect to launched power (77% relative to absorbed power) is achieved-the highest value for any mid-infrared fiber laser to date, to the best of our knowledge. Opportunities for further power and efficiency scaling are also discussed.

  2. On-line complexation/cloud point preconcentration for the sensitive determination of dysprosium in urine by flow injection inductively coupled plasma-optical emission spectrometry

    International Nuclear Information System (INIS)

    Ortega, Claudia; Cerutti, Soledad; Silva, Maria F.; Olsina, Roberto A.; Martinez, Luis D.

    2003-01-01

    An on-line dysprosium preconcentration and determination system based on the hyphenation of cloud point extraction (CPE) to flow injection analysis (FIA) associated with ICP-OES was studied. For the preconcentration of dysprosium, a Dy(III)-2-(5-bromo-2-pyridylazo)-5-diethylaminophenol complex was formed on-line at pH 9.22 in the presence of nonionic micelles of PONPE-7.5. The micellar system containing the complex was thermostated at 30 C in order to promote phase separation, and the surfactant-rich phase was retained in a microcolumn packed with cotton at pH 9.2. The surfactant-rich phase was eluted with 4 mol L -1 nitric acid at a flow rate of 1.5 mL min -1 , directly in the nebulizer of the plasma. An enhancement factor of 50 was obtained for the preconcentration of 50 mL of sample solution. The detection limit value for the preconcentration of 50 mL of aqueous solution of Dy was 0.03 μg L -1 . The precision for 10 replicate determinations at the 2.0 μg L -1 Dy level was 2.2% relative standard deviation (RSD), calculated from the peak heights obtained. The calibration graph using the preconcentration system for dysprosium was linear with a correlation coefficient of 0.9994 at levels near the detection limits up to at least 100 μg L -1 . The method was successfully applied to the determination of dysprosium in urine. (orig.)

  3. Graphite furnace atomic absorption spectrometry with a tantalum boat for the determination of yttrium, samarium, and dysprosium in a mish metal

    International Nuclear Information System (INIS)

    Daidoji, Hidehiro; Tamura, Shohei

    1982-01-01

    The determination of yttrium, samarium, and dysprodium by means of graphite-furnace atomic absorption spectrometry (AAS) was studied by a tantalum boat inserted into a graphite tube atomizer. These elements could not be determined by the use of a commercial graphite tube, In the atomization from a tantalum boat, better analytical sensitivities and negligible memory effects for these rare earths are obtained. The analytical sensitivities of yttrium, samarium, and dysprodium with the tantalum boat were 0.60 ng, 0.86 ng, and 0.17 ng respectively. This method was applied for the determination of yttrium, samarium, and dysprosium in a mish metal. The measurements were performed with slightly acidified solutions (0.01 mol dm 3 HCI or HNO 3 ). The sensitivities and the precisions for these elements decreased with increasing acid concentration. An enhancement in the sensitivities of yttrium and dysprosium upon the addition of a large excess of lanthanum, neodymium, and praseodymium salts were observed. The yttrium, samarium, and dysprosium in a mish metal were determined with both analytical curves of standard solutions containing an excess of lanthanum, cerium, and neodymium ions and of the standard addition. The precisions for this work were in the 3 - 9.3% range. (author)

  4. 40 CFR 205.171-3 - Test motorcycle sample selection.

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 24 2010-07-01 2010-07-01 false Test motorcycle sample selection. 205... ABATEMENT PROGRAMS TRANSPORTATION EQUIPMENT NOISE EMISSION CONTROLS Motorcycle Exhaust Systems § 205.171-3 Test motorcycle sample selection. A test motorcycle to be used for selective enforcement audit testing...

  5. 12 CFR 308.171 - Responses to application.

    Science.gov (United States)

    2010-01-01

    ... PRACTICE AND PROCEDURE Rules and Procedures Relating to the Recovery of Attorney Fees and Other Expenses § 308.171 Responses to application. (a) By FDIC. (1) Within 20 days after service of an application... statement of intent to negotiate under § 308.179 of this subpart, failure to file an answer within the 20...

  6. Potential probiotic of Lactobacillus johnsonii LT171 for chicken ...

    African Journals Online (AJOL)

    The objective of this research was to investigate the potential probiotic of Lactobacillus johnsonii LT171. It had aggregation (60 min) and antibacterial effects against Salmonella Enteritidis, Salmonella Typhimurium and Escherichia coli O78:K80. It showed amylase and protease activity and high clear zone in culture medium ...

  7. 47 CFR 17.1 - Basis and purpose.

    Science.gov (United States)

    2010-10-01

    ... antenna structure owners. The standards are referenced from two Federal Aviation Administration (FAA... STRUCTURES General Information § 17.1 Basis and purpose. (a) The rules in this part are issued pursuant to the authority contained in Title III of the Communications Act of 1934, as amended, which vest...

  8. 22 CFR 171.44 - Improper use of reports.

    Science.gov (United States)

    2010-04-01

    ... PUBLIC Ethics in Government Act Provisions § 171.44 Improper use of reports. (a) The Attorney General may bring a civil action against any person who obtains or uses a financial disclosure report: (1) For any... person who obtains or uses the reports for these prohibited purposes. Such remedy shall be in addition to...

  9. 21 CFR 171.7 - Withdrawal of petition without prejudice.

    Science.gov (United States)

    2010-04-01

    ... 21 Food and Drugs 3 2010-04-01 2009-04-01 true Withdrawal of petition without prejudice. 171.7... Withdrawal of petition without prejudice. (a) In some cases the Commissioner will notify the petitioner that... clarification or the obtaining of additional data. This withdrawal will be without prejudice to a future filing...

  10. Workplace testing of the new single sphere neutron spectrometer based on Dysprosium activation foils (Dy-SSS)

    International Nuclear Information System (INIS)

    Bedogni, R.; Gómez-Ros, J.M.; Esposito, A.; Gentile, A.; Chiti, M.; Palacios-Pérez, L.; Angelone, M.; Tana, L.

    2012-01-01

    A photon insensitive passive neutron spectrometer consisting of a single moderating polyethylene sphere with Dysprosium activation foils arranged along three perpendicular axes was designed by CIEMAT and INFN. The device is called Dy-SSS (Dy foil-based Single Sphere Spectrometer). It shows nearly isotropic response in terms of neutron fluence up to 20 MeV. The first prototype, previously calibrated with 14 MeV neutrons, has been recently tested in workplaces having different energy and directional distributions. These are a 2.5 MeV nearly mono-chromatic and mono-directional beam available at the ENEA Frascati Neutron Generator (FNG) and the photo-neutron field produced in a 15 MV Varian CLINAC DHX medical accelerator, located in the Ospedale S. Chiara (Pisa). Both neutron spectra are known through measurements with a Bonner Sphere Spectrometer. In both cases the experimental response of the Dy-SSS agrees with the reference data. Moreover, it is demonstrated that the spectrometric capability of the new device are independent from the directional distribution of the neutron field. This opens the way to a new generation of moderation-based neutron instruments, presenting all advantages of the Bonner sphere spectrometer without the disadvantage of the repeated exposures. This concept is being developed within the NESCOFI@BTF project of INFN (Commissione Scientifica Nazionale 5).

  11. Workplace testing of the new single sphere neutron spectrometer based on Dysprosium activation foils (Dy-SSS)

    Science.gov (United States)

    Bedogni, R.; Gómez-Ros, J. M.; Esposito, A.; Gentile, A.; Chiti, M.; Palacios-Pérez, L.; Angelone, M.; Tana, L.

    2012-08-01

    A photon insensitive passive neutron spectrometer consisting of a single moderating polyethylene sphere with Dysprosium activation foils arranged along three perpendicular axes was designed by CIEMAT and INFN. The device is called Dy-SSS (Dy foil-based Single Sphere Spectrometer). It shows nearly isotropic response in terms of neutron fluence up to 20 MeV. The first prototype, previously calibrated with 14 MeV neutrons, has been recently tested in workplaces having different energy and directional distributions. These are a 2.5 MeV nearly mono-chromatic and mono-directional beam available at the ENEA Frascati Neutron Generator (FNG) and the photo-neutron field produced in a 15 MV Varian CLINAC DHX medical accelerator, located in the Ospedale S. Chiara (Pisa). Both neutron spectra are known through measurements with a Bonner Sphere Spectrometer. In both cases the experimental response of the Dy-SSS agrees with the reference data. Moreover, it is demonstrated that the spectrometric capability of the new device are independent from the directional distribution of the neutron field. This opens the way to a new generation of moderation-based neutron instruments, presenting all advantages of the Bonner sphere spectrometer without the disadvantage of the repeated exposures. This concept is being developed within the NESCOFI@BTF project of INFN (Commissione Scientifica Nazionale 5).

  12. Workplace testing of the new single sphere neutron spectrometer based on Dysprosium activation foils (Dy-SSS)

    Energy Technology Data Exchange (ETDEWEB)

    Bedogni, R., E-mail: roberto.bedogni@lnf.infn.it [INFN-LNF (Frascati National Laboratories), Via E. Fermi n. 40-00044 Frascati (Italy); Gomez-Ros, J.M. [INFN-LNF (Frascati National Laboratories), Via E. Fermi n. 40-00044 Frascati (Italy); CIEMAT, Av. Complutense 40, 28040 Madrid (Spain); Esposito, A.; Gentile, A.; Chiti, M.; Palacios-Perez, L. [INFN-LNF (Frascati National Laboratories), Via E. Fermi n. 40-00044 Frascati (Italy); Angelone, M. [ENEA C.R. Frascati, C.P. 65, 00044 Frascati (Italy); Tana, L. [A.O. Universitaria Pisana-Ospedale S. Chiara, Via Bonanno Pisano, Pisa (Italy)

    2012-08-21

    A photon insensitive passive neutron spectrometer consisting of a single moderating polyethylene sphere with Dysprosium activation foils arranged along three perpendicular axes was designed by CIEMAT and INFN. The device is called Dy-SSS (Dy foil-based Single Sphere Spectrometer). It shows nearly isotropic response in terms of neutron fluence up to 20 MeV. The first prototype, previously calibrated with 14 MeV neutrons, has been recently tested in workplaces having different energy and directional distributions. These are a 2.5 MeV nearly mono-chromatic and mono-directional beam available at the ENEA Frascati Neutron Generator (FNG) and the photo-neutron field produced in a 15 MV Varian CLINAC DHX medical accelerator, located in the Ospedale S. Chiara (Pisa). Both neutron spectra are known through measurements with a Bonner Sphere Spectrometer. In both cases the experimental response of the Dy-SSS agrees with the reference data. Moreover, it is demonstrated that the spectrometric capability of the new device are independent from the directional distribution of the neutron field. This opens the way to a new generation of moderation-based neutron instruments, presenting all advantages of the Bonner sphere spectrometer without the disadvantage of the repeated exposures. This concept is being developed within the NESCOFI@BTF project of INFN (Commissione Scientifica Nazionale 5).

  13. 46 CFR 171.065 - Subdivision requirements- Type I.

    Science.gov (United States)

    2010-10-01

    ... the following: (i) 0.6LN (0.056LN) where— N=the total number of passengers; and L=LBP in feet (meters... bulkhead deck. EC01MR91.021 Table 171.065(a) (English units) Vessel length (LBP) Criterion numeral (CN) FS CN less than or equal to 23 A Vessel length greater than 392 feet CN greater than 23 and less than...

  14. 25 CFR 171.310 - Can I use water delivered by BIA for livestock purposes?

    Science.gov (United States)

    2010-04-01

    ... 25 Indians 1 2010-04-01 2010-04-01 false Can I use water delivered by BIA for livestock purposes? 171.310 Section 171.310 Indians BUREAU OF INDIAN AFFAIRS, DEPARTMENT OF THE INTERIOR LAND AND WATER IRRIGATION OPERATION AND MAINTENANCE Water Use § 171.310 Can I use water delivered by BIA for livestock...

  15. 40 CFR 205.171-2 - Test exhaust system sample selection and preparation.

    Science.gov (United States)

    2010-07-01

    ... Systems § 205.171-2 Test exhaust system sample selection and preparation. (a)(1) Exhaust systems... 40 Protection of Environment 24 2010-07-01 2010-07-01 false Test exhaust system sample selection and preparation. 205.171-2 Section 205.171-2 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY...

  16. 42 CFR 423.171 - Procedures for approval of accreditation as a basis for deeming compliance.

    Science.gov (United States)

    2010-10-01

    ... BENEFIT Cost Control and Quality Improvement Requirements § 423.171 Procedures for approval of... 42 Public Health 3 2010-10-01 2010-10-01 false Procedures for approval of accreditation as a basis for deeming compliance. 423.171 Section 423.171 Public Health CENTERS FOR MEDICARE & MEDICAID SERVICES...

  17. 42 CFR 456.171 - Medicaid agency review of need for admission.

    Science.gov (United States)

    2010-10-01

    ... 42 Public Health 4 2010-10-01 2010-10-01 false Medicaid agency review of need for admission. 456.171 Section 456.171 Public Health CENTERS FOR MEDICARE & MEDICAID SERVICES, DEPARTMENT OF HEALTH AND... Hospitals Medical, Psychiatric, and Social Evaluations and Admission Review § 456.171 Medicaid agency review...

  18. 40 CFR 171.3 - Categorization of commercial applicators of pesticides.

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 23 2010-07-01 2010-07-01 false Categorization of commercial applicators of pesticides. 171.3 Section 171.3 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) PESTICIDE PROGRAMS CERTIFICATION OF PESTICIDE APPLICATORS § 171.3 Categorization of commercial...

  19. 29 CFR 1952.171 - Where the plan may be inspected.

    Science.gov (United States)

    2010-07-01

    ... and copied during normal business hours at the following locations: Office of State Programs... 29 Labor 9 2010-07-01 2010-07-01 false Where the plan may be inspected. 1952.171 Section 1952.171..., DEPARTMENT OF LABOR (CONTINUED) APPROVED STATE PLANS FOR ENFORCEMENT OF STATE STANDARDS California § 1952.171...

  20. RESULTS OF THE FIRST MI-171A2 FLYING LABORATORY TEST PHASE

    Directory of Open Access Journals (Sweden)

    V. A. Ivchin

    2014-01-01

    Full Text Available The present publication describes the results of the first stage of the flying laboratory (Mi-171 helicopter flight tests performed at Mil Moscow Helicopter Plant, JSC facilities. Main rotor components with blades made of polymer composite materials and X-type tail rotor were tested on the Mi-171 № 14987, flying laboratory, under Mi-171A Helicopter Retrofit Program.

  1. RESULTS OF THE FIRST MI-171A2 FLYING LABORATORY TEST PHASE

    OpenAIRE

    V. A. Ivchin; K. Y. Samsonov

    2014-01-01

    The present publication describes the results of the first stage of the flying laboratory (Mi-171 helicopter) flight tests performed at Mil Moscow Helicopter Plant, JSC facilities. Main rotor components with blades made of polymer composite materials and X-type tail rotor were tested on the Mi-171 № 14987, flying laboratory, under Mi-171A Helicopter Retrofit Program.

  2. 9 CFR 381.171 - Definition and standard for “Turkey Ham.”

    Science.gov (United States)

    2010-01-01

    ... Ham.â 381.171 Section 381.171 Animals and Animal Products FOOD SAFETY AND INSPECTION SERVICE... Standards of Identity or Composition § 381.171 Definition and standard for “Turkey Ham.” (a) “Turkey Ham... label shall show the word “Turkey” in the same size, style, color, and with the same background as the...

  3. 26 CFR 1.381(c)(17)-1 - Deficiency dividend of personal holding company.

    Science.gov (United States)

    2010-04-01

    ... 26 Internal Revenue 4 2010-04-01 2010-04-01 false Deficiency dividend of personal holding company. 1.381(c)(17)-1 Section 1.381(c)(17)-1 Internal Revenue INTERNAL REVENUE SERVICE, DEPARTMENT OF THE TREASURY (CONTINUED) INCOME TAX (CONTINUED) INCOME TAXES Insolvency Reorganizations § 1.381(c)(17)-1...

  4. 49 CFR 17.1 - What is the purpose of these regulations?

    Science.gov (United States)

    2010-10-01

    ... 49 Transportation 1 2010-10-01 2010-10-01 false What is the purpose of these regulations? 17.1 Section 17.1 Transportation Office of the Secretary of Transportation INTERGOVERNMENTAL REVIEW OF DEPARTMENT OF TRANSPORTATION PROGRAMS AND ACTIVITIES § 17.1 What is the purpose of these regulations? (a) The...

  5. Level Densities and Radiative Strength Functions in 170,171Yb

    International Nuclear Information System (INIS)

    Agvaanluvsan, U.; Schiller, A.; Becker, J.A.; Berstein, L.A.; Guttormsen, M.; Mitchell, G.E.; Rekstad, J.; Siem, S.; Voinov, A.

    2003-01-01

    Level densities and radiative strength functions in 171 Yb and 170 Yb nuclei have been measured with the 171 Yb( 3 He, 3 He(prime) γ) 171 Yb and 171 Yb( 3 He, αγ) 170 Yb reactions. A simultaneous determination of the nuclear level density and the radiative strength function was made. The present data adds to and is consistent with previous results for several other rare earth nuclei. The method will be briefly reviewed and the result from the analysis will be presented. The radiative strength function for 171 Yb is compared to previously published work.

  6. Oxide perovskites with tetravalent dysprosium and compounds of the type Ba/sub 3/RE/sub 4/O/sub 9/ (RE = Rare Earth Element)

    Energy Technology Data Exchange (ETDEWEB)

    Brauer, G; Kristen, H [Freiburg Univ. (Germany, F.R.)

    1980-03-01

    In analogy to our investigations concerning tetravalent Nd in oxide perovskites, we also tried to stabilize dysprosium(IV) by incorporation in host-lattices with the perovskite structure. As host-lattices we used BaCeO/sub 3/, BaTbO/sub 3/, and SrTbO/sub 3/. Only in Ba(Ce, Dy)O/sub 3/ we could trace Dy(IV) with certainty. Among the prepared mixed oxides, also the phase Ba/sub 3/Dy/sub 4/O/sub 9/ occured. The lattice parameters of several phases of this latter type were redetermined.

  7. Effect of solvents on relation of intensities of bands of luminescence spectra of terbium and dysprosium ions in solutions of their complexes with acetoacetic ester

    International Nuclear Information System (INIS)

    Kononenko, L.I.; Bel'tyukova, S.V.; Meshkova, S.B.; Kravchenko, T.B.; Poluehktov, N.S.

    1978-01-01

    An investigation is made of the effect of different solvents on the ratio of the intensity of luminescence spectrum bands of terbium and dysprosium ions, corresponding and not corresponding to ''supersensitive'' transitions in complex compounds with acetoacetic ether. A dependence is established between these values and the dielectric constant of the solvent, and also parallels in their changes, which indicate the similar manifestation of the effect of solvents in both elements. A correlation is observed between ratios of the intensity of luminescence spectrum bands and values of forces of neodymium complex absorption band oscillators in different solvents

  8. Optical amplifier operating at 1.3 microns useful for telecommunications and based on dysprosium-doped metal chloride host materials

    Energy Technology Data Exchange (ETDEWEB)

    Page, R.H.; Schaffers, K.I.; Payne, S.A.; Krupke, W.F.; Beach, R.J.

    1997-12-02

    Dysprosium-doped metal chloride materials offer laser properties advantageous for use as optical amplifiers in the 1.3 {micro}m telecommunications fiber optic network. The upper laser level is characterized by a millisecond lifetime, the host material possesses a moderately low refractive index, and the gain peak occurs near 1.31 {micro}m. Related halide materials, including bromides and iodides, are also useful. The Dy{sup 3+}-doped metal chlorides can be pumped with laser diodes and yield 1.3 {micro}m signal gain levels significantly beyond those currently available. 9 figs.

  9. Optical amplifier operating at 1.3 microns useful for telecommunications and based on dysprosium-doped metal chloride host materials

    Energy Technology Data Exchange (ETDEWEB)

    Page, Ralph H. (San Ramon, CA); Schaffers, Kathleen I. (Pleasanton, CA); Payne, Stephen A. (Castro Valley, CA); Krupke, William F. (Pleasanton, CA); Beach, Raymond J. (Livermore, CA)

    1997-01-01

    Dysprosium-doped metal chloride materials offer laser properties advantageous for use as optical amplifiers in the 1.3 .mu.m telecommunications fiber optic network. The upper laser level is characterized by a millisecond lifetime, the host material possesses a moderately low refractive index, and the gain peak occurs near 1.31 .mu.m. Related halide materials, including bromides and iodides, are also useful. The Dy.sup.3+ -doped metal chlorides can be pumped with laser diodes and yield 1.3 .mu.m signal gain levels significantly beyond those currently available.

  10. Determination of Diclofenac on a Dysprosium Nanowire- Modified Carbon Paste Electrode Accomplished in a Flow Injection System by Advanced Filtering

    Directory of Open Access Journals (Sweden)

    Ali Akbar Moosavi-Movahedi

    2009-09-01

    Full Text Available A new detection technique called Fast Fourier Transform Square-Wave Voltammetry (FFT SWV is based on measurements of electrode admittance as a function of potential. The response of the detector (microelectrode, which is generated by a redox processes, is fast, which makes the method suitable for most applications involving flowing electrolytes. The carbon paste electrode was modified by nanostructures to improve sensitivity. Synthesized dysprosium nanowires provide a more effective nanotube-like surface [1-4] so they are good candidates for use as a modifier for electrochemical reactions. The redox properties of diclofenac were used for its determination in human serum and urine samples. The support electrolyte that provided a more defined and intense peak current for diclofenac determination was a 0.05 mol L−1 acetate buffer pH = 4.0. The drug presented an irreversible oxidation peak at 850 mV vs. Ag/AgCl on a modified nanowire carbon paste electrode which produced high current and reduced the oxidation potential by about 100 mV. Furthermore, the signal-to-noise ratio was significantly increased by application of a discrete Fast Fourier Transform (FFT method, background subtraction and two-dimensional integration of the electrode response over a selected potential range and time window. To obtain the much sensivity the effective parameters such as frequency, amplitude and pH was optimized. As a result, CDL of 2.0 × 10−9 M and an LOQ of 5.0 × 10−9 M were found for the determination for diclofenac. A good recovery was obtained for assay spiked urine samples and a good quantification of diclofenac was achieved in a commercial formulation.

  11. On the annealing behaviour of dysprosium ion implanted nickel: a combined study using Rutherford backscattering, transmission electron microscopy, and total current spectroscopy

    International Nuclear Information System (INIS)

    Chadderton, L.T.; Johnson, E.

    1977-01-01

    Despite continuing improvements in applications of the analytical method of Rutherford backscattering (RBS) to solid state physics it is recognized that more complete information can be obtained if other techniques - for example transmission electron microscopy (TEM) - are employed simultaneously. Experiments are described in which a combined RBS and TEM study of the annealing of nickel, rendered amorphous by implantation of 20 keV dysprosium ions is supplemented with a completely new technique - total current spectroscopy (TCS). In TCS low energy electrons (0-15 eV) are used to probe the damaged nickel. Observations have been made during annealing of both the reappearance of the bulk band structure of the metal and of a 'surface peak' which is highly sensitive to the recovery process. Changes in the height of the surface peak reveal three sharp annealing stages, the first two being preceded by reverse annealing which correlates well with RBS and TEM results. The first annealing stage - following the amorphous to crystalline transition - may be associated with electronic effects in the vicinity of the Curie point. Changes in the position of the surface peak allow one to trace the diffusion of dysprosium to the surface. Quantum mechanical resonances at the damage/crystal interface have also been followed throughout annealing. The initially amorphous layer (approximately 2.2nm) increases in thickness slightly during recovery. (Auth.)

  12. Four new dysprosium and neodymium octamolybdate hydrates: assembly of RE2(Mo8O27) sheets and topotactic transformations.

    Science.gov (United States)

    Kuang, Xiaojun; Evans, Ivana R

    2010-07-05

    Four new Dy and Nd hydrated octamolybdate materials have been prepared: [Dy(2)(H(2)O)(12)](Mo(8)O(27)) x 8 H(2)O, [Dy(2)(H(2)O)(6)](Mo(8)O(27)), [Nd(2)(H(2)O)(12)](Mo(8)O(27)) x 6 H(2)O, and [Nd(2)(H(2)O)(6)]Mo(8)O(27) x 3 H(2)O. They adopt one known and three new structure types, which we have determined ab initio from powder X-ray diffraction data. The four compounds contain the same basic structural building block, in the form of RE(2)Mo(8)O(27) (RE = Dy, Nd) chains, which are arranged differently for the two rare earths in the fully hydrated precursor materials. [Dy(2)(H(2)O)(12)](Mo(8)O(27)) x 8 H(2)O comprises isolated Dy(2)Mo(8)O(27) chains assembled in a zigzag manner along the a axis with interspersed crystallized water molecules, which differs from the parallel arrangements of isolated Nd(2)Mo(8)O(27) chains in [Nd(2)(H(2)O)(12)](Mo(8)O(27)) x 6 H(2)O. Partial dehydration of the two precursors leads to new phases [Dy(2)(H(2)O)(6)](Mo(8)O(27)) and [Nd(2)(H(2)O)(6)]Mo(8)O(27) x 3 H(2)O, respectively, prior to complete dehydration, which leads to initially amorphous and eventually crystalline rare-earth molybdenum mixed metal oxides. Both initial transformations occur topotactically. Partial dehydration of the Dy phase condenses the assembly of the Dy(2)Mo(8)O(27) chains principally along the a axis, leading to a 3-dimensional (3D) framework, with each Dy bridging two (Mo(8)O(27))(6-) sheets in the product. The partial dehydration of the Nd precursor condenses the assembly of Nd(2)Mo(8)O(27) chains along the [110] axis, leading to a 3D framework where each Nd bridges three (Mo(8)O(27))(6-) units. Both new dysprosium octamolybdates adopt noncentrosymmetric polar structures in space group P2(1) and are second harmonic generation (SHG) active.

  13. Microstructure and thermal properties of dysprosium and thulium co-doped barium titanate ceramics for high performance multilayer ceramic capacitors

    Energy Technology Data Exchange (ETDEWEB)

    Kim, Jinseong; Kim, Dowan; Noh, Taimin [School of Materials Science and Engineering, Pusan National University, Busan 609-735 (Korea, Republic of); Ahn, Byungmin [Department of Chemical Engineering and Materials Science, University of Southern California, Los Angeles, CA 90089-0241 (United States); Lee, Heesoo, E-mail: heesoo@pusan.ac.kr [School of Materials Science and Engineering, Pusan National University, Busan 609-735 (Korea, Republic of)

    2011-09-15

    Highlights: > Dy/Tm co-doping method in BaTiO{sub 3} was suggested to improve electrical properties and temperature stability simultaneously. > We examined these properties in terms of microstructural analysis and substitution rate. > Increase of Dy{sub 2}O{sub 3} addition enhanced dielectric constant. > Increase of Tm{sub 2}O{sub 3} addition enhanced temperature stability. > Improved electrical properties and temperature stability through Dy/Tm co-doping were deduced from formation of electrons and core-shell structure. - Abstract: The co-doping characteristics on microstructure and thermal properties of barium titanate (BaTiO{sub 3}) were investigated to elucidate formation of core-shell structure by dysprosium (Dy) and thulium (Tm) addition in the BaTiO{sub 3}-Dy{sub 2}O{sub 3}-Tm{sub 2}O{sub 3} system. The dielectrics co-doped with 0.7 mol% Dy{sub 2}O{sub 3} and 0.3 mol% Tm{sub 2}O{sub 3} had the dielectric constant up to 2200 as a function of temperature, which was 30% higher than that of specimen containing only Tm{sub 2}O{sub 3} at the room temperature. It could be explained by the fact that the increase of Dy{sub 2}O{sub 3} addition contributed to the improvement of dielectric constant. On the other hand, the rapid diffusion rate of Dy{sup 3+} ions in BaTiO{sub 3} showed an adverse effect on temperature stability caused by destruction of core-shell. As the compensation for shell expansion in BaTiO{sub 3}, the reinforcement of the core-shell structure through the addition of Tm{sub 2}O{sub 3} was confirmed by TEM-EDS analysis and attributed the temperature coefficient of capacitance (TCC) in a reliability condition (-55 deg. C to 125 deg. C, {Delta}C = {+-}15% or less). The enhanced electrical properties and temperature stability could be deduced from the generation of electrons and the formation core-shell structure in co-doped BaTiO{sub 3} system respectively.

  14. 25 CFR 171.305 - Will BIA provide leaching service to me?

    Science.gov (United States)

    2010-04-01

    ... 25 Indians 1 2010-04-01 2010-04-01 false Will BIA provide leaching service to me? 171.305 Section... OPERATION AND MAINTENANCE Water Use § 171.305 Will BIA provide leaching service to me? (a) We may provide you leaching service if: (1) You submit a written plan that documents how soil salinity limits your...

  15. 40 CFR 171.5 - Standards for certification of private applicators.

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 23 2010-07-01 2010-07-01 false Standards for certification of private applicators. 171.5 Section 171.5 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED... practical knowledge of the pest problems and pest control practices associated with his agricultural...

  16. 48 CFR 3009.171-3 - Determination of eligibility for award of FPS guard service contracts.

    Science.gov (United States)

    2010-10-01

    ... eligibility for award of FPS guard service contracts. 3009.171-3 Section 3009.171-3 Federal Acquisition... eligibility for award of FPS guard service contracts. (a) Contracting officers shall make a determination of eligibility for award of FPS guard service contracts upon identification of the apparent successful offeror as...

  17. 21 CFR 14.171 - Utilization of an advisory committee on the initiative of FDA.

    Science.gov (United States)

    2010-04-01

    ... 21 Food and Drugs 1 2010-04-01 2010-04-01 false Utilization of an advisory committee on the initiative of FDA. 14.171 Section 14.171 Food and Drugs FOOD AND DRUG ADMINISTRATION, DEPARTMENT OF HEALTH... technical advisory committee for human prescription drugs. The Commissioner's determinations on the agenda...

  18. Single-molecule magnet behavior in an octanuclear dysprosium(iii) aggregate inherited from helical triangular Dy3 SMM-building blocks.

    Science.gov (United States)

    Zhang, Li; Zhang, Peng; Zhao, Lang; Wu, Jianfeng; Guo, Mei; Tang, Jinkui

    2016-06-28

    An unprecedented octanuclear dysprosium(iii) cluster with the formula [Dy8L6(μ3-OH)4(μ2-CH3O)2(CH3OH)6(H2O)2]·6H2O·10CH3OH·2CH3CN () based on a nonlinearly tritopic aroylhydrazone ligand H3L has been isolated, realizing the successful linking of pairwise interesting triangular Dy3 SMMs. It is noteworthy that two enantiomers (Λ and Δ configurations) individually behaving as a coordination-induced chirality presented in the Dy3 helicate are connected in the meso Dy8 cluster. Remarkably, alternating-current magnetic susceptibility measurements revealed that the Dy8 cluster shows typical SMM behavior inherited from its Dy3 helical precursor. It is one of the rare polynuclear Lnn SMMs (n > 7) under zero dc field.

  19. Study for the determination of samarium, europium,terbium, dysprosium and yttrium in gadolinium oxide matrix by means of atomic absorption spectrophotometry using a graphite furnace

    International Nuclear Information System (INIS)

    Caires, A.C.F.

    1985-01-01

    A study for determination of samarium, europium, terbium, dysprosium and yttrium in a gadolinium oxide matrix by atomic absorption spectrophotometry using a graphite furnace is presented. The best charrring and atomization conditions were estabilished for each element, the most convenient ressonance lines being selected as well. The study was carried out for the mentioned lanthanides both when pure and when in binary mixtures with gadolinium, besides those where all for them were together with gadolinium. The determination limits for pure lanthanides were found to be between 1.3 and 9.6 ng assuming a 20% relative standard deviation as acceptable. The detection limits were in the range 0.51 and 7.5 ng, assuming as positive any answer higher than twofold the standard deviation. (author) [pt

  20. Synthesis and X-ray diffraction studies of dysprosium-calcium ferrites Dy1-xCaxFeO3-y (0≤x≤2/3)

    International Nuclear Information System (INIS)

    Li, J.; Song, D.; Su, Z.; Wang, T.M.

    1997-01-01

    Samples of dysprosium-calcium ferrites Dy 1-x Ca x FeO 3-y with x ranging from 0 to 2/3 were novelly prepared in air by solid state reaction and characterized by X-ray powder diffraction. These samples are single-phased orthorhombic perovskite-type compounds belonging to the space group D 2h 16 -Pbnm. The lattice constants of the Dy 1-x Ca x FeO 3-y samples have been refined by Cohen's least-squares method. The initial substitution of Ca for Dy leads to a decrease of the lattice constants. Further substitution of Ca for Dy has hardly any influence on the lattice dimensions. (orig.)

  1. Influence of intramolecular f-f interactions on nuclear spin driven quantum tunneling of magnetizations in quadruple-decker phthalocyanine complexes containing two terbium or dysprosium magnetic centers.

    Science.gov (United States)

    Fukuda, Takamitsu; Matsumura, Kazuya; Ishikawa, Naoto

    2013-10-10

    Nuclear spin driven quantum tunneling of magnetization (QTM) phenomena, which arise from admixture of more than two orthogonal electronic spin wave functions through the couplings with those of the nuclear spins, are one of the important magnetic relaxation processes in lanthanide single molecule magnets (SMMs) in the low temperature range. Although recent experimental studies have indicated that the presence of the intramolecular f-f interactions affects their magnetic relaxation processes, little attention has been given to their mechanisms and, to the best of our knowledge, no rational theoretical models have been proposed for the interpretations of how the nuclear spin driven QTMs are influenced by the f-f interactions. Since quadruple-decker phthalocyanine complexes with two terbium or dysprosium ions as the magnetic centers show moderate f-f interactions, these are appropriate to investigate the influence of the f-f interactions on the dynamic magnetic relaxation processes. In the present paper, a theoretical model including ligand field (LF) potentials, hyperfine, nuclear quadrupole, magnetic dipolar, and the Zeeman interactions has been constructed to understand the roles of the nuclear spins for the QTM processes, and the resultant Zeeman plots are obtained. The ac susceptibility measurements of the magnetically diluted quadruple-decker monoterbium and diterbium phthalocyanine complexes, [Tb-Y] and [Tb-Tb], have indicated that the presence of the f-f interactions suppresses the QTMs in the absence of the external magnetic field (H(dc)) being consistent with previous reports. On the contrary, the faster magnetic relaxation processes are observed for [Tb-Tb] than [Tb-Y] at H(dc) = 1000 Oe, clearly demonstrating that the QTMs are rather enhanced in the presence of the external magnetic field. Based on the calculated Zeeman diagrams, these observations can be attributed to the enhanced nuclear spin driven QTMs for [Tb-Tb]. At the H(dc) higher than 2000 Oe, the

  2. Dual-mode T_1 and T_2 magnetic resonance imaging contrast agent based on ultrasmall mixed gadolinium-dysprosium oxide nanoparticles: synthesis, characterization, and in vivo application

    International Nuclear Information System (INIS)

    Tegafaw, Tirusew; Xu, Wenlong; Ahmad, Md Wasi; Lee, Gang Ho; Baeck, Jong Su; Chang, Yongmin; Bae, Ji Eun; Chae, Kwon Seok; Kim, Tae Jeong

    2015-01-01

    A new type of dual-mode T_1 and T_2 magnetic resonance imaging (MRI) contrast agent based on mixed lanthanide oxide nanoparticles was synthesized. Gd"3"+ ("8S_7_/_2) plays an important role in T_1 MRI contrast agents because of its large electron spin magnetic moment resulting from its seven unpaired 4f-electrons, and Dy"3"+ ("6H_1_5_/_2) has the potential to be used in T_2 MRI contrast agents because of its very large total electron magnetic moment: among lanthanide oxide nanoparticles, Dy_2O_3 nanoparticles have the largest magnetic moments at room temperature. Using these properties of Gd"3"+ and Dy"3"+ and their oxide nanoparticles, ultrasmall mixed gadolinium-dysprosium oxide (GDO) nanoparticles were synthesized and their potential to act as a dual-mode T_1 and T_2 MRI contrast agent was investigated in vitro and in vivo. The D-glucuronic acid coated GDO nanoparticles (d_a_v_g = 1.0 nm) showed large r_1 and r_2 values (r_2/r_1 ≈ 6.6) and as a result clear dose-dependent contrast enhancements in R_1 and R_2 map images. Finally, the dual-mode imaging capability of the nanoparticles was confirmed by obtaining in vivo T_1 and T_2 MR images. (paper)

  3. Extraction of Dysprosium Ions with DTPA Functionalized Superparamagnetic Nanoparticles Probed by Energy Dispersive X-ray Fluorescence and TEM/High-Angle Annular Dark Field Imaging.

    Science.gov (United States)

    Melo, Fernando Menegatti de; Almeida, Sabrina da Nobrega; Uezu, Noemi Saori; Ramirez, Carlos Alberto Ospina; Santos, Antonio Domingues Dos; Toma, Henrique Eisi

    2018-06-01

    The extraction of dysprosium (Dy3+) ions from aqueous solution was carried out successfully, using magnetite (Fe3O4) nanoparticles functionalized with diethylenetriaminepentaacetic acid (MagNP@DTPA). The process was monitored by energy dispersive X-ray fluorescence spectroscopy, as a function of concentration, proceeding according to a Langmuir isotherm with an equilibrium constant of 2.57 × 10-3 g(MagNP) L-1 and a saturation limit of 63.2 mgDy/gMagNP. The presence of paramagnetic Dy3+ ions attached to the superparamagnetic nanoparticles led to an overall decrease of magnetization. By imaging the nanoparticles surface using scanning transmission electron microscopy equipped with high resolution elemental analysis, it was possible to probe the binding of the Dy3+ ions to DTPA, and to show their distribution in a region of negative magnetic field gradients. This finding is coherent with the observed decrease of magnetization, associated with the antiferromagnetic coupling between the lanthanide ions and the Fe3O4 core.

  4. Ovine progressive pneumonia provirus levels are unaffected by the prion 171R allele in an Idaho sheep flock.

    Science.gov (United States)

    Harrington, Robert D; Herrmann-Hoesing, Lynn M; White, Stephen N; O'Rourke, Katherine I; Knowles, Donald P

    2009-01-22

    Selective breeding of sheep for arginine (R) at prion gene (PRNP) codon 171 confers resistance to classical scrapie. However, other effects of 171R selection are uncertain. Ovine progressive pneumonia/Maedi-Visna virus (OPPV) may infect up to 66% of a flock thus any affect of 171R selection on OPPV susceptibility or disease progression could have major impact on the sheep industry. Hypotheses that the PRNP 171R allele is 1) associated with the presence of OPPV provirus and 2) associated with higher provirus levels were tested in an Idaho ewe flock. OPPV provirus was found in 226 of 358 ewes by quantitative PCR. The frequency of ewes with detectable provirus did not differ significantly among the 171QQ, 171QR, and 171RR genotypes (p > 0.05). Also, OPPV provirus levels in infected ewes were not significantly different among codon 171 genotypes (p > 0.05). These results show that, in the flock examined, the presence of OPPV provirus and provirus levels are not related to the PRNP 171R allele. Therefore, a genetic approach to scrapie control is not expected to increase or decrease the number of OPPV infected sheep or the progression of disease. This study provides further support to the adoption of PRNP 171R selection as a scrapie control measure.

  5. Ovine progressive pneumonia provirus levels are unaffected by the prion 171R allele in an Idaho sheep flock

    Directory of Open Access Journals (Sweden)

    Herrmann-Hoesing Lynn M

    2009-01-01

    Full Text Available Abstract Selective breeding of sheep for arginine (R at prion gene (PRNP codon 171 confers resistance to classical scrapie. However, other effects of 171R selection are uncertain. Ovine progressive pneumonia/Maedi-Visna virus (OPPV may infect up to 66% of a flock thus any affect of 171R selection on OPPV susceptibility or disease progression could have major impact on the sheep industry. Hypotheses that the PRNP 171R allele is 1 associated with the presence of OPPV provirus and 2 associated with higher provirus levels were tested in an Idaho ewe flock. OPPV provirus was found in 226 of 358 ewes by quantitative PCR. The frequency of ewes with detectable provirus did not differ significantly among the 171QQ, 171QR, and 171RR genotypes (p > 0.05. Also, OPPV provirus levels in infected ewes were not significantly different among codon 171 genotypes (p > 0.05. These results show that, in the flock examined, the presence of OPPV provirus and provirus levels are not related to the PRNP 171R allele. Therefore, a genetic approach to scrapie control is not expected to increase or decrease the number of OPPV infected sheep or the progression of disease. This study provides further support to the adoption of PRNP 171R selection as a scrapie control measure.

  6. Global use structures of the magnetic materials neodymium and dysprosium. A scenario-based analysis of the effect of the diffusion of electromobility on the demand for rare earths; Globale Verwendungsstrukturen der Magnetwerkstoffe Neodym und Dysprosium. Eine szenariobasierte Analyse der Auswirkung der Diffusion der Elektromobilitaet auf den Bedarf an Seltenen Erden

    Energy Technology Data Exchange (ETDEWEB)

    Gloeser-Chahoud, Simon; Kuehn, Andre; Tercero Espinoza, Luis

    2016-06-15

    Neodymium-iron-boron magnets (NdFeB) have experienced a significant demand as the most powerful permanent magnet in recent years, especially for the manufacture of compact electric servomotors with high efficiency and high power density, especially for mobile applications in hybrid traction motors and electric vehicles or for electric bikes. However, NdFeB magnets are also increasingly being used in general mechanical engineering (conveying and pumping systems, tools, air conditioning systems, lift motors, etc.), in the small electric motors of conventional passenger cars or in the generators of large wind power plants with permanent magnetic direct drive. Nevertheless, there is still high uncertainty in the use structures of NdFeB magnets and the contained rare earth elements neodymium and dysprosium. An effective instrument for increasing the market transparency and the understanding of complex anthropogenic material cycles is the dynamic material flow modeling. In the present work paper, this instrument is used for an in-depth analysis of the use structures of NdFeB magnets and the contained rare earths on a global scale. The dynamic modeling of product usage cycles reveals today's usage structures and quantifies future magnetic quantities in obsolete product flows. It could be shown that the magnets in today's scrap volume are mainly contained in obsolete electronics applications such as hard disks (HDD), CD and DVD drives, which makes the recycling hardly seem to be economical due to the small magnets and the high material spread, but in the foreseeable future with larger magnetic quantities from synchronous servomotors and generators can be expected, which significantly increases the recycling potential. In a further step, the effect of the diffusion of alternative drives in the automotive market on the dysprosium requirement is analyzed using a system dynamics model and possible adaptation mechanisms in the form of different substitution effects in

  7. 14 CFR 171.321 - DME and marker beacon performance requirements.

    Science.gov (United States)

    2010-01-01

    ... 14 Aeronautics and Space 3 2010-01-01 2010-01-01 false DME and marker beacon performance... (MLS) § 171.321 DME and marker beacon performance requirements. (a) The DME equipment must meet the..._regulations/ibr_locations.html. (b) MLS marker beacon equipment must meet the performance requirements...

  8. 19 CFR 171.24 - Remission of forfeitures and payment of fees, costs or interest.

    Science.gov (United States)

    2010-04-01

    ... Disposition of Petitions § 171.24 Remission of forfeitures and payment of fees, costs or interest. Any seizure... fees, costs or interest from the Government. [T.D. 00-88, 65 FR 78093, Dec. 14, 2000] ... 19 Customs Duties 2 2010-04-01 2010-04-01 false Remission of forfeitures and payment of fees...

  9. 46 CFR 171.017 - One and two compartment standards of flooding.

    Science.gov (United States)

    2010-10-01

    ... 46 Shipping 7 2010-10-01 2010-10-01 false One and two compartment standards of flooding. 171.017... standards of flooding. (a) One compartment standard of flooding. A vessel is designed to a one compartment standard of flooding if the margin line is not submerged when the total buoyancy between each set of two...

  10. 40 CFR 267.171 - What standards apply to the containers?

    Science.gov (United States)

    2010-07-01

    ... STANDARDIZED PERMIT Use and Management of Containers § 267.171 What standards apply to the containers... to the management of the containers. (a) Condition of containers. If a container holding hazardous... that are compatible and will not react with the hazardous waste to be stored. (c) Management of...

  11. 46 CFR 160.171-17 - Approval testing for adult size immersion suit.

    Science.gov (United States)

    2010-10-01

    ... test described in § 160.171-17(d). (c) Mobility and flotation tests. The mobility and flotation... suit at the beginning of the period of flotation by more than 200 grams. (11) Impact. While wearing a... is required for this test: (i) A sealed copper or aluminum can that has at least two parallel flat...

  12. 42 CFR 137.171 - Where do Self-Governance Tribes send their audit reports?

    Science.gov (United States)

    2010-10-01

    ... Provisions Audits and Cost Principles § 137.171 Where do Self-Governance Tribes send their audit reports? (a) For fiscal years ending on or before June 30, 1996, the audit report must be sent to: National... years, beginning after June 30, 1996, the audit report must be sent to: Single Audit Clearinghouse, 1201...

  13. Gene expression profiling in colon of mice exposed to food additive titanium dioxide (E171).

    Science.gov (United States)

    Proquin, Héloïse; Jetten, Marlon J; Jonkhout, Marloes C M; Garduño-Balderas, Luis G; Briedé, Jacob J; de Kok, Theo M; Chirino, Yolanda I; van Loveren, Henk

    2018-01-01

    Dietary factors that may influence the risks of colorectal cancer, including specific supplements, are under investigation. Previous studies showed the capacity of food additive titanium dioxide (E171) to induce DNA damage in vitro and facilitate growth of colorectal tumours in vivo. This study aimed to investigate the molecular mechanisms behind these effects after E171 exposure. BALB/c mice were exposed by gavage to 5 mg/kg bw /day of E171 for 2, 7, 14, and 21 days. Transcriptome changes were studied by whole genome mRNA microarray analysis on the mice's distal colons. In addition, histopathological changes as well as a proliferation marker were analysed. The results showed significant gene expression changes in the olfactory/GPCR receptor family, oxidative stress, the immune system and of cancer related genes. Transcriptome analysis also identified genes that thus far have not been included in known biological pathways and can induce functional changes by interacting with other genes involved in different biological pathways. Histopathological analysis showed alteration and disruption in the normal structure of crypts inducing a hyperplastic epithelium. At cell proliferation level, no consistent increase over time was observed. These results may offer a mechanistic framework for the enhanced tumour growth after ingestion of E171 in BALB/c mice. Copyright © 2017 Elsevier Ltd. All rights reserved.

  14. 7 CFR 400.171 - Qualifying when a state does not require that an Annual Statutory Financial Statement be filed.

    Science.gov (United States)

    2010-01-01

    ... Annual Statutory Financial Statement be filed. 400.171 Section 400.171 Agriculture Regulations of the... filing an Annual Statutory Financial Statement must, in addition to the requirements of § 400.170 (a), (b), (c) and (d), submit an Annual Statutory Financial Statement audited by a Certified Public Accountant...

  15. 47 CFR 36.171 - Property held for future telecommunications use-Account 2002; Telecommunications plant under...

    Science.gov (United States)

    2010-10-01

    ... 47 Telecommunication 2 2010-10-01 2010-10-01 false Property held for future telecommunications use-Account 2002; Telecommunications plant under construction-Account 2003; and Telecommunications plant adjustment-Account 2005. 36.171 Section 36.171 Telecommunication FEDERAL COMMUNICATIONS COMMISSION (CONTINUED...

  16. Discovery of Conservation and Diversification of miR171 Genes by Phylogenetic Analysis based on Global Genomes

    Directory of Open Access Journals (Sweden)

    Xudong Zhu

    2015-07-01

    Full Text Available The microRNA171 (miR171 family is widely distributed and highly conserved in a range of species and plays critical roles in regulating plant growth and development through repressing expression of ( transcription factors. However, information on the evolutionary conservation and functional diversification of the miRNA171 family members remains scanty. We reconstructed the phylogenetic relationships among miR171 precursor and mature sequences so as to investigate the extent and degree of evolutionary conservation of miR171 in (L. Heynh. (ath, grape ( L. (vvi, poplar ( Torr. & A.Gray ex Hook. (ptc, and rice ( L. (osa. Despite strong conservation of over 80%, some mature miR171 sequences, such as , and and , -, and -, have undergone critical sequence variation, leading to functional diversification, since they target non gene transcript(s. Phylogenetic analyses revealed a combination of old ancestral relationships and recent lineage-specific diversification in the miR171 family within the four model plants. The -regulatory motifs on the upstream promoter sequences of genes were highly divergent and shared some similar elements, indicating their possible contribution to the functional variation observed within the miR171 family. This study will buttress our understanding of the functional differentiation of miRNAs and the relationships of miRNA–target pairs based on the evolutionary history of genes.

  17. Synthesis and characterization of a family of structurally characterized dysprosium alkoxides for improved fatigue-resistance characteristics of PDyZT thin films.

    Science.gov (United States)

    Boyle, Timothy J; Bunge, Scott D; Clem, Paul G; Richardson, Jacob; Dawley, Jeffrey T; Ottley, Leigh Anna M; Rodriguez, Mark A; Tuttle, Bruce A; Avilucea, Gabriel R; Tissot, Ralph G

    2005-03-07

    Using either an ammoniacal route, the reaction between DyCl3, Na0, and HOR in liquid ammonia, or preferentially reacting Dy(N(SiMe3)2)3 with HOR in a solvent, we isolated a family of dysprosium alkoxides as [Dy(mu-ONep)2(ONep)]4 (1), (ONep)2Dy[(mu3-ONep)(mu-ONep)Dy(ONep)(THF)]2(mu-ONep) (2), (ONep)2Dy[(mu3-ONep)(mu-ONep)Dy(ONep)(py)]2(mu-ONep) (3), [Dy3(mu3-OBut)2(mu-OBut3(OBut)4(HOBut)2] (4), [Dy3(mu3-OBut)2(mu-OBut)3(OBut)4(THF)2] (5), [Dy3(mu3-OBut)2(mu-OBut)3(OBut)4(py)2] (6), (DMP)Dy(mu-DMP)4[Dy(DMP)2(NH3)]2 (7), [Dy(eta6-DMP)(DMP)2]2 (8), Dy(DMP)3(THF)3 (9), Dy(DMP)3(py)3 (10), Dy(DIP)3(NH3)2 (11), [Dy(eta6-DIP)(DIP)2]2 (12), Dy(DIP)3(THF)2 (13), Dy(DIP)3(py)3 (14), Dy(DBP)3(NH3) (15), Dy(DBP)3 (16), Dy(DBP)3(THF) (17), Dy(DBP)3(py)2 (18), [Dy(mu-TPS)(TPS2]2 (19), Dy(TPS)3(THF)3 (20), and Dy(TPS)3(py)3 (21), where ONep = OCH2CMe3, OBut) = OCMe3, DMP = OC6H3(Me)(2)-2,6, DIP = OC6H3(CHMe2)(2)-2,6, DBP = OC6H3(CMe3)(2)-2,6, TPS = OSi(C6H5)3, tol = toluene, THF = tetrahydrofuran, and py = pyridine. We were not able to obtain X-ray quality crystals of compounds 2, 8, and 9. The structures observed and data collected for the Dy compounds are consistent with those reported for its other congeners. A number of these precursors were used as Dy dopants in Pb(Zr0.3Ti0.7)O3 (PZT 30/70) thin films, with compound 12 yielding the highest-quality films. The resulting Pb0.94Dy0.04(Zr0.3Ti0.7)O3 [PDyZT (4/30/70)] had similar properties to PZT (30/70), but showed substantial resistance to polarization reversal fatigue.

  18. The role of dysprosium on the structural and magnetic properties of (Nd_1_−_xDy_x)_2Fe_1_4B nanoparticles

    International Nuclear Information System (INIS)

    Rahimi, Hamed; Ghasemi, Ali; Mozaffarinia, Reza; Tavoosi, Majid

    2017-01-01

    In current work, Nd2Fe14B nanoparticles was synthesized by sol-gel method. Dysprosium powders were added into Nd2Fe14B nanoparticles by mechanical alloying process in order to enhancement of coercivity. The phase analysis, structure, and magnetic properties of annealed (Nd_1_−_xDy_x)_2Fe_1_4B nanoparticles with different Dy-content (x=0.1, 0.2, 0.3, 0.4, 0.5, 0.6) were investigated by employing X-ray diffraction, X-ray photoelectron spectroscopy, energy dispersive spectroscopy, field emission scanning electron microscope, transmission electron microscope and vibrating sample magnetometer techniques. The results showed that with an increase in Dy amounts, the coercivity of particles increased from 2.9 kOe to 13.4 kOe and then decreased to 5.6 kOe. By adding an optimum amount of Dy (x=0.4), the coercivity was significantly increased from 2.9 kOe to 13.4 kOe. The average particle size of annealed (Nd_1_−_xDy_x)_2Fe_1_4B nanoparticles was below 10 nm. Magnetization reversal studies indicate that the coercivity of milled and annealed (Nd_1_−_xDy_x)_2Fe_1_4B nanoparticles is controlled by the nucleation of reversed magnetic domains. The experimental results in the angular dependence of coercivity for (Nd_1_−_xDy_x)_2Fe_1_4B permanent magnets showed that the normalized coercivity of the permanent magnets H_c(θ)/H_c(0) increases from 1 to about 1.2–1.5 with increasing θ from 0 to about π/3, for x=0.4–0.6. - Highlights: • Dy was added to Nd_2Fe_1_4B nanoparticles to improve the coercivity. • A maximum squareness ratio of 0.99 was obtained. • The average particle size decreased with an increase in Dy-content.

  19. Systematic evaluation of a 171Yb optical clock by synchronous comparison between two lattice systems.

    Science.gov (United States)

    Gao, Qi; Zhou, Min; Han, Chengyin; Li, Shangyan; Zhang, Shuang; Yao, Yuan; Li, Bo; Qiao, Hao; Ai, Di; Lou, Ge; Zhang, Mengya; Jiang, Yanyi; Bi, Zhiyi; Ma, Longsheng; Xu, Xinye

    2018-05-22

    Optical clocks are the most precise measurement devices. Here we experimentally characterize one such clock based on the 1 S 0 - 3 P 0 transition of neutral 171 Yb atoms confined in an optical lattice. Given that the systematic evaluation using an interleaved stabilization scheme is unable to avoid noise from the clock laser, synchronous comparisons against a second 171 Yb lattice system were implemented to accelerate the evaluation. The fractional instability of one clock falls below 4 × 10 -17 after an averaging over a time of 5,000 seconds. The systematic frequency shifts were corrected with a total uncertainty of 1.7 × 10 -16 . The lattice polarizability shift currently contributes the largest source. This work paves the way to measuring the absolute clock transition frequency relative to the primary Cs standard or against the International System of Units (SI) second.

  20. Purification and partial characterization of bacteriocin produced by Lactococcus lactis ssp. lactis LL171.

    Science.gov (United States)

    Kumari, Archana; Akkoç, Nefise; Akçelik, Mustafa

    2012-04-01

    Lactic acid bacteria (LAB) are possessing ability to synthesize antimicrobial compounds (like bacteriocin) during their growth. In this regard, novel bacteriocin compound secreting capability of LAB isolated from Tulum Cheese in Turkey was demonstrated. The synthesized bacteriocin was purified by ammonium sulphate precipitation, dialysis and gel filtration. The molecular weight (≈3.4 kDa) of obtained bacteriocin was confirmed by SDS-PAGE, which revealed single peptide band. Molecular identification of LAB strain isolated from Tulum Cheese was conducted using 16S rDNA gene sequencing as Lactococcus lactis ssp. lactis LL171. The amino acid sequences (KKIDTRTGKTMEKTEKKIELSLKNMKTAT) of the bacteriocin from Lactococcus lactis ssp. lactis LL171 was found unique and novel than reported bacteriocins. Further, the bacteriocin was possessed the thermostable property and active at wide range of pH values from 1 to 11. Thus, bacteriocin reported in this study has the potential applications property as food preservative agent.

  1. 12 CFR 225.171 - What are the limitations on managing or operating a portfolio company held as a merchant banking...

    Science.gov (United States)

    2010-01-01

    ... of the portfolio company. Examples of the types of actions that may be subject to these types of... operating a portfolio company held as a merchant banking investment? 225.171 Section 225.171 Banks and... COMPANIES AND CHANGE IN BANK CONTROL (REGULATION Y) Regulations Merchant Banking Investments § 225.171 What...

  2. Global use structures of the magnetic materials neodymium and dysprosium. A scenario-based analysis of the effect of the diffusion of electromobility on the demand for rare earths

    International Nuclear Information System (INIS)

    Gloeser-Chahoud, Simon; Kuehn, Andre; Tercero Espinoza, Luis

    2016-01-01

    Neodymium-iron-boron magnets (NdFeB) have experienced a significant demand as the most powerful permanent magnet in recent years, especially for the manufacture of compact electric servomotors with high efficiency and high power density, especially for mobile applications in hybrid traction motors and electric vehicles or for electric bikes. However, NdFeB magnets are also increasingly being used in general mechanical engineering (conveying and pumping systems, tools, air conditioning systems, lift motors, etc.), in the small electric motors of conventional passenger cars or in the generators of large wind power plants with permanent magnetic direct drive. Nevertheless, there is still high uncertainty in the use structures of NdFeB magnets and the contained rare earth elements neodymium and dysprosium. An effective instrument for increasing the market transparency and the understanding of complex anthropogenic material cycles is the dynamic material flow modeling. In the present work paper, this instrument is used for an in-depth analysis of the use structures of NdFeB magnets and the contained rare earths on a global scale. The dynamic modeling of product usage cycles reveals today's usage structures and quantifies future magnetic quantities in obsolete product flows. It could be shown that the magnets in today's scrap volume are mainly contained in obsolete electronics applications such as hard disks (HDD), CD and DVD drives, which makes the recycling hardly seem to be economical due to the small magnets and the high material spread, but in the foreseeable future with larger magnetic quantities from synchronous servomotors and generators can be expected, which significantly increases the recycling potential. In a further step, the effect of the diffusion of alternative drives in the automotive market on the dysprosium requirement is analyzed using a system dynamics model and possible adaptation mechanisms in the form of different substitution effects in the

  3. PA171 Containers on a Wood Pallet with Metal Top Adapter, Air Pressure Tests During MIL-STD-1660 Tests

    National Research Council Canada - National Science Library

    2004-01-01

    ... (PM-MAS) to conduct Air Pressure Tests during MIL-STD-1660, "Design Criteria for Ammunition Unit Loads" testing on the PA171 containers on a wood pallet with metal top adapter as manufactured by Alliant Tech...

  4. Extension of the energy range of the experimental activation cross-sections data of longer-lived products of proton induced nuclear reactions on dysprosium up to 65MeV.

    Science.gov (United States)

    Tárkányi, F; Ditrói, F; Takács, S; Hermanne, A; Ignatyuk, A V

    2015-04-01

    Activation cross-sections data of longer-lived products of proton induced nuclear reactions on dysprosium were extended up to 65MeV by using stacked foil irradiation and gamma spectrometry experimental methods. Experimental cross-sections data for the formation of the radionuclides (159)Dy, (157)Dy, (155)Dy, (161)Tb, (160)Tb, (156)Tb, (155)Tb, (154m2)Tb, (154m1)Tb, (154g)Tb, (153)Tb, (152)Tb and (151)Tb are reported in the 36-65MeV energy range, and compared with an old dataset from 1964. The experimental data were also compared with the results of cross section calculations of the ALICE and EMPIRE nuclear model codes and of the TALYS nuclear reaction model code as listed in the latest on-line libraries TENDL 2013. Copyright © 2015. Published by Elsevier Ltd.

  5. Dysprosium doping induced shape and magnetic anisotropy of Fe{sub 3−x}Dy{sub x}O{sub 4} (x=0.01–0.1) nanoparticles

    Energy Technology Data Exchange (ETDEWEB)

    Jain, Richa [School of Sciences, Indira Gandhi National Open University, Maidan Garhi, New Delhi 110068 (India); Department of Physics, ARSD college, University of Delhi, New Delhi 110021 (India); Luthra, Vandna [Department of Physics, Gargi College, Siri Fort Road, New Delhi 110049 (India); Gokhale, Shubha, E-mail: sgokhale@ignou.ac.in [School of Sciences, Indira Gandhi National Open University, Maidan Garhi, New Delhi 110068 (India)

    2016-09-15

    The effect of dysprosium doping on evolution of structural and magnetic properties of magnetite (Fe{sub 3}O{sub 4}) nanoparticles is reported. A standard route of co-precipitation was used for the synthesis of undoped and doped magnetite nanoparticles Fe{sub 3−x}Dy{sub x}O{sub 4} (x=0.0–0.1). Transmission electron microscopy (TEM) shows formation of round shaped particles with diameter in the range of 8–14 nm for undoped sample. On doping beyond x=0.01, the formation of rod like structures is initiated along with the round shaped particles. The number of rods is found to increase with increasing doping concentration. Magnetic characterization using Vibrating Sample Magnetometer (VSM) revealed doping dependent magnetic properties which can be correlated with the crystallite size as determined from X-ray diffraction (XRD). Enhancement in the saturation magnetization in the initial stages of doping can be explained on the basis of incorporation of Dy{sup 3+} ions in the inverse spinel structure at the octahedral site in place of Fe{sup 3+} ions. Subsequent decrease in saturation magnetization observed beyond x=0.03 could be attributed to precipitation of excess Dy in form of dysprosium ferrite phase. - Highlights: • Report on formation of nanorods in magnetite prompted by Dy doping. • Observation of anisotropic magnetic behaviour emanating from the shape anisotropy. • Evidence of Dy{sup 3+} ions occupying octahedral site in place of Fe{sup 3+} ions. • Nanorods envisaged to be useful as catalysts and in biomedical applications.

  6. Time-of-flight and activation experiments on 147Pm and 171Tm for astrophysics

    Science.gov (United States)

    Guerrero, C.; Lerendegui-Marco, J.; Domingo-Pardo, C.; Casanovas, A.; Dressler, R.; Halfon, S.; Heinitz, S.; Kivel, N.; Köster, U.; Paul, M.; Quesada-Molina, J. M.; Schumann, D.; Tarifeño-Saldivia, A.; Tessler, M.; Weissman, L.; Aberle, O.; Andrzejewski, J.; Audouin, L.; Bacak, M.; Balibrea, J.; Barbagallo, M.; Becvar, F.; Berthoumieux, E.; Billowes, J.; Bosnar, D.; Brown, A.; Caamaño, M.; Calviño, F.; Calviani, M.; Cano-Ott, D.; Cardella, R.; Cerutti, F.; Chen, Y. H.; Chiaveri, E.; Colonna, N.; Cortés, G.; Cortés-Giraldo, M. A.; Cosentino, L.; Damone, L. A.; Diakaki, M.; Dupont, E.; Durán, I.; Fernández-Domínguez, B.; Ferrari, A.; Ferreira, P.; Finocchiaro, P.; Göbel, K.; García, A. R.; Gawlik, A.; Gilardoni, S.; Glodariu, T.; Gonçalves, I. F.; González, E.; Griesmayer, E.; Gunsing, F.; Harada, H.; Heyse, J.; Jenkins, D. G.; Jericha, E.; Käppeler, F.; Kadi, Y.; Kalamara, A.; Kavrigin, P.; Kimura, A.; Kivel, N.; Kokkoris, M.; Krticka, M.; Kurtulgil, D.; Leal-Cidoncha, E.; Lederer, C.; Leeb, H.; Meo, S. Lo; Lonsdale, S. J.; Macina, D.; Marganiec, J.; Martínez, T.; Masi, A.; Massimi, C.; Mastinu, P.; Mastromarco, M.; Maugeri, E. A.; Mazzone, A.; Mendoza, E.; Mengoni, A.; Milazzo, P. M.; Mingrone, F.; Musumarra, A.; Negret, A.; Nolte, R.; Oprea, A.; Patronis, N.; Pavlik, A.; Perkowski, J.; Porras, I.; Praena, J.; Radeck, D.; Rauscher, T.; Reifarth, R.; Rout, P. C.; Rubbia, C.; Ryan, J. A.; Sabaté-Gilarte, M.; Saxena, A.; Schillebeeckx, P.; Smith, A. G.; Sosnin, N. V.; Stamatopoulos, A.; Tagliente, G.; Tain, J. L.; Tassan-Got, L.; Tsinganis, A.; Valenta, S.; Vannini, G.; Variale, V.; Vaz, P.; Ventura, A.; Vlachoudis, V.; Vlastou, R.; Wallner, A.; Warren, S.; Weiss, C.; Woods, P. J.; Wright, T.; Žugec, P.

    2017-09-01

    The neutron capture cross section of several key unstable isotopes acting as branching points in the s-process are crucial for stellar nucleosynthesis studies, but they are very challenging to measure due to the difficult production of sufficient sample material, the high activity of the resulting samples, and the actual (n,γ) measurement, for which high neutron fluxes and effective background rejection capabilities are required. As part of a new program to measure some of these important branching points, radioactive targets of 147Pm and 171Tm have been produced by irradiation of stable isotopes at the ILL high flux reactor. Neutron capture on 146Nd and 170Er at the reactor was followed by beta decay and the resulting matrix was purified via radiochemical separation at PSI. The radioactive targets have been used for time-of-flight measurements at the CERN n_TOF facility using the 19 and 185 m beam lines during 2014 and 2015. The capture cascades were detected using a set of four C6D6 scintillators, allowing to observe the associated neutron capture resonances. The results presented in this work are the first ever determination of the resonance capture cross section of 147Pm and 171Tm. Activation experiments on the same 147Pm and 171Tm targets with a high-intensity 30 keV quasi-Maxwellian flux of neutrons will be performed using the SARAF accelerator and the Liquid-Lithium Target (LiLiT) in order to extract the corresponding Maxwellian Average Cross Section (MACS). The status of these experiments and preliminary results will be presented and discussed as well.

  7. T helper 17.1 cells associate with multiple sclerosis disease activity: perspectives for early intervention.

    Science.gov (United States)

    van Langelaar, Jamie; van der Vuurst de Vries, Roos M; Janssen, Malou; Wierenga-Wolf, Annet F; Spilt, Isis M; Siepman, Theodora A; Dankers, Wendy; Verjans, Georges M G M; de Vries, Helga E; Lubberts, Erik; Hintzen, Rogier Q; van Luijn, Marvin M

    2018-05-01

    Interleukin-17-expressing CD4+ T helper 17 (Th17) cells are considered as critical regulators of multiple sclerosis disease activity. However, depending on the species and pro-inflammatory milieu, Th17 cells are functionally heterogeneous, consisting of subpopulations that differentially produce interleukin-17, interferon-gamma and granulocyte macrophage colony-stimulating factor. In the current study, we studied distinct effector phenotypes of human Th17 cells and their correlation with disease activity in multiple sclerosis patients. T helper memory populations single- and double-positive for C-C chemokine receptor 6 (CCR6) and CXC chemokine receptor 3 (CXCR3) were functionally assessed in blood and/or cerebrospinal fluid from a total of 59 patients with clinically isolated syndrome, 35 untreated patients and 24 natalizumab-treated patients with relapsing-remitting multiple sclerosis, and nine patients with end-stage multiple sclerosis. Within the clinically isolated syndrome group, 23 patients had a second attack within 1 year and 26 patients did not experience subsequent attacks during a follow-up of >5 years. Low frequencies of T helper 1 (Th1)-like Th17 (CCR6+CXCR3+), and not Th17 (CCR6+CXCR3-) effector memory populations in blood strongly associated with a rapid diagnosis of clinically definite multiple sclerosis. In cerebrospinal fluid of clinically isolated syndrome and relapsing-remitting multiple sclerosis patients, Th1-like Th17 effector memory cells were abundant and showed increased production of interferon-gamma and granulocyte macrophage colony-stimulating factor compared to paired CCR6+ and CCR6-CD8+ T cell populations and their blood equivalents after short-term culturing. Their local enrichment was confirmed ex vivo using cerebrospinal fluid and brain single-cell suspensions. Across all pro-inflammatory T helper cells analysed in relapsing-remitting multiple sclerosis blood, Th1-like Th17 subpopulation T helper 17.1 (Th17.1; CCR6+CXCR3+CCR4

  8. Low-power, miniature {sup 171}Yb ion clock using an ultra-small vacuum package

    Energy Technology Data Exchange (ETDEWEB)

    Jau, Y.-Y.; Schwindt, P. D. D. [Sandia National Laboratories, Albuquerque, New Mexico 87185 (United States); Partner, H. [Sandia National Laboratories, Albuquerque, New Mexico 87185 (United States); Center for Quantum Information and Control (CQuIC), Department of Physics and Astronomy, University of New Mexico, Albuquerque, New Mexico 87131 (United States); Prestage, J. D.; Kellogg, J. R.; Yu, N. [Jet Propulsion Laboratory, California Institute of Technology, Pasadena, California 91109 (United States)

    2012-12-17

    We report a demonstration of a very small microwave atomic clock using the 12.6 GHz hyperfine transition of the trapped {sup 171}Yb ions inside a miniature, completely sealed-off 3 cm{sup 3} ion-trap vacuum package. In the ion clock system, all of the components are highly miniaturized with low power consumption except the 369 nm optical pumping laser still under development for miniaturization. The entire clock, including the control electronics, consumes <300 mW. The fractional frequency instability of the miniature Yb{sup +} clock reaches the 10{sup -14} range after a few days of integration.

  9. Dysprosium selective potentiometric membrane sensor

    Energy Technology Data Exchange (ETDEWEB)

    Zamani, Hassan Ali, E-mail: haszamani@yahoo.com [Department of Applied Chemistry, Mashhad Branch, Islamic Azad University, Mashhad (Iran, Islamic Republic of); Faridbod, Farnoush; Ganjali, Mohammad Reza [Center of Excellence in Electrochemistry, Faculty of Chemistry, University of Tehran, Tehran (Iran, Islamic Republic of)

    2013-03-01

    A novel Dy(III) ion-selective PVC membrane sensor was made using a new synthesized organic compound, 3,4-diamino-N Prime -((pyridin-2-yl)methylene)benzohydrazide (L) as an excellent sensing element. The electrode showed a Nernstian slope of 19.8 {+-} 0.6 mV per decade in a wide concentration range of 1.0 Multiplication-Sign 10{sup -6}-1.0 Multiplication-Sign 10{sup -2} mol L{sup -1}, a detection limit of 5.5 Multiplication-Sign 10{sup -7} mol L{sup -1}, a short conditioning time, a fast response time (< 10 s), and high selectivity towards Dy(III) ion in contrast to other cations. The proposed sensor was successfully used as an indicator electrode in the potentiometric titration of Dy(III) ions with EDTA. The membrane sensor was also applied to the F{sup -} ion indirect determination of some mouth washing solutions and to the Dy{sup 3+} determination in binary mixtures. Highlights: Black-Right-Pointing-Pointer The novelty of this work is based on the high affinity of the ionophore toward the Dy{sup 3+} ions. Black-Right-Pointing-Pointer This technique is very simple, fast and inexpensive and it is not necessary to use sophisticated equipment. Black-Right-Pointing-Pointer The newly developed sensor is superior to the formerly reported Dy{sup 3+} sensors in terms of selectivity.

  10. Neutron capture at the s-process branching points $^{171}$Tm and $^{204}$Tl

    CERN Multimedia

    Branching points in the s-process are very special isotopes for which there is a competition between the neutron capture and the subsequent b-decay chain producing the heavy elements beyond Fe. Typically, the knowledge on the associated capture cross sections is very poor due to the difficulty in obtaining enough material of these radioactive isotopes and to measure the cross section of a sample with an intrinsic activity; indeed only 2 out o the 21 ${s}$-process branching points have ever been measured by using the time-of-flight method. In this experiment we aim at measuring for the first time the capture cross sections of $^{171}$Tm and $^{204}$Tl, both of crucial importance for understanding the nucleosynthesis of heavy elements in AGB stars. The combination of both (n,$\\gamma$) measurements on $^{171}$Tm and $^{204}$Tl will allow one to accurately constrain neutron density and the strength of the 13C(α,n) source in low mass AGB stars. Additionally, the cross section of $^{204}$Tl is also of cosmo-chrono...

  11. Detailed high-spin spectroscopy and the search for the wobbling mode in 171Ta

    International Nuclear Information System (INIS)

    Hartley, D J.; Mohr, W.H.; Vanhoy, J.R.

    2005-01-01

    High-spin states in 171 Ta were populated in the 124 Sn( 51 V,4n) reaction at 228 MeV to search for evidence of stable triaxial deformation. Identification of a wobbling sequence based on the previously known πi 13/2 structure would provide a unique signature for this rarely observed shape. No such sequence was identified in these data, which suggests that the island of triaxial strongly deformed bands may be smaller than once thought. However, over 200 new transitions and two new bands were placed in the level scheme and the sequence based on the πi 13/2 orbital could be observed up to spin and parity I π =(101/2 + ). The relative excitations of all the sequences were determined and the ground state of 171 Ta was found to have 5/2 + quantum numbers, contrary to previous reports. All of the previously known structures were extended to much higher spin and their high-frequency band crossings are interpreted within the framework of the cranked shell model

  12. Radiological profile of pulmonary tuberculosis in HIV: concerning 171 observations in Kinshasa

    International Nuclear Information System (INIS)

    Djamba, O.N.; Mukaya, J.; Kayembe, J.M.

    2011-01-01

    This prospective descriptive study was conducted in Depistage center of the Tuberculosis treatment of Kabinda during a period of three months, had as objectives to study the radiological profile of pulmonary tuberculosis in HIV and HIV- patients, then to compare the frequency of different radiological abnormalities between the two groups to determine some characteristics of co-infection HIV/TP+. Among 171 patients with contagious pulmonary tuberculosis, 50 patients had positive serology for HIV, a prevalence of 29,2%. The intrathoracic lymph nodes, localized lesions only in the lower field were more observed in HIV, as well as pleurisy and the absence of radiological abnormality. The only one case of miliary was HIV positive. By contrast, excavations and localized lesions in the upper field were predominant in HIV-. Atypical radiological manifestations of pulmonary tuberculosis were more common in patients with HIV infection.

  13. Production, separation and target preparation of 171Tm an 147Pm for neutron cross section measurements

    CERN Document Server

    Heinitz, S; Schumann, D; Dressler, R; Kivel, N; Guerrero, C; Köster, U; Tessler, M; Paul, M; Halfon, S

    2015-01-01

    The knowledge of the neutron capture cross sections of s-process branching point isotopes represents a basic requirement for the understanding of star evolution. Since such branching point isotopes are by definition radioactive, the measurement of their cross sections from thermal to stellar energies becomes a challenging task. Considerable amounts of material have to be produced, representing a significant radioactive hazard. We report here on the production and separation of 3.5 mg 171Tm from 240 mg 170Er2O3 and 72 µg 147Pm from 100 mg 146Nd2O3 irradiated at the ILL high flux reactor. Thin targets were prepared with high chemical and radioisotopic purity suitable for neutron capture measurements at n_TOF CERN and the SARAF-LiLiT facility.

  14. Adsorption of Reactive Blue 171 from Aqueous Solution using Low Cost Activated Carbon Prepared from Agricultural Solid Waste: Albizia amara

    Directory of Open Access Journals (Sweden)

    K. Anitha

    2015-07-01

    Full Text Available The adsorption of Reactive Blue 171 (Reactive Dye from aqueous solution using activated carbon prepared from Albizia amara pod shell waste as an adsorbent have been carried out. The experimental adsorption data fitted reasonably well to Langmuir and Freundlich adsorption isotherms. Kinetic parameters as a function of Initial dye concentration have been calculated and the kinetic data were substituted in Pseudo First Order, Elovich and Pseudo Second order equations. A probable explanation is offered to account for the results of kinetic study. The thermodynamic parameter enthalpy change (∆H suggests the exothermic nature of absorption of Reactive Blue 171 onto activated Albizia amara pod shell waste carbon.

  15. 22 CFR 171.52 - Appeal of denial of access to, declassification of, amendment of, accounting of disclosures of...

    Science.gov (United States)

    2010-04-01

    ... of, amendment of, accounting of disclosures of, or challenge to classification of records. 171.52..., amendment of, accounting of disclosures of, or challenge to classification of records. (a) Right of... records, amendment of records, accounting of disclosures of records, or any authorized holder of...

  16. 25 CFR 171.420 - Can I dispose of sewage, trash, or other refuse on a BIA irrigation project?

    Science.gov (United States)

    2010-04-01

    ... 25 Indians 1 2010-04-01 2010-04-01 false Can I dispose of sewage, trash, or other refuse on a BIA... AND WATER IRRIGATION OPERATION AND MAINTENANCE Irrigation Facilities § 171.420 Can I dispose of sewage, trash, or other refuse on a BIA irrigation project? No. Sewage, trash, or other refuse are considered...

  17. Expression, purification and preliminary X-ray crystallographic analysis of the chicken MHC class I molecule YF1*7.1

    International Nuclear Information System (INIS)

    Hee, Chee Seng; Gao, Song; Miller, Marcia M.; Goto, Ronald M.; Ziegler, Andreas; Daumke, Oliver; Uchanska-Ziegler, Barbara

    2009-01-01

    The chicken classical MHC class I antigen YF1*7.1 was crystallized together with β 2 -microglobulin but without a peptide ligand. Crystals diffracted synchrotron radiation to 1.32 Å and belonged to the monoclinic space group P2 1 . YF1*7.1 is an allele of a polymorphic major histocompatibility complex (MHC) class I-like locus within the chicken Y gene complex. With the aim of understanding the possible role of the YF1*7.1 molecule in antigen presentation, the complex of YF1*7.1 heavy chain and β 2 -microglobulin was reconstituted and purified without a peptide. Crystals diffracted synchrotron radiation to 1.32 Å resolution and belonged to the monoclinic space group P2 1 . The phase problem was solved by molecular replacement. A detailed examination of the structure may provide insight into the type of ligand that could be bound by the YF1*7.1 molecule

  18. [A role for hypnosis in cataract surgery: Report of 171 procedures].

    Science.gov (United States)

    Agard, E; Pernod, C; El Chehab, H; Russo, A; Haxaire, M; Dot, C

    2016-03-01

    To study the effectiveness of relaxation hypnosis in outpatient cataract surgery. Prospective study of 171 patients undergoing cataract surgery under hypnosis, performed by the same nurse anesthetist. The procedures were performed by 2 senior surgeons, A and B (A=78 surgeries, and B=93 surgeries) under topical anesthesia and with a 2.2-mm mini-incision. The hypnosis group (n=102) was compared to a control group (n=69) according to quantitative, objective criteria: hemodynamic changes and the need for intravenous medication in operating room, as well as subjective, qualitative criteria: surgical comfort, effectiveness of hypnosis, and patient satisfaction. Subgroup analyses by surgeon, 1st and 2nd eye surgery, were performed. Hemodynamic parameters were not significantly different between the 2 groups: systolic blood pressure (P=0.06) and maximum heart rate (P=0.25). However, the use of intraoperative intravenous medication was significantly higher in the control group (49.3% versus 21.6%, Phypnosis group reported a mean comfort rating of 8.4/10, and 100% were satisfied with this hypnosis experience. Preliminary results of this study are very positive for all three parties: patient/anesthetist/surgeon. They are leading to an expanded university training program for operating room personnel in order to improve quality of care and reduce premedication in elderly patients so as to facilitate their return to home. Copyright © 2015 Elsevier Masson SAS. All rights reserved.

  19. Basal Cell Carcinoma of the Head and Neck Region: An Analysis of 171 Cases

    International Nuclear Information System (INIS)

    Janjua, O. S.; Qureshi, S. M.

    2012-01-01

    Objective. To analyze the pattern of presentation of basal cell carcinoma (BCC) and margin status for excised specimens in the head and neck region. Study Design. Retrospective cross-sectional. Duration of Study. January 2009 to December 2011. Methodology. The database of the pathology department was searched to identify records of all malignant skin tumors that underwent standard excision with margins. Out of these records, tumors with a diagnosis of BCC in the head and neck region were retrieved and separated. Age, gender, anatomic location, pattern of tumor, and margin status were noted. Results. A total of 171 cases of BCC from various sites of head and neck were retrieved. Male to female ratio was 1.4?:?1. The age ranged from 22 to 90 years. Seventy-six cases presented on right side, 79 on left, and 16 were in the midline. Most common anatomical site was the nose followed by the cheek. Nodular lesions were the most common (46.2%) followed by pigmented variety (18.7%). Margins were clear in 77 (45.1%) cases, involved in 86 (50.2%) cases, and close in 8 (4.7%) cases. Conclusion. Nose was the most common site followed by the cheek. Nodular and pigmented varieties were the most frequent and margins were involved in more than fifty percent of the cases

  20. Basal Cell Carcinoma of the Head and Neck Region: An Analysis of 171 Cases

    Directory of Open Access Journals (Sweden)

    Omer Sefvan Janjua

    2012-01-01

    Full Text Available Objective. To analyze the pattern of presentation of basal cell carcinoma (BCC and margin status for excised specimens in the head and neck region. Study Design. Retrospective cross-sectional. Duration of Study. January 2009 to December 2011. Methodology. The database of the pathology department was searched to identify records of all malignant skin tumors that underwent standard excision with margins. Out of these records, tumors with a diagnosis of BCC in the head and neck region were retrieved and separated. Age, gender, anatomic location, pattern of tumor, and margin status were noted. Results. A total of 171 cases of BCC from various sites of head and neck were retrieved. Male to female ratio was 1.4 : 1. The age ranged from 22 to 90 years. Seventy-six cases presented on right side, 79 on left, and 16 were in the midline. Most common anatomical site was the nose followed by the cheek. Nodular lesions were the most common (46.2% followed by pigmented variety (18.7%. Margins were clear in 77 (45.1% cases, involved in 86 (50.2% cases, and close in 8 (4.7% cases. Conclusion. Nose was the most common site followed by the cheek. Nodular and pigmented varieties were the most frequent and margins were involved in more than fifty percent of the cases.

  1. Measurement of the acoustic reflectivity of sirenia (Florida manatees) at 171 kHz.

    Science.gov (United States)

    Jaffe, Jules S; Simonet, Fernando; Roberts, Paul L D; Bowles, Ann E

    2007-01-01

    The Florida manatee (Trichechus manatus latirostris) is an endangered sirenian. At present, its adult population (approximately 2200) seems stable, but tenuous. Manatee-boat collisions are a significant proportion (approximately 25%) of mortalities. Here, the potential use of active sonar for detecting manatees by quantifying sonic reflectivity is explored. In order to estimate reflectivity two methods were used. One method measured live reflections from captive animals using a carefully calibrated acoustic and co-registered optical system. The other method consisted of the analysis of animal tissue in order to obtain estimates of the sound speed and density and to predict reflectivity. The impedance measurement predicts that for a lateral view, the tissue reflectivity is close to 0.13, with a critical grazing angle of 28 degrees. Data measured from live animals indicate that substantial reflections can be recorded, however in many instances observed "empirical target strengths" were less than an experimentally dependent -48-dB threshold. Conclusions favor the hypothesis that the animals reflect substantial amounts of sound; however, the reflections can often be specular, and therefore impractical for observation by a manatee detection sonar operating at 171 kHz.

  2. High-resolution Laboratory Measurements of Coronal Lines near the Fe IX Line at 171 Å

    Science.gov (United States)

    Beiersdorfer, Peter; Träbert, Elmar

    2018-02-01

    We present high-resolution laboratory measurements in the spectral region between 165 and 175 Å that focus on the emission from various ions of C, O, F, Ne, S, Ar, Fe, and Ni. This wavelength region is centered on the λ171 Fe IX channel of the Atmospheric Imaging Assembly on the Solar Dynamics Observatory, and we place special emphasis on the weaker emission lines of Fe IX predicted in this region. In general, our measurements show a multitude of weak lines missing in the current databases, where the emission lines of Ni are probably most in need of further identification and reclassification. We also find that the wavelengths of some of the known lines need updating. Using the multi-reference Møller–Plesset method for wavelength predictions and collisional-radiative modeling of the line intensities, we have made tentative assignments of more than a dozen lines to the spectrum of Fe IX, some of which have formerly been identified as Fe VII, Fe XIV, or Fe XVI lines. Several Fe features remain unassigned, although they appear to be either Fe VII or Fe X lines. Further work will be needed to complete and correct the spectral line lists in this wavelength region.

  3. Scarlet fever: A not so typical exanthematous pharyngotonsillitis (based on 171 cases).

    Science.gov (United States)

    García-Vera, César; de Dios Javierre, Bárbara; Castán Larraz, Beatriz; Arana Navarro, Teresa; Cenarro Guerrero, Teresa; Ruiz Pastora, Rafael; Sánchez Gimeno, Javier

    2016-01-01

    To describe the age, signs and clinical symptoms of children with scarlet fever at the present time, and to check whether they are equivalent to those with traditional streptococcal pharyngotonsillitis. An observational, retrospective study was conducted on the clinical records of 5500 children aged from 0 to 15 years attending a primary health care center. A record was made of the percentage of the cases in which signs and symptoms appear and the Centor score was calculated. Microbiological diagnosis of the disease was made using the rapid antigen-detection test or traditional culture. A total of 171 out of 252 scarlet fever diagnoses were microbiologically verified in 158 patients. The median age was 3.8 years (interquartile range: 2.91-4.78), with the majority (57%) under the age of 4 years. There was fever in 89% of the processes (95% CI: 84-94%), with a temperature of >38°C in 73% (95% CI: 65-80%), enlarged lymph nodes in 70% (95% CI: 58-82%), absence of cough in 73% (95% CI: 65-80%), and tonsillar exudate in only 24% (95% CI: 17-31%). The Centor score (n=105) was ≤2 points in 86% (95% CI: 79-92%). The only difference regarding age is that episodes in patients under the age of 4 years old have significantly higher fever (>38°C) than the older ones (80% versus 63%. OR 3.13; 95% CI: 1.46-6.71). Scarlet fever pharyngotonsillitis differs from the traditional streptococcal pharyngotonsillitis, and its evaluation using clinical prediction rules such as Centor or McIsaac is questionable. The main diagnostic key must certainly be rash, regardless of patient age. Copyright © 2015 Elsevier España, S.L.U. and Sociedad Española de Enfermedades Infecciosas y Microbiología Clínica. All rights reserved.

  4. Rapid detection of TiO2 (E171) in table sugar using Raman spectroscopy.

    Science.gov (United States)

    Tan, Chen; Zhao, Bin; Zhang, Zhiyun; He, Lili

    2017-02-01

    The potential toxic effects of titanium dioxide (TiO 2 ) to humans remain debatable despite its broad application as a food additive. Thus, confirmation of the existence of TiO 2 particles in food matrices and subsequently quantifying them are becoming increasingly critical. This study developed a facile, rapid (E171) from food products (e.g., table sugar) by Raman spectroscopy. To detect TiO 2 particles from sugar solution, sequential centrifugation and washing procedures were effectively applied to separate and recover 97% of TiO 2 particles from the sugar solution. The peak intensity of TiO 2 sensitively responded to the concentration of TiO 2 with a limit of detection (LOD) of 0.073 mg kg -1 . In the case of sugar granules, a mapping technique was applied to directly estimate the level of TiO 2 , which can be potentially used for rapid online monitoring. The plot of averaged intensity to TiO 2 concentration in the sugar granules exhibited a good linear relationship in the wide range of 5-2000 mg kg -1 , with an LOD of 8.46 mg kg -1 . Additionally, we applied Raman spectroscopy to prove the presence of TiO 2 in sugar-coated doughnuts. This study begins to fill in the analytical gaps that exist regarding the rapid detection and quantification of TiO 2 in food, which facilitate the risk assessment of TiO 2 through food exposure.

  5. Continuous in vitro exposure of intestinal epithelial cells to E171 food additive causes oxidative stress, inducing oxidation of DNA bases but no endoplasmic reticulum stress.

    Science.gov (United States)

    Dorier, Marie; Béal, David; Marie-Desvergne, Caroline; Dubosson, Muriel; Barreau, Frédérick; Houdeau, Eric; Herlin-Boime, Nathalie; Carriere, Marie

    2017-08-01

    The whitening and opacifying properties of titanium dioxide (TiO 2 ) are commonly exploited when it is used as a food additive (E171). However, the safety of this additive can be questioned as TiO 2 nanoparticles (TiO 2 -NPs) have been classed at potentially toxic. This study aimed to shed some light on the mechanisms behind the potential toxicity of E171 on epithelial intestinal cells, using two in vitro models: (i) a monoculture of differentiated Caco-2 cells and (ii) a coculture of Caco-2 with HT29-MTX mucus-secreting cells. Cells were exposed to E171 and two different types of TiO 2 -NPs, either acutely (6-48 h) or repeatedly (three times a week for 3 weeks). Our results confirm that E171 damaged these cells, and that the main mechanism of toxicity was oxidation effects. Responses of the two models to E171 were similar, with a moderate, but significant, accumulation of reactive oxygen species, and concomitant downregulation of the expression of the antioxidant enzymes catalase, superoxide dismutase and glutathione reductase. Oxidative damage to DNA was detected in exposed cells, proving that E171 effectively induces oxidative stress; however, no endoplasmic reticulum stress was detected. E171 effects were less intense after acute exposure compared to repeated exposure, which correlated with higher Ti accumulation. The effects were also more intense in cells exposed to E171 than in cells exposed to TiO 2 -NPs. Taken together, these data show that E171 induces only moderate toxicity in epithelial intestinal cells, via oxidation.

  6. Altered selenium status in Huntington's disease: neuroprotection by selenite in the N171-82Q mouse model.

    Science.gov (United States)

    Lu, Zhen; Marks, Eileen; Chen, Jianfang; Moline, Jenna; Barrows, Lorraine; Raisbeck, Merl; Volitakis, Irene; Cherny, Robert A; Chopra, Vanita; Bush, Ashley I; Hersch, Steven; Fox, Jonathan H

    2014-11-01

    Disruption of redox homeostasis is a prominent feature in the pathogenesis of Huntington's disease (HD). Selenium an essential element nutrient that modulates redox pathways and has been reported to provide protection against both acute neurotoxicity (e.g. methamphetamine) and chronic neurodegeneration (e.g. tauopathy) in mice. The objective of our study was to investigate the effect of sodium selenite, an inorganic form of selenium, on behavioral, brain degeneration and biochemical outcomes in the N171-82Q Huntington's disease mouse model. HD mice, which were supplemented with sodium selenite from 6 to 14 weeks of age, demonstrated increased motor endurance, decreased loss of brain weight, decreased mutant huntingtin aggregate burden and decreased brain oxidized glutathione levels. Biochemical studies revealed that selenite treatment reverted HD-associated changes in liver selenium and plasma glutathione in N171-82Q mice and had effects on brain selenoprotein transcript expression. Further, we found decreased brain selenium content in human autopsy brain. Taken together, we demonstrate a decreased selenium phenotype in human and mouse HD and additionally show some protective effects of selenite in N171-82Q HD mice. Modification of selenium metabolism results in beneficial effects in mouse HD and thus may represent a therapeutic strategy. Copyright © 2014 Elsevier Inc. All rights reserved.

  7. Individual addressing of trapped {sup 171}Yb{sup +} ion qubits using a microelectromechanical systems-based beam steering system

    Energy Technology Data Exchange (ETDEWEB)

    Crain, S.; Mount, E.; Baek, S.; Kim, J., E-mail: jungsang@duke.edu [Electrical and Computer Engineering Department, Fitzpatrick Institute for Photonics, Duke University, Durham, North Carolina 27708 (United States)

    2014-11-03

    The ability to individually manipulate the increasing number of qubits is one of the many challenges towards scalable quantum information processing with trapped ions. Using micro-mirrors fabricated with micro-electromechanical systems technology, we focus laser beams on individual ions in a linear chain and steer the focal point in two dimensions. We demonstrate sequential single qubit gates on multiple {sup 171}Yb{sup +} qubits and characterize the gate performance using quantum state tomography. Our system features negligible crosstalk to neighboring ions (<3×10{sup −4}), and switching speed comparable to typical single qubit gate times (<2 μs)

  8. The role of dysprosium on the structural and magnetic properties of (Nd{sub 1−x}Dy{sub x}){sub 2}Fe{sub 14}B nanoparticles

    Energy Technology Data Exchange (ETDEWEB)

    Rahimi, Hamed; Ghasemi, Ali, E-mail: ali13912001@yahoo.com; Mozaffarinia, Reza; Tavoosi, Majid

    2017-02-15

    In current work, Nd2Fe14B nanoparticles was synthesized by sol-gel method. Dysprosium powders were added into Nd2Fe14B nanoparticles by mechanical alloying process in order to enhancement of coercivity. The phase analysis, structure, and magnetic properties of annealed (Nd{sub 1−x}Dy{sub x}){sub 2}Fe{sub 14}B nanoparticles with different Dy-content (x=0.1, 0.2, 0.3, 0.4, 0.5, 0.6) were investigated by employing X-ray diffraction, X-ray photoelectron spectroscopy, energy dispersive spectroscopy, field emission scanning electron microscope, transmission electron microscope and vibrating sample magnetometer techniques. The results showed that with an increase in Dy amounts, the coercivity of particles increased from 2.9 kOe to 13.4 kOe and then decreased to 5.6 kOe. By adding an optimum amount of Dy (x=0.4), the coercivity was significantly increased from 2.9 kOe to 13.4 kOe. The average particle size of annealed (Nd{sub 1−x}Dy{sub x}){sub 2}Fe{sub 14}B nanoparticles was below 10 nm. Magnetization reversal studies indicate that the coercivity of milled and annealed (Nd{sub 1−x}Dy{sub x}){sub 2}Fe{sub 14}B nanoparticles is controlled by the nucleation of reversed magnetic domains. The experimental results in the angular dependence of coercivity for (Nd{sub 1−x}Dy{sub x}){sub 2}Fe{sub 14}B permanent magnets showed that the normalized coercivity of the permanent magnets H{sub c}(θ)/H{sub c}(0) increases from 1 to about 1.2–1.5 with increasing θ from 0 to about π/3, for x=0.4–0.6. - Highlights: • Dy was added to Nd{sub 2}Fe{sub 14}B nanoparticles to improve the coercivity. • A maximum squareness ratio of 0.99 was obtained. • The average particle size decreased with an increase in Dy-content.

  9. Characterization of a Large Antibiotic Resistance Plasmid Found in Enteropathogenic Escherichia coli Strain B171 and Its Relatedness to Plasmids of Diverse E. coli and Shigella Strains.

    Science.gov (United States)

    Hazen, Tracy H; Michalski, Jane; Nagaraj, Sushma; Okeke, Iruka N; Rasko, David A

    2017-09-01

    Enteropathogenic Escherichia coli (EPEC) is a leading cause of severe infantile diarrhea in developing countries. Previous research has focused on the diversity of the EPEC virulence plasmid, whereas less is known regarding the genetic content and distribution of antibiotic resistance plasmids carried by EPEC. A previous study demonstrated that in addition to the virulence plasmid, reference EPEC strain B171 harbors a second, larger plasmid that confers antibiotic resistance. To further understand the genetic diversity and dissemination of antibiotic resistance plasmids among EPEC strains, we describe the complete sequence of an antibiotic resistance plasmid from EPEC strain B171. The resistance plasmid, pB171_90, has a completed sequence length of 90,229 bp, a GC content of 54.55%, and carries protein-encoding genes involved in conjugative transfer, resistance to tetracycline ( tetA ), sulfonamides ( sulI ), and mercury, as well as several virulence-associated genes, including the transcriptional regulator hha and the putative calcium sequestration inhibitor ( csi ). In silico detection of the pB171_90 genes among 4,798 publicly available E. coli genome assemblies indicates that the unique genes of pB171_90 ( csi and traI ) are primarily restricted to genomes identified as EPEC or enterotoxigenic E. coli However, conserved regions of the pB171_90 plasmid containing genes involved in replication, stability, and antibiotic resistance were identified among diverse E. coli pathotypes. Interestingly, pB171_90 also exhibited significant similarity with a sequenced plasmid from Shigella dysenteriae type I. Our findings demonstrate the mosaic nature of EPEC antibiotic resistance plasmids and highlight the need for additional sequence-based characterization of antibiotic resistance plasmids harbored by pathogenic E. coli . Copyright © 2017 American Society for Microbiology.

  10. Self-image perception of 171 children and adolescents with cleft lip and palate from 22 countries.

    Science.gov (United States)

    Abd-Elsayed, Alaa A; Delgado, Sergio V; Livingstone, Morgan

    2013-01-01

    Cleft lip (CL) and cleft palate (CP) are among the most common congenital deformities of the head and neck. They are associated with many problems, physical and psychological. We describe 171 children and adolescents with CL/CP from 22 countries who were asked to draw their faces in a self-image perception drawing 2 hours before surgery to repair their deformities. The aim of the study was to explore whether children and adolescents with CL and CP perceived themselves as deformed when given the opportunity to draw their faces before surgery to repair their deformities. Children were asked to lie down on a large piece of paper to have their body outline traced. Subsequently, the children were asked to draw their faces within the outline. All of the children included in this study drew their faces with normal mouths. None of the 171 patients with CL/CP drew their deformity when asked to draw their faces; the reasons are not clear. The children may have wanted to compensate for their disability with the constructive use of fantasy as they anticipated the surgery to repair their CL/CP. An additional hypothesis is that the children felt the need to draw an image that they knew represented their parents' desires.

  11. F-state quenching with CH4 for buffer-gas cooled 171Y b+ frequency standard

    Directory of Open Access Journals (Sweden)

    Y.-Y. Jau

    2015-11-01

    Full Text Available We report that methane, CH4, can be used as an efficient F-state quenching gas for trapped ytterbium ions. The quenching rate coefficient is measured to be (2.8 ± 0.3 × 106 s−1 Torr−1. For applications that use microwave hyperfine transitions of the ground-state 171Y b ions, the CH4 induced frequency shift coefficient and the decoherence rate coefficient are measured as δν/ν = (−3.6 ± 0.1 × 10−6 Torr−1 and 1/T2 = (1.5 ± 0.2 × 105 s−1 Torr−1. In our buffer-gas cooled 171Y b+ microwave clock system, we find that only ≤10−8 Torr of CH4 is required under normal operating conditions to efficiently clear the F-state and maintain ≥85% of trapped ions in the ground state with insignificant pressure shift and collisional decoherence of the clock resonance.

  12. Correlation of ibuprofen bioavailability with gastrointestinal transit by scintigraphic monitoring of 171Er-labeled sustained-release tablets

    International Nuclear Information System (INIS)

    Parr, A.F.; Beihn, R.M.; Franz, R.M.; Szpunar, G.J.; Jay, M.

    1987-01-01

    External gamma scintigraphy was used to monitor the gastrointestinal (GI) transit of radiolabeled sustained-release tablets containing 800 mg ibuprofen in eight fasted healthy volunteers. Ibuprofen serum concentrations were determined from blood samples drawn sequentially over a 24-hr period. Serum concentrations and related parameters were correlated to the position of the dosage form in the GI tract from the scintiphotos. The sustained-release tablets were radiolabeled intact utilizing a neutron activation procedure, by incorporating 0.18% of 170 Er2O3 (enriched to greater than 96% 170 Er) into the bulk formulation. After manufacture of the final dosage forms, the tablets were irradiated in a neutron flux (4.4 x 10(13) n/cm2.sec) for 2 min, converting the stable 170 Er to radioactive 171 Er (t1/2 = 7.5 hr). Each tablet contained 50 microCi of 171 Er at the time of administration. The scintigraphy studies suggested that the greatest proportion of ibuprofen was absorbed from this dosage form while the tablet was in the large bowel. The dosage forms eroded slowly in the small bowel and appeared to lose their integrity in the large bowel. In vitro studies showed only minimal effects of the neutron irradiation procedure on the dosage form performance

  13. Expression, purification, crystallization and preliminary X-ray crystallographic analysis of l-lactate dehydrogenase and its H171C mutant from Bacillus subtilis

    International Nuclear Information System (INIS)

    Zhang, Yanfeng; Gao, Xiaoli

    2011-01-01

    Recombinant wild-type l-lactate dehydrogenase from B. subtilis (BsLDH) was cocrystallized with fructose 1,6-bisphosphate and NAD + and the crystal diffracted to 2.38 Å resolution. The H171C mutant of BsLDH was also crystallized as the apoenzyme and in complex with NAD + and the crystals diffracted to 2.20 and 2.49 Å, respectively. All crystals belonged to space group P3. l-Lactate dehydrogenase (LDH) is an important enzyme involved in the last step of glycolysis that catalyzes the reversible conversion of pyruvate to l-lactate with the simultaneous oxidation of NADH to NAD + . In this study, wild-type LDH from Bacillus subtilis (BsLDH-WT) and the H171C mutant (BsLDH-H171C) were expressed in Escherichia coli and purified to near-homogeneity. BsLDH-WT was crystallized in the presence of fructose 1,6-bisphosphate (FBP) and NAD + and the crystal diffracted to 2.38 Å resolution. The crystal belonged to space group P3, with unit-cell parameters a = b = 171.04, c = 96.27 Å. BsLDH-H171C was also crystallized as the apoenzyme and in complex with NAD + , and data sets were collected to 2.20 and 2.49 Å resolution, respectively. Both BsLDH-H171C crystals belonged to space group P3, with unit-cell parameters a = b = 133.41, c = 99.34 Å and a = b = 133.43, c = 99.09 Å, respectively. Tetramers were observed in the asymmetric units of all three crystals

  14. Comparing Zeeman qubits to hyperfine qubits in the context of the surface code: +174Yb and +171Yb

    Science.gov (United States)

    Brown, Natalie C.; Brown, Kenneth R.

    2018-05-01

    Many systems used for quantum computing possess additional states beyond those defining the qubit. Leakage out of the qubit subspace must be considered when designing quantum error correction codes. Here we consider trapped ion qubits manipulated by Raman transitions. Zeeman qubits do not suffer from leakage errors but are sensitive to magnetic fields to first order. Hyperfine qubits can be encoded in clock states that are insensitive to magnetic fields to first order, but spontaneous scattering during the Raman transition can lead to leakage. Here we compare a Zeeman qubit (+174Yb) to a hyperfine qubit (+171Yb) in the context of the surface code. We find that the number of physical qubits required to reach a specific logical qubit error can be reduced by using +174Yb if the magnetic field can be stabilized with fluctuations smaller than 10 μ G .

  15. 235Uranium isotope abundance certified reference material for gamma spectrometry EC nuclear reference material 171 certification report

    International Nuclear Information System (INIS)

    De Bievre, P.; Eschbach, H.L.; Lesser, R.; Meyer, H.; Audenhove, Van J.

    1986-01-01

    This certification report contains the information necessary for the final certification of EC nuclear reference material 171. It is also intended to inform the user of the reference material concerned on technical/scientific details which are not given in the certificate. The report describes the reference material which consists of sets of U 3 O 8 samples with five different 235 U/U abundances, filled in cylindrical aluminium cans. The can bottom serves as window for emitted gamma radiation. The report describes how the 235 U/U abundances were characterized, how the other properties relevant for gamma measurements were determined and gives all connected results as well as those from the verification measurements. Appendix A represents the draft certificate. 32 refs

  16. Experience in developing and using the VITAMIN-C 171-neutron, 36-gamma-ray group cross-section library

    International Nuclear Information System (INIS)

    Roussin, R.W.; Weisbin, C.R.; White, J.E.; Wright, R.Q.; Greene, N.M.; Ford, W.E. III; Wright, J.B.; Diggs, B.R.

    1978-01-01

    The Department of Energy (DOE) Division of Magnetic Fusion Energy (DMFE) and Reactor Research and Technology (DRRT) jointly sponsored the development of a coupled, fine-group cross-section library. The 171-neutron, 36-gamma-ray group library is intended to be applicable to fusion reactor neutronics and LMFBR core and shield analysis. Versions of the library are available from the Radiation Shielding Information Center (RSIC) at Oak Ridge National Laboratory in both AMPX and CCCC formats. Computer codes for energy group collapsing, interpolation on Bondarenko factors for resonance self-shielding and temperature corrections, and various other useful data manipulations are available. The experience gained in the utilization of this library is discussed. Indications are that this venture, which is designed to allow users to derive problem-dependent cross sections from a fine-group master library, has been a success

  17. Restriction map of the single-stranded DNA genome of Kilham rat virus strain 171, a nondefective parvovirus

    International Nuclear Information System (INIS)

    Banerjee, P.T.; Rathrock, R.; Mitra, S.

    1981-01-01

    A physical map of Kilham rat virus strain 171 DNA was constructed by analyzing the sizes and locations of restriction endonuclease-generated fragments of the replicative-form viral DNA synthesized in vitro. BglI, KpnI, BamHI, SmaI, XhoI, and XorII did not appear to have any cleavage sites, whereas 11 other enzymes cleaved the genome at one to eight sites, and AluI generated more than 12 distinct fragments. The 30 restriction sites that were mapped were distributed randomly in the viral genome. A comparison of the restriction fragments of in vivo- and in vitro-replicated replicative-form DNAs showed that these DNAs were identical except in the size or configuration of the terminal fragments

  18. Production, separation and target preparation of {sup 171}Tm and {sup 147}Pm for neutron cross section measurements

    Energy Technology Data Exchange (ETDEWEB)

    Heinitz, Stephan; Maugeri, Emilio A.; Schumann, Dorothea; Dressler, Rugard; Kivel, Niko [Paul Scherrer Institute, Villigen (Switzerland); Guerrero, Carlos [Sevilla Univ. (Spain); Koester, Ullrich [Institut Laue-Langevin, Grenoble (France); Tessler, Moshe; Paul, Michael [Hebrew Univ. of Jerusalem (Israel); Halfon, Shlomi [Soreq Nuclear Research Center, Yavne (Israel); Collaboration: nTOF Collaboration

    2017-07-01

    The knowledge of the neutron capture cross sections of s-process branching point isotopes represents a basic requirement for the understanding of star evolution. Since such branching point isotopes are by definition radioactive, the measurement of their cross sections from thermal to stellar energies becomes a challenging task. Considerable amounts of material have to be produced, representing a significant radioactive hazard. We report here on the production and separation of 3.5 mg {sup 171}Tm from 240 mg {sup 170}Er{sub 2}O{sub 3} and 72 μg {sup 147}Pm from 100 mg {sup 146}Nd{sub 2}O{sub 3} irradiated at the ILL high flux reactor. Thin targets were prepared with high chemical and radioisotopic purity suitable for neutron capture measurements at nTOF CERN and the SARAF-LiLiT facility.

  19. The decay of hot dysprosium nuclei

    International Nuclear Information System (INIS)

    Atac, A.; Rekstad, J.; Guttormsen, M.; Messelt, S.; Ramsoey, T.; Thorsteinsen, T.F.; Loevhoeiden, G.; Roedland, T.

    1987-03-01

    The γ-decay following the 162,163 Dy( 3 He,αxn) reactions with E 3 He =45 MeV has been studied. Non-statistical γ-radiation with energies of E γ ≅1 MeV and ≅2 MeV is found for various residual nuclei. The properties of these γ-ray bumps depend on the number of emitted neutrons and reveal an odd-even mass dependence. New techniques to extract average neutron energies as a function of excitation energy and of the number of emitted neutrons are employed. The deduced neutron energies are consistent with Fermi-gas model predictions

  20. Low frequency of the scrapile resistance-associated allele and presence of lysine-171 allele of the prion protein gene in Italian Biellese ovine breed

    NARCIS (Netherlands)

    Acutis, P.L.; Sbaiz, L.; Verburg, F.J.; Riina, M.V.; Ru, G.; Moda, G.; Caramelli, M.; Bossers, A.

    2004-01-01

    Frequencies of polymorphisms at codons 136, 154 and 171 of the prion protein (PrP) gene were studied in 1207 pure-bred and cross-bred Italian Biellese rams, a small ovine breed of about 65 000 head in Italy. Aside from the five most common alleles (VRQ, ARQ, ARR, AHQ and ARH), the rare ARK allele

  1. Metabolic behavior and distribution of the synthetic nonapeptide fragment 163-171 of human IL-1 beta.

    Science.gov (United States)

    Pessina, G P; Bocci, V; Nicoletti, C; Becherucci, C; Presentini, R; Parente, L; Villa, L; Tagliabue, A; Boraschi, D

    1990-01-01

    The pharmacokinetic parameters and distribution of the adjuvant synthetic nonapeptide VQGEESNDK, corresponding to the fragment in position 163-171 in human IL-1, were analyzed after administration to rabbit through different routes. The radiolabeled peptide did not bind to plasma proteins and, when inoculated i.v., it disappeared very rapidly from the circulation, with a t1/2 alpha of 1 min and a t 1/2 beta of 166 min. Upon administration through i.m., s.c. and oral route, the Cmax was reached between 30 and 90 min after inoculum and ranged between 7 and 4% of the administered dose. Organ distribution showed that most of the radioactivity was concentrated in kidneys and excreted in urine. From Sephadex G-10 chromatography, about 60% of the peptide recovered in the urine 4h after i.v. inoculum was intact, whereas it was more than 85% degraded when administered by other routes. The amount of intact peptide recovered in the urine correlated with the biological effectiveness through different routes, suggesting that the adjuvant effect in vivo is exerted by the intact peptide, rather than by its metabolites.

  2. Calculations of the relative effectiveness of alanine for neutrons with energies up to 17.1 MeV

    International Nuclear Information System (INIS)

    Gerstenberg, H.M.; Coyne, J.J.

    1990-01-01

    The relative effectiveness (RE) of alanine has been calculated for neutrons using the RE of alanine for charged particles. The neutrons interact with one or more of the elements (hydrogen, carbon, nitrogen and oxygen) that compose the alanine. These interactions produce spectra of secondary charged particles consisting of ions of H, D, He, Be, B, C, N and O. From a combination of the calculated secondary charged particle spectra generated by the slowing down neutrons, and the calculated RE of the ions produced, a RE for the neutrons can be obtained. In addition, lineal energy spectra were determined for neutrons with energies up to 17.1 MeV interacting with alanine. An analytical code was used to calculate these spectra for a 1 μm diameter alanine cell surrounded by an alanine medium. For comparison, similar calculations were made for muscle tissue. Finally, the calculated differential RE was folded with dose distributions to obtain RE-weighted distributions for alanine. (author)

  3. DISCOVERY OF A GIANT RADIO HALO IN A NEW PLANCK GALAXY CLUSTER PLCKG171.9-40.7

    Energy Technology Data Exchange (ETDEWEB)

    Giacintucci, Simona [Department of Astronomy, University of Maryland, College Park, MD 20742 (United States); Kale, Ruta; Venturi, Tiziana [INAF-Istituto di Radioastronomia, via Gobetti 101, I-40129 Bologna (Italy); Wik, Daniel R.; Markevitch, Maxim, E-mail: simona@astro.umd.edu [Astrophysics Science Division, NASA/Goddard Space Flight Center, Greenbelt, MD 20771 (United States)

    2013-03-20

    We report the discovery of a giant radio halo in a new, hot, X-ray luminous galaxy cluster recently found by Planck, PLCKG171.9-40.7. The radio halo was found using Giant Metrewave Radio Telescope observations at 235 MHz and 610 MHz, and in the 1.4 GHz data from an NRAO Very Large Array Sky Survey pointing that we have reanalyzed. The diffuse radio emission is coincident with the cluster X-ray emission, and has an extent of {approx}1 Mpc and a radio power of {approx}5 Multiplication-Sign 10{sup 24} W Hz{sup -1} at 1.4 GHz. Its integrated radio spectrum has a slope of {alpha} Almost-Equal-To 1.8 between 235 MHz and 1.4 GHz, steeper than that of a typical giant halo. The analysis of the archival XMM-Newton X-ray data shows that the cluster is hot ({approx}10 keV) and disturbed, consistent with X-ray-selected clusters hosting radio halos. This is the first giant radio halo discovered in one of the new clusters found by Planck.

  4. 171 ORIGINAL ARTICLE

    African Journals Online (AJOL)

    Boaz

    A SURVEY ON URINARY TRACT INFECTION ASSOCIATED WITH TWO MOST COMMON. UROPATHOGENIC BACTERIA .... UTI due to Escherichia coli and Klebsiella pneumoniae .... activity and high pregnancy rate (among females) that.

  5. Frequency measurement of the 2S(1/2)-2D(3/2) electric quadrupole transition in a single 171Yb+ ion.

    Science.gov (United States)

    Webster, Stephen; Godun, Rachel; King, Steven; Huang, Guilong; Walton, Barney; Tsatourian, Veronika; Margolis, Helen; Lea, Stephen; Gill, Patrick

    2010-03-01

    We report on precision laser spectroscopy of the 2S(1/2)(F = 0)-2D(3/2) (F = 2, m(F) = 0) clock transition in a single ion of 171Yb+. The absolute value of the transition frequency, determined using an optical frequency comb referenced to a hydrogen maser, is 688358979309310 +/- 9 Hz. This corresponds to a fractional frequency uncertainty of 1.3 x 10(-14).

  6. Micrometastatic cancer cells in bone marrow: in vitro detection with anti-cytokeratin and in vivo labeling with anti-17-1A monoclonal antibodies

    International Nuclear Information System (INIS)

    Schlimok, G.; Funke, I.; Holzmann, B.

    1987-01-01

    The detection of early micrometastasis or disseminated single tumor cells poses a problem for conventional diagnosis procedures. Using a panel of monoclonal antibodies against cytokeratin and the 17-1A epithelial antigen the authors identified immunocytochemically tumor cells in bone marrow of patients with breast cancer and colorectal cancer at the time of surgery of the primary tumor. Monoclonal antibody CK2, recognizing the human cytokeratin component 18 in simple epithelia, appeared to be the most suitable reagent because of its negative reaction with bone marrow samples of the noncarcinoma patients. Its specificity was further demonstrated in a double-marker staining procedure using an anti-leukocyte common antigen monoclonal antibody (T200) as counterstain. A comparative analysis showed that immunocytology was clearly superior to conventional cytology and histology. In 9.5-20.5% of patients without distant metastasis, tumor cells could be detected in bone marrow. They found a significant correlation between tumor cells in bone marrow and conventional risk factors, such as distant metastasis or lymph node involvement. In a first approach toward immunotherapy they demonstrated in 3 patients that infused monoclonal antibody 17-1A can label single tumor cells in bone marrow in vivo. They then used this single approach to follow up on 7 patients undergoing 17-1A therapy in an adjuvant clinical trial

  7. A polymorphic variant in the human electron transfer flavoprotein alpha-chain (alpha-T171) displays decreased thermal stability and is overrepresented in very-long-chain acyl-CoA dehydrogenase-deficient patients with mild childhood presentation

    DEFF Research Database (Denmark)

    Bross, P; Pedersen, P; Nyholm, M

    1999-01-01

    The consequences of two amino acid polymorphisms of human electron transfer flavoprotein (alpha-T/I171 in the alpha-subunit and beta-M/T154 in the beta-subunit) on the thermal stability of the enzyme are described. The alpha-T171 variant displayed a significantly decreased thermal stability, wher....... This is compatible with a negative modulating effect of the less-stable alpha-T171 ETF variant in this group of VLCAD patients that harbor missense mutations in at least one allele and therefore potentially display residual levels of VLCAD enzyme activity. Udgivelsesdato: 1999-Jun...

  8. Growth suppression of colorectal cancer by plant-derived multiple mAb CO17-1A × BR55 via inhibition of ERK1/2 phosphorylation.

    Science.gov (United States)

    Kwak, Dong Hoon; Moussavou, Ghislain; Lee, Ju Hyoung; Heo, Sung Youn; Ko, Kisung; Hwang, Kyung-A; Jekal, Seung-Joo; Choo, Young-Kug

    2014-11-14

    We have generated the transgenic Tabaco plants expressing multiple monoclonal antibody (mAb) CO7-1A × BR55 by cross-pollinating with mAb CO17-1A and mAb BR55. We have demonstrated the anti-cancer effect of plant-derived multiple mAb CO17-1A × BR55. We find that co-treatment of colorectal mAbs (anti-epithelial cellular adhesion molecule (EpCAM), plant-derived monoclonal antibody (mAb(P)) CO17-1A and mAb(P) CO17-1A × BR55) with RAW264.7 cells significantly inhibited the cell growth in SW620 cancer cells. In particular, multi mAb(P) CO17-1A × BR55 significantly and efficiently suppressed the growth of SW620 cancer cells compared to another mAbs. Apoptotic death-positive cells were significantly increased in the mAb(P) CO17-1A × BR55-treated. The mAb(P) CO17-1A × BR55 treatment significantly decreased the expression of B-Cell lymphoma-2 (BCl-2), but the expression of Bcl-2-associated X protein (Bax), and cleaved caspase-3 were markedly increased. In vivo, the mAb(P) CO17-1A × BR55 significantly and efficiently inhibited the growth of colon tumors compared to another mAbs. The apoptotic cell death and inhibition of pro-apoptotic proteins expression were highest by treatment with mAb(P) CO17-1A × BR55. In addition, the mAb(P) CO17-1A × BR55 significantly inhibited the extracellular signal-regulated kinase 1 and 2 (ERK1/2) phosphorylation in cancer cells and tumors. Therefore, this study results suggest that multiple mAb(P) CO17-1A × BR55 has a significant effect on apoptosis-mediated anticancer by suppression of ERK1/2 phosphorylation in colon cancer compared to another mAbs. In light of these results, further clinical investigation should be conducted on mAb(P) CO17-1A × BR55 to determine its possible chemopreventive and/or therapeutic efficacy against human colon cancer.

  9. Arabidopsis miR171-Targeted Scarecrow-Like Proteins Bind to GT cis-Elements and Mediate Gibberellin-Regulated Chlorophyll Biosynthesis under Light Conditions

    Science.gov (United States)

    Ma, Zhaoxue; Hu, Xupeng; Cai, Wenjuan; Huang, Weihua; Zhou, Xin; Luo, Qian; Yang, Hongquan; Wang, Jiawei; Huang, Jirong

    2014-01-01

    An extraordinarily precise regulation of chlorophyll biosynthesis is essential for plant growth and development. However, our knowledge on the complex regulatory mechanisms of chlorophyll biosynthesis is very limited. Previous studies have demonstrated that miR171-targeted scarecrow-like proteins (SCL6/22/27) negatively regulate chlorophyll biosynthesis via an unknown mechanism. Here we showed that SCLs inhibit the expression of the key gene encoding protochlorophyllide oxidoreductase (POR) in light-grown plants, but have no significant effect on protochlorophyllide biosynthesis in etiolated seedlings. Histochemical analysis of β-glucuronidase (GUS) activity in transgenic plants expressing pSCL27::rSCL27-GUS revealed that SCL27-GUS accumulates at high levels and suppresses chlorophyll biosynthesis at the leaf basal proliferation region during leaf development. Transient gene expression assays showed that the promoter activity of PORC is indeed regulated by SCL27. Consistently, chromatin immunoprecipitation and quantitative PCR assays showed that SCL27 binds to the promoter region of PORC in vivo. An electrophoretic mobility shift assay revealed that SCL27 is directly interacted with G(A/G)(A/T)AA(A/T)GT cis-elements of the PORC promoter. Furthermore, genetic analysis showed that gibberellin (GA)-regulated chlorophyll biosynthesis is mediated, at least in part, by SCLs. We demonstrated that SCL27 interacts with DELLA proteins in vitro and in vivo by yeast-two-hybrid and coimmunoprecipitation analysis and found that their interaction reduces the binding activity of SCL27 to the PORC promoter. Additionally, we showed that SCL27 activates MIR171 gene expression, forming a feedback regulatory loop. Taken together, our data suggest that the miR171-SCL module is critical for mediating GA-DELLA signaling in the coordinate regulation of chlorophyll biosynthesis and leaf growth in light. PMID:25101599

  10. Gulf of Mexico OCS oil and gas lease sales 171, 174, 177, and 180 - Western Planning Area. Final environmental impact statement

    International Nuclear Information System (INIS)

    1998-05-01

    The Minerals Management Service proposes to hold annual oil and gas lease sales in the Western Planning Area (WPA) of the Gulf of Mexico Outer Continental Shelf (OCS). The proposed actions are the Western Gulf sales scheduled in the Outer Continental Shelf Oil and Gas Leasing Program: 1997-2002 (Sale 171 in 1998, Sale 174 in 1999, Sale 177 in 2000, and Sale 180 in 2001). This environmental impact statement (EIS) serves as a decision document for proposed Sale 171. This document includes the purpose and background of the proposed actions, identification of the alternatives, description of the affected environment, and an analysis of the potential environmental impacts of the proposed actions, alternatives, and associated activities, including proposed mitigating measures and their potential effects. Potential contributions to cumulative impacts resulting from activities associated with the proposed actions are also analyzed. Each of the proposed actions will offer for lease all unleased blocks in the Western Planning Area of the Gulf of Mexico OCS, with the exclusion of the East and West Flower Garden Banks (Blocks A-375 and A-398 in the High Island Area, East Addition, South Extension) and three blocks used for Naval mine warfare testing and training (Blocks 793, 799, and 816 in the Mustang Island Area). Additionally, discussions between the United States and Mexico regarding tracts beyond the U.S. Exclusive Economic Zone are ongoing and may result in the deferral of those tracts for Sale 171 (approximately 277 tracts) in the open-quotes Northern Portion of the Western Gapclose quotes (Figure 1-1). Additional copies of this EIS and the referenced visuals may be obtained from the MMS, Gulf of Mexico OCS Region, Public Information Office (MS 5034), 1201 Elmwood Park Boulevard, New Orleans, Louisiana 70123-2394, or by telephone at I-800-200-GULF

  11. Measurement of the radiative capture cross section of the s-process branching points 204Tl and 171Tm at the n_TOF facility (CERN)

    Science.gov (United States)

    Casanovas, A.; Domingo-Pardo, C.; Guerrero, C.; Lerendegui-Marco, J.; Calviño, F.; Tarifeño-Saldivia, A.; Dressler, R.; Heinitz, S.; Kivel, N.; Quesada, J. M.; Schumann, D.; Aberle, O.; Alcayne, V.; Andrzejewski, J.; Audouin, L.; Bécares, V.; Bacak, M.; Barbagallo, M.; Bečvář, F.; Bellia, G.; Berthoumieux, E.; Billowes, J.; Bosnar, D.; Brown, A.; Busso, M.; Caamaño, M.; Caballero-Ontanaya, L.; Calviani, M.; Cano-Ott, D.; Cerutti, F.; Chen, Y. H.; Chiaveri, E.; Colonna, N.; Cortés, G.; Cortés-Giraldo, M. A.; Cosentino, L.; Cristallo, S.; Damone, L. A.; Diakaki, M.; Dietz, M.; Dupont, E.; Durán, I.; Eleme, Z.; Fernández-Domínguez, B.; Ferrari, A.; Ferreira, P.; Finocchiaro, P.; Furman, V.; Göbel, K.; Gawlik, A.; Gilardoni, S.; Glodariu, T.; Gonçalves, I. F.; González-Romero, E.; Gunsing, F.; Heyse, J.; Jenkins, D. G.; Käppeler, F.; Kadi, Y.; Katabuchi, T.; Kimura, A.; Kokkoris, M.; Kopatch, Y.; Krtička, M.; Kurtulgil, D.; Ladarescu, I.; Lederer-Woods, C.; Meo, S. Lo; Lonsdale, S. J.; Macina, D.; Martínez, T.; Masi, A.; Massimi, C.; Mastinu, P.; Mastromarco, M.; Matteucci, F.; Maugeri, E. A.; Mazzone, A.; Mendoza, E.; Mengoni, A.; Michalopoulou, V.; Milazzo, P. M.; Mingrone, F.; Musumarra, A.; Negret, A.; Nolte, R.; Ogállar, F.; Oprea, A.; Patronis, N.; Pavlik, A.; Perkowski, J.; Persanti, L.; Porras, I.; Praena, J.; Radeck, D.; Ramos, D.; Rauscher, T.; Reifarth, R.; Rochman, D.; Sabaté-Gilarte, M.; Saxena, A.; Schillebeeckx, P.; Simone, S.; Smith, A. G.; Sosnin, N. V.; Stamatopoulos, A.; Tagliente, G.; Tain, J. L.; Talip, T.; Tassan-Got, L.; Tsinganis, A.; Ulrich, J.; Valenta, S.; Vannini, G.; Variale, V.; Vaz, P.; Ventura, A.; Vlachoudis, V.; Vlastou, R.; Wallner, A.; Woods, P. J.; Wright, T.; Žugec, P.; Köster, U.

    2018-05-01

    The neutron capture cross section of some unstable nuclei is especially relevant for s-process nucleosynthesis studies. This magnitude is crucial to determine the local abundance pattern, which can yield valuable information of the s-process stellar environment. In this work we describe the neutron capture (n,γ) measurement on two of these nuclei of interest, 204Tl and 171Tm, from target production to the final measurement, performed successfully at the n_TOF facility at CERN in 2014 and 2015. Preliminary results on the ongoing experimental data analysis will also be shown. These results include the first ever experimental observation of capture resonances for these two nuclei.

  12. The role of short-range Cys171-Cys178 disulfide bond in maintaining cutinase active site integrity: A molecular dynamics simulation

    International Nuclear Information System (INIS)

    Matak, Mehdi Youssefi; Moghaddam, Majid Erfani

    2009-01-01

    Understanding structural determinants in enzyme active site integrity can provide a good knowledge to design efficient novel catalytic machineries. Fusarium solani pisi cutinase with classic triad Ser-His-Asp is a promising enzyme to scrutinize these structural determinants. We performed two MD simulations: one, with the native structure, and the other with the broken Cys171-Cys178 disulfide bond. This disulfide bond stabilizes a turn in active site on which catalytic Asp175 is located. Functionally important H-bonds and atomic fluctuations in catalytic pocket have been changed. We proposed that this disulfide bond within active site can be considered as an important determinant of cutinase active site structural integrity.

  13. Generic Safety Issue (GSI) 171 -- Engineered Safety Feature (ESF) failure from a loop subsequent to LOCA: Assessment of plant vulnerability and CDF contributions

    International Nuclear Information System (INIS)

    Martinez-Guridi, G.; Samanta, P.; Chu, L.; Yang, J.

    1998-01-01

    Generic Safety Issue 171 (GSI-171), Engineered Safety Feature (ESF) from a Loss Of Offsite Power (LOOP) subsequent to a Loss Of Coolant Accident (LOCA), deals with an accident sequence in which a LOCA is followed by a LOOP. This issue was later broadened to include a LOOP followed by a LOCA. Plants are designed to handle a simultaneous LOCA and LOOP. In this paper, the authors address the unique issues that are involved i LOCA with delayed LOOP (LOCA/LOOP) and LOOP with delayed LOCA (LOOP/LOCA) accident sequences. LOCA/LOOP accidents are analyzed further by developing event-tree/fault-tree models to quantify their contributions to core-damage frequency (CDF) in a pressurized water reactor and a boiling water reactor (PWR and a BWR). Engineering evaluation and judgments are used during quantification to estimate the unique conditions that arise in a LOCA/LOOP accident. The results show that the CDF contribution of such an accident can be a dominant contributor to plant risk, although BWRs are less vulnerable than PWRs

  14. Mutation of Asp(171) and Asp(262) of the chemokine receptor CXCR4 impairs its coreceptor function for human immunodeficiency virus-1 entry and abrogates the antagonistic activity of AMD3100

    DEFF Research Database (Denmark)

    Hatse, S; Princen, K; Gerlach, L O

    2001-01-01

    by mutational analysis. We established a set of stably transfected U87.CD4 cell lines expressing different mutant forms of CXCR4 (i.e., CXCR4[WT], CXCR4[D171N], CXCR4[D262N], CXCR4[D171N,D262N], and CXCR4[H281A]), to compare the activity of the compound against mutated versus wild-type CXCR4. We found...... by substitution of Asp(171) and/or Asp(262) by neutral asparagine residue(s). Both aspartates, but most particularly Asp(262), also proved essential for the anti-HIV-1 activity of AMD3100 against the viruses NL4.3, IIIB, and HE. In contrast, substitution of His(281) by a neutral alanine potentiated...

  15. THE EFFECT OF DIFFERENT OPTIONS OF BLADES MAIN ROTOR ON THE X-SHAPED TAIL ROTOR OF THE MI-171 LL

    Directory of Open Access Journals (Sweden)

    Valery A. Ivchin

    2018-01-01

    Full Text Available This paper describes the effect of different rotor blades on the X-shaped tail rotor of the Mi-171 LL, observed conducting flight tests. The tests were carried out on the same helicopter in the similar atmospheric conditions.The objective of the tests was the comparison of flight performance of two sets of rotor blades of the helicopter Mi-171 LL. However, materials test revealed a difference in the angles of the tail rotor at different MRs with the same takeoff weight.The authors are grateful to I.G. Peskov, S.R. Zamula and A.I. Orlov for assistance in carrying out this work and the preparation of this article.Noted that the helicopter takeoff weight when hovering out of ground effect in ISA with blades from polymer composite materials (PCM exceeds the takeoff weight of the helicopter with the serial blades in the nominal mode of the engine operation at ~ 750kg, in the takeoff mode at ~ 700kg.Knowing the altitude and climatic characteristics of the engine, the obtained dependence allows to determine the balancing value of jрв on hovering at different combinations of pressure altitude and outside air temperature for a given speed of the main rotor (MR.It follows from the work that when the same value Nпр(95/nнвпр3 or Nfact the balancing values of jрв for the helicopter with the main rotor blades from the PCM is less than for the helicopters with serial blades by 0.5…0.9°. The difference in the angles of the tail rotor increases with growing of Nепр(95/nнвпр3 (Nfact. Perhaps this is caused by different induction effect of the main rotor on the tail rotor to the MR from PCM and the serial ones.As follows from the materials, the thrust of the main rotor with blades from PCM with the same engine power is more in comparison with the serial blades. Consequently inductive speeds of the main rotor are more and the angles of the tail rotor are less. It can be assumed that a large induced velocity of the main rotor increases the thrust

  16. Thermal safety characterization on PETN, PBX-9407, LX-10-2, LX-17-1 and detonator in the LLNL's P-ODTX system

    Energy Technology Data Exchange (ETDEWEB)

    Hsu, P. C. [Lawrence Livermore National Lab. (LLNL), Livermore, CA (United States); Strout, S. [Lawrence Livermore National Lab. (LLNL), Livermore, CA (United States); Reynolds, J. G. [Lawrence Livermore National Lab. (LLNL), Livermore, CA (United States); Kahl, E. [Lawrence Livermore National Lab. (LLNL), Livermore, CA (United States); Ellsworth, F. [Lawrence Livermore National Lab. (LLNL), Livermore, CA (United States); Healy, T. [Lawrence Livermore National Lab. (LLNL), Livermore, CA (United States)

    2017-09-21

    Incidents caused by fire and other thermal events can heat energetic materials that may lead to thermal explosion and result in structural damage and casualty. Thus, it is important to understand the response of energetic materials to thermal insults. The One-Dimensional-Time to Explosion (ODTX) system at the Lawrence Livermore National Laboratory (LLNL) has been used for decades to characterize thermal safety of energetic materials. In this study, an integration of a pressure monitoring element has been added into the ODTX system (P-ODTX) to perform thermal explosion (cook-off) experiments (thermal runaway) on PETN powder, PBX-9407, LX-10-2, LX-17-1, and detonator samples (cup tests). The P-ODTX testing generates useful data (thermal explosion temperature, thermal explosion time, and gas pressures) to assist with the thermal safety assessment of relevant energetic materials and components. This report summarizes the results of P-ODTX experiments that were performed from May 2015 to July 2017. Recent upgrades to the data acquisition system allows for rapid pressure monitoring in microsecond intervals during thermal explosion. These pressure data are also included in the report.

  17. Synthesis and characterization of phosphors based on calcium and magnesium silicates doped with europium and dysprosium; Síntese e caracterização de fósforos a base de silicatos de cálcio e magnésio dopados com európio e disprósio

    Energy Technology Data Exchange (ETDEWEB)

    Misso, Agatha Matos

    2016-07-01

    Ca and Mg silicates based phosphors were prepared by sol-gel method combined with the molten salts process. The gel of silica was obtained from Na{sub 2}SiO{sub 3} solution by using europium, dysprosium, calcium and magnesium chloride solutions. Therefore, those chlorides were homogeneously dispersed into the gel. The obtained gel was dried and heat treated to 900° C for 1h to allow the fusion of the present salts. Then it was water washed until negative test for Cl{sup -}, and dried. The reduction of the europium to Eu{sup 2+} was performed under atmosphere of 5% of H{sub 2} and 95% of Ar to 900° C for 3h, to reach CaMgSi{sub 2}O{sub 6}:Eu{sup 2+} and CaMgSi{sub 2}O{sub 6}:Eu{sup 2+}:Dy{sup 3+} phosphors. Diopside was identified as main crystalline phase and quartz, as secondary phase from XRD (X-ray diffraction) patterns. SEM (scanning electron microscopy) micrographs, of the samples showed needles, spheres, leaves and rods of particles and agglomerates. Thermal analysis (TGA-DTGA) curves revealed that the crystallization temperature of CaMgSi{sub 2}O{sub 6}:Eu{sup 2+} lies around 765° C. Photoluminescence spectroscopy of the phosphors was studied based on interconfigurational 4f{sup N} → 4f{sup N-1} 5d transition of Eu{sup 2+} ion. The spectra of excitation showed 4f{sup N} → 4f{sup N-1} 5d transition of Eu{sup 2+} ion broad band, related to the ligand to metal charge transfer transition (LMCT) O{sup 2-} (2p) → Eu{sup 3+} in the 250 nm region, when the emission is monitored at 583,5 nm. It also presents the 4f ↔ 4f transitions of Eu{sup 3+} ion bands, showing the {sup 7}F{sub 0} → {sup 5}L{sub 6} transition at 393 nm. From emission spectra with excitation monitored at 393 nm, it can be observed fine peaks between 570 and 750 nm which are characteristics of {sup 5}D{sub 0} → {sup 7}F{sub J} (J = 0 - 5) transition of Eu{sup 3+} ion, indicating that the Eu{sup 3+} ion occupies a site with center of inversion. Finally, the obtained results indicate

  18. Multi-residue determination of 171 pesticides in cowpea using modified QuEChERS method with multi-walled carbon nanotubes as reversed-dispersive solid-phase extraction materials.

    Science.gov (United States)

    Han, Yongtao; Song, Le; Zou, Nan; Chen, Ronghua; Qin, Yuhong; Pan, Canping

    2016-09-15

    A rapid and sensitive method for the determination of 171 pesticides in cowpea was developed using multi-walled carbon nanotubes (MWCNTs) as reversed-dispersive solid-phase (r-DSPE) extraction materials. The clean-up performance of MWCNTs was proved to be obviously superior to PSA and GCB. This method was validated on cowpea spiked at 0.01 and 0.1mgkg(-1) with five replicates. The mean recoveries for 169 pesticides ranged from 74% to 129% with relative standard deviations (RSDs) (n=5) lower than 16.4%, except diflufenican and quizalofop-ethyl. Good linearity for all pesticides was obtained with the calibration curve coefficients (R(2)) larger than 0.9970. The limit of detection (LODs) and limit of quantification (LOQs) for the 171 pesticides ranged from 0.001 to 0.003mgkg(-1) and from 0.002 to 0.009mgkg(-1), respectively. The method was demonstrated to be reliable and sensitive for the routine monitoring of the 171 pesticides in cowpea samples. Copyright © 2016 Elsevier B.V. All rights reserved.

  19. Photodissociation spectroscopy of the dysprosium monochloride molecular ion

    Energy Technology Data Exchange (ETDEWEB)

    Dunning, Alexander, E-mail: alexander.dunning@gmail.com; Schowalter, Steven J.; Puri, Prateek; Hudson, Eric R. [Department of Physics and Astronomy, University of California, Los Angeles, California 90095 (United States); Petrov, Alexander; Kotochigova, Svetlana [Department of Physics, Temple University, Philadelphia, Pennsylvania 19122 (United States)

    2015-09-28

    We have performed a combined experimental and theoretical study of the photodissociation cross section of the molecular ion DyCl{sup +}. The photodissociation cross section for the photon energy range 35 500 cm{sup −1} to 47 500 cm{sup −1} is measured using an integrated ion trap and time-of-flight mass spectrometer; we observe a broad, asymmetric profile that is peaked near 43 000 cm{sup −1}. The theoretical cross section is determined from electronic potentials and transition dipole moments calculated using the relativistic configuration-interaction valence-bond and coupled-cluster methods. The electronic structure of DyCl{sup +} is extremely complex due to the presence of multiple open electronic shells, including the 4f{sup 10} configuration. The molecule has nine attractive potentials with ionically bonded electrons and 99 repulsive potentials dissociating to a ground state Dy{sup +} ion and Cl atom. We explain the lack of symmetry in the cross section as due to multiple contributions from one-electron-dominated transitions between the vibrational ground state and several resolved repulsive excited states.

  20. Influence of dysprosium addition on the structural, morphological ...

    Indian Academy of Sciences (India)

    Microwave absorption properties of hexaferrite (70 wt%)–acrylic resin. (30 wt%) composites ... the RE ions were substituted for Sr (Ba) or Fe, taking into accounts the .... general the RE substitutions weaken the super exchange interactions ...

  1. Single molecule magnet behaviour in robust dysprosium-biradical complexes.

    Science.gov (United States)

    Bernot, Kevin; Pointillart, Fabrice; Rosa, Patrick; Etienne, Mael; Sessoli, Roberta; Gatteschi, Dante

    2010-09-21

    A Dy-biradical complex was synthesized and characterized down to very low temperature. ac magnetic measurements reveal single molecule magnet behaviour visible without any application of dc field. The transition to the quantum tunneling regime is evidenced. Photophysical and EPR measurements provide evidence of the excellent stability of these complexes in solution.

  2. Scissors Mode of Dipolar Quantum Droplets of Dysprosium Atoms

    Science.gov (United States)

    Ferrier-Barbut, Igor; Wenzel, Matthias; Böttcher, Fabian; Langen, Tim; Isoard, Mathieu; Stringari, Sandro; Pfau, Tilman

    2018-04-01

    We report on the observation of the scissors mode of a single dipolar quantum droplet. The existence of this mode is due to the breaking of the rotational symmetry by the dipole-dipole interaction, which is fixed along an external homogeneous magnetic field. By modulating the orientation of this magnetic field, we introduce a new spectroscopic technique for studying dipolar quantum droplets. This provides a precise probe for interactions in the system, allowing us to extract a background scattering length for 164Dy of 69 (4 )a0 . Our results establish an analogy between quantum droplets and atomic nuclei, where the existence of the scissors mode is also only due to internal interactions. They further open the possibility to explore physics beyond the available theoretical models for strongly dipolar quantum gases.

  3. Calorimetric investigation of an yttrium-dysprosium spin glass

    International Nuclear Information System (INIS)

    Wenger, L.E.

    1978-01-01

    In an effort to compare the spin glass characteristics of yttrium--rare earth alloys with those of the noble-metal spin glasses, the susceptibility and heat capacity of Y/sub 0.98/Dy/sub 0.02/ have been measured in the temperature range 2.5--40 K. The low-field ac susceptibility measurement shows the characteristic cusp-like peak at 7.64 K. The magnetic specific heat of the same sample shows a peak at 7.0 K and may be qualitatively described as a semi-cusp. The magnetic entropy change from absolute zero to 7 K is approximately 0.52 of cR ln(2J+1). These results are qualitatively different than previous calorimetric results on the archetypal spin glasses, AuFe and CuMn, where rounded maxima are observed at temperatures above the spin glass transition temperatures

  4. Emission spectra of yttrium vanadate doped with bismuth and dysprosium

    International Nuclear Information System (INIS)

    Pawar, B.V.; Patil, R.N.

    1975-01-01

    The fluorescence spectra of YVO 4 :Bi and YVO 4 :Bi:Dy phosphors under X-rays and ultra-violet radiation have been studied. The observations on the phosphors with constant Bi 3+ and varying Dy 3+ concentration can be attributed to radiationless transfer of energy from Bi 3+ to Dy 3+ coupled with non-radiative losses due to self-quenching at higher level of Dy 3+ concentration. While the observations on the phosphors with constant Dy 3+ and varying Bi 3+ concentration indicate that there is radiationless transfer from Bi 3+ to Dy 3+ under X-ray or UV irradiation. (author)

  5. Dysprosium-free melt-spun permanent magnets

    International Nuclear Information System (INIS)

    Brown, D N; Wu, Z; He, F; Miller, D J; Herchenroeder, J W

    2014-01-01

    Melt-spun NdFeB powders can be formed into a number of different types of permanent magnet for a variety of applications in electronics, automotive and clean technology industries. The melt-spinning process produces flake powder with a fine uniform array of nanoscale Nd 2 Fe 14 B grains. These powders can be net-shape formed into isotropic polymer-bonded magnets or hot formed into fully dense magnets. This paper discusses the influence of heavy rare earth elements and microstructure on the magnetic performance, thermal stability and material cost of NdFeB magnets. Evidence indicates that melt-spun nanocrystalline NdFeB magnets are less dependent on heavy rare earth elements for high-temperature performance than the alternative coarser-grained sintered NdFeB magnets. In particular, hot-pressed melt-spun magnets are an attractive low-cost solution for applications that require thermal stability up to 175–200 °C. (paper)

  6. Dysprosium-free melt-spun permanent magnets.

    Science.gov (United States)

    Brown, D N; Wu, Z; He, F; Miller, D J; Herchenroeder, J W

    2014-02-12

    Melt-spun NdFeB powders can be formed into a number of different types of permanent magnet for a variety of applications in electronics, automotive and clean technology industries. The melt-spinning process produces flake powder with a fine uniform array of nanoscale Nd2Fe14B grains. These powders can be net-shape formed into isotropic polymer-bonded magnets or hot formed into fully dense magnets. This paper discusses the influence of heavy rare earth elements and microstructure on the magnetic performance, thermal stability and material cost of NdFeB magnets. Evidence indicates that melt-spun nanocrystalline NdFeB magnets are less dependent on heavy rare earth elements for high-temperature performance than the alternative coarser-grained sintered NdFeB magnets. In particular, hot-pressed melt-spun magnets are an attractive low-cost solution for applications that require thermal stability up to 175-200 °C.

  7. Crystal and molecular structure of dysprosium (3) n-aminobenzoate

    International Nuclear Information System (INIS)

    Khiyalov, M.S.; Amiraslanov, I.R.; Mamedov, Kh.S.; Movsumov, Eh.M.

    1981-01-01

    The X ray diffraction investigation of the Dy(NH 2 C 6 H 4 COO) 3 x3H 2 O complex is carried out. Triclinic crystals have lattice parameters α=11.095(15), b=9.099(17), c=12.780 (15)A, α=108.051(12), β=89.072(10); γ=104.954(12) 0 , space group P anti 1, Z=2. The structure consists of dimer molecules. The third water molecule in the formula is an outer spherical one. The average lengths of Dy-O and Dy-OH 2 are 2.39 and 2.40 A respectively, the average value of Dy-O in bridge carboxylates (2.26A) is remarkably shorter. Hydrogen bonds between amine ligand ends, carboxylic groups oxygen and water molecules bind complex molecules into the three-dimensional frame [ru

  8. Microscopic study of neutron-rich dysprosium isotopes

    International Nuclear Information System (INIS)

    Vargas, Carlos E.; Velazquez, Victor; Lerma, Sergio

    2013-01-01

    Microscopic studies in heavy nuclei are very scarce due to large valence spaces involved. This computational problem can be avoided by means of the use of symmetry-based models. Ground-state, γ and β bands, and their B(E2) transition strengths in 160-168 Dy isotopes, are studied in the framework of the pseudo-SU(3) model which includes the preserving symmetry Q . Q term and the symmetry-breaking Nilsson and pairing terms, systematically parametrized. Additionally, three rotor-like terms are considered, whose free parameters, fixed for all members of the chain, are used to fine tune the moment of inertia of rotational bands and the band head of γ and β bands. The model succesfully describes in a systematic way rotational features in these nuclei and allows to extrapolate toward the midshell nucleus 170 Dy. The results presented show that it is possible to study a full chain of isotopes or isotones in the region with the present model. (orig.)

  9. Microscopic study of neutron-rich dysprosium isotopes

    Energy Technology Data Exchange (ETDEWEB)

    Vargas, Carlos E. [Universidad Veracruzana, Facultad de Fisica e Inteligencia Artificial, Xalapa (Mexico); Universidad Nacional Autonoma de Mexico, Facultad de Ciencias, Apartado Postal 70-542, Mexico D.F. (Mexico); Velazquez, Victor [Universidad Nacional Autonoma de Mexico, Facultad de Ciencias, Apartado Postal 70-542, Mexico D.F. (Mexico); Lerma, Sergio [Universidad Veracruzana, Facultad de Fisica e Inteligencia Artificial, Xalapa (Mexico)

    2013-01-15

    Microscopic studies in heavy nuclei are very scarce due to large valence spaces involved. This computational problem can be avoided by means of the use of symmetry-based models. Ground-state, {gamma} and {beta} bands, and their B(E2) transition strengths in {sup 160-168}Dy isotopes, are studied in the framework of the pseudo-SU(3) model which includes the preserving symmetry Q . Q term and the symmetry-breaking Nilsson and pairing terms, systematically parametrized. Additionally, three rotor-like terms are considered, whose free parameters, fixed for all members of the chain, are used to fine tune the moment of inertia of rotational bands and the band head of {gamma} and {beta} bands. The model succesfully describes in a systematic way rotational features in these nuclei and allows to extrapolate toward the midshell nucleus {sup 170}Dy. The results presented show that it is possible to study a full chain of isotopes or isotones in the region with the present model. (orig.)

  10. Structural and magnetic study of dysprosium substituted cobalt ferrite nanoparticles

    Energy Technology Data Exchange (ETDEWEB)

    Kumar, Hemaunt, E-mail: hvatsal@gmail.com [Department of Physics, Govind Ballabh Pant University of Agr. & Technology, Pantnagar, Uttarakhand 263145 (India); Srivastava, R.C. [Department of Physics, Govind Ballabh Pant University of Agr. & Technology, Pantnagar, Uttarakhand 263145 (India); Pal Singh, Jitendra [Advanced Analysis Centre, Korea Institute of Science and Technology, Seoul 02792 (Korea, Republic of); Negi, P. [Department of Physics, Govind Ballabh Pant University of Agr. & Technology, Pantnagar, Uttarakhand 263145 (India); Agrawal, H.M. [Advanced Analysis Centre, Korea Institute of Science and Technology, Seoul 02792 (Korea, Republic of); Das, D. [UGC-DAE CSR Kolkata Centre, Kolkata 700098 (India); Hwa Chae, Keun [Advanced Analysis Centre, Korea Institute of Science and Technology, Seoul 02792 (Korea, Republic of)

    2016-03-01

    The present work investigates the magnetic behavior of Dy{sup 3+} substituted cobalt ferrite nanoparticles. X-ray diffraction studies reveal presence of cubic spinel phases in these nanoparticles. Raman spectra of these nanoparticles show change in intensity of Raman bands, which reflects cation redistribution in cubic spinel lattice. Saturation magnetization and coercivity decrease with increase of Dy{sup 3+}concentration in these nanoparticles. Room temperature Mössbauer measurements show the cation redistribution in these nanoparticles and corroborates the results obtained from Raman Spectroscopic measurements. Decrease in magnetization of Dy{sup 3+} substituted cobalt ferrite is attributed to the reduction in the magnetic interaction and cation redistribution. - Highlights: • Slight decrease in crystallite size after Dy{sup 3+} doping. • Saturation magnetization and coercivity decrease after Dy{sup 3+} doping. • Mössbauer measurements show the cation redistribution in the samples.

  11. Dysprosium Acetylacetonato Single-Molecule Magnet Encapsulated in Carbon Nanotubes

    Directory of Open Access Journals (Sweden)

    Ryo Nakanishi

    2016-12-01

    Full Text Available Dy single-molecule magnets (SMMs, which have several potential uses in a variety of applications, such as quantum computing, were encapsulated in multi-walled carbon nanotubes (MWCNTs by using a capillary method. Encapsulation was confirmed by using transmission electron microscopy (TEM. In alternating current magnetic measurements, the magnetic susceptibilities of the Dy acetylacetonato complexes showed clear frequency dependence even inside the MWCNTs, meaning that this hybrid can be used as magnetic materials in devices.

  12. Etiologies et pronostic des occlusions intestinales aigues mécaniques à l’Hôpital National de Zinder: étude transversale sur 171 patients

    Science.gov (United States)

    Adamou, Harissou; Magagi, Ibrahim Amadou; Habou, Oumarou; Magagi, Amadou; Maazou, Halidou; Adamou, Mansour; Harouna, Yacouba

    2016-01-01

    L’occlusion intestinale aigue (OIA) mécanique, représente l’une des pathologies les plus fréquentes en chirurgie digestive d’urgence. L’objectif de cette étude était de décrire les aspects étiologiques et pronostiques des occlusions intestinales aigues mécaniques à l’Hôpital National de Zinder (HNZ), Niger. Il s’agissait d’une étude transversale sur 24 mois (Janvier 2013 à Décembre 2014) ayant inclus tous les patients opérés pour OIA. Les occlusions intestinales mécaniques représentaient 24,50% (n=171) des urgences chirurgicales digestives (n=622). L’âge médian était à 25 ans (extrêmes: 1 jour et 95 ans). Le sexe ratio était à 3,5 en faveur des hommes. Les enfants représentaient 38,60% (n=66). Le siège de l’obstacle était sur le grêle dans 60,82% (n=104), colique dans 21,63%(n=37) et mixte dans 17,54% (n=30). Le mécanisme par strangulation constituait 88,89% (n=152) dont les hernies étranglées avec 49,70% (n=85) et les invaginations intestinales aigues avec 19,88% (n=34) des patients. Les malformations ano-rectales et les tumeurs constituaient les principales étiologies par obstruction avec respectivement 7,02% (n=12) et 3,51% (n=6). Une résection intestinale était faite dans 52 cas (30,41%). Les complications septiques prédominaient (n=39/53), dont la suppuration pariétale (n=23). Le séjour moyen était de 7,82 jours. La mortalité globale était 11,70% (n=20). Celle-ci était corrélée statistiquement à la nécrose intestinale (p=0,01) et au retard d’admission (p=0,04). Les étiologies des OIA sont multiples et dominées par les hernies étranglées. La morbi-mortalité élevée qu’elles entrainent pourrait être évitée par la prise en charge précoce avant l’installation d’une nécrose intestinale. PMID:27800103

  13. Fractionated or single-dose total body irradiation in 171 acute myeloblastic leukemias in first complete remission: is there a best choice?

    International Nuclear Information System (INIS)

    Resbeut, Michel; Cowen, Didier; Blaise, Didier; Gluckman, Eliane; Cosset, Jean-Marc; Rio, Bernard; Pene, Francoise; Milpied, Nicolas; Cuillere, Jean-Claude; Reiffers, Josy; Richaud, Pierre

    1995-01-01

    Purpose: To evaluate the importance of fractionating total body irradiation (TBI) in patients receiving an allogenic bone marrow transplant (BMT) for an acute myeloblastic leukemia (AML) in first complete remission (CR1). Methods and Materials: Between 1983 and 1990, 171 consecutive patients received either single dose TBI (STBI) (n = 65) or fractionated TBI (FTBI) (n = 106) after being conditioned with cyclophosphamide and before receiving a non-T-depleted Human Leucocyte Antigen (HLA)-identical marrow. Both groups were comparable except for date of BMT and diagnosis-to-BMT interval (D-BMT). Results: After 63 months median follow-up, transplant-related mortality (TRM), probability of relapse, and 5-year disease-free survival (DFS) were 0.38 and 0.27 (p = 0.04), 0.29 and 0.26 (p = 0.22), 0.43 and 0.56 (p = 0.06), respectively, for STBI and FTBI. The supposed influence of the schedule of TBI disappeared in the multivariate analysis: TRM was enhanced by severe acute graft vs. host disease (p = 0.0002), early years of transplant (before January 1, 1987) (p = 0.0003), and longer D-BMT intervals (p = 0.038). Relapse was linked to early years of transplant (p < 0.00001), and the absence of chronic GVHD (p = 0.007). Longer DFSs were observed for later years of transplant (after January 1, 1987 and later) (p = 0.001), milder acute GVHD (p = 0.005), and shorter D-BMT intervals (p = 0.045). Important improvements of the results were made during the 7-year observation period: TRM, probability of relapse, and DFS were, respectively, 0.36, 0.28, and 0.46 for patients transplanted before January 1, 1987 vs. 0.21, 0.15, and 0.67 after that date. Conclusion: Our data strongly suggest that allogenic BMT is the best postremission treatment for AML in CR1, and the results are better when BMT shortly follows the achievement of remission. The schedule of TBI was of little importance compared with the improvements made in the management of patients undergoing BMT during the 1980s, and

  14. Reflexiones sobre el Real Decreto español 171/2007, de 9 de febrero, por el que se regula la publicidad de los protocolos familiares en las sociedades familiares

    Directory of Open Access Journals (Sweden)

    María Angustias Díaz Gómez

    2011-06-01

    Full Text Available El objeto de este trabajo es analizar el Protocolo Familiar, estudiando su concepto, naturaleza jurídica y eficacia, su contenido, publicidad y desarrollo. El protocolo familiar es un instrumento jurídico que pretende organizar la relación entre la familia y la empresa, separando ambas realidades y, especialmente, trata de planificar adecuadamente la sucesión de la empresa familiar. Se trata de reflexionar sobre el Real Decreto español 171/2007, de 9 de febrero, por el que se regula la publicidad de los protocolos familiares en las Sociedades Familiares.The object of this work is to analyze the Family Protocol, studying his concept, juridical nature and effectiveness, his content, advertising and development. The family protocol is a legal instrument that, intends to organize the interaction between a family and their family-owned business, separating both realities and, specially, it tries to plan adequately the succession of the family business. It is a question of thinking about the Spanish Royal decree 171/2007, of February 9rd, by which there is regulated the advertising of the family protocols in the Familiar Companies.

  15. 21 CFR 171.1 - Petitions.

    Science.gov (United States)

    2010-04-01

    ... AND DRUG ADMINISTRATION, DEPARTMENT OF HEALTH AND HUMAN SERVICES (CONTINUED) FOOD FOR HUMAN... Office of Food Additive Safety (HFS-200), Center for Food Safety and Applied Nutrition, Food and Drug... formulas. (3) All correspondence and written summaries of oral discussions relating to a food additive...

  16. 22 CFR 171.11 - Definitions.

    Science.gov (United States)

    2010-04-01

    ... Privacy Act, E.O. 12958, and the Ethics in Government Act; (e) Record means all information under the... when they can qualify as disseminators of “news”) who make their products available for purchase by the...

  17. 22 CFR 171.20 - Definitions.

    Science.gov (United States)

    2010-04-01

    ... against unauthorized disclosure and is marked to indicate its classified status when in documentary form... documentary material, regardless of its physical form or characteristics that is owned by, produced by or for... Management. ...

  18. BDML Metadata: 171 [SSBD[Archive

    Lifescience Database Archive (English)

    Full Text Available NC-SA 0.180 ddc4bac7-2646-4717-a00a-4daff073490b 0.105 x 0.105 x 0.5 (micrometer), 40 (second) http://ssbd.qbic.riken.jp/data.../source/Ce_KK_P002/RNAi_R10E4.4_061107_01.zip http://ssbd.qbic.riken.jp/data.../bdml/Ce_KK_P002/RNAi_R10E4.4_061107_01.bdml0.18.xml http://ssbd.qbic.riken.jp/data/pdpml/Ce_KK_...P002.pdpml0.06.xml http://ssbd.qbic.riken.jp/search/ddc4bac7-2646-4717-a00a-4daff073490b/ http://ssbd.qbic.riken.jp/omero/webclient/?show=dataset-87 ...

  19. 40 CFR 763.171 - Labeling requirements.

    Science.gov (United States)

    2010-07-01

    ... plastic, paper, metal, or other durable substances. Labels must be attached in such a manner that they... Act (15 U.S.C. 2605) as of (insert effective date of ban on distribution in commerce). Distribution of...

  20. 76 FR 171 - Paper Clips From China

    Science.gov (United States)

    2011-01-03

    ... changes, if any, in the supply and demand conditions or business cycle for the Domestic Like Product that... disclosure of business proprietary information (BPI) under an administrative protective order (APO) and APO..., a U.S. or foreign trade or business association, or another interested party (including an...

  1. Publications | Page 171 | IDRC - International Development ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Through books, articles, research publications, and studies, we aim to widen the impact of ... Using Information and Communication Technologies (ICTs) for water ... involving natural, social, and health scientists, engineers, and economists.

  2. Publications | Page 171 | IDRC - International Development ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    We share the results of our funded research, and offer free training materials to guide ... impact on disadvantaged populations, resulting in poor access to quality. ... provide equal distribution of basic health service for people in isolated areas.

  3. 48 CFR 203.171-3 - Policy.

    Science.gov (United States)

    2010-10-01

    ... ethics counselor regarding the applicability of post-employment restrictions to activities that the... receiving compensation from the contractor, the post-employment ethics opinion described in paragraph (a) of... procurement, rescission of a contract, or initiation of suspension or debarment proceedings. [74 FR 2409, Jan...

  4. 22 CFR 171.36 - Exemptions.

    Science.gov (United States)

    2010-04-01

    ... evaluation material used solely to determine individual qualifications for employment or promotion and to avoid giving unfair advantage to individuals by virtue of their having access to such material. Foreign...

  5. 40 CFR 171.2 - Definitions.

    Science.gov (United States)

    2010-07-01

    ... pesticide applicator program in this part: (1) The term accident means an unexpected, undesirable event... pesticide which permits its use with other chemicals without undesirable results being caused by the... the act or process whereby the application of a pesticide is made by a competent person acting under...

  6. Gender | Page 171 | IDRC - International Development Research ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    As an engine of economic growth, private enterprise plays an important role in ... In helping developing countries pursue private sector development strategies that ... supported by IDRC is laying the groundwork for more inclusive growth.

  7. Search Results | Page 171 | IDRC - International Development ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Survey on the Use of Mobile Telephone for Micro and Small Business Development in ... (ICTs) have become key factors driving social and economic advancement. ... Microfinance and Information and Communication Technologies : HIVOS ...

  8. 171-IJBCS-Article-Dr Rene Bikomo

    African Journals Online (AJOL)

    Dr Gatsing

    étaient fermés par rabattement simple du bord d'ouverture ... (Tableau 1). Le macabo blanc a le moins perdu du poids, en comparaison de la réduction de poids considérable enregistrée sur le macabo rouge pendant la même phase. ... Tableau 1: Analyse de la variance de l'effet de la variété, du stade de maturité, de la.

  9. 49 CFR 171.7 - Reference material.

    Science.gov (United States)

    2010-10-01

    .../publications.com; AAR Manual of Standards and Recommended Practices, Section C—Part III, Specifications for... Edition, March 1996 172.102. American Pyrotechnics Association (APA), P.O. Box 30438, Bethesda, MD 20824, (301) 907-8181, www.americanpyro.com: APA Standard 87-1, Standard for Construction and Approval for...

  10. 14 CFR 171.9 - Installation requirements.

    Science.gov (United States)

    2010-01-01

    ...) The facility must be installed according to accepted good engineering practices, applicable electric... a power distribution system or locally generated, with a supplemental standby system, if needed. (c...

  11. 14 CFR 171.159 - Installation requirements.

    Science.gov (United States)

    2010-01-01

    ... Installation requirements. (a) The facility must be installed according to accepted good engineering practices... must have a reliable source of suitable primary power, either from a power distribution system or...

  12. 10 CFR 171.5 - Definitions.

    Science.gov (United States)

    2010-01-01

    ... self-supporting chain reaction. Operating license means having a license issued pursuant to § 50.57 of..., partnership, firm, association, trust, estate, public or private institution, group, Government agency other...

  13. 46 CFR 171.010 - Definitions.

    Science.gov (United States)

    2010-10-01

    ... tunnel. (e) Freeing port means any direct opening through the vessel's bulwark or hull to quickly drain... 600 nautical miles (1111 kilometers). (o) Scupper means a pipe or tube of at least 30 millimeters (1.25 inches) in diameter leading down from a deck or sole and through the hull to drain water overboard...

  14. Adsorption of dysprosium on the graphite (0001) surface: Nucleation and growth at 300 K

    International Nuclear Information System (INIS)

    Kwolek, Emma J.; Lii-Rosales, Ann; Lei, Huaping; Wang, Cai-Zhuang; Tringides, Michael C.; Evans, James W.; Wallingford, Mark; Zhou, Yinghui; Thiel, Patricia A.

    2016-01-01

    We have studied nucleation and growth of Dy islands on the basal plane of graphite at 300 K using scanning tunneling microscopy, density functional theory (DFT) in a form that includes van der Waals interactions, and analytic theory. The interaction of atomic Dy with graphite is strong, while the diffusion barrier is small. Experiment shows that at 300 K, the density of nucleated islands is close to the value predicted for homogeneous nucleation, using critical nucleus size of 1 and the DFT-derived diffusion barrier. Homogeneous nucleation is also supported by the monomodal shape of the island size distributions. Comparison with the published island density of Dy on graphene shows that the value is about two orders of magnitude smaller on graphite, which can be attributed to more effective charge screening in graphite. The base of each island is 3 atomic layers high and atomically ordered, forming a coincidence lattice with the graphite. Islands resist coalescence, probably due to multiple rotational orientations associated with the coincidence lattice. Upper levels grow as discernible single-atom layers. Analysis of the level populations reveals significant downward interlayer transport, which facilitates growth of the base. This island shape is metastable, since more compact three-dimensional islands form at elevated growth temperature.

  15. Dysprosium separation from aqueous phase by non-dispersive solvent extraction employing hollow fibre membrane module

    International Nuclear Information System (INIS)

    Yadav, Kartikey K.; Singh, D.K.; Kain, V.

    2017-01-01

    Rare earth elements (REEs) consist of fourteen lanthanides and three elements which are Sc, Y and La resulting in total 17 REEs. In the last decade, these rare earths elements which have unique physical and chemical properties have been highly in demand for their application in almost all walks of life. Various methods such as ion exchange, precipitation and solvent extraction have been used to recover these elements from aqueous solutions. These traditional methods have some inherent disadvantages like handling of hazardous organic chemicals, ineffectiveness to recover a very low concentration of contaminated source etc. In this regard, an important method i.e. liquid membrane offers separation scheme; which combines the characteristics, of solvent extraction and solid membrane separation, to overcome the disadvantages of conventional techniques. Various experiments were carried out to evaluate the effect of feed acidity, metal ion concentration, carrier concentration, feed composition, flow rates and phase ratio on the transport of rare earths metal ions across the membrane

  16. Manufacturing of Dysprosium-Iron Alloys by Electrolysis in Fluoride-Based Electrolytes: Oxide Solubility Determinations

    Science.gov (United States)

    Martinez, Ana Maria; Støre, Anne; Osen, Karen Sende

    2018-04-01

    Electrolytic production of light rare earth elements and alloys takes place in a fluoride-based electrolyte using rare earth oxides as raw material. The optimization of this method, mainly in terms of the energy efficiency and environmental impact control, is rather challenging. Anode effects, evolution of fluorine-containing compounds, and side cathode reactions could largely be minimized by a good control of the amount of rare earth oxide species dissolved in the fluoride-based electrolyte and their dissolution rate. The oxide content of the fluoride melts REF3-LiF (RE = Nd, Dy) at different compositions and temperatures were experimentally determined by carbothermal analysis of melt samples. The highest solubility values of oxide species, added as Dy2O3 and Dy2(CO3)3, were obtained to be of ca. 3 wt pct (expressed as Dy2O3) in the case of the equimolar DyF3-LiF melt at 1323 K (1050 °C). The oxide saturation values increased with the amount of REF3 present in the molten bath and the working temperature.

  17. A naproxen complex of dysprosium intercalates into calf thymus DNA base pairs

    International Nuclear Information System (INIS)

    Yang, Mengsi; Jin, Jianhua; Xu, Guiqing; Cui, Fengling; Luo, Hongxia

    2014-01-01

    Highlights: • Binding mode to ctDNA was studied by various methods. • Intercalation is the most possible binding mode. • Dynamic and static quenching occurred simultaneously. • Hydrophobic force played a major role. • Binding characteristic of rare earth complexes to DNA are dependent on the element. - Abstract: The binding mode and mechanism of dysprosium–naproxen complex (Dy–NAP) with calf thymus deoxyribonucleic acid (ctDNA) were studied using UV–vis and fluorescence spectra in physiological buffer (pH 7.4). The results showed that more than one type of quenching process occurred and the binding mode between Dy–NAP with ctDNA might be intercalation. In addition, ionic strength, iodide quenching and fluorescence polarization experiments corroborated the intercalation binding mode between Dy–NAP and ctDNA. The calculated thermodynamic parameters ΔG, ΔH and ΔS at different temperature demonstrated that hydrophobic interaction force played a major role in the binding process

  18. White light emission and color tunability of dysprosium doped barium silicate glasses

    Energy Technology Data Exchange (ETDEWEB)

    Mishra, Lokesh; Sharma, Anchal; Vishwakarma, Amit K.; Jha, Kaushal [Department of Applied Physics, Delhi Technological University, Delhi 110042 (India); Jayasimhadri, M., E-mail: jayaphysics@yahoo.com [Department of Applied Physics, Delhi Technological University, Delhi 110042 (India); Ratnam, B.V.; Jang, Kiwan [Department of Physics, Changwon National University, Changwon 641-77 (Korea, Republic of); Rao, A.S.; Sinha, R.K. [Department of Applied Physics, Delhi Technological University, Delhi 110042 (India)

    2016-01-15

    The present work elucidates the synthesis of Dy{sup 3+} doped barium silicate glasses, along with the subsequent studies performed to evaluate its viability in solid state lighting applications. The synthesized photonic glasses were investigated via X-Ray Diffraction, Scanning Electron Microscopy and Fourier Transform Infrared Spectroscopy. The photoluminescence properties were examined under ultraviolet (UV)/near UV (NUV) excitation. Photoluminescence spectrum exhibited characteristic emission bands at λ{sub em}=483 nm (blue) and λ{sub em}=576 nm (yellow) which are ascribed to the {sup 4}F{sub 9/2}→{sup 6}H{sub 15/2} and {sup 4}F{sub 9/2}→{sup 6}H{sub 13/2} transitions of Dy{sup 3+} ion, respectively. The chromaticity coordinates under excitation of λ{sub ex}=348 nm are (0.31, 0.34), which lies in the white region of CIE 1931 chromaticity diagram and are in excellent proximity with the standard equal energy white illuminant (0.333, 0.333). The calculated correlated color temperature and the yellow to blue (Y/B) ratio are found to be 6602 K and 1.12, respectively for the optimized sample. The synthesized photonic glass also offered the possibility of tuning the color as exemplified through the variation in CIE coordinates, correlated color temperature and the Y/B ratio. The results confirm the possibility of color tunability from the proposed glass and may be useful for various photonic device applications. - Highlights: • Successfully synthesized Dy{sup 3+} doped barium silicate glasses. • Structural properties thoroughly discussed by using XRD and FT-IR. • Photoluminescence and colorimetry properties have been investigated. • Y/B ratio and the reason for color tunability have been successfully explained. • CIE coordinates of Dy{sup 3+}:BBS glass confirm its suitability for w-LEDs.

  19. New ultrasonic attenuation maxima for single crystal dysprosium in a magnetic field

    International Nuclear Information System (INIS)

    Treder, R.A.; Maekawa, S.; Levy, M.

    1976-01-01

    The temperatures and corresponding applied basal plane magnetic fields are reported for longitudinal ultrasonic attenuation maxima in a cylindrical Dy sample. Besides maxima at Tsub(N) and Tsub(C), two new maxima are observed and possible explanations for their existence are given. (Auth.)

  20. Adsorption of dysprosium on the graphite (0001) surface: Nucleation and growth at 300 K

    Energy Technology Data Exchange (ETDEWEB)

    Kwolek, Emma J.; Lii-Rosales, Ann [The Ames Laboratory, Ames, Iowa 50011 (United States); Department of Chemistry, Iowa State University, Ames, Iowa 50011 (United States); Lei, Huaping; Wang, Cai-Zhuang; Tringides, Michael C.; Evans, James W. [The Ames Laboratory, Ames, Iowa 50011 (United States); Department of Physics and Astronomy, Iowa State University, Ames, Iowa 50011 (United States); Wallingford, Mark; Zhou, Yinghui [The Ames Laboratory, Ames, Iowa 50011 (United States); Thiel, Patricia A., E-mail: pthiel@iastate.edu [The Ames Laboratory, Ames, Iowa 50011 (United States); Department of Chemistry, Iowa State University, Ames, Iowa 50011 (United States); Department of Materials Science and Engineering, Iowa State University, Ames, Iowa 50011 (United States)

    2016-12-07

    We have studied nucleation and growth of Dy islands on the basal plane of graphite at 300 K using scanning tunneling microscopy, density functional theory (DFT) in a form that includes van der Waals interactions, and analytic theory. The interaction of atomic Dy with graphite is strong, while the diffusion barrier is small. Experiment shows that at 300 K, the density of nucleated islands is close to the value predicted for homogeneous nucleation, using critical nucleus size of 1 and the DFT-derived diffusion barrier. Homogeneous nucleation is also supported by the monomodal shape of the island size distributions. Comparison with the published island density of Dy on graphene shows that the value is about two orders of magnitude smaller on graphite, which can be attributed to more effective charge screening in graphite. The base of each island is 3 atomic layers high and atomically ordered, forming a coincidence lattice with the graphite. Islands resist coalescence, probably due to multiple rotational orientations associated with the coincidence lattice. Upper levels grow as discernible single-atom layers. Analysis of the level populations reveals significant downward interlayer transport, which facilitates growth of the base. This island shape is metastable, since more compact three-dimensional islands form at elevated growth temperature.

  1. An operationally simple method for separating the rare-earth elements neodymium and dysprosium

    Energy Technology Data Exchange (ETDEWEB)

    Bogart, Justin A.; Lippincott, Connor A.; Carroll, Patrick J.; Schelter, Eric J. [Department of Chemistry, University of Pennsylvania, Philadelphia, PA (United States)

    2015-07-06

    Rare-earth metals are critical components of electronic materials and permanent magnets. Recycling of consumer materials is a promising new source of rare earths. To incentivize recycling there is a clear need for simple methods for targeted separations of mixtures of rare-earth metal salts. Metal complexes of a tripodal nitroxide ligand [{(2-"tBuNO)C_6H_4CH_2}{sub 3}N]{sup 3-} (TriNOx{sup 3-}), feature a size-sensitive aperture formed of its three η{sup 2}-(N,O) ligand arms. Exposure of metal cations in the aperture induces a self-associative equilibrium comprising [M(TriNOx)thf]/[M(TriNOx)]{sub 2} (M=rare-earth metal). Differences in the equilibrium constants (K{sub eq}) for early and late metals enables simple Nd/Dy separations through leaching with a separation ratio S{sub Nd/Dy}=359. (copyright 2015 WILEY-VCH Verlag GmbH and Co. KGaA, Weinheim)

  2. An Operationally Simple Method for Separating the Rare-Earth Elements Neodymium and Dysprosium.

    Science.gov (United States)

    Bogart, Justin A; Lippincott, Connor A; Carroll, Patrick J; Schelter, Eric J

    2015-07-06

    Rare-earth metals are critical components of electronic materials and permanent magnets. Recycling of consumer materials is a promising new source of rare earths. To incentivize recycling there is a clear need for simple methods for targeted separations of mixtures of rare-earth metal salts. Metal complexes of a tripodal nitroxide ligand [{(2-(t) BuNO)C6 H4 CH2 }3 N](3-) (TriNOx(3-) ), feature a size-sensitive aperture formed of its three η(2) -(N,O) ligand arms. Exposure of metal cations in the aperture induces a self-associative equilibrium comprising [M(TriNOx)thf]/ [M(TriNOx)]2 (M=rare-earth metal). Differences in the equilibrium constants (Keq ) for early and late metals enables simple Nd/Dy separations through leaching with a separation ratio SNd/Dy =359. © 2015 WILEY-VCH Verlag GmbH & Co. KGaA, Weinheim.

  3. Cerium: an unlikely replacement of dysprosium in high performance Nd-Fe-B permanent magnets.

    Science.gov (United States)

    Pathak, Arjun K; Khan, Mahmud; Gschneidner, Karl A; McCallum, Ralph W; Zhou, Lin; Sun, Kewei; Dennis, Kevin W; Zhou, Chen; Pinkerton, Frederick E; Kramer, Matthew J; Pecharsky, Vitalij K

    2015-04-24

    Replacement of Dy and substitution of Nd in NdFeB-based permanent magnets by Ce, the most abundant and lowest cost rare earth element, is important because Dy and Nd are costly and critical rare earth elements. The Ce, Co co-doped alloys have excellent high-temperature magnetic properties with an intrinsic coercivity being the highest known for T ≥ 453 K. © 2015 WILEY-VCH Verlag GmbH & Co. KGaA, Weinheim.

  4. A Linear Tetranuclear Dysprosium(III) Compound Showing Single-Molecule Magnet Behavior

    Energy Technology Data Exchange (ETDEWEB)

    Ke, Hongshan; Xu, Gong Feng; Guo, Yun-Nan; Gamez, Patrick; Beavers, Christine M; Teat, Simon J; Tang, Jinkui

    2010-04-20

    Although magnetic measurements reveal a single-relaxation time for a linear tetranuclear Dy(III) compound, the wide distribution of the relaxation time observed clearly suggests the presence of two slightly different anisotropic centres, therefore opening new avenues for investigating the relaxation dynamics of lanthanide aggregates.

  5. Experimental study of induced staggered magnetic fields in dysprosium gallium garnet (DGG)

    International Nuclear Information System (INIS)

    Steiner, M.; Corliss, L.M.; Hastings, J.M.; Blume, M.; Giordano, N.; Wolf, W.P.

    1979-01-01

    Neutron diffraction techniques have been used to study induced staggered magnetic field effects in DGG. The application of a uniform magnetic field at temperatures much greater than the Neel temperature induces a significant amount of antiferromagnetic order. The temperature and field dependences of this effect are in good agreement with recent theoretical predicions

  6. Influence of dysprosium and terbium additions on aluminium structure and properties

    International Nuclear Information System (INIS)

    Fridlyander, I.N.; Sokolovskaya, E.M.; Zimina, E.N.; Tkachenko, E.A.; Artemova, M.S.

    1992-01-01

    The influence of 0.3%Dy and 0.3%Tb additions were investigated on grain size in aluminium ingots and on recrystallization and mechanical properties in 1.5 mm thick sheets. Grain refinement in ingots was revealed along with an increase of sheet recrystallization temperature and grain growth retardation in the process of secondary recrystallization. Ultimate strength was found to rise at some decrease of specific elongation

  7. Improvement of high-frequency characteristics of Z-type hexaferrite by dysprosium doping

    International Nuclear Information System (INIS)

    Mu Chunhong; Liu Yingli; Song Yuanqiang; Wang Liguo; Zhang Huaiwu

    2011-01-01

    Z-type hexaferrite has great potential applications as anti-EMI material for magnetic devices in the GHz region. In this work, Dy-doped Z-type hexaferrites with nominal stoichiometry of Ba 3 Co 2 Dy x Fe 24-x O 41 (x 0.0, 0.05, 0.5, 1.0) were prepared by an improved solid-state reaction method. The effects of rare earth oxide (Dy 2 O 3 ) addition on the phase composition, microstructure and electromagnetic properties of the ceramics were investigated. Structure and micromorphology characterizations indicate that certain content of Dy doping will cause the emergence of the second phase Dy 3 Fe 5 O 12 at the grain boundaries of the majority phase Z-type hexaferrite, due to which the straightforward result is the grain refinement during the successive sintering process. Permeability spectra measurements show that the initial permeability reaches its maximum of 17 at 300 MHz with x = 0.5, while the cutoff frequency keeps above 800 MHz. The apparent specific anisotropy field H K of Dy-doped Z-type hexaferrites decreases with x increasing. The relationships among phase composition, grain size, permeability spectra, and anisotropy are theoretically investigated, and according to the analysis, Dy doping effects on its magnetic properties can be well explained and understood.

  8. Synthesis, photoluminescence and intramolecular energy transfer model of a dysprosium complex

    Energy Technology Data Exchange (ETDEWEB)

    Zhang Aiqin; Zhang Jiuli; Pan Qiliang; Wang Shuhua [College of Materials Science and Engineering, Taiyuan University of Technology, No. 79 West Yingze Street, Taiyuan, Shanxi 030024 (China); Key Laboratory of Interface Science and Engineering in Advanced Materials of Taiyuan University of Technology, Ministry of Education, Taiyuan, Shanxi 030024 (China); Jia Husheng, E-mail: Jia_Husheng@126.com [College of Materials Science and Engineering, Taiyuan University of Technology, No. 79 West Yingze Street, Taiyuan, Shanxi 030024 (China) and Key Laboratory of Interface Science and Engineering in Advanced Materials of Taiyuan University of Technology, Ministry of Education, Taiyuan, Shanxi 030024 (China); Xu Bingshe [College of Materials Science and Engineering, Taiyuan University of Technology, No. 79 West Yingze Street, Taiyuan, Shanxi 030024 (China); Key Laboratory of Interface Science and Engineering in Advanced Materials of Taiyuan University of Technology, Ministry of Education, Taiyuan, Shanxi 030024 (China)

    2012-04-15

    The energy of the highest occupied molecular orbital and the lowest unoccupied molecular orbital as well as their energy gaps, and the singlet and triplet state energy levels of 4-benzoylbenzoic acid (HL=4-BBA) and triphenylphosphine oxide (TPPO) were calculated with the Gaussian03 program package. The singlet state and triplet state energy levels were also estimated from the UV-vis absorption spectra and phosphorescence spectra. The results suggest that the calculated values approximately coincided with the experimental values. A Dy(III) complex was synthesized with 4-BBA as primary ligand and TPPO as neutral ligand. The structure of the complex was characterized by elemental analysis, {sup 1}H NMR spectrometry, and FTIR spectrometry. TG-DTG analysis indicates that the complex kept stable up to 305 Degree-Sign C. The photoluminescence properties were studied by fluorescence spectrometry. The results show that Dy(III) ion sensitized by 4-BBA and TPPO emitted characteristic peaks at 572 nm ({sup 4}F{sub 9/2}-{sup 6}H{sub 13/2}) and 480 nm ({sup 4}F{sub 9/2}-{sup 6}H{sub 15/2}), and its Commission Internationale de L'Eclairge coordinates were calculated as x=0.33 and y=0.38, being located in the white range. Intermolecular energy transfer process was discussed and energy transfer model was also proposed. - Highlights: Black-Right-Pointing-Pointer Quantum calculation provides theoretical method of ligand choice for rare earth. Black-Right-Pointing-Pointer The complex Dy(L){sub 3}(TPPO){sub 2} emitted white light. Black-Right-Pointing-Pointer The CIE coordinates were calculated as x=0.33 and y=0.38. Black-Right-Pointing-Pointer Energy transfer in Dy(L){sub 3}(TPPO){sub 2} followed Dexter electron exchange theory.

  9. Crystal-field magnetic anisotropy of dilute dysprosium or erbium in yttrium single crystals

    DEFF Research Database (Denmark)

    Høg, J.; Touborg, P.

    1974-01-01

    Magnetization measurements have been performed between 1.3 and 300 K in fields up to 50 × 105 A/m in the a, b, and c directions of hcp crystals of pure Y and Y doped with 0.14-at.% Dy or 0.14-at.% Er, using the Faraday method and a vibrating-sample method. The characteristic behavior of both...

  10. Extraction and stripping of neodymium (III) and dysprosium (III) by TRUEX solvent

    International Nuclear Information System (INIS)

    Rout, Alok; Venkatesan, K.A.; Antony, M.P.; Srinivasan, T.G.; Vasudeva Rao, P.R.

    2009-01-01

    McCabe-Thiele diagram for the extraction and stripping of Nd (III) and Dy (III) by TRUEX solvent has been constructed to determine the number of stages required for complete extraction and stripping. (author)

  11. Road Materials and Pavement Design Volume 17(1)

    CSIR Research Space (South Africa)

    De Beer, Morris

    2016-03-01

    Full Text Available Materials and Pavement Design Volume 17, 2016 - Issue 1 Editorial Board Page ebi | Published online: 03 Oct 2016  http://dx.doi.org/10.1080/14680629.2016.1244475 Editors-in-Chief Hervé DI BENEDETTO - University of Lyon/ENTPE, Vaulx-en-Velin, France... Andrew Charles COLLOP - De Montfort University, Leicester, UK William G. BUTTLAR - University of Missouri, Urbana-Champaign, USA Editor-in-Chief at Large Jorge B. Sousa - Consulpav, Oeiras, Portugal Associate Editors Morris de Beer - CSIR Built...

  12. 26 CFR 1.171-2 - Amortization of bond premium.

    Science.gov (United States)

    2010-04-01

    ... annual accrual periods. Example 3. Holder uses accrual method of accounting—(i) Facts. The facts are the same as in Example 1 of this paragraph (c) except that A uses an accrual method of accounting. Thus... disbursements method of accounting, and C decides to use annual accrual periods ending on January 15 of each...

  13. 47 CFR 87.171 - Class of station symbols.

    Science.gov (United States)

    2010-10-01

    ... RLO—VHF omni-range RLS—Surveillance radar RLT—Radionavigation land test RLW—Microwave landing system RNV—Radio Navigation Land/DME RPC—Ramp Control TJ—Aircraft earth station in the Aeronautical Mobile...

  14. 17 CFR 171.24 - Submission of the record.

    Science.gov (United States)

    2010-04-01

    ... previously served on the party appealing. If the party appealing objects to the materials included or..., at any time, direct that an omission or misstatement be corrected and, if necessary, that a...

  15. What we do | Page 171 | IDRC - International Development ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    ... Health, Livelihoods and Sustainable Production Systems (Sub-Saharan Africa) ... North And Central America, Panama, Peru, South America, North Of Sahara, ... IDRC supported the development and testing of a reliable and cost-efficient ...

  16. What we do | Page 171 | IDRC - International Development ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Equity Gauge Zambia : Enhancing Governance, Equity and Health ... of community organizations, health workers and other actors in the health system. ... China, Far East Asia, India, Kenya, North And Central America, Panama, Peru, South ...

  17. Potential probiotic of Lactobacillus johnsonii LT171 for chicken ...

    African Journals Online (AJOL)

    STORAGESEVER

    2009-11-02

    Nov 2, 2009 ... ISSN 1684–5315 © 2009 Academic Journals. Full Length Research Paper ... ability to the mucus and antibacterial effects against pathogens is the major .... medium consisting of skim milk (1%) and agar (1.5%). Clear zones.

  18. What we do | Page 171 | IDRC - International Development ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    ... sharing our knowledge with policymakers, researchers, and communities around the world;; fostering new talent by offering fellowships and awards; and; putting new knowledge into the hands of those who can use it best to address global challenges. Part of Canada's foreign affairs and development efforts, IDRC invests ...

  19. 48 CFR 217.171 - Multiyear contracts for services.

    Science.gov (United States)

    2010-10-01

    ... services (e.g., ground maintenance, in-plane refueling, bus transportation, and refuse collection and... installation being closed or realigned under a base closure law as defined in 10 U.S.C. 2667(h)(2); or (C) A... Public Law 105-56 and similar sections in subsequent DoD appropriations acts); or (ii) A cancellation...

  20. 44 CFR 206.171 - Crisis counseling assistance and training.

    Science.gov (United States)

    2010-10-01

    ... description of the organizational structure of the program, including designation by the Governor of an... assistance based on recommendations of the Regional Administrator and the Secretary; (ii) Obligate funds and... books, documents, papers, and records that pertain to Federal funds, equipment, and supplies received...

  1. All projects related to | Page 171 | IDRC - International Development ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    ... Miscellaneous, Natural Resources, Science and Technology, Social Policy ... Greening Small and Medium Enterprises: Its Impact on Competitiveness and ... RESEARCH NETWORKS, RESEARCH CENTRES, Science and Technology ... As countries steadily increase the share and value of knowledge, information, and ...

  2. 171 Adoption of Enriched Local Complementary Food in Osun State ...

    African Journals Online (AJOL)

    User

    2012-01-24

    Jan 24, 2012 ... blended with legumes to give the protein portion of the diet (Lartey et al. 1999). Often such foods are introduced to mothers, made available and methods of preparation are taught in either hospital during antenatal care or in the communities. Adoption of innovation is defined as a point of decision to make ...

  3. 49 CFR 171.8 - Definitions and abbreviations.

    Science.gov (United States)

    2010-10-01

    ... chemical reaction between a fuel, such as hydrogen or hydrogen rich gases, alcohols, or hydrocarbons, and... reaction. This may be achieved by methods such as adding an inhibiting chemical, degassing the hazardous... requirements: (1) Has an engineering degree and one year of work experience in cargo tank structural or...

  4. 48 CFR 411.171 - Solicitation provisions and contract clauses.

    Science.gov (United States)

    2010-10-01

    ... provision at 452.211-70, Brand Name or Equal, in solicitations, other than those for construction, where “brand name or equal” purchase descriptions are used. (b) Contracting officers shall insert the clause at..., Attachment to Statement of Work/Specifications, when there are attachments to the description (statement of...

  5. 48 CFR 3009.171-5 - Serious felonies prohibiting award.

    Science.gov (United States)

    2010-10-01

    ... ethics of the business concern; or are of a nature that is inconsistent with the mission of FPS..., including those arising out of a procurement contract, cooperative agreement, grant or other assistance... the integrity or business ethics of the business concern; or is of a nature that is inconsistent with...

  6. 19 CFR 171.51 - Application and definitions.

    Science.gov (United States)

    2010-04-01

    ... Customs Duties U.S. CUSTOMS AND BORDER PROTECTION, DEPARTMENT OF HOMELAND SECURITY; DEPARTMENT OF THE...) Controlled substance. “Controlled substance” has the meaning given in 21 U.S.C. 802. (4) Normal and customary... knowledge is sufficient. An established norm, standard, or custom is persuasive but not conclusive or...

  7. People’s Republic of China Scientific Abstracts, Number 171

    Science.gov (United States)

    1977-07-07

    products by using newly-hatched silkworm larvae ( Bombyx mori ) as the test insects. Comparisons have been made with different varieties öf~the...English-language sources are transcribed or reprinted, with the original phrasing and other characteristics retained. Headlines, editorial reports...following the last line of a brief, indicate how the original information was processed. Where no processing indicator is given, the infor- mation was

  8. Sex Discrimination in Employment. Research Report No. 171.

    Science.gov (United States)

    Morris, J. David; Wood, Linda B.

    This report examines the status of women and the laws that have been enacted to protect women from discrimination in employment. Written in lay language, it examines employment and occupational statistics for women in the United States and in Kentucky. Following an introduction in Chapter 1, the report presents four chapters surveying the problem,…

  9. 40 CFR 80.171 - Product transfer documents (PTDs).

    Science.gov (United States)

    2010-07-01

    ... (PTDs). (a) Contents. For each occasion when any gasoline refiner, importer, reseller, distributor... or CARB-based certification, or under a certification option which creates an oxygenate or PRC use restriction, then the PTD for the additized product must identify the applicable use restriction. The PTD for...

  10. 14 CFR 171.273 - Maintenance and operations requirements.

    Science.gov (United States)

    2010-01-01

    ... authorized persons. (3) FCC licensing requirements for operations and maintenance personnel. (4) Posting of..., with a maximum corrective maintenance time of not greater than 1.5 hours. This measure applies to... than 1,500 hours. This measure applies to unscheduled outages, out-of-tolerance conditions, and...

  11. 14 CFR 171.323 - Fabrication and installation requirements.

    Science.gov (United States)

    2010-01-01

    ..., using applicable electric and safety codes and Federal Communications Commission (FCC) licensing... time not to exceed 1.5 hours. This measure applies to correction of unscheduled failures of the monitor... measure applies to unscheduled outage, out-of-tolerance conditions, and failures of the monitor...

  12. 49 CFR 171.16 - Detailed hazardous materials incident reports.

    Science.gov (United States)

    2010-10-01

    ... containing any hazardous material suffers structural damage to the lading retention system or damage that..., explosion or dangerous evolution of heat (i.e., an amount of heat sufficient to be dangerous to packaging or personal safety to include charring of packaging, melting of packaging, scorching of packaging, or other...

  13. 50 CFR 216.171 - Effective dates and definitions.

    Science.gov (United States)

    2010-10-01

    ... concern listed in next bullet) found dead or live on shore within a two day period and occurring on same... distress. (2) Shutdown (this definition specifically applies only to the word as used in § 216.174(a)(1... live, in the water animal involved in a USE. ...

  14. Report on INT Program INT-17-1a

    Energy Technology Data Exchange (ETDEWEB)

    Escher, J. E. [Lawrence Livermore National Lab. (LLNL), Livermore, CA (United States); Blackmon, J. [Lawrence Livermore National Lab. (LLNL), Livermore, CA (United States); Elster, C. [Lawrence Livermore National Lab. (LLNL), Livermore, CA (United States); Launey, K. [Lawrence Livermore National Lab. (LLNL), Livermore, CA (United States); Lee, D. [Lawrence Livermore National Lab. (LLNL), Livermore, CA (United States); Scielzo, N. D. [Lawrence Livermore National Lab. (LLNL), Livermore, CA (United States)

    2017-04-19

    The purpose of the 5-week program was to bring together physicists from the low-energy nuclear structure and reaction communities to identify avenues for achieving reliable and predictive descriptions of reactions involving nuclei across the isotopic chart. The 4-day embedded workshop focused on connecting theory developments to experimental advances and data needs for astrophysics and other applications.

  15. Результаты первого этапа летных испытаний вертолета – летающей лаборатории Ми-171А2

    OpenAIRE

    ИВЧИН ВАЛЕРИЙ АНДРЕЕВИЧ; САМСОНОВ КОНСТАНТИН ЮРЬЕВИЧ

    2014-01-01

    В настоящей работе представлены результаты первого этапа летных испытаний летающей лаборатории модернизированного вертолета Ми-171А2 на базе летающей лаборатории Ми-171А, оборудованного несущим винтом с новыми лопастями из композитных материалов и новым рулевым винтом.

  16. Antiferroquadrupolar ordering and anisotropic magnetic phase diagram of dysprosium palladium bronze, DyPd3S4

    International Nuclear Information System (INIS)

    Matsuoka, Eiichi; Tayama, Takashi; Sakakibara, Toshiro; Hiroi, Zenji; Takeda, Naoya; Ishikawa, Masayasu; Shirakawa, Naoki

    2007-01-01

    From the measurements of magnetization and specific heat, we constructed B-T phase diagrams of single-crystalline DyPd 3 S 4 which is known to exhibit antiferroquadrupolar (AFQ) and antiferromagnetic (AFM) ordering at low temperatures. The phase diagrams are found to be highly anisotropic and re-entrant, which are typical of rare-earth compounds exhibiting multipolar ordering. The crystalline electric field (CEF) scheme of Dy 3+ in DyPd 3S4 was deduced from the specific heat and magnetization measurements of the Y-diluted compounds Dy 1-x Y x Pd 3 S 4 (0.1≤x≤0.9) and discussed in detail. The CEF ground state was determined to be the orbitally-degenerated quartet Γ 67 (1) , and the overall splitting width was estimated to be about 104 K. No correlation was found between the anisotropy of T Q and that of the Zeeman splitting width of the ground quartet Γ 67 (1) . (author)

  17. Effect of Ligand Field Tuning on the SMM Behavior for Three Related Alkoxide-Bridged Dysprosium Dimers.

    Science.gov (United States)

    Peng, Yan; Mereacre, Valeriu; Baniodeh, Amer; Lan, Yanhua; Schlageter, Martin; Kostakis, George E; Powell, Annie K

    2016-01-04

    The synthesis and characterization of three Dy2 compounds, [Dy2(HL1)2(NO3)4] (1), [Dy2(L2)2(NO3)4] (2), and [Dy2(HL3)2(NO3)4] (3), formed using related tripodal ligands with a central tertiary amine bearing picolyl and alkoxy arms, 2-[(2-hydroxy-ethyl)-pyridin-2-ylmethylamino]-ethanol (H2L1), 2-(bis-pyridin-2-ylmethylamino)-ethanol (HL2), and 2-(bis-pyridin-2-ylmethylamino)-propane-1,3-diol (H2L3), are reported. The compounds are rare examples of alkoxide-bridged {Dy2} complexes and display capped square antiprism coordination geometry around each Dy(III) ion. Changes in the ligand field environment around the Dy(III) ions brought about through variations in the ligand donors can be gauged from the magnetic properties, with compounds 1 and 2 showing antiparallel coupling between the Dy(III) ions and 3 showing parallel coupling. Furthermore, slow relaxation of the magnetization typical of SMM behavior could be observed for compounds 2 and 3, suggesting that small variations in the ligand field can have a significant influence on the slow relaxation processes responsible for SMM behavior of Dy(III)-based systems.

  18. Effects of magnetic annealing on structure and multiferroic properties of pure and dysprosium substituted BiFeO 3

    KAUST Repository

    Zhang, Shuxia; Yao, Yingbang; Chen, Yao; Wang, Dongliang; Zhang, Xianping; Awaji, Satoshi; Watanabe, Kazuo; Ma, Yanwei

    2012-01-01

    In this work, the effects of magnetic annealing on crystal structure and multiferroic properties of BiFeO 3 and Bi 0.85Dy 0.15FeO 3 have been investigated. It is found that the X-ray diffraction patterns of pure BiFeO 3 samples are obviously broadened after magnetic annealing, whereas those of Bi 0.85Dy 0.15FeO 3 samples are almost unchanged. Magnetic field annealing did not affect the magnetic properties of these two kinds of samples much. However, ferroelectric properties of the two materials exhibited different behaviors after magnetic field annealing. For pure BiFeO 3 samples, the remnant polarizations (P r) are suppressed; in contrast, for Bi 0.85Dy 0.15FeO 3 samples, P r is greatly enhanced. Possible mechanisms for the effects of magnetic field annealing have been discussed. © 2012 Elsevier B.V. All rights reserved.

  19. A rational approach to the modulation of the dynamics of the magnetisation in a dysprosium-nitronyl-nitroxide radical complex.

    Science.gov (United States)

    Poneti, Giordano; Bernot, Kevin; Bogani, Lapo; Caneschi, Andrea; Sessoli, Roberta; Wernsdorfer, Wolfgang; Gatteschi, Dante

    2007-05-14

    A control of the dynamics of the magnetisation is chemically achieved in a ring-like Dy-radical based molecule, allowing the estimation of the quantum tunneling frequency with a (4)He-cooled susceptometer.

  20. Manufacturing of Dysprosium-Iron Alloys by Electrolysis in Fluoride-Based Electrolytes. Electrolysis in a Laboratory-Scale Cell

    Science.gov (United States)

    Martinez, Ana Maria; Osen, Karen Sende; Støre, Anne; Gudbrandsen, Henrik; Kjos, Ole Sigmund; Solheim, Asbjørn; Wang, Zhaohui; Oury, Alexandre; Namy, Patrick

    2018-04-01

    Electrolytic production of light rare earth elements and rare earth alloys with transition elements takes place in a fluoride-based electrolyte using rare earth oxides as raw material. The optimization of this method, mainly in terms of the energy efficiency and environmental impact control, is rather challenging. Anode effects, evolution of fluorine-containing compounds and side cathode reactions could largely be minimized by good control of the amount of rare earth oxide species dissolved in the fluoride-based electrolyte and their dissolution rate. The Dy2O3 feed rate needed for stable cell operation was studied by following up the anode voltage and gas analysis. On-line analysis of the cell off-gases by FTIR showed that the electrochemical reaction for the formation of Dy-Fe alloy gives mainly CO gas and that CF4 is starting to evolve gradually at anode voltages of ca. 3.25 V. The limiting current density for the discharge of the oxide ions at the graphite anode was in the range of 0.1 to 0.18 A cm-2 at dissolved Dy2O3 contents of ca. 1 wt pct. Modeling of the laboratory cell reactor was also carried out by implementing two models, i.e., an electrical model simulating the current density distribution at the electrodes and a laminal bubbly flow model that explains the electrolyte velocity induced by gas bubble production at the anode.

  1. Sol-gel synthesis and crystallization kinetics of dysprosium-titanate Dy2Ti2O7 for photonic applications

    Czech Academy of Sciences Publication Activity Database

    Mrázek, Jan; Potel, M.; Buršík, Jiří; Mráček, A.; Kallistová, Anna; Jonášová, Šárka; Boháček, Jan; Kašík, Ivan

    2015-01-01

    Roč. 168, November (2015), s. 159-167 ISSN 0254-0584 Institutional support: RVO:67985882 ; RVO:68081723 ; RVO:67985831 Keywords : Ceramics * Inorganic compounds * Optical materials Subject RIV: JA - Electronics ; Optoelectronics, Electrical Engineering; JG - Metallurgy (UFM-A); CB - Analytical Chemistry, Separation (GLU-S) Impact factor: 2.101, year: 2015

  2. Critical Rare Earths, National Security, and U.S.-China Interactions: A Portfolio Approach to Dysprosium Policy Design

    Science.gov (United States)

    2015-01-01

    from Donald and Susan Rice , both funds which enabled me to focus on the dissertation. I thank Dean Susan Marquis for her dedication to the growth of...quota of 89,2000 tonnes (Table 2.2). The sprawling black market not only prevents Beijing’s efforts to bring the production under its levers to...yttrium are often used for pigmentation for consumer products such as paint and sunglasses. REE-based lasers are used for cosmetic , epidermal, and

  3. White- and blue-light-emitting dysprosium(III) and terbium(III)-doped gadolinium titanate phosphors.

    Science.gov (United States)

    Antić, Ž; Kuzman, S; Đorđević, V; Dramićanin, M D; Thundat, T

    2017-06-01

    Here we report the synthesis and structural, morphological, and photoluminescence analysis of white- and blue-light-emitting Dy 3 + - and Tm 3 + -doped Gd 2 Ti 2 O 7 nanophosphors. Single-phase cubic Gd 2 Ti 2 O 7 nanopowders consist of compact, dense aggregates of nanoparticles with an average size of ~25 nm for Dy 3 + -doped and ~50 nm for Tm 3 + -doped samples. The photoluminescence results indicated that ultraviolet (UV) light excitation of the Dy 3 + -doped sample resulted in direct generation of white light, while a dominant yellow emission was obtained under blue-light excitation. Intense blue light was obtained for Tm 3 + -doped Gd 2 Ti 2 O 7 under UV excitation suggesting that this material could be used as a blue phosphor. Copyright © 2016 John Wiley & Sons, Ltd.

  4. Isothermal sections of phase equilibria diagrams for systems (terbium, dysprosium, holmium)-molybdenum-boron at 1273 K

    International Nuclear Information System (INIS)

    Kuz'ma, Yu.B.; Zakharchuk, N.P.; Maksimova, L.T.

    1988-01-01

    The methods of X-ray analysis are used to study the R-Mo-B (R-Tb, Dy, Ho) systems and isothermal sections of phase equilibria diagrams at 1273 K are plotted. A formation of RMoB 4 (structure of the YCrB 4 type) is confirmed and borides R 3 MoB 7 (structure of the Er 3 CrB 7 type) and ∼ RMo 4 B 8 (of the unknown structure) are obtained for the first time. Borides DyMoB 3 and HoMoB 3 are of the ErMoB 3 structure. Lattice periods of new compounds are indicated. Diffractogrammes of borides Dy 3 MoB 7 and DyMoB 3 are calculated. A peculiarity of components interaction in the systems rare-earth metal-molybdenum-boron is considered

  5. Effects of magnetic annealing on structure and multiferroic properties of pure and dysprosium substituted BiFeO 3

    KAUST Repository

    Zhang, Shuxia

    2012-07-01

    In this work, the effects of magnetic annealing on crystal structure and multiferroic properties of BiFeO 3 and Bi 0.85Dy 0.15FeO 3 have been investigated. It is found that the X-ray diffraction patterns of pure BiFeO 3 samples are obviously broadened after magnetic annealing, whereas those of Bi 0.85Dy 0.15FeO 3 samples are almost unchanged. Magnetic field annealing did not affect the magnetic properties of these two kinds of samples much. However, ferroelectric properties of the two materials exhibited different behaviors after magnetic field annealing. For pure BiFeO 3 samples, the remnant polarizations (P r) are suppressed; in contrast, for Bi 0.85Dy 0.15FeO 3 samples, P r is greatly enhanced. Possible mechanisms for the effects of magnetic field annealing have been discussed. © 2012 Elsevier B.V. All rights reserved.

  6. Generation of White Light from Dysprosium-Doped Strontium Aluminate Phosphor by a Solid-State Reaction Method

    Science.gov (United States)

    Sahu, Ishwar Prasad; Bisen, D. P.; Brahme, N.; Tamrakar, Raunak Kumar

    2016-04-01

    A single-host lattice, white light-emitting SrAl2O4:Dy3+ phosphor was synthesized by a solid-state reaction method. The crystal structure of prepared SrAl2O4:Dy3+ phosphor was in a monoclinic phase with space group P21. The chemical composition of the sintered SrAl2O4:Dy3+ phosphor was confirmed by the energy dispersive x-ray spectroscopy technique. Under ultra-violet excitation, the characteristic emissions of Dy3+ are peaking at 475 nm, 573 nm and 660 nm, originating from the transitions of 4F9/2 → 6H15/2, 4F9/2 →&!nbsp; 6H13/2 and 4F9/2 → 6H11/2 in the 4f9 configuration of Dy3+ ions. Commission International de I'Eclairage color coordinates of SrAl2O4:Dy3+ are suitable for white light-emitting phosphor. In order to investigate the suitability of the samples as white color light sources for industrial uses, correlated color temperature (CCT) and color rendering index (CRI) values were calculated. Values of CCT and CRI were found well within the defined acceptable range. Mechanoluminescence (ML) intensity of SrAl2O4:Dy3+ phosphor increased linearly with increasing impact velocity of the moving piston. Thus, the present investigation indicates piezo-electricity was responsible for producing ML in sintered SrAl2O4:Dy3+ phosphor. Decay rates of the exponential decaying period of the ML curves do not change significantly with impact velocity. The photoluminescence and ML results suggest that the synthesized SrAl2O4:Dy3+ phosphor was useful for the white light-emitting diodes and stress sensor respectively.

  7. Complexes of lanthanum(III), cerium(III), samarium(III) and dysprosium(III) with substituted piperidines

    Energy Technology Data Exchange (ETDEWEB)

    Manhas, B S; Trikha, A K; Singh, H; Chander, M

    1983-11-01

    Complexes of the general formulae M/sub 2/Cl/sub 6/(L)/sub 3/.C/sub 2/H/sub 5/OH and M/sub 2/(NO/sub 3/)/sub 6/(L)/sub 2/.CH/sub 3/OH have been synthesised by the reactions of chlorides and nitrates of La(III), Ce(III), Sm(III) and Dy(III) with 2-methylpiperidine, 3-methylpiperidine and 4-methylpiperidine. These complexes have been characterised on the basis of their elemental analysis, and IR and electronic reflectance spectra. IR spectral data indicate the presence of coordinated ethanol and methanol molecules and bidentate nitrate groups. Coordination numbers of the metal ions vary from 5 to 8. 19 refs.

  8. Study of the optical and magnetostatic properties of thin platelets of dysprosium and holmium ortho-ferrites

    International Nuclear Information System (INIS)

    Challeton, Didier

    1970-07-01

    Device applications of cylindrical magnetic domains - sometimes referred to as 'bubbles' - was first demonstrated by A.H. Bobeck in the rare earth ortho-ferrites. General magnetic and optical properties of the rare earth ortho-ferrites are considered. The theoretical study of the cylindrical magnetic domains and their stability conditions are presented in this paper. The single crystals were grown by the PbO flux method. The thin platelets (≅ 50 microns thick) preparation is specified and the magneto-optical measurements are presented. Absorption, birefringence and Faraday rotation were measured in HoFeO 3 and DyFeO 3 . The utilisation conditions of these materials are characterized by the measurements of the smallest stable domain diameter. (author) [fr

  9. Hexanuclear, heterometallic, Ni₃Ln₃ complexes possessing O-capped homo- and heterometallic structural subunits: SMM behavior of the dysprosium analogue.

    Science.gov (United States)

    Goura, Joydeb; Guillaume, Rogez; Rivière, Eric; Chandrasekhar, Vadapalli

    2014-08-04

    The reaction of hetero donor chelating mannich base ligand 6,6'-{(2-(dimethylamino)ethylazanediyl)bis(methylene)}bis(2-methoxy-4-methylphenol) with Ni(ClO4)2·6H2O and lanthanide(III) salts [Dy(III) (1); Tb(III) (2); Gd (III) (3); Ho(III) (4); and Er(III) (5)] in the presence of triethylamine and pivalic acid afforded a series of heterometallic hexanuclear Ni(II)-Ln(III) coordination compounds, [Ni3Ln3(μ3-O)(μ3-OH)3(L)3(μ-OOCCMe3)3]·(ClO4)·wCH3CN·xCH2Cl2·yCH3OH·zH2O [for 1, w = 8, x = 3, y = 0, z = 5.5; for 2, w = 0, x = 5, y = 0, z = 6.5; for 3, w = 15, x = 18, y = 3, z = 7.5; for 4, w = 15, x = 20, y = 6, z = 9.5; and for 5, w = 0, x = 3, y = 2, z = 3]. The molecular structure of these complexes reveals the presence of a monocationic hexanuclear derivative containing one perchlorate counteranion. The asymmetric unit of each of the hexanuclear derivatives comprises the dinuclear motif [NiLn(L)(μ3-O)(μ3-OH)(μ-Piv)]. The cation contains three interlinked O-capped clusters: one Ln(III)3O and three Ni(II)Ln(III)2O. Each of the lanthanide centers is eight- coordinated (distorted trigonal-dodecahedron), while the nickel centers are hexacoordinate (distorted octahedral). The study of the magnetic properties of all compounds are reported and suggests single molecule magnet behavior for the Dy(III) derivative (1).

  10. Enhancement of lanthanide evaporation by complexation: Dysprosium tri-iodide mixed with indium iodide and thulium tri-iodide mixed with thallium iodide

    Energy Technology Data Exchange (ETDEWEB)

    Curry, J. J.; Henins, A.; Hardis, J. E. [National Institute of Standards and Technology, 100 Bureau Drive, Gaithersburg, Maryland 20899 (United States); Estupiñán, E. G. [OSRAM SYLVANIA Inc., 71 Cherry Hill Drive, Beverly, Massachusetts 01915 (United States); Lapatovich, W. P. [Walter Lapatovich Consulting, 51 Pye Brook Lane, Boxford, Massachusetts 01921 (United States); Shastri, S. D. [Advanced Photon Source, Argonne National Laboratory, 9700 South Cass Avenue, Argonne, Illinois 60439 (United States)

    2013-09-28

    The vapors in equilibrium with condensates of DyI{sub 3}, DyI{sub 3}/InI, TmI{sub 3}, and TmI{sub 3}/TlI were observed over the temperature range from 900 K to 1400 K using x-ray induced fluorescence. The total densities of each element (Dy, Tm, In, Tl, and I) in the vapor, summed over all atomic and molecular species, were determined. Dramatic enhancements in the total vapor densities of Dy and Tm were observed in the vapors over DyI{sub 3}/InI and TmI{sub 3}/TlI as compared to the vapors over pure DyI{sub 3} and pure TmI{sub 3}, respectively. An enhancement factor exceeding 10 was observed for Dy at T≈ 1020 K, decreasing to 0 at T≈ 1250 K. An enhancement factor exceeding 20 was observed for Tm at T≈ 1040 K, decreasing to 0 at T≈ 1300 K. Such enhancements are expected from the formation of the vapor-phase hetero-complexes DyInI{sub 4} and TmTlI{sub 4}. Numerical simulations of the thermo-chemical equilibrium suggest the importance of additional complexes in liquid phases. A description of the measurement technique is given. Improvements in the absolute calibration lead to an approximately 40% correction to previously reported preliminary results [J. J. Curry et al., Chem. Phys. Lett. 507, 52 (2011); Appl. Phys. Lett. 100, 083505 (2012)].

  11. Complexation behaviour of DADCA and DAPDA with dysprosium-166/holmium-166 parent daughter system and its potential for use in radioimmunotherapy

    International Nuclear Information System (INIS)

    Orsini, S.; University of Technology, Broadway, NSW; Di Bartolo, N.; Smith, S.; Baker, T.

    1998-01-01

    Full text: A novel approach for the delivery of therapeutic doses from 166 Ho to cancerous tissue is via the decay of its parent, 166 Dy. When designing radioimmunoconjugte, a crucial question is to determine whether the ligand used in the radiolabeling process is capable of holding the 166 Ho on decay of the parent, 166 Dy. In this study, two pendant arm macrocycles 1, 10-Diaza-4, 7, 13, 16-tetraoxacyclooctadecane-N, N'-diacetic acid, (DACDA) and 1, 10-Diaza-4, 7, 13-trioxacyclopentadecane-N, N'-diacetic acid, (DAPDA) that were reported to forms reasonably stable complexes with Dy and Ho, were synthesised. The synthesis of the two pendant arm macrocycles was first attempted using methods outlined by Chang and Rowland. The yields obtained through this method were low (10 % for both ligands) and it was considered important to investigate alternative approaches to the synthesis. The new method involved an alkylation reaction in the presence of acetonitrile and sodium bicarbonate. The method took considerably less time and the yields increased to 88 %. The ligands were characterised using 1 H NMR, 13 C NMR and mass spectrometry. The chemical and radiolytic stabilities of 166 Dy and 166 Ho complexes of the two ligands were investigated at pH = 5 and the ligands potential for use in the in vivo generator system evaluated

  12. CCDC 1402057: Experimental Crystal Structure Determination : pentakis(tetra-n-butylammonium) tetrakis(mu-oxalato)-dodecachloro-tetranitrosyl-ethanol-tetra-ruthenium-dysprosium sesquihydrate

    KAUST Repository

    Kuhn, Paul-Steffen; Cremer, Laura; Gavriluta, Anatolie; Jovanović, Katarina K.; Filipović, Lana; Hummer, Alfred A.; Bü chel, Gabriel E.; Dojčinović, Biljana P.; Meier, Samuel M.; Rompel, Annette; Radulović, Siniša; Tommasino, Jean Bernard; Luneau, Dominique; Arion, Vladimir B.

    2015-01-01

    An entry from the Cambridge Structural Database, the world’s repository for small molecule crystal structures. The entry contains experimental data from a crystal diffraction study. The deposited dataset for this entry is freely available from the CCDC and typically includes 3D coordinates, cell parameters, space group, experimental conditions and quality measures.

  13. 3D dysprosium density in the metal-halide lamp measured by emission and laser absorption spectroscopy in a centrifuge at 1-10g

    NARCIS (Netherlands)

    Flikweert, A.J.; Nimalasuriya, T.; Thubé, G.M.; Kroesen, G.M.W.; Stoffels, W.W.

    2007-01-01

    The metal-halide lamp is a High Intensity Discharge (HID) lamp with a high efficiency. The salt additive (DyI3) acts as prime radiator. The present lamp suffers from non-uniform light output, caused by diffusion and convection processes. To gain a better understanding of the lamp, the convection is

  14. Effect of dysprosium substitution on electrical properties of SrBi{sub 4}Ti{sub 4}O{sub 15}

    Energy Technology Data Exchange (ETDEWEB)

    Mamatha, B., E-mail: boinanemamatha@gmail.com; Sarah, P.

    2014-10-15

    SrBi{sub 4−x}Dy{sub x}Ti{sub 4}O{sub 15} (with x = 0.02, 0.04, 0.06 and 0.08) powders have been synthesized using the stoichiometric amounts of nitrates and oxides of the constituent materials through sol–gel method. The compound so formed is characterized using X-ray diffraction. The density and lattice parameters are calculated. The impedance and electrical conductivity properties are investigated. The imaginary part of impedance as a function of frequency shows Debye like relaxation. Impedance data presented in the Nyquist plot which is used to identify an equivalent circuit and the fundamental circuit parameters are determined at different temperatures. The results of bulk a.c. conductivity as a function of frequency at different temperatures are presented. The dielectric behavior was investigated. Permittivity was calculated based on the relaxation frequency using an alternative approach based on the variation of the imaginary impedance component as a function of reciprocal angular frequency. The frequency dependence of real and imaginary permittivities was also investigated. - Highlights: • SrBi{sub 4−x}Dy{sub x}Ti{sub 4}O{sub 15} (x = 0.02, 0.04, 0.06 and 0.08) powders are produced by sol–gel method. Phase formation is confirmed by XRD analysis. • Frequency dependent imaginary part of impedance shows distribution of relaxation in system. • Broadness of Z″ peak shows distribution of relaxation frequency. • Increase in peak width at ½ maxima of Z″ with increase of temperature shows increase of relaxation frequency distribution. • Cole–Cole plots are resolved into two different circles, ascribed to different mechanisms of polarization and relaxation phenomena.

  15. Transition metal redox switches for reversible "on/off" and "slow/fast" single-molecule magnet behaviour in dysprosium and erbium bis-diamidoferrocene complexes.

    Science.gov (United States)

    Dickie, Courtney M; Laughlin, Alexander L; Wofford, Joshua D; Bhuvanesh, Nattamai S; Nippe, Michael

    2017-12-01

    Single-molecule magnets (SMMs) are considered viable candidates for next-generation data storage and quantum computing. Systems featuring switchability of their magnetization dynamics are particularly interesting with respect to accessing more complex logic gates and device architectures. Here we show that transition metal based redox events can be exploited to enable reversible switchability of slow magnetic relaxation of magnetically anisotropic lanthanide ions. Specifically, we report anionic homoleptic bis-diamidoferrocene complexes of Dy 3+ (oblate) and Er 3+ (prolate) which can be reversibly oxidized by one electron to yield their respective charge neutral redox partners (Dy: [1] - , 1 ; Er: [2] - , 2 ). Importantly, compounds 1 and 2 are thermally stable which allowed for detailed studies of their magnetization dynamics. We show that the Dy 3+ [1] - / 1 system can function as an "on"/"off" or a "slow"/"fast" redox switchable SMM system in the absence or presence of applied dc fields, respectively. The Er 3+ based [2] - / 2 system features "on"/"off" switchability of SMM properties in the presence of applied fields. Results from electrochemical investigations, UV-vis-NIR spectroscopy, and 57 Fe Mössbauer spectroscopy indicate the presence of significant electronic communication between the mixed-valent Fe ions in 1 and 2 in both solution and solid state. This comparative evaluation of redox-switchable magnetization dynamics in low coordinate lanthanide complexes may be used as a potential blueprint toward the development of future switchable magnetic materials.

  16. Comparison of MR imaging after administration of dysprosium-based magnetic-susceptibility contrast media with diffusion-weighted MR imaging in evaluation of regional cerebral ischemia

    International Nuclear Information System (INIS)

    Moseley, M.E.; Kucharczyk, J.; Kurhanewicz, J.; Mintorovitch, J.; Cohen, Y.; Rocklage, S.; Quay, S.C.; Norman, D.

    1989-01-01

    This paper reports on a study to establish whether a nonionic T2-shortening contrast agent, Dy-DTPA-bis(methylamide) (Dy-DTPA-BMA), would facilitate early detection of stroke-induced cerebral perfusion deficits. The sensitivity of susceptibility-enhanced MR imaging was compared with that of diffusion-weighted MR imaging in the same cats subjected to unilateral occlusion of the middle cerebral artery (MCA). A 2-T unit, equipped with self-shielded gradient coils (± 20 G/cm, 15-cm bore size), was used in conjunction with an 8.5-cm inner diameter low-pass bird cage proton imaging coil. Diffusion-weighted images displayed increased signal intensity in the ischemic MCA territory less than 1 hour after occlusion, whereas T2-weighted MR images without contrast enhancement usually failed to depict injury for 2--3 hours after toke. With contrast administration (0.5 mmoles/kg of Dy-DTPA-BMA), however, T2-weighted images revealed perfusion deficits (hyperintensity) within 1 hour after MCA occlusion, and these corresponded to the anatomic regions of ischemic injury shown on diffusion-weighted MR images

  17. Magnetic anisotropy and neutron scattering studies of some rare earth metals

    International Nuclear Information System (INIS)

    Day, R.

    1978-08-01

    The thesis is concerned with magnetic anisotropy of dysprosium and alloys of gadolinium: yttrium, and also neutron scattering studies of dysprosium. The experiments are discussed under the topic headings: magnetic anisotropy, rare earths, torque measurements, elastic neutron scattering, inelastic neutron scattering, dysprosium measurements, and results for the gadolinium: yttrium alloys. (U.K.)

  18. 29 CFR 4.171 - “Bona fide” fringe benefits.

    Science.gov (United States)

    2010-07-01

    ... plans or trusts of the types listed in 26 U.S.C. 401(a) which are disapproved by the Internal Revenue Service as not satisfying the requirements of section 401(a) of the Internal Revenue Code or which do not... expenses incident to employment, incentive or suggestion awards, and recruitment bonuses, as well as tools...

  19. 26 CFR 1.171-3 - Special rules for certain bonds.

    Science.gov (United States)

    2010-04-01

    ... disbursements method of accounting, and E decides to use annual accrual periods ending on March 1 of each year... any bond premium among the accrual periods by reference to the equivalent fixed rate debt instrument... remaining term of the instrument. The holder also allocates any bond premium among the accrual periods by...

  20. 171_Abdussalam et al.,_PATTERN OF UTILISATION OF OGTT THE ...

    African Journals Online (AJOL)

    user pc

    2017-12-02

    Dec 2, 2017 ... estimated to be about 4.7% and is projected increase to about 5.5% by the year 2030 (Sha. 2010). According to the Global Burden of Dise. Study, there was ... burden of t important non communicable disease may proba ... 2.2 million deaths by predisposing individuals to ot .... with DM (Barr, 2002). HbA1c is ...

  1. SU-F-T-171: Manufacturing Cost Effective Heterogeneous Phantoms for Use in Proton Therapy

    Energy Technology Data Exchange (ETDEWEB)

    Pruett, J; Chen, Y; Ahmad, S; Johnson, D [University of Oklahoma Health Sciences Center, Oklahoma City, OK (United States)

    2016-06-15

    Purpose: To study the feasibility of 3D printing cost effective heterogeneous phantoms for use in proton therapy treatment planning quality assurance. Methods: A desktop 3D printer was utilized to create a series of 2 cm × 2 cm × 4 cm PLA plastic blocks of varying fill materials and hexagonal fill pattern. The blocks were than tested when filled with air, polyurethane foam, paraffin, silicone, and caulk of calcium carbonate – acrylic polymer blend. The blocks were evaluated with a “GE Lightspeed” 16 slice CT scanner and average CT# of the materials’ centers evaluated. Blocks were then placed into a custom aperture fitted to a Mevion Proton system to determine the relative stopping power of each. Scans were performed in water tank with Marcus type parallel plate chamber under a beam with a range of 15 cm and modulation of 2 cm. Shifts in range occurring relative to the 80% distal edge of the open SOBP were evaluated. Results: The CT#s of the blocks were plotted against their measured relative stopping power. This curve was compared to that which is in clinical use. While the trend agrees generally, specific differences between the relative stopping powers were as great as 10%. Conclusion: We have demonstrated that it is possible to utilize different cost effective materials in the manufacturing of phantoms for use in proton therapy. While different materials may provide better agreement to established calibration curves, a custom curve specific to the materials used may be utilized to accurately predict proton treatment dose distributions.

  2. 26 CFR 1.501(c)(17)-1 - Supplemental unemployment benefit trusts.

    Science.gov (United States)

    2010-04-01

    ... 26 Internal Revenue 7 2010-04-01 2010-04-01 true Supplemental unemployment benefit trusts. 1.501(c... Supplemental unemployment benefit trusts. (a) Requirements for qualification. (1) A supplemental unemployment... the purpose of providing supplemental unemployment compensation benefits (as defined in section 501(c...

  3. Percutaneous tracheostomy with the guide wire dilating forceps technique : presentation of 171 consecutive patients

    NARCIS (Netherlands)

    Fikkers, Bernard G; van Heerbeek, Niels; Krabbe, Paul F M; Marres, Henri A M; van den Hoogen, Frank J A

    BACKGROUND: Evaluation of percutaneous tracheostomy (PT) with the guide wire dilating forceps (GWDF) technique. METHODS: Prospective study of perioperative complications, retrospective analysis of early and late complications in an ICU in a teaching university hospital. RESULTS: The success rate of

  4. Percutaneous tracheostomy with the guide wire dilating forceps technique: presentation of 171 consecutive patients.

    NARCIS (Netherlands)

    Fikkers, B.G.; Heerbeek, N. van; Krabbe, P.F.M.; Marres, H.A.M.; Hoogen, F.J.A. van den

    2002-01-01

    BACKGROUND: Evaluation of percutaneous tracheostomy (PT) with the guide wire dilating forceps (GWDF) technique. METHODS: Prospective study of perioperative complications, retrospective analysis of early and late complications in an ICU in a teaching university hospital. RESULTS: The success rate of

  5. 40 CFR 171.4 - Standards for certification of commercial applicators.

    Science.gov (United States)

    2010-07-01

    ... ultimate use of many commodities as food and feed. Practical knowledge is required concerning soil and... shall demonstrate practical knowledge of the principles and practices of pest control and safe use of... apply various formulations of pesticides, solutions, and gases, together with a knowledge of which...

  6. Summary report of soil removal preliminary excavations. (Report No. ES-389-75-171)

    International Nuclear Information System (INIS)

    Wickland, C.E.

    1975-07-01

    A proposed technique to remove small areas, 2 , of contaminated soil is discussed along with the results of an actual excavation. Based on the results of a trial excavation in uncontaminated soil and an excavation of two trenches in contaminated soil, it is concluded that the techniques described are a satisfactory means of contaminated soil removal. It can be done safely with a release of airborne plutonium a factor of 10 or more below the Environmental Protection Administration (EPA) limit

  7. Public Mass Shooters and Firearms: A Cross-National Study of 171 Countries.

    Science.gov (United States)

    Lankford, Adam

    2016-01-01

    Model the global distribution of public mass shooters around the world. Negative binomial regression is used to test the effects of homicide rates, suicide rates, firearm ownership rates, and several control variables on public mass shooters per country from 1966 to 2012. The global distribution of public mass shooters appears partially attributable to cross-national differences in firearms availability but not associated with cross-national homicide or suicide rates. The United States and other nations with high firearm ownership rates may be particularly susceptible to future public mass shootings, even if they are relatively peaceful or mentally healthy according to other national indicators.

  8. 21 CFR 606.171 - Reporting of product deviations by licensed manufacturers, unlicensed registered blood...

    Science.gov (United States)

    2010-04-01

    ... components, including Source Plasma; an unlicensed registered blood establishment; or a transfusion service... unlicensed blood or blood components, including Source Plasma, if that event meets all the following criteria... chapter) by either a paper or electronic filing: (1) If you make a paper filing, you should identify on...

  9. SU-E-J-171: Surface Imaging Based Intrafraction Motion Assessments for Whole Brain Radiotherapy

    International Nuclear Information System (INIS)

    Wiant, D; Vanderstraeten, C; Maurer, J; Pursley, J; Terrell, J; Sintay, B

    2014-01-01

    Purpose: To quantify and characterize intrafraction motion for whole brain radiotherapy treatments in open face masks using 3D surface imaging. Methods: Fifteen whole brain patients were monitored with 3D surface imaging over a total of 202 monitoring sessions. Mean translations and rotations were calculated over each minute, each session, and over all sessions combined. The percentage of each session that the root mean square (RMS) of the linear translations were outside of 2 mm, 3 mm, 4 mm, and 5 mm were determined for each patient. Correlations between mean translations per minute and time and between standard deviation per minute and time were evaluated using Pearson's r value. Results: The mean RMS translation averaged over all patients was 1.45 mm +/− 1.52 mm. The patients spent an average of 18%, 10%, 6%, and 3% of the monitoring time outside of 2 mm, 3 mm, 4 mm, and 5 mm RMS tolerances, respectively. The RMS values averaged over all patients were 1.31 mm +/− 0.98 mm, 1.52 +/- 1.04, and 1.30 mm +/− 0.71 mm over the 1th, 5th, and 10th minutes of monitoring, respectively. Neither, the RMS values (p = 0.15) or the standard deviations of the RMS values (p = 0.16) showed significant correlations with time. Conclusion: The patients were positioned within 2 mm of isocenter, which was the initial set-up tolerance, for the majority of their treatments. The average position changed by < 0.3 mm over 10 minutes of monitoring. Short term movements, reflected by the standard deviations, where on the order of 1 mm. This immobilization system provides adequate immobilization over a course of treatment for whole brain radiotherapy. This system may also be suitable for head and neck or stereotactic radiosurgery treatments as well

  10. Yeast Interacting Proteins Database: YOR171C, YOR034C [Yeast Interacting Proteins Database

    Lifescience Database Archive (English)

    Full Text Available ain base phosphates, which function as signaling molecules, regulates synthesis of ceramide from exogenous l...chain base phosphates, which function as signaling molecules, regulates synthesis of ceramide from exogenous

  11. DA Masolo A Short History of African Philosophy, a Review pp165-171

    African Journals Online (AJOL)

    DA Masolo

    Review of Barry Hallen's A Short History of African Philosophy, Second ... 2006, by African Philosophy: The Analytic Approach (Africa World Press). .... handling of culpability in witchcraft accusations as overlooking the obvious logical inference.

  12. Trees [Nuclear Physics. B, ISSN 0550-3213, Nov 2016, v. 912, p. 151-171

    International Nuclear Information System (INIS)

    Epstein, Henri

    2016-01-01

    An algebraic formalism, developed with V. Glaser and R. Stora for the study of the generalized retarded functions of quantum field theory, is used to prove a factorization theorem which provides a complete description of the generalized retarded functions associated with any tree graph. Integrating over the variables associated to internal vertices to obtain the perturbative generalized retarded functions for interacting fields arising from such graphs is shown to be possible for a large category of space–times.

  13. 48 CFR 3009.171-4 - Determination of ownership, control, or operation.

    Science.gov (United States)

    2010-10-01

    ... of a business concern, including Chief Financial Officer, Chief Operating Officer, or Chief... for the contracting officer to refuse making contract award to the business concern. (b) Any financial... following types of roles or interests with respect to the business concern: (1) Director or officer...

  14. Sexospécificités | Page 171 | CRDI - Centre de recherches pour le ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Langue English. What determines whether or not men choose violence? Do childhood experiences play a role? Does having children make a difference? Even though men are overwhelmingly the victims and perpetrators of armed violence in cities, little is known about the reasons why some men — even amidst incentives ...

  15. 22 CFR 171.34 - Request for an accounting of record disclosures.

    Science.gov (United States)

    2010-04-01

    ... 22 Foreign Relations 1 2010-04-01 2010-04-01 false Request for an accounting of record disclosures... disclosures. (a) How made. Except where accountings of disclosures are not required to be kept, as set forth... individual. This accounting shall contain the date, nature, and purpose of each disclosure as well as the...

  16. 21 CFR 516.171 - Confidentiality of data and information in an index file.

    Science.gov (United States)

    2010-04-01

    ... AND HUMAN SERVICES (CONTINUED) ANIMAL DRUGS, FEEDS, AND RELATED PRODUCTS NEW ANIMAL DRUGS FOR MINOR USE AND MINOR SPECIES Index of Legally Marketed Unapproved New Animal Drugs for Minor Species § 516... unless specifically notified in writing by the holder of the right to disclose, to reference, or...

  17. 19 CFR 171.52 - Petition for expedited procedures in an administrative forfeiture proceeding.

    Science.gov (United States)

    2010-04-01

    ..., DEPARTMENT OF HOMELAND SECURITY; DEPARTMENT OF THE TREASURY (CONTINUED) FINES, PENALTIES, AND FORFEITURES... intermediate port of call or actually engaged in fishing operations is subject to seizure for administrative... to 19 U.S.C. 1605, or take physical custody of the vessel. When a summons to appear has been issued...

  18. 49 CFR 171.14 - Transitional provisions for implementing certain requirements.

    Science.gov (United States)

    2010-10-01

    ... hazardous material prior to October 1, 1991; (iii) Is marked “Inhalation Hazard” if appropriate, in... poisonous by inhalation for which the packaging was authorized under the requirements of part 172 or part.... (h) The proper shipping name “Gasohol gasoline mixed with ethyl alcohol, with not more than 20...

  19. 49 CFR 171.1 - Applicability of Hazardous Materials Regulations (HMR) to persons and functions.

    Science.gov (United States)

    2010-10-01

    ... $250 for each violation, except the maximum civil penalty is $110,000 if the violation results in death... and functions. Federal hazardous materials transportation law (49 U.S.C. 5101 et seq.) directs the... regulations to persons who transport hazardous materials in commerce. In addition, the law authorizes the...

  20. AN/GRC-171 Rivet Switch Multichannel UHF/AM Transceiver

    Science.gov (United States)

    1975-03-01

    1879CS/LGMG Arellano, Cayetno A Chief, ATC Operations 1879CS/ FFA Capt Rucker, William C. CMSgt McCallum, Duncan Control Tower Chief Contractor...9/* zs L-f-ZO 7s. to ZJ-S’ 59.9s GENERAL PURPOSE FORM AFCS iaoot/io«i . o.^...,«.., ,,,,„ i ,„„„ lIBS^pnnwWWIW^ Bpp ^BWTWRPIP»^ 4.3.15 AN

  1. 75 FR 61520 - National Council on the Arts 171st Meeting

    Science.gov (United States)

    2010-10-05

    ... Markusen, Director of the Project on Regional and Industrial Economics at the University of Minnesota's..., it becomes necessary for the Council to discuss non-public commercial or financial information of...

  2. 48 CFR 3009.171-7 - Contract award approval procedures for contractors with felony convictions.

    Science.gov (United States)

    2010-10-01

    ... felony no longer calls into question the individual or business concern's integrity or business ethics... individual or business concern's integrity or business ethics and that an award would be consistent with the... request to permit award of a contract for FPS guard services to a business concern owned, controlled, or...

  3. [Depression and burden on primary caregivers of elderly persons with physical dependence of the UMF 171].

    Science.gov (United States)

    Navarro-Sandoval, Cristina; Uriostegui-Espíritu, Lizbeth Carlota; Delgado-Quiñones, Edna Gabriela; Sahagún-Cuevas, Minerva Natalia

    2017-01-01

    According to the National Health and Nutrition Survey of 2012, more than a quarter of older adults (26.9%) have some degree of disability, requiring a primary caregiver to perform basic activities of daily living. The aim is to determine the prevalence of depression and burden on primary caregivers of elderly persons with physical dependence. A descriptive cross-sectional study with non-probability sampling that included the primary caregivers of elderly patients with physical dependence. Barthel scale was applied as a tool to measure the level of physical dependence in elderly patients; while the primary caregivers were applied to the Beck Depression and Zarit scale for assessing the level of caregiver burden. A sample of 76 primary caregivers was calculated and descriptive statistical analysis was performed. Of the 76 primary caregivers, 55.3% were without depression, 32.9% had mild depression, and 11.8% with moderate depression. According to the Zarit scale, 40.8% had no burden, 44.7% had burden light, and 14.5% intense burden. The role of primary caregiver is a stressful task which can interfere with their family health; so our role is to provide care not only to the geriatric dependent patients, but also to their caregiver.

  4. Clinics in diagnostic imaging (171). Caecal volvulus with underlying intestinal malrotation.

    Science.gov (United States)

    Ooi, Su Kai Gideon; Tan, Tien Jin; Ngu, James Chi Yong

    2016-11-01

    A 46-year-old Chinese woman with a history of cholecystectomy and appendicectomy presented to the emergency department with symptoms of intestinal obstruction. Physical examination revealed central abdominal tenderness but no clinical features of peritonism. Plain radiography of the abdomen revealed a grossly distended large bowel loop with the long axis extending from the right lower abdomen toward the epigastrium, and an intraluminal air-fluid level. These findings were suspicious for an acute caecal volvulus, which was confirmed on subsequent contrast-enhanced computed tomography (CT) of the abdomen and pelvis. CT demonstrated an abnormal positional relationship between the superior mesenteric vein and artery, indicative of an underlying intestinal malrotation. This case highlights the utility of preoperative imaging in establishing the diagnosis of an uncommon cause of bowel obstruction. It also shows the importance of recognising the characteristic imaging features early, so as to ensure appropriate and expedient management, thus reducing patient morbidity arising from complications. Copyright: © Singapore Medical Association.

  5. 30 CFR 206.171 - What definitions apply to this subpart?

    Science.gov (United States)

    2010-07-01

    ... United States or who holds title subject to Federal restriction against alienation. Indian tribe means... restriction against alienation. Lease means any contract, profit-share arrangement, joint venture, or other...

  6. 171 Géochimie comparative des sédiments de ruisseaux des rives ...

    African Journals Online (AJOL)

    Valued Packard Bell Customer

    FFTB) qui est un accident ... (FBO) qui est un accident ductilo-fragile (Kankeu, 2008 [4]) et la faille de la Sanaga (FS) qui est un accident ..... African Central Cameroon shear zone (W-Tibati-Area): petrology and geodynamic significance, journal of ...

  7. 42 CFR 416.171 - Determination of payment rates for ASC services.

    Science.gov (United States)

    2010-10-01

    ... relative value units under § 414.22(b)(5)(i)(B) of this subchapter multiplied by the conversion factor... applicable conversion factor and the relative payment weight established under § 416.167(b), unless otherwise indicated in this section. (1) Conversion factor for CY 2008. CMS calculates a conversion factor so that...

  8. 19 CFR Appendix C to Part 171 - Customs Regulations Guidelines for the Imposition and Mitigation of Penalties for Violations of...

    Science.gov (United States)

    2010-04-01

    ... revocation of a license or permit. Such minimal employment shall be prima facie evidence of lack of... obligations including duties, taxes and refunds. 4. A penalty of $5,000 against any broker who fails to...

  9. 10 CFR 171.16 - Annual fees: Materials licensees, holders of certificates of compliance, holders of sealed source...

    Science.gov (United States)

    2010-01-01

    .... 4 Another license includes licenses for extraction of metals, heavy metals, and rare earths. 5 There..., in-situ recovery, heap-leaching, ore buying stations, ion exchange facilities and in-processing of ores containing source material for extraction of metals other than uranium or thorium, including...

  10. T171. REDUCED FRONTAL CORTICAL THICKNESS AND SURFACE IN A 10 YEARS FOLLOW-UP OF EARLY ONSET PSYCHOSIS

    Science.gov (United States)

    Ilzarbe, Daniel; de la Serna, Elena; Baeza, Inmaculada; Pariente, Jose; Fortea, Adriana; Redondo, Marina; Bargallo, Nuria; Castro-Fornieles, Josefina; Sugranyes, Gisela

    2018-01-01

    Abstract Background Structural volume loss of cortical gray matter over time in schizophrenia has been widely reported (Vita et al. 2012), and may be more pronounced when the disorder has an onset prior to age 18 (Early Onset Psychosis, EOP; Arango et al. 2008). More recently, studies have focused on measures of cortical morphology. The single study in EOP so far has identified greater loss of cortical thickness (CTH) in patients with schizophrenia over time (van Haren et al. 2011), whereas to our knowledge, no so far study has examined measures of surface area (SA) in EOP following a longitudinal design. We set out to examine measures of both CTH and SA in a sample of EOP at 10-year-follow-up. Methods Patients with EOP were recruited at first episode, matched by sex and age with healthy controls (HC) and re-assessed at 10 years. Subjects were evaluated clinically and structural T1 volumes were acquired using magnetic resonance imaging at baseline and 10-year-follow-up. Images were preprocessed, segmented and analysed with FreeSurfer. Quality control procedure was carried out by two raters. Images were segmented and CTH and SA values were extracted for each parcellation employing Desikan-Killiany Atlas; these were grouped in frontal, occipital, temporal, parietal and cingulate lobes so as to reduce multiple comparisons. When group or group by time effects were detected, parcellations were individually examined. A linear mixed model was built using Stata IC 13.1 to evaluate the effect of group and time on CTH and SA, including hemisphere as fixed effects and correcting by total intracranial volume and setting a critical p-value of .05. Results Thirty-nine subjects completed the follow-up. After removing 9 due to poor quality T1 images (technical problems, excess of movement), 28 subjects were finally included (13 EOP, 15 HC). There were no significant differences in age (EOP=26.9 ± 0.6 vs HC=27.2 ± 0.3 at follow-up) or sex distribution (%female: EOP=43% vs HC=38%) between groups. The distribution of diagnosis in the case group was: schizoaffective disorder (n=5), bipolar disorder with psychotic features (n=3), schizophrenia (n=2) and others (n=3). There was a trend-level group effect in global CTH (p = .07) which was significant in the frontal lobe (p = .014). EOP exhibited less CTH in the caudal middle frontal (p = .016) and pars opercularis (p = .03) and orbitalis (p = .007) of the inferior frontal gyrus. There was an effect of time in the parietal (p = .013) and occipital (p = .004) lobes consisting of thinner CTH at follow-up in both groups. There were no differences in SA between groups. Both showed an increase in total SA (p < .001) and for parietal (p < .001), temporal (p = .009) and occipital (p = .003) regions at follow-up. There a group by time effect in frontal SA, consisting of an increase over time in HC and a decrease in EOP (p = .044), specifically in medial orbito-frontal cortex (p = .039). Discussion Our results have identified: 1) thinner cortices in frontal regions in EOP compared to HC, which seems to be constant over time; and 2) a decreased in SA in frontal areas in EOP along time, contrasting with HC, whose frontal surface increased at follow-up. These findings are consistent with another study (Greenstein et al. 2006) which also reported reduced CTH in frontal areas in EOP during development, while we found no abnormalities in temporal regions (Vita et al. 2012). Despite the small sample size, to our knowledge this is the longest follow-up of an EOP sample employing magnetic resonance imaging so far.

  11. Minimally invasive or interventional repair of atrial septal defects in children: experience in 171 cases and comparison with conventional strategies.

    Science.gov (United States)

    Formigari, R; Di Donato, R M; Mazzera, E; Carotti, A; Rinelli, G; Parisi, F; Pasquini, L; Ballerini, L

    2001-05-01

    The goal of this study was to evaluate percutaneous interventional and minimally invasive surgical closure of secundum atrial septal defect (ASD) in children. Concern has surrounded abandoning conventional midline sternotomy in favor of the less invasive approaches pursuing a better cosmetic result and a more rational resource utilization. A retrospective analysis was performed on the patients treated from June 1996 to December 1998. One hundred seventy-one children (median age 5.8 years, median weight 22.1 kg) underwent 52 device implants, 72 minimally invasive surgical operations and 50 conventional sternotomy operations. There were no deaths and no residual left to right shunt in any of the groups. The overall complication rate causing delayed discharge was 12.6% for minimally invasive surgery, 12.0% for midline sternotomy and 3.8% for transcatheter device closure (p appeal of the percutaneous and minimally invasive approaches must be weighed against their greater exposure to technical pitfalls. Adequate training is needed if a strategy of surgical or percutaneous minimally invasive closure of ASD in children is planned in place of conventional surgery.

  12. 34 CFR 403.171 - Who is eligible to apply to a State board for an award?

    Science.gov (United States)

    2010-07-01

    ... an adult learning center; and (2) Business, industry, labor organizations, or apprenticeship programs...) OFFICE OF VOCATIONAL AND ADULT EDUCATION, DEPARTMENT OF EDUCATION STATE VOCATIONAL AND APPLIED TECHNOLOGY...

  13. FCJ-171 Expectations denied: Fan and industry conflict around the localisation of the Japanese video game Yakuza 3

    Directory of Open Access Journals (Sweden)

    Craig Norris

    2014-12-01

    Full Text Available Online fan cultures provides researchers with a space to observe and analyse the development and establishment of fan participation with media properties. The visibility of, and zealous postings by, fans on online forums offers a valuable opportunity to explore what happens when fans feel their expectations are being denied or limited by creator or industry actions. This article examines the fallout around the localisation of the Japanese video game Yakuza 3 into the West in 2010.

  14. 77 FR 69789 - Foreign-Trade Zone 171-Liberty County, TX; Application for Reorganization/Expansion Under...

    Science.gov (United States)

    2012-11-21

    ... zones and can permit significantly greater flexibility in the designation of new subzones or ``usage..., Highway FM 787, Liberty; Site 5 (583.081 acres)--Sjolander Plastics Storage Railyard facility, adjacent to...

  15. 25 CFR 171.100 - What are some of the terms I should know for this part?

    Science.gov (United States)

    2010-04-01

    ... number means either your Social Security Number or your Employer Identification Number. Temporarily non...). Urgency means a situation that we have determined may adversely impact our irrigation facilities..., compact, or other legal document, or by specialized engineering studies. Water user (see Customer). We, us...

  16. 40 CFR 429.171 - Effluent limitations representing the degree of effluent reduction attainable by the application...

    Science.gov (United States)

    2010-07-01

    ... degree of effluent reduction attainable by the application of the best practicable control technology... (CONTINUED) EFFLUENT GUIDELINES AND STANDARDS TIMBER PRODUCTS PROCESSING POINT SOURCE CATEGORY Wood Furniture... best practicable control technology currently available (BPT). Except as provided in 40 CFR 125.30...

  17. Homologación de soldadores y procesos bajo el código AWS D17.1

    OpenAIRE

    Gaona Latorre, Mireia

    2015-01-01

    Los fabricantes de motores aeronáuticos exigen a las organizaciones de mantenimiento que dispongan de soldadores homologados para realizar reparaciones en los componentes. Los certificados de homologación son la mejor garantía de que los soldadores poseen la destreza y conocimientos necesarios para realizar trabajos de soldadura. Estas homologaciones se realizan tanto a los soldadores que emplean métodos manuales como a operadores de máquinas de soldeo. Este proyecto está dividido en dos p...

  18. 25 CFR 171.500 - How does BIA determine the annual operation and maintenance assessment rate for the irrigation...

    Science.gov (United States)

    2010-04-01

    ... costs needed for the reliable operation of the irrigation facility infrastructure; (8) Maintenance of a... 25 Indians 1 2010-04-01 2010-04-01 false How does BIA determine the annual operation and... Indians BUREAU OF INDIAN AFFAIRS, DEPARTMENT OF THE INTERIOR LAND AND WATER IRRIGATION OPERATION AND...

  19. 40 CFR 171.7 - Submission and approval of State plans for certification of commercial and private applicators of...

    Science.gov (United States)

    2010-07-01

    ... authorities are pending enactment and/or promulgation, the Governor (or Chief Executive) may request that a...) Any changes in commercial applicator subcategories. (iii) A summary of enforcement activities related... contents of examinations (e.g., multiple choice, true-false) and submission of sample examination questions...

  20. Itzï (version 17.1): an open-source, distributed GIS model for dynamic flood simulation

    Science.gov (United States)

    Guillaume Courty, Laurent; Pedrozo-Acuña, Adrián; Bates, Paul David

    2017-05-01

    Worldwide, floods are acknowledged as one of the most destructive hazards. In human-dominated environments, their negative impacts are ascribed not only to the increase in frequency and intensity of floods but also to a strong feedback between the hydrological cycle and anthropogenic development. In order to advance a more comprehensive understanding of this complex interaction, this paper presents the development of a new open-source tool named Itzï that enables the 2-D numerical modelling of rainfall-runoff processes and surface flows integrated with the open-source geographic information system (GIS) software known as GRASS. Therefore, it takes advantage of the ability given by GIS environments to handle datasets with variations in both temporal and spatial resolutions. Furthermore, the presented numerical tool can handle datasets from different sources with varied spatial resolutions, facilitating the preparation and management of input and forcing data. This ability reduces the preprocessing time usually required by other models. Itzï uses a simplified form of the shallow water equations, the damped partial inertia equation, for the resolution of surface flows, and the Green-Ampt model for the infiltration. The source code is now publicly available online, along with complete documentation. The numerical model is verified against three different tests cases: firstly, a comparison with an analytic solution of the shallow water equations is introduced; secondly, a hypothetical flooding event in an urban area is implemented, where results are compared to those from an established model using a similar approach; and lastly, the reproduction of a real inundation event that occurred in the city of Kingston upon Hull, UK, in June 2007, is presented. The numerical approach proved its ability at reproducing the analytic and synthetic test cases. Moreover, simulation results of the real flood event showed its suitability at identifying areas affected by flooding, which were verified against those recorded after the event by local authorities.

  1. 19 CFR Appendix B to Part 171 - Customs Regulations, Guidelines for the Imposition and Mitigation of Penalties for Violations of...

    Science.gov (United States)

    2010-04-01

    ... prior to liquidation. In addition, a potential loss of duty exists where Customs discovers the violation... statement or omission that is based on a bona fide erroneous belief as to the facts, so long as the belief... that do not change the admissibility or entry status of merchandise or its appraised value or...

  2. Preparation, characterization, and luminescence properties of dysprosium perchlorate with MABA-Si and phen or dipy complexes as well as SiO{sub 2}@Dy(MABA-Si)L core-shell structure nanometermeter luminescent composites

    Energy Technology Data Exchange (ETDEWEB)

    Li, Wen-Xian, E-mail: nmglwx@163.com [College of Chemistry and Chemical Engineering, Inner Mongolia University, Hohhot 010021 (China); Zheng, Yu-Shan [Inner Mongolia Autonomous Region Product Quality Inspection Institute, Hohhot 010010 (China); Cao, Xiao-fang; Bai, Juan; Fu, Zhi-Fang; Bao, Jin-Rong; Li, Yi-Lian [College of Chemistry and Chemical Engineering, Inner Mongolia University, Hohhot 010021 (China)

    2016-10-15

    Two novel ternary rare earth complexes Dy(MABA-Si)·L{sub 2}(ClO{sub 4}){sub 3}·2H{sub 2}O (L= Phen or Dipy) were prepared using HOOCC{sub 6}H{sub 4}N(CONH(CH{sub 2}){sub 3}Si-(OCH{sub 2}CH{sub 3}){sub 3}){sub 2} which was abbreviated or denoted as MABA-Si. MABA-Si was the first ligand, L was the second ligand. The corresponding two SiO{sub 2}@Dy(MABA-Si)L nanometermeter luminescent composites were synthesized as well, and the silica spheres is the core, and the ternary rare earth complex Dy(MABA-Si)·L{sub 2}(ClO{sub 4}){sub 3}·2H{sub 2}O was the shell layer, who was abbreviated or denoted as Dy((MABA-Si)L). The ternary complexes have been characterized by element analysis, molar conductivity, IR spectra and {sup 1}HNMR spectra. The results showed that the chemical formula of the complex was Dy(MABA-Si)·L{sub 2}(ClO{sub 4}){sub 3}·2H{sub 2}O. The fluorescent spectra illustrated that the complexes displayed its characteristic luminescence in solid state, and the luminescence was superior than Dy{sup 3+}. The core-shell structure of SiO{sub 2}@Dy(MABA-Si)L nanometermeter luminescent composite was characterized by SEM, TEM and IR spectra. Based on the SEM photographs, the core-shell structure particles showed its regular microstructure including smooth surface, and good dispersity. The ternary complex coated on the mono-dispersed SiO{sub 2} spheres by self-assembly. The fluorescent spectra illustrated that the core-shell structure of SiO{sub 2}@Dy(MABA-Si)L nanometermeter luminescent composites exhibited stronger fluorescent than the ternary complexes. The fluorescence lifetime of the complexes and core-shell structure composites was measured as well.

  3. Dysprosium-doped PbGa2S4 laser generating at 4.3 μm directly pumped by 1.7 μm laser diode.

    Science.gov (United States)

    Jelínková, Helena; Doroshenko, Maxim E; Jelínek, Michal; Sulc, Jan; Osiko, Vyacheslav V; Badikov, Valerii V; Badikov, Dmitrii V

    2013-08-15

    In this Letter, we demonstrate the pulsed and CW operation of the Dy:PbGa(2)S(4) laser directly pumped by the 1.7 μm laser diode. In the pulsed regime (pulse duration 5 ms; repetition rate 20 Hz), the maximum mean output power of 9.5 mW was obtained with the slope efficiency of 9.3% with respect to the absorbed pump power. The generated wavelength was 4.32 μm, and the laser beam cross section was approximately Gaussian on both axes. Stable CW laser generation was also successfully obtained with the maximum output power of 67 mW and the slope efficiency of 8%. Depopulation of the lower laser level by 1.7 μm pump radiation absorption followed by 1.3 μm upconversion fluorescence was demonstrated. These results show the possibility of construction of the compact diode-pumped solid-state pulsed or CW laser generating at 4.3 μm in the power level of tens mW operating at room temperature.

  4. Stability constants and thermodynamic parameters of trivalent gadolinium, yttrium, terbium, dysprosium and holmium complexes with 2-(p-sulphophenylazo) 1,8-dihydroxynaphthalene 3,6 disulphonic acid (trisodium salt)[SPADNS

    International Nuclear Information System (INIS)

    Dubey, S.N.; Nagpal, S.; Kalra, H.L.; Puri, D.M.

    1980-01-01

    The stepwise stability constants of Gd(III), Y(III), Tb(III), Dy(III) and Ho(III) complexes with SPADNS have been determined potentiometrically in aqueous solution using Bjerrum-Calvin technique as modified by Irving and Rossotti at different temperatures (20deg and 40deg) and 0.1 M ionic strength (NaClO 4 ). The trend in the stability of these metal complexes has been found to be: Ho(III) > Dy(III) > Tb(III) > Y(III) > Gd(III). The overall changes in ΔGdeg, ΔHdeg and ΔSdeg accompanying the complex formation have also been determined. (author)

  5. Stability constants and thermodynamic parameters of trivalent gadolinium, yttrium, terbium, dysprosium and holmium complexes with 2-(p-sulphophenylazo) 1,8-dihydroxynaphthalene 3,6 disulphonic acid (trisodium salt)(SPADNS)

    Energy Technology Data Exchange (ETDEWEB)

    Dubey, S.N.; Nagpal, S.; Kalra, H.L.; Puri, D.M. (Kurukshetra Univ. (India). Dept. of Chemistry)

    1980-10-01

    The stepwise stability constants of Gd(III), Y(III), Tb(III), Dy(III) and Ho(III) complexes with SPADNS have been determined potentiometrically in aqueous solution using Bjerrum-Calvin technique as modified by Irving and Rossotti at different temperatures (20deg and 40deg) and 0.1 M ionic strength (NaClO/sub 4/). The trend in the stability of these metal complexes has been found to be: Ho(III) > Dy(III) > Tb(III) > Y(III) > Gd(III). The overall changes in ..delta..Gdeg, ..delta..Hdeg and ..delta..Sdeg accompanying the complex formation have also been determined.

  6. Poly[(6-carboxypicolinato-κ3O2,N,O6(μ3-pyridine-2,6-dicarboxylato-κ5O2,N,O6:O2′:O6′dysprosium(III

    Directory of Open Access Journals (Sweden)

    Xu Li

    2009-11-01

    Full Text Available In the title complex, [Dy(C7H3NO4(C7H4NO4]n, one of the ligands is fully deprotonated while the second has lost only one H atom. Each DyIII ion is coordinated by six O atoms and two N atoms from two pyridine-2,6-dicarboxylate and two 6-carboxypicolinate ligands, displaying a bicapped trigonal-prismatic geometry. The average Dy—O bond distance is 2.40 Å, some 0.1Å longer than the corresponding Ho—O distance in the isotypic holmium complex. Adjacent DyIII ions are linked by the pyridine-2,6-dicarboxylate ligands, forming a layer in (100. These layers are further connected by π–π stacking interactions between neighboring pyridyl rings [centroid–centroid distance = 3.827 (3 Å] and C—H...O hydrogen-bonding interactions, assembling a three-dimensional supramolecular network. Within each layer, there are other π–π stacking interactions between neighboring pyridyl rings [centroid–centroid distance = 3.501 (2 Å] and O—H...O and C—H...O hydrogen-bonding interactions, which further stabilize the structure.

  7. Study on Magnetic Responsibility of Rare Earth Ferrite/Polyacrylamide Magnetic Microsphere

    Institute of Scientific and Technical Information of China (English)

    Zhang Ming; Wang Zhifeng; Zhang Hong; Dai Shaojun; Qiu Guanming; Okamoto Hiroshi

    2005-01-01

    In inverse microemulsion, rare earth ferrite/polyacrylamide magnetic microsphere were prepared and their magnetic responsibility were studied by magnetic balance. Results indicate that the magnetic responsibility of microsphere relates to magnetic moment of rare earth ion, and it can be improved by the addition of dysprosium ion of high magnetic moment. Dysprosium content has an effect on magnetic responsibility of dysprosium ferrite/polyacrylamide magnetic microsphere. The microsphere displays strong magnetic responsibility when the molar ratio of Dy3+/iron is 0.20.

  8. 1.7. Acid decomposition of kaolin clays of Ziddi Deposit. 1.7.1. The hydrochloric acid decomposition of kaolin clays and siallites

    International Nuclear Information System (INIS)

    Mirsaidov, U.M.; Mirzoev, D.Kh.; Boboev, Kh.E.

    2016-01-01

    Present article of book is devoted to hydrochloric acid decomposition of kaolin clays and siallites. The chemical composition of kaolin clays and siallites was determined. The influence of temperature, process duration, acid concentration on hydrochloric acid decomposition of kaolin clays and siallites was studied. The optimal conditions of hydrochloric acid decomposition of kaolin clays and siallites were determined.

  9. Polymer Based Molecular Composites. Volume 171. Materials Research Society Symposium Proceedings Held in Boston, Massachusetts on 27-30 November 1989

    Science.gov (United States)

    1990-09-01

    reactivity features promoted by the polymeric sulfonic acid moiety in contrast to HCI. Further work is being undertaken utilizing para toluene 21 sulfonic...styrene and isoprene block and homo- polymers were synthesized by anionic polymerization. Cyclohexane (Burdick and Jackson HPLC Grade) was degassed and...terephthalic acid and 21 mole-% 4 aminophenol , was purchased from Hoechst Celanese. Blends containing 70 weight-% PPE and 30 weight-% PS were kindly

  10. CRED Subsurface Temperature Recorder (STR); NWHI, LAY; Long: -171.72929, Lat: 25.75915 (WGS84); Sensor Depth: 0.91m; Data Range: 20060910-20080920.

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — Data from Coral Reef Ecosystem Division (CRED), NOAA Pacific Islands Fisheries Science Center (PIFSC) Subsurface Temperature Recorders (STR) provide a time series of...

  11. 19 CFR Appendix D to Part 171 - Guidelines for the Imposition and Mitigation of Penalties for Violations of 19 U.S.C. 1593a

    Science.gov (United States)

    2010-04-01

    ... of all relevant facts. The concept of comparative negligence may be utilized in determining the...., examination of the financial records of a foreign entity related to the U.S. company claiming inability to pay...

  12. CRED Subsurface Temperature Recorder (STR); NWHI, LAY; Long: -171.72941, Lat: 25.75893 (WGS84); Sensor Depth: 1.00m; Data Range: 20030723-20040923.

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — Data from Coral Reef Ecosystem Division (CRED), NOAA Pacific Islands Fisheries Science Center (PIFSC) Subsurface Temperature Recorders (STR) provide a time series of...

  13. 171. Funcionamiento y resultados del programa de fast-track en el tratamiento de la tetralogía de fallot

    Directory of Open Access Journals (Sweden)

    J. Orrit Palacios

    2010-01-01

    Conclusiones: La corrección completa de la tetralogía de Fallot con el programa de fast-track de anestesia disminuye la ventilación mecánica, la estancia en cuidados intensivos y el tiempo de hospitalización. Asimismo se reducen los costes económicos del tratamiento.

  14. Regular cellular distribution of plasmids by oscillating and filament-forming ParA ATPase of plasmid pB171

    DEFF Research Database (Denmark)

    Ebersbach, Gitte; Ringgaard, Simon; Møller-Jensen, Jakob

    2006-01-01

    with each other in a bacterial two-hybrid assay but do not interact with FtsZ, eight other essential cell division proteins or MreB actin. Based on these observations, we propose a simple model for how oscillating ParA filaments can mediate regular cellular distribution of plasmids. The model functions...

  15. Role of Community and Technical Colleges in Producing Nursing Graduates: Rethinking the Pipeline for Guided Pathways. Research Report 17-1

    Science.gov (United States)

    Washington State Board for Community and Technical Colleges, 2017

    2017-01-01

    Though it is still possible to enter the nursing profession with a Licensed Practical Nursing Certificate (LPN) or an Associate's Degree in Nursing (ADN), it is becoming increasingly necessary to get a Bachelor of Science in Nursing (BSN) in order to be assured of continued employment. The Associate in Applied Science-T Nursing Degree prepares…

  16. http://sjm06.com/SJM%20ISSN1452-4864/9_2_2014_November_145-292/9_2_2014_159_171.pdf

    Directory of Open Access Journals (Sweden)

    Ildikó Marosi

    2014-10-01

    Full Text Available There are explicit, as well as tacit expectations among skills and competencies that are demanded from those newly graduated. My main question of interest is the following: Where do young people learn these skills, knowledge and experience? Present paper is based on literature review and a quantitative research which was conducted among university students aged 18-33, in autumn 2013. The findings prove that a significant part of tacit knowledge is gained through family socialisation, during the process of informal learning rather than via formal education. Hence, family socialisation affects the competence portfolio of young graduates immensely. Present paper endeavours to investigate this influence.

  17. Proteome analysis identifies L1CAM/CD171 and DPP4/CD26 as novel markers of human skin mast cells.

    Science.gov (United States)

    Gschwandtner, M; Paulitschke, V; Mildner, M; Brunner, P M; Hacker, S; Eisenwort, G; Sperr, W R; Valent, P; Gerner, C; Tschachler, E

    2017-01-01

    The function of skin mast cells has been well documented in IgE-mediated allergic reactions, whereas other mast cell functions are poorly defined. This study aimed at identifying novel mast cell proteins by proteome analysis of primary human skin mast cells. The proteome of skin mast cells was compared to other cell types and analyzed using bioinformatics. The expression and function of two proteins hitherto not described in skin mast cells was investigated in isolated mast cells as well as in mast cells in situ. Within the mast cell proteome, we identified 49 highly expressed proteins previously not described in mast cells; 21 of these proteins were found to be selectively expressed in mast cells. Two proteins, the neural cell adhesion molecule L1 and dipeptidyl peptidase 4, were further studied. L1 was found to be highly expressed in mast cells in normal, psoriasis, and mastocytosis skin. Dipeptidyl peptidase 4 was found to be expressed in mast cells in normal, psoriasis, and mastocytosis skin as well as in bone marrow mast cells in patients with systemic mastocytosis. In normal skin, mast cells were identified as a major source of dipeptidyl peptidase 4 and we also found that skin mast cells and fibroblasts secrete an active form of this enzyme. In a systematic proteomics approach we identified two novel mast cell proteins potentially relevant to skin homeostasis: neural cell adhesion molecule L1 and dipeptidyl peptidase 4. © 2016 John Wiley & Sons A/S. Published by John Wiley & Sons Ltd.

  18. CRED Subsurface Temperature Recorder (STR); AMSM, SWA; Long: -171.09092, Lat: -11.05855 (WGS84); Sensor Depth: 14.00m; Data Range: 20040216-20060211.

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — Data from Coral Reef Ecosystem Division (CRED), NOAA Pacific Islands Fisheries Science Center (PIFSC) Subsurface Temperature Recorders (STR) provide a time series of...

  19. The double par locus of virulence factor pB171: DNA segregation is correlated with oscillation of ParA

    DEFF Research Database (Denmark)

    Ebersbach, G; Gerdes, K; Charbon, Gitte Ebersbach

    2001-01-01

    Prokaryotic plasmids and chromosomes encode partitioning (par) loci that segregate DNA to daughter cells before cell division. Recent database analyses showed that almost all known par loci encode an ATPase and a DNA-binding protein, and one or more cis-acting regions where the proteins act. All...

  20. Pharmacogenetic diversification by alternative translation initiation: background channels to the fore: Commentary on Kisselbach et al., Br J Pharmacol 171: 5182–5194

    OpenAIRE

    Abbott, G W

    2015-01-01

    Unanticipated complexity of drug-target interactions creates a headache for those attempting to rationalize and create simple models of antiarrhythmic action, but can also introduce opportunities for increased drug specificity, or for potentially advantageous spatial and temporal variation in drug effects. The newest findings reported by Kisselbach et al. in this issue are a case in point. Building upon previous pioneering work demonstrating that neuronal K2P 2.1 potassium-selective "backgrou...

  1. SU-F-J-171: Robust Atlas Based Segmentation of the Prostate and Peripheral Zone Regions On MRI Utilizing Multiple MRI System Vendors

    International Nuclear Information System (INIS)

    Padgett, K; Pollack, A; Stoyanova, R; Swallen, A; Nelson, A

    2016-01-01

    Purpose: Automatically generated prostate MRI contours can be used to aid in image registration with CT or ultrasound and to reduce the burden of contouring for radiation treatment planning. In addition, prostate and zonal contours can assist to automate quantitative imaging features extraction and the analyses of longitudinal MRI studies. These potential gains are limited if the solutions are not compatible across different MRI vendors. The goal of this study is to characterize an atlas based automatic segmentation procedure of the prostate collected on MRI systems from multiple vendors. Methods: The prostate and peripheral zone (PZ) were manually contoured by an expert radiation oncologist on T2-weighted scans acquired on both GE (n=31) and Siemens (n=33) 3T MRI systems. A leave-one-out approach was utilized where the target subject is removed from the atlas before the segmentation algorithm is initiated. The atlas-segmentation method finds the best nine matched atlas subjects and then performs a normalized intensity-based free-form deformable registration of these subjects to the target subject. These nine contours are then merged into a single contour using Simultaneous Truth and Performance Level Estimation (STAPLE). Contour comparisons were made using Dice similarity coefficients (DSC) and Hausdorff distances. Results: Using the T2 FatSat (FS) GE datasets the atlas generated contours resulted in an average DSC of 0.83±0.06 for prostate, 0.57±0.12 for PZ and 0.75±0.09 for CG. Similar results were found when using the Siemens data with a DSC of 0.79±0.14 for prostate, 0.54±0.16 and 0.70±0.9. Contrast between prostate and surrounding anatomy and between the PZ and CG contours for both vendors demonstrated superior contrast separation; significance was found for all comparisons p-value < 0.0001. Conclusion: Atlas-based segmentation yielded promising results for all contours compared to expertly defined contours in both Siemens and GE 3T systems providing fast and automatic segmentation of the prostate. Funding Support, Disclosures, and Conflict of Interest: AS Nelson is a partial owner of MIM Software, Inc. AS Nelson, and A Swallen are current employees at MIM Software, Inc.

  2. SU-F-J-171: Robust Atlas Based Segmentation of the Prostate and Peripheral Zone Regions On MRI Utilizing Multiple MRI System Vendors

    Energy Technology Data Exchange (ETDEWEB)

    Padgett, K; Pollack, A; Stoyanova, R [University of Miami, Miami, Florida (United States); Swallen, A; Nelson, A [MIM Software Inc., Cleveland, OH (United States)

    2016-06-15

    Purpose: Automatically generated prostate MRI contours can be used to aid in image registration with CT or ultrasound and to reduce the burden of contouring for radiation treatment planning. In addition, prostate and zonal contours can assist to automate quantitative imaging features extraction and the analyses of longitudinal MRI studies. These potential gains are limited if the solutions are not compatible across different MRI vendors. The goal of this study is to characterize an atlas based automatic segmentation procedure of the prostate collected on MRI systems from multiple vendors. Methods: The prostate and peripheral zone (PZ) were manually contoured by an expert radiation oncologist on T2-weighted scans acquired on both GE (n=31) and Siemens (n=33) 3T MRI systems. A leave-one-out approach was utilized where the target subject is removed from the atlas before the segmentation algorithm is initiated. The atlas-segmentation method finds the best nine matched atlas subjects and then performs a normalized intensity-based free-form deformable registration of these subjects to the target subject. These nine contours are then merged into a single contour using Simultaneous Truth and Performance Level Estimation (STAPLE). Contour comparisons were made using Dice similarity coefficients (DSC) and Hausdorff distances. Results: Using the T2 FatSat (FS) GE datasets the atlas generated contours resulted in an average DSC of 0.83±0.06 for prostate, 0.57±0.12 for PZ and 0.75±0.09 for CG. Similar results were found when using the Siemens data with a DSC of 0.79±0.14 for prostate, 0.54±0.16 and 0.70±0.9. Contrast between prostate and surrounding anatomy and between the PZ and CG contours for both vendors demonstrated superior contrast separation; significance was found for all comparisons p-value < 0.0001. Conclusion: Atlas-based segmentation yielded promising results for all contours compared to expertly defined contours in both Siemens and GE 3T systems providing fast and automatic segmentation of the prostate. Funding Support, Disclosures, and Conflict of Interest: AS Nelson is a partial owner of MIM Software, Inc. AS Nelson, and A Swallen are current employees at MIM Software, Inc.

  3. SU-E-T-171: Evaluation of the Analytical Anisotropic Algorithm in a Small Finger Joint Phantom Using Monte Carlo Simulation

    International Nuclear Information System (INIS)

    Chow, J; Owrangi, A; Jiang, R

    2014-01-01

    Purpose: This study investigated the performance of the anisotropic analytical algorithm (AAA) in dose calculation in radiotherapy concerning a small finger joint. Monte Carlo simulation (EGSnrc code) was used in this dosimetric evaluation. Methods: Heterogeneous finger joint phantom containing a vertical water layer (bone joint or cartilage) sandwiched by two bones with dimension 2 × 2 × 2 cm 3 was irradiated by the 6 MV photon beams (field size = 4 × 4 cm 2 ). The central beam axis was along the length of the bone joint and the isocenter was set to the center of the joint. The joint width and beam angle were varied from 0.5–2 mm and 0°–15°, respectively. Depth doses were calculated using the AAA and DOSXYZnrc. For dosimetric comparison and normalization, dose calculations were repeated in water phantom using the same beam geometry. Results: Our AAA and Monte Carlo results showed that the AAA underestimated the joint doses by 10%–20%, and could not predict joint dose variation with changes of joint width and beam angle. The calculated bone dose enhancement for the AAA was lower than Monte Carlo and the depth of maximum dose for the phantom was smaller than that for the water phantom. From Monte Carlo results, there was a decrease of joint dose as its width increased. This reflected the smaller the joint width, the more the bone scatter contributed to the depth dose. Moreover, the joint dose was found slightly decreased with an increase of beam angle. Conclusion: The AAA could not handle variations of joint dose well with changes of joint width and beam angle based on our finger joint phantom. Monte Carlo results showed that the joint dose decreased with increase of joint width and beam angle. This dosimetry comparison should be useful to radiation staff in radiotherapy related to small bone joint

  4. Using Surveys of Students' Social-Emotional Learning and School Climate for Accountability and Continuous Improvement. Policy Brief 17-1

    Science.gov (United States)

    Hough, Heather; Kalogrides, Demetra; Loeb, Susanna

    2017-01-01

    The research featured in this paper is part of the CORE-PACE Research Partnership, through which Policy Analysis for California Education (PACE) has partnered with the CORE districts to conduct research designed to support them in continuous improvement while simultaneously helping to improve policy and practice in California and nationwide.…

  5. 171 ROYAL DECREE 1891/1991 of 30 December 1991 on the installation and use of X-ray equipment for the purposes of medical diagnosis

    International Nuclear Information System (INIS)

    1992-01-01

    The Decree lays down the rules enabling government authorities to monitor the proper functioning of such appliances. It takes account of the Council of European Communities' Directive 80/836/Euratom amended by Directive 84/466/Euratom on basic safety standards for the health protection of the general public and workers against the dangers of ionization and Directive 84/467/Euratom laying down basic measures for the radiation protection of persons undergoing medical examination or treatment. The Decree provides for a register of firms authorised to sell and maintain medical X-ray equipment, and a register of the equipment installed. It also sets out requirements relating to third party liability insurance, and to the qualifications and training of personnel operating the equipment. (NEA)

  6. Phase 1 trial of carfilzomib (PR-171) in combination with vorinostat (SAHA) in patients with relapsed or refractory B-cell lymphomas.

    Science.gov (United States)

    Holkova, Beata; Kmieciak, Maciej; Bose, Prithviraj; Yazbeck, Victor Y; Barr, Paul M; Tombes, Mary Beth; Shrader, Ellen; Weir-Wiggins, Caryn; Rollins, April D; Cebula, Erin M; Pierce, Emily; Herr, Megan; Sankala, Heidi; Hogan, Kevin T; Wan, Wen; Feng, Changyong; Peterson, Derick R; Fisher, Richard I; Grant, Steven; Friedberg, Jonathan W

    2016-01-01

    A phase 1 study with carfilzomib and vorinostat was conducted in 20 B-cell lymphoma patients. Vorinostat was given orally twice daily on days 1, 2, 3, 8, 9, 10, 15, 16, and 17 followed by carfilzomib (given as a 30-min infusion) on days 1, 2, 8, 9, 15, and 16. A treatment cycle was 28 days. Dose escalation initially followed a standard 3 + 3 design, but adapted a more conservative accrual rule following dose de-escalation. The maximum tolerated dose was 20 mg/m2 carfilzomib and 100 mg vorinostat (twice daily). The dose-limiting toxicities were grade 3 pneumonitis, hyponatremia, and febrile neutropenia. One patient had a partial response and two patients had stable disease. Correlative studies showed a decrease in NF-κB activation and an increase in Bim levels in some patients, but these changes did not correlate with clinical response.

  7. CRED Subsurface Temperature Recorder (STR); NWHI, LAY; Long: -171.73891, Lat: 25.77957 (WGS84); Sensor Depth: 1.22m; Data Range: 20060911-20070411.

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — Data from Coral Reef Ecosystem Division (CRED), NOAA Pacific Islands Fisheries Science Center (PIFSC) Subsurface Temperature Recorders (STR) provide a time series of...

  8. Evidence from Students’ Information Seeking Diaries Underscores the Importance of Including Librarians in Undergraduate Education. A Review of: Lee, J. Y., Paik, W., & Joo, S. (2012. Information resource selection of undergraduate students in academic search tasks. Information Research, 17(1, paper511. Retrieved 8 Aug., 2012 from http://informationr.net/ir/17-1/paper511.html

    Directory of Open Access Journals (Sweden)

    Maria Melssen

    2012-12-01

    Full Text Available Objective – To determine what informationresources undergraduate students choose tocomplete assignments for their courses, whythey choose those resources, the process ofselecting those resources and the factors thatcontributed to selecting the resources, andtheir perceptions of those resources.Design – Semi-structured information seekingdiary.Setting – Private university in Seoul, Korea.Subjects – 233 undergraduate students fromall majors and all years.Methods – Students selected one assignmentfrom their elective course and recorded thefollowing in a diary: what the assignment was,the topic they needed to research to completethe assignment, resources used, the factors thatcontributed to choosing the resources, andperceptions of those resources.Main Results – Data were analyzed bothqualitatively and quantitatively. The factorsthat affected the students’ resource selectionwere analyzed qualitatively using an opencoding method created by the researchers. Thefactors were not predetermined by theresearchers, but were selected based on thefactors identified by the students. Onlineresources (67.1% were the most frequentlyselected resources by the students compared tohuman resources (11.5%, print materials (11.5%, and mass media (3%. Students used an average of 5.28 resources to complete one assignment. Factors that affected the students’ selection of resources were the type of information provided by the resource, the features of the resource, the search strategy used when searching in the resource, and the students’ interaction with other people when selecting and using the resource. More than one factor typically contributed to the students’ selection of the resource. The students’ perceptions of the resources they selected were analyzed quantitatively: perceptions were analyzed in six content areas using a five point scale. Correlations and similarities across the six content areas were also analyzed. Perceptions of resources were broken down into six categories and the resources were rated on a five point scale. Librarians (4.50 were the most useful resource and lecture notes (5.0 were the most credible. Family (3.29 was the least useful, and social question and answer services, such as Yahoo! Answers, (2.62 were the least credible. Family was the most accessible and familiar resource (4.90 and 4.95 respectively. Experts (2.25 were least accessible and librarians (1.50 were the least familiar. Students were most satisfied with Google Scholar (4.33 and were most likely to use an online database (4.52 again. They were least satisfied with social question and answer services (3.05 and least likely to use a report sharing site (2.93 again. The usefulness and credibility of the resource contributed most to the undergraduates’ satisfaction with the resource, while accessibility and usefulness were the major contributing factors to users intended continued use of a resource.Conclusion – There are multiple reasons that support further information literacy education. Information literacy courses would encourage and teach students how to effectively use resources that they found credible and reliable, but considered inaccessible and unfamiliar. Information literacy education would also help educate students on how to best formulate their search strategies and how to select the best resource to use based on that strategy. Students also highlighted the importance of human interaction in resource selection and utilization. This is an opportunity for librarians and professors to play a more active role in assisting students in selecting and using the best resources to complete course assignments. Due to the limitations of this study, further research is needed to investigate the factors affecting the exclusion of resources, not only the inclusion. Future study designs should address the characteristics of the study participants themselves, such as the age and gender. The impact of the research topic and subject on resource selection, as well as what resources are selected for non-academic information needs, should also be investigated.

  9. Synthesis and X-ray structure of the dysprosium(III complex derived from the ligand 5-chloro-1,3-diformyl-2-hydroxybenzene-bis-(2-hydroxybenzoylhydrazone [Dy2(C22H16ClN4O53](SCN 3.(H2O.(CH3OH

    Directory of Open Access Journals (Sweden)

    Aliou H. Barry

    2003-12-01

    Full Text Available The title compound [Dy2(C22H16ClN4O53](SCN 3.(H2O.(CH3OH has been synthesized and its crystal structure determined by single X-ray diffraction at room temperature. The two nine coordinated Dy(III are bound to three macromolecules ligand through the phenolic oxygens of the p-chlorophenol moieties, the nitrogen atoms and the carbonyl functions of the hydrazonic moieties. The phenolic oxygen atoms of the 2-hydroxybenzoyl groups are not bonded to the metal ions. In the bases of the coordination polyhedra the six Dy-N bonds are in the range 2.563(13-2.656(13 Å and the twelve Dy-O bonds are in the range 2.281(10-2.406(10 Å.

  10. Synthesis and magneto-structural studies on a new family of carbonato bridged 3d-4f complexes featuring a [CoLn(CO3)] (Ln = La, Gd, Tb, Dy and Ho) core: slow magnetic relaxation displayed by the cobalt(ii)-dysprosium(iii) analogue.

    Science.gov (United States)

    Majee, Mithun Chandra; Towsif Abtab, Sk Md; Mondal, Dhrubajyoti; Maity, Manoranjan; Weselski, Marek; Witwicki, Maciej; Bieńko, Alina; Antkowiak, Michał; Kamieniarz, Grzegorz; Chaudhury, Muktimoy

    2018-03-06

    A new family of [3 + 3] hexanuclear 3d-4f complexes [(μ 3 -CO 3 ){Co II Ln III L(μ 3 -OH)(OH 2 )} 3 ]-(ClO 4 )·mC 2 H 5 OH·nH 2 O (1-5) [Ln = La (1), Gd (2), Tb (3), Dy (4), and Ho (5)] have been prepared in moderate to high yields (62-78%) following a self-assembly reaction between the ligand 6,6',6''-(nitrilotris(methylene))tris-(2-methoxy-4-methylphenol) (H 3 L), Co(OAc) 2 ·4H 2 O and the lanthanide ion precursors in the mandatory presence of tetrabutylammonium hydroxide. During the reaction, atmospheric carbon dioxide is fixed in the product molecule as a bridging carbonato ligand which connects all the three lanthanide centers of this molecular assembly through a rare η 2 :η 2 :η 2 -μ 3 mode of bridging as revealed from X-ray crystallography. The metal centers in all these compounds, except the Gd III analogue (2), are coupled in antiferromagnetic manner while the nature of coupling in the CoGd complex is ferromagnetic. DFT calculations revealed that this ferromagnetic interaction occurs most likely by the Co II -Gd III superexchange, mediated via the bridging oxygen atoms. Only the Co II -Dy III compound (4) displayed a slow relaxation of the magnetization at a very low temperature as established by AC susceptibility measurements. The data provides an estimation of the activation energy U/k B = 9.2 K and the relaxation time constant τ 0 = 1.0 × 10 -7 s.

  11. Cermet electrode

    Science.gov (United States)

    Maskalick, Nicholas J.

    1988-08-30

    Disclosed is a cermet electrode consisting of metal particles of nickel, cobalt, iron, or alloys or mixtures thereof immobilized by zirconia stabilized in cubic form which contains discrete deposits of about 0.1 to about 5% by weight of praseodymium, dysprosium, terbium, or a mixture thereof. The solid oxide electrode can be made by covering a substrate with particles of nickel, cobalt, iron, or mixtures thereof, growing a stabilized zirconia solid oxide skeleton around the particles thereby immobilizing them, contacting the skeleton with a compound of praseodymium, dysprosium, terbium, or a mixture thereof, and heating the skeleton to a temperature of at least 500.degree. C. The electrode can also be made by preparing a slurry of nickel, cobalt, iron, or mixture and a compound of praseodymium, dysprosium, terbium, or a mixture thereof, depositing the slurry on a substrate, heating the slurry to dryness, and growing a stabilized zirconia skeleton around the metal particles.

  12. Chemical composition and microstructure of magnetically melt-textured Bi2Sr2Ca0.8Dy0.2Cu2O8-y

    International Nuclear Information System (INIS)

    Stassen, S.; Rulmont, A.; Krekels, T.; Ausloos, M.; Cloots, R.

    1996-01-01

    Dysprosium-doped Bi-based 2212 materials have been synthesized in the presence of a magnetic field, applied perpendicularly to the lateral face of a cylinder, by a melt-textured growth process. Thick (well oriented) layers of different chemical composition have been observed. A dysprosium-doped 2212 phase (the expected D phase) and a dysprosium-free bismuth-rich and strontium-deficient 2212 phase have been found. It is argued that the latter is a so-called M phase. Other impurity phases have been observed, connected with both 2212-type layers. A novel aspect of this work is the calcium solubility at the strontium site in the 2201 structure, and inversely the strontium solubility at the calcium site in the 8250 structure. (orig.)

  13. CRED Subsurface Temperature Recorder (STR); Swains Island, American Samoa; Long: -171.09087, Lat: -11.05859 (WGS84); Sensor Depth: 6.70m; Data Date Range: 20100316-20120321.

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — Data from Coral Reef Ecosystem Division (CRED), NOAA Pacific Islands Fisheries Science Center (PIFSC) Subsurface Temperature Recorders (STR) provide a time series of...

  14. CRED Sea Surface Temperature (SST) Buoy; NWHI, LAY; Long: -171.74252, Lat: 25.77290 (WGS84); Sensor Depth: 0.33m; Data Range: 20030724-20040923.

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — Data from Coral Reef Ecosystem Division (CRED), NOAA Pacific Islands Fisheries Science Center (PIFSC) Sea Surface Temperature (SST) Buoys provide a time series of...

  15. CRED Subsurface Temperature Recorder (STR); Swains Island, American Samoa; Long: -171.09113, Lat: -11.05870 (WGS84); Sensor Depth: 29.30m; Data Date Range: 20100316-20120321.

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — Data from Coral Reef Ecosystem Division (CRED), NOAA Pacific Islands Fisheries Science Center (PIFSC) Subsurface Temperature Recorders (STR) provide a time series of...

  16. Quantum paraelectric behavior of pyrochlore Pb.sub.1.83./sub.Mg.sub.0.29./sub.Nb.sub.1.71./sub.O.sub.6.39./sub..

    Czech Academy of Sciences Publication Activity Database

    Kamba, Stanislav; Nuzhnyy, Dmitry; Denisov, Sergey; Veljko, Sergiy; Bovtun, Viktor; Savinov, Maxim; Petzelt, Jan; Kalnberga, M.; Sternberg, A.

    2007-01-01

    Roč. 76, - (2007), 054125/1-054125/6 ISSN 1098-0121 R&D Projects: GA ČR(CZ) GA202/06/0403 Institutional research plan: CEZ:AV0Z10100520 Keywords : quantum paraelectrics * soft mode * infrared spectroscopy Subject RIV: BM - Solid Matter Physics ; Magnetism Impact factor: 3.172, year: 2007

  17. CRED Ocean Data Platform (ODP), Acoustic Doppler Profiler (ADP); AMSM, SWA; Long: -171.09092, Lat: -11.05848 (WGS84); Sensor Depth: 15.00m; Data Range: 20020227-20021207.

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — The Ocean Data Platform (ODP) is placed on the sea floor to measure water current profiles, waves, temperature and conductivity. The ODP consists of an upward...

  18. Osteoarthritis of the knee in coal miners: report by the Industrial Injuries Advisory Council in accordance with Section 171 of the Social Security Administration Act 1992 considering prescription for osteoarthritis of the knee in coal miners

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    2008-08-15

    The report considers prescription for osteoarthritis of the knee in miners. Osteoarthritis of the knee, a common disorder in the general population, was last reviewed by the Council in May 1995 in its Command paper 'Disorders of the Knee' (Cm. 2842). This report follows a representation from an ex-Council member highlighting epidemiological evidence of an increased risk of this disorder in miners. The coal mining industry has undergone many changes which have decreased the extent to which miners have been exposed to such employment conditions, notably the closure of many mines by 1986. However, there is evidence that the relevant exposure circumstances will still have occurred after 1986 in certain categories of miner, such as faceworkers working nonmechanised coal faces.It is recommended that osteoarthritis of the knee should be prescribed in relation to work as an underground miner for ten years or more in aggregate; but that to be reckonable, any service from 1986 onwards should be in certain specific categories of coal mining occupation, as set out in the recommended prescription schedule. 2 apps.

  19. CRED Sea Surface Temperature (SST) Buoy; NWHI, LAY; Long: -171.74250, Lat: 25.77240 (WGS84); Sensor Depth: 0.33m; Data Range: 20040924-20060910.

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — Data from Coral Reef Ecosystem Division (CRED), NOAA Pacific Islands Fisheries Science Center (PIFSC) Sea Surface Temperature (SST) Buoys provide a time series of...

  20. Doctoral Students in New Zealand Have Low Awareness of Institutional Repository Existence, but Positive Attitudes Toward Open Access Publication of Their Work. A Review of: Stanton, K. V., & Liew, C. L. (2012. Open access theses in institutional repositories: An exploratory study of the perceptions of doctoral students. Information Research, 17(1, paper 507. Available from http://InformationR.net/ir/17-1/paper507.html

    Directory of Open Access Journals (Sweden)

    Theresa S. Arndt

    2012-12-01

    Full Text Available Objective – To investigate doctoral students'knowledge of and attitudes toward openaccess models of scholarly communication andinstitutional repositories, and to examine theirwillingness to comply with a mandatoryinstitutional repository (IR submission policy.Design – Mixed method, sequentialexploratory design.Setting – A large, multi-campus New Zealanduniversity that mandates IR deposit of doctoraltheses.Subjects – Two doctoral students from each offour university colleges were interviewed. All901 doctoral students were subsequently sent asurvey, with 251 responding.Methods – Semi-structured interviews witheight subjects selected by purposive sampling,followed by a survey sent to all doctoralstudents. The authors used NVivo 8 foranalysis of interview data, along with a twophaseapproach to coding. First, they analyzedtranscripts from semi-structured interviewsline-by-line to identify themes. In the secondphase, authors employed focused coding toanalyze the most common themes and tomerge or drop peripheral themes. Themeswere mapped against Rogers' diffusion ofinnovation theory and social exchange theoryconstructs to aid interpretation. The resultswere used to develop a survey with a fixed set of response choices. Authors then analyzed survey results using Excel and SurveyMonkey, first as a single data set and then by discipline.Main Results – The authors found that general awareness of open access was high (62%, and overall support for open access publication was 86.3%. Awareness of IRs as a general concept was much lower at 48%. Those subject to a mandatory IR deposit policy for doctoral theses overwhelmingly indicated willingness to comply (92.6%, as did those matriculating prior to the policy (83.3%, although only 77.3% of all respondents agreed that deposit should be mandatory. Only 17.6% of respondents had deposited their own work in an IR, while 31.7% reported directly accessing a repository for research. The greatest perceived benefits of IR participation were removal of cost for readers, ease of sharing research, increased exposure and citing of one's work, and professional networking. The greatest perceived risks were plagiarism, loss of ability to publish elsewhere, and less prestige relative to traditional publication. The reason most given for selecting a specific publication outlet was recommendation of a doctoral supervisor. Disciplinary differences in responses were not sizable.For additional interpretation, the authors applied Rogers’s diffusion of innovations theory to determine the extent to which IRs are effective innovations. The authors posit that repositories will become a more widely adopted innovations as awareness of IRs in general increases, and through increased awareness that IR content is discoverable through major search engines such as Google Scholar, thus improving usability and increasing dissemination of research. Using the social exchange theory framework, the authors found that respondents’ expressed willingness to deposit their work in IRs demonstrated altruistic motives for sharing their research freely with others, appreciation for the reciprocity of gaining access to others’ research, and awareness of the potential direct reward of having their work cited more often.Conclusion – Authors identified that lack of awareness, rather than resistance to deposit, as the main barrier to IR depository participation. Major benefits perceived for participating included the public good of knowledge sharing and increased exposure for one’s work. Concerns included copyright and plagiarism issues. These findings have implications for communication and marketing campaigns to promote doctoral students' deposit of their work in institutional repositories. While respondents reported low direct use of IRs for conducting research, the vast majority reported using Google Scholar, and so may have unknowingly accessed open access repository content. This finding suggests that attention be given to enhanced metadata for optimizing discoverability of IR content through general search engines.

  1. Influence of a solvent on thermodynamics of electrolytic dissociation of simple and complex rare earth salts

    Energy Technology Data Exchange (ETDEWEB)

    Gorodyskij, A.V.; Fialkov, Yu.Ya.; Chernyj, D.B. (AN Ukrainskoj SSR, Kiev. Inst. Obshchej i Neorganicheskoj Khimii; Kievskij Politekhnicheskij Inst. (Ukrainian SSR))

    1982-03-01

    Influence of the double mixed solvent on thermodynamic characteristics of ionic migration of lanthanum, neodymium, europium and dysprosium chlorides as well as their phenanthroline complexes is considered. Decrease of lambdasub(c) of simple and complex rare earth salts in the lanthanum, neodymium-europium-dysprosium series as explained by increase of solvation degree, associated with lanthanum compression. It is shown that increase of methanol or propanol content results in exothermicity decrease of the ionic migration process. The temperature constituents of enthalpy and entropy of dissociation of the simple and complex rare earth salts are presented.

  2. Steric structure and thermodynamic aspects of Dy3+ complexes with aminobenzoic acids in aqueous solutions

    International Nuclear Information System (INIS)

    Kondrashina, Yu.G.; Mustafina, A.R.; Vul'fson, S.G.

    1994-01-01

    Stability and structure of dysprosium(3) aminobenzoate complexes with molar ratios Dy:L 1:1 and 1:2 (HL-aminobenzoic acid) in aqueous solutions are determined on the basis of pH-metric and paramagnetic birefringence data. The increase of conjugation effect in the series of benzoic, meta- ortho-, and para-aminobenzoic acid results in the increase of stability of 1:1 and 1:2 complexes. Features of the structure and coordination of ligands in dysprosium complexes with meta-, ortho-, and para-aminobenzoic acid are considered. 11 refs.; 4 figs.; 2 tabs

  3. Faraday effect in γ-Dy2S3 and c-Dy2O3 paramagnetic crystals

    International Nuclear Information System (INIS)

    Shelykh, A.I.

    1987-01-01

    Studies of spectral and temperature dependences of Faraday effect in γ-Dy 2 S 3 and C-Dy 2 O 3 paramagnetic crystals are conducted. Paramagnetism of these crystals is brought about by Dy 3+ ions. Estimation of the effect of such factors as the value of paramagnetic ion concentration, width of the forbidden band, crystallochemical composition on magnetooptical effect in the considered compounds of dysprosium is carried out on the basis of the obtained experimental data and theoretical analysis. It is shown, that the Faraday effect in the considered compounds of dysprosium as well as the value of paramagnetic moment may be regarded rather accurately in free ion approximation

  4. The change of the state of an endohedral fullerene by encapsulation into SWCNT: a Raman spectroelectrochemical study of Dy3N@C80 peapods

    Czech Academy of Sciences Publication Activity Database

    Kalbáč, Martin; Kavan, Ladislav; Zukalová, Markéta; Yang, S.; Čech, J.; Roth, S.; Dunsch, L.

    2007-01-01

    Roč. 13, - (2007), s. 8811-8817 ISSN 0947-6539 R&D Projects: GA AV ČR KJB400400601; GA MŠk LC510 Institutional research plan: CEZ:AV0Z40400503 Keywords : dysprosium * electrochemistry * fullerenes * nanotubes Subject RIV: CG - Electrochemistry Impact factor: 5.330, year: 2007

  5. Preparation, Structure Characterization and Thermal Decomposition ...

    African Journals Online (AJOL)

    NJD

    Decomposition Process of the Dysprosium(III) m-Methylbenzoate 1 ... A dinuclear complex [Dy(m-MBA)3phen]2·H2O was prepared by the reaction of DyCl3·6H2O, m-methylbenzoic acid and .... ing rate of 10 °C min–1 are illustrated in Fig. 4.

  6. Critical resources in clean energy technologies and waste flows

    DEFF Research Database (Denmark)

    Habib, Komal

    is fraught with the risk of shifting the supply security problem from one type of non‐renewable resources (fossil fuels) to another type (metals), in particular the specialty metals such as rare earth elements e.g. neodymium and dysprosium. This PhD work presented an in‐depth analysis of potential resource...

  7. Regulation of the growth and photosynthesis of cherry tomato ...

    African Journals Online (AJOL)

    The growth and photosynthetic characteristics of cherry tomato seedlings were investigated under seven light irradiations such as dysprosium lamps (white light; control, C), red light emitting diodes (LEDs) (R), blue LEDs (B), orange LEDs (O), green LEDs (G), red and blue LEDs (RB) and red, blue and green LEDs (RBG) ...

  8. Axial segregation in high intensity discharge lamps measured by laser absorption spectroscopy

    NARCIS (Netherlands)

    Flikweert, A.J.; Nimalasuriya, T.; Groothuis, C.H.J.M.; Kroesen, G.M.W.; Stoffels, W.W.

    2005-01-01

    High intensity discharge lamps have a high efficiency. These lamps contain rare-earth additives (in our case dysprosium iodide) which radiate very efficiently. A problem is color separation in the lamp because of axial segregation of the rare-earth additives, caused by diffusion and convection. Here

  9. Axial segregation in high intensity discharge lamps measured by laser absorption spectroscopy

    NARCIS (Netherlands)

    Stoffels, W.W.; Flikweert, A.J.; Nimalasuriya, T.; Groothuis, C.H.J.M.; Haverlag, M.; Kroesen, G.M.W.

    2005-01-01

    HID lamps containing rare earth additives (in our case dysprosium) show color separation because of axial segregation, caused by diffusion and convection. Two-dimensional atomic Dy density profiles are measured by means of laser absorption spectroscopy. The radially resolved atomic density

  10. Test plan for air monitoring during the Cryogenic Retrieval Demonstration

    International Nuclear Information System (INIS)

    Yokuda, E.

    1992-06-01

    This report presents a test plan for air monitoring during the Cryogenic Retrieval Demonstration (CRD). Air monitors will be used to sample for the tracer elements neodymium, terbium, and ytterbium, and dysprosium. The results from this air monitoring will be used to determine if the CRD is successful in controlling dust and minimizing contamination. Procedures and equipment specifications for the test are included

  11. Material flow analysis of NdFeB magnets for Denmark: a comprehensive waste flow sampling and analysis approach.

    Science.gov (United States)

    Habib, Komal; Schibye, Peter Klausen; Vestbø, Andreas Peter; Dall, Ole; Wenzel, Henrik

    2014-10-21

    Neodymium-iron-boron (NdFeB) magnets have become highly desirable for modern hi-tech applications. These magnets, in general, contain two key rare earth elements (REEs), i.e., neodymium (Nd) and dysprosium (Dy), which are responsible for the very high strength of these magnets, allowing for considerable size and weight reduction in modern applications. This study aims to explore the current and future potential of a secondary supply of neodymium and dysprosium from recycling of NdFeB magnets. For this purpose, material flow analysis (MFA) has been carried out to perform the detailed mapping of stocks and flows of NdFeB magnets in Denmark. A novel element of this study is the value added to the traditionally practiced MFAs at national and/or global levels by complementing them with a comprehensive sampling and elemental analysis of NdFeB magnets, taken out from a sample of 157 different products representing 18 various product types. The results show that the current amount of neodymium and dysprosium in NdFeB magnets present in the Danish waste stream is only 3 and 0.2 Mg, respectively. However, this number is estimated to increase to 175 Mg of neodymium and 11.4 Mg of dysprosium by 2035. Nevertheless, efficient recovery of these elements from a very diverse electronic waste stream remains a logistic and economic challenge.

  12. Scanning Electron Microscope-Cathodoluminescence Analysis of Rare-Earth Elements in Magnets.

    Science.gov (United States)

    Imashuku, Susumu; Wagatsuma, Kazuaki; Kawai, Jun

    2016-02-01

    Scanning electron microscope-cathodoluminescence (SEM-CL) analysis was performed for neodymium-iron-boron (NdFeB) and samarium-cobalt (Sm-Co) magnets to analyze the rare-earth elements present in the magnets. We examined the advantages of SEM-CL analysis over conventional analytical methods such as SEM-energy-dispersive X-ray (EDX) spectroscopy and SEM-wavelength-dispersive X-ray (WDX) spectroscopy for elemental analysis of rare-earth elements in NdFeB magnets. Luminescence spectra of chloride compounds of elements in the magnets were measured by the SEM-CL method. Chloride compounds were obtained by the dropwise addition of hydrochloric acid on the magnets followed by drying in vacuum. Neodymium, praseodymium, terbium, and dysprosium were separately detected in the NdFeB magnets, and samarium was detected in the Sm-Co magnet by the SEM-CL method. In contrast, it was difficult to distinguish terbium and dysprosium in the NdFeB magnet with a dysprosium concentration of 1.05 wt% by conventional SEM-EDX analysis. Terbium with a concentration of 0.02 wt% in an NdFeB magnet was detected by SEM-CL analysis, but not by conventional SEM-WDX analysis. SEM-CL analysis is advantageous over conventional SEM-EDX and SEM-WDX analyses for detecting trace rare-earth elements in NdFeB magnets, particularly dysprosium and terbium.

  13. Accumulation of weak optical signals and spectral memory in InSe single crystals

    International Nuclear Information System (INIS)

    Abdinov, A.Shj.; Babaeva, R.F.

    1995-01-01

    Dysprosium alloying effect on the electron and physico-chemical properties of InSe monocrystals is studied. Accumulation of low light signals and spectral or color memory is shown to be observed under certain conditions (temperature, content of admitted impurity, wave length and light intensity)

  14. Tuning the activity of Pt alloy electrocatalysts by means of the lanthanide contraction

    DEFF Research Database (Denmark)

    Escribano, Maria Escudero; Malacrida, Paolo; Hansen, Martin Hangaard

    2016-01-01

    is lanthanum, cerium, samarium, gadolinium, terbium, dysprosium, thulium, or calcium. The materials are among the most active polycrystalline Pt-based catalysts reported, presenting activity enhancement by a factor of 3 to 6 over Pt. The active phase consists of a Pt overlayer formed by acid leaching. The ORR...

  15. Influence of organic component on geometry and stability of the Dy(3) complexes with benzoic and aminobenzoic acids in water-80 vol.% DMSO(DMFA) mixtures

    International Nuclear Information System (INIS)

    Kondrashina, Yu.G.; Mustafina, A.R.; Devyatov, F.V.; Vul'fson, S.G.; Kazanskij Gosudarstvennyj Univ., Kazan

    1995-01-01

    Data of pH-metric and magnetooptical analyses were used to evaluate stability and structure of benzoate and aminobenzoate dysprosium (3) complexes in water and water - 80 vol.% DMSO (DMFA) mixtures. Factors, dictating change of complex structure and stability when passing from water to organic water solvents, are discussed. 19 refs.; 2 figs.; 1 tab

  16. Thermal characterization of (U, Dy)O2 pellets

    International Nuclear Information System (INIS)

    Pelloni, M; Bianchi, L; Pablovich, M.E; Kaufmann, F; Kempf, R

    2012-01-01

    The thermal diffusivity of (U,Dy)O 2 pellets were determined in the temperature range 250 K to 1600 K measured by the laser flash method. The dependence of thermal with temperature and dysprosium content was studied and found in good agreement with physical models available (author)

  17. Material Flow Analysis of NdFeB magnets for Denmark: A comprehensive waste flow sampling and analysis approach

    DEFF Research Database (Denmark)

    Habib, Komal; Schibye, Peter Klausen; Vestbø, Andreas Peter

    2014-01-01

    for considerable size and weight reduction in modern applications. This study aims to explore the current and future potential of secondary supply of neodymium and dysprosium from recycling of NdFeB magnets. For this purpose, Material Flow Analysis (MFA) has been carried out to perform the detailed mapping...

  18. Field dosimetry on sterilization area of medical-hospitable materials

    International Nuclear Information System (INIS)

    Mariano, C.S.T.P.; Campos, L.L.

    1992-01-01

    The calcium sulfate doped with dysprosium, used in high dose dosimetry by electron paramagnetic resonance (EPR), is studied on field dosimetry for medical-hospitable materials sterilization. The calibration curves of EPR signal in function of absorbed dose in air and the thermal decay of EPR signal at room temperature are also presented. (C.G.C)

  19. A Thermally Actuated Flux Pump for Energizing YBCO Pucks

    Science.gov (United States)

    2016-05-01

    a Hall sensor with an advertised active area of approximately 1.016 mm diameter supplied by Lakeshore was positioned in the centre of the YBCO as...top and the coldhead (green) along the bottom. The brown colour is the light green of the coldhead and the orange of the dysprosium centre

  20. Excited bands in even-even rare-earth nuclei

    International Nuclear Information System (INIS)

    Vargas, Carlos E.; Hirsch, Jorge G.

    2004-01-01

    The energetics of states belonging to normal parity bands in even-even dysprosium isotopes, and their B(E2) transition strengths, are studied using an extended pseudo-SU(3) shell model. States with pseudospin 1 are added to the standard pseudospin 0 space, allowing for a proper description of known excited normal parity bands

  1. Perovskite catalysts for oxidative coupling

    Science.gov (United States)

    Campbell, Kenneth D.

    1991-01-01

    Perovskites of the structure A.sub.2 B.sub.2 C.sub.3 O.sub.10 are useful as catalysts for the oxidative coupling of lower alkane to heavier hydrocarbons. A is alkali metal; B is lanthanide or lanthanum, cerium, neodymium, samarium, praseodymium, gadolinium or dysprosium; and C is titanium.

  2. ORF Alignment: NC_003305 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available ... Length = 231 ... Query: 171 LDAALRGAEITQKRATELQAKDVGTVAASDNAQVALDQARANVVAGEAAISSAKANVELL 230 ... LDA...ALRGAEITQKRATELQAKDVGTVAASDNAQVALDQARANVVAGEAAISSAKANVELL Sbjct: 9 ... LDAALRGAEITQKRATELQAKDVGTVAASDNAQVALDQARANVVAGEAAISSAKANVEL

  3. ORF Alignment: NC_006513 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available th = 129 ... Query: 171 RKRAEEVANENREKYQKLFHMLPIGISITDAHGDILEANCQFAEMVGARRIQPESWRKLP 230 ... RKRAEEVANENREKYQKLFHMLPIGISITDAH...GDILEANCQFAEMVGARRIQPESWRKLP Sbjct: 1 ... RKRAEEVANENREKYQKLFHMLPIGISITDAH

  4. ORF Alignment: NC_006322 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available 12 PRQGADLQYTMTLSFEEAAFGKETTIEIPREETCETCSGSGAKPGTKPETCSHCGGSGQL 171 ... PRQGADLQYTMTLSFEEAAFGKETTIEIPREETCETCSGSGAKPGTKPETCS...HCGGSGQL Sbjct: 1 ... PRQGADLQYTMTLSFEEAAFGKETTIEIPREETCETCSGSGAKPGTKPETCSHCGGSGQL 60 ...

  5. ORF Alignment: NC_006270 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available 12 PRQGADLQYTMTLSFEEAAFGKETTIEIPREETCETCSGSGAKPGTKPETCSHCGGSGQL 171 ... PRQGADLQYTMTLSFEEAAFGKETTIEIPREETCETCSGSGAKPGTKPETCS...HCGGSGQL Sbjct: 1 ... PRQGADLQYTMTLSFEEAAFGKETTIEIPREETCETCSGSGAKPGTKPETCSHCGGSGQL 60 ...

  6. Browse Title Index

    African Journals Online (AJOL)

    Items 151 - 171 of 171 ... Vol 4 (2013), World Trade Organisation (WTO): Trade rules/agreements and developing countries, Abstract PDF. Emeka Adibe. Vol 6 (2015), Xenophobia: A crime against humanity and its attendant implications on human rights, Abstract PDF. Simon-Peter Ayooluwa St. Emmanuel. 151 - 171 of 171 ...

  7. ORF Alignment: NC_003277 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available KWAIVEESKQIQALRYYSAQGYSVINKYLRGDDYPETQAKETLLSRDYLSTNEPSDEEF 60 ... Query: 504 PDKAWIND...TILNIYLEKGHKGRILGDVAHFKGEAEMLFPPNTKLKIESIVN 554 ... PDKAWINDTILNIYLEKGHKGRILGDVAHFKGEAEMLFPPNTKLKIESIVN Sbjct: 121 PDKAWINDTILNIYLEKGHKGRILGDVAHFKGEAEMLFPPNTKLKIESIVN 171

  8. ORF Alignment: NC_006855 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available KWAIVEESKQIQALRYYSAQGYSVINKYLRGDDYPETQAKETLLSRDYLSTNEPSDEEF 60 ... Query: 504 PDKAWIND...TILNIYLEKGHKGRILGDVAHFKGEAEMLFPPNTKLKIESIVN 554 ... PDKAWINDTILNIYLEKGHKGRILGDVAHFKGEAEMLFPPNTKLKIESIVN Sbjct: 121 PDKAWINDTILNIYLEKGHKGRILGDVAHFKGEAEMLFPPNTKLKIESIVN 171

  9. ORF Alignment: NC_003901 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available KIVEYTTREAFWDLYKPGCDEHLVLHKIRKVPAFVKELDFVACDEDT 60 ... Query: 135 IFGNPDYYHRFGFVNAREYDIRTSWGDNFDAFMALEL 171 ... ... ... IFGNPDYYHRFGFVNAREYDIRTSWGDNFDAFMALEL Sbjct: 121 IFGNPDYYHRFGFVNAREYDIRTSWGDNFDAFMALEL 157

  10. Dicty_cDB: [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VF (Link to library) VFC171 (Link to dictyBase) - - - Contig-U16478-1 VFC171P (Link... to Original site) VFC171F 482 VFC171Z 633 VFC171P 1115 - - Show VFC171 Library VF (Link to library) Clone ID VFC171 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U16478-1 Original site URL http://dict...ptttrlptt trlstttrlptttrlptttrlptttrlptttrlsttrlxtttrlstswctswctswictr ygswissrllcwynhs*l*t*c*sfkksnerywyk*i...ologous to C-terminal repeat sequence of rhodopsin and synaptophysin. 88 1e-15 3 X54062 |X54062.1 Dictyostel

  11. Genotoxic and cytotoxic damage by the therapeutic radiopharmaceutical [{sup 166}Dy]Dy/{sup 166}Ho-EDTMP as in vivo generator system; Dano genotoxico y citotoxico por el radiofarmaco terpeutico [{sup 166}Dy]Dy/{sup 166}Ho-EDTMP como sistema de generador in vivo

    Energy Technology Data Exchange (ETDEWEB)

    Pedraza L, M; Piedras R, J [Instituto Nacional de Ciencias Medicas y Nutricion, Salvador Zubiran. Vasco. de Quiroga 15, 14000 Mexico D.F. (Mexico); Ferro F, G; Morales R, P [ININ, Km. 36.5 Carretera Mexico-Toluca, Ocoyoacac, 52045 Estado de Mexico (Mexico); Murphy S, E [Hospital Santaelena, Mexico D.F. (Mexico); Hernandez O, O [Escuela Superior de Fisica y Matematicas, IPN, Mexico D.F. (Mexico)

    2005-07-01

    In patients with leukemias and multiple myeloma, the cure can be obtained to inclination of a bone marrow transplant (m.o.), for that which one is used a combination of external radiotherapy and chemotherapy with the consequent toxicity to healthy organs. The complex [{sup 166}Dy]Dy/{sup 166}Ho-ethylenediaminetetramethylenephosphonate ([{sup 166}Dy]Dy/{sup 166}Ho-EDTMP) it forms a generator system in vivo stable with bony selective likeness in mice therefore, this it could work as a therapeutic radiopharmaceutical for bone marrow ablation. The objective of this original work was to determine the genotoxic and cytotoxic damage produced by the [{sup 166}Dy]Dy/{sup 166}Ho-EDTMP like a generator system in vivo by means of the reticulocytes reduction (RET) and micronucleus elevation in reticulocytes (RET-MN) in peripheral blood and to evaluate its myeloablative potential for histopathologic studies. It was irradiated {sup 166}Dy{sub 2}O{sub 3} enriched and it was add in form {sup 166}DyCI{sub 3} to the EDTMP in a softening media of phosphates (pH 8), the optimal molar relationship {sup 166}Dy: EDTMP was 1.7:1 and the radiochemical purity was evaluated by ITLC. The Dy:EDTMP complexes, non radioactive, its were prepared in the same way with non irradiated dysprosium oxide. A group of BALB/c mice was injected intraperitoneally with the radiopharmaceutical and two groups of control mice were injected with the non radioactive complex and with sodium chloride 0.9% respectively. Before injecting each one of the solutions it was take a basal sample of peripheral blood of the mouse tail and each 48 h post-injection during 12 d. The animals were sacrificed to obtain the organs of interest and to determine the radioactivity in each one. The femur was used for the histopathologic studies. The quantification of the frequency of RET and RET-MN was carried out by flow cytometry of the sanguine samples and the Monte Carlo code MCNP4B for the dosimetry calculations was used. The

  12. Genotoxic and cytotoxic damage by the therapeutic radiopharmaceutical [166Dy]Dy/166Ho-EDTMP as in vivo generator system

    International Nuclear Information System (INIS)

    Pedraza L, M.; Piedras R, J.; Ferro F, G.; Morales R, P.; Murphy S, E.; Hernandez O, O.

    2005-01-01

    In patients with leukemias and multiple myeloma, the cure can be obtained to inclination of a bone marrow transplant (m.o.), for that which one is used a combination of external radiotherapy and chemotherapy with the consequent toxicity to healthy organs. The complex [ 166 Dy]Dy/ 166 Ho-ethylenediaminetetramethylenephosphonate ([ 166 Dy]Dy/ 166 Ho-EDTMP) it forms a generator system in vivo stable with bony selective likeness in mice therefore, this it could work as a therapeutic radiopharmaceutical for bone marrow ablation. The objective of this original work was to determine the genotoxic and cytotoxic damage produced by the [ 166 Dy]Dy/ 166 Ho-EDTMP like a generator system in vivo by means of the reticulocytes reduction (RET) and micronucleus elevation in reticulocytes (RET-MN) in peripheral blood and to evaluate its myeloablative potential for histopathologic studies. It was irradiated 166 Dy 2 O 3 enriched and it was add in form 166 DyCI 3 to the EDTMP in a softening media of phosphates (pH 8), the optimal molar relationship 166 Dy: EDTMP was 1.7:1 and the radiochemical purity was evaluated by ITLC. The Dy:EDTMP complexes, non radioactive, its were prepared in the same way with non irradiated dysprosium oxide. A group of BALB/c mice was injected intraperitoneally with the radiopharmaceutical and two groups of control mice were injected with the non radioactive complex and with sodium chloride 0.9% respectively. Before injecting each one of the solutions it was take a basal sample of peripheral blood of the mouse tail and each 48 h post-injection during 12 d. The animals were sacrificed to obtain the organs of interest and to determine the radioactivity in each one. The femur was used for the histopathologic studies. The quantification of the frequency of RET and RET-MN was carried out by flow cytometry of the sanguine samples and the Monte Carlo code MCNP4B for the dosimetry calculations was used. The radiochemical purity was 99% and in average the specific

  13. Food-grade titanium dioxide exposure exacerbates tumor formation in colitis associated cancer model.

    Science.gov (United States)

    Urrutia-Ortega, Ismael M; Garduño-Balderas, Luis G; Delgado-Buenrostro, Norma L; Freyre-Fonseca, Verónica; Flores-Flores, José O; González-Robles, Arturo; Pedraza-Chaverri, José; Hernández-Pando, Rogelio; Rodríguez-Sosa, Miriam; León-Cabrera, Sonia; Terrazas, Luis I; van Loveren, Henk; Chirino, Yolanda I

    2016-07-01

    Colorectal cancer is the fourth worldwide cause of death and even if some dietary habits are consider risk factors, the contribution of food additives including foodgrade titanium dioxide (TiO2), designated as E171, has been poorly investigated. We hypothesized that oral E171 intake could have impact on the enhancement of colorectal tumor formation and we aimed to investigate if E171 administration could enhance tumor formation in a colitis associated cancer (CAC) model. BALB/c male mice were grouped as follows: a) control, b) E171, c) CAC and d) CAC + E171 group (n = 6). E171 used in this study formed agglomerates of 300 nm in water. E171 intragastric administration (5 mg/kg body weight/5 days/10 weeks) was unable to induce tumor formation but dysplastic alterations were observed in the distal colon but enhanced the tumor formation in distal colon (CAC + E171 group) measured by tumor progression markers. Some E171 particles were internalized in colonic cells of the E171 and CAC + E171 groups and both groups showed a decrease in goblet cells in the distal colon. However the CAC + E171 group showed a higher decrease of these cells that act as protection barrier in colon. These results suggest that E171 could worsen pre-existent intestinal diseases. Copyright © 2016 Elsevier Ltd. All rights reserved.

  14. Radiative properties of ceramic metal-halide high intensity discharge lamps containing additives in argon plasma

    Science.gov (United States)

    Cressault, Yann; Teulet, Philippe; Zissis, Georges

    2016-07-01

    The lighting represents a consumption of about 19% of the world electricity production. We are thus searching new effective and environment-friendlier light sources. The ceramic metal-halide high intensity lamps (C-MHL) are one of the options for illuminating very high area. The new C-MHL lamps contain additives species that reduce mercury inside and lead to a richer spectrum in specific spectral intervals, a better colour temperature or colour rendering index. This work is particularly focused on the power radiated by these lamps, estimated using the net emission coefficient, and depending on several additives (calcium, sodium, tungsten, dysprosium, and thallium or strontium iodides). The results show the strong influence of the additives on the power radiated despite of their small quantity in the mixtures and the increase of visible radiation portion in presence of dysprosium.

  15. Dependence of ion - photon emission characteristics on the concentration of implanted atoms of the bombarding beam

    International Nuclear Information System (INIS)

    Belykh, S.F.; Evtukhov, R.N.; Redina, I.V.; Ferleger, V.Kh.

    1989-01-01

    Results of experiment, where Dy + beams, its spraying products emitting intensively optical radiation with continuous spectrum (CSR), are used for tantalum surface bombardment, are presented. The given experiment allowed one to separate the scattered particle CSR contribution and was conducted under controlled beam n atom concentration on the target surface. E 0 energy and j 0 dysprosium ion flux density made up respectively 3.5 keV and 3x10 5 Axcm -2 . The obtained result analysis has shown that a notable dependence of spectrum type on n value is detected. Dy scattered atoms to not emit CSR. The main contribution to CSR is made by sprayed particles, containing dysprosium atoms

  16. Paramagnetic metal complexes as potential relaxation agents for NMR imaging

    International Nuclear Information System (INIS)

    Coroiu, Ilioara; Demco, D. E.; Darabont, Al.; Bogdan, M.

    1997-01-01

    The development of nuclear magnetic resonance (NMR) imaging technique as a clinical diagnostic modality has prompted the need for a new class of pharmaceuticals. These drugs must be administered to a patient in order to enhance the image contrast between the normal and diseased tissue and/or indicate the status of organ function or blood flow. Paramagnetic compounds are presently undergoing extensive evaluation as contrast agents in magnetic resonance imaging (MRI). These agents increase contrast in MRI by differentially localizing in tissue where they increase the relaxation rates of nearby water protons. The longitudinal R 1 and transverse R 2 relaxivities were measured as a function of molar concentrations for some new paramagnetic complexes like the following: dysprosium, erbium and gadolinium citrates, gadolinium methylene diphosphonate, dysprosium and gadolinium iminodiacetate, manganese para-aminobenzoate and copper nicotinate. The available theoretical approaches for quantitative understanding are presented. (authors)

  17. Comparative examination of the fresh and spent nuclear TRIGA fuel by neutron radiography

    International Nuclear Information System (INIS)

    Dinca, M.

    2016-01-01

    At the Institute for Nuclear Research (INR) there is in operation an underwater (wet) neutron radiography facility (INUM) designed especially for nuclear fuel investigation. INUM was involved in CANDU experimental type and TRIGA type nuclear fuel investigations. In this paper are presented the results after investigation of the nuclear fuel TRIGA-HEU and TRIGA-LEU, fresh and spent, using transfer method with metallic foils of dysprosium and indium and radiographic films (38 cm x 10 cm). This method is the most suitable for spent fuel and offers a high geometrical resolution of the images that subsequently are digitalized with a professional scanner for films. From the images obtained for TRIGA-HEU and TRIGA-LEU with different degree of burn-up there are established the opportunities to use dysprosium or indium converter foils based on their response to thermal or epithermal neutrons to evaluate the degree of burn-up, dimensional measurements, defects etc. (authors)

  18. Extraction spectrophotometric determination of rare earth with trioctylethylammonium bromide and Xylenol Orange

    International Nuclear Information System (INIS)

    Shijo, Yoshio

    1976-01-01

    A spectrophotometric method of determination of the rare earth was studied by the solvent extraction of rare earth-Xylenol Orange chelate into xylene solution of trioctylethylammonium bromide(TOEA). The rare earth-XO-TOEA complexes are extracted into aromatic hydrocarbons such as benzene, toluene, and xylene, but not into polar solvents such as n-butanol ethylacetate, methylisobutylketone, and nitrobenzene. The optimum pH range for the extraction were 6.3 -- 6.7, 6.3 -- 6.5, 5.8 -- 6.9, 5.7 -- 6.9, and 5.5 -- 6.8 for lanthanum, praseodymium, cerium, gadolinium, and dysprosium, respectively. The absorption maximum of the complexes extracted into xylene were found at 605 nm for lanthanum, praseodymium, and cerium, 596 nm for gadolinium, and 590 nm for dysprosium. Beer's law held for about 0 -- 4.5 μg of rare earth per 5 ml of xylene. The molar absorptivity of the extracted species were 1.53x10 5 , 1.42x10 5 , 1.35x10 5 , 8.5x10 4 , 8.2x10 4 cm -1 mol -1 l for lanthanum, praseodymium, cerium, gadolinium, and dysprosium, respectively. The composition of the ternary complexes were estimated to be M:XO:TOEA=1:1:2 for gadolinium and dysprosium, whereas 1:2:n for lanthanum, praseodymium and cerium. Combination ratio n of TOEA to metal-XO chelates in the latters could not be estimated by the commonly available methods. Thorium, vanadium, uranium, bismuth, aluminum, zirconium, chromium, nitrate, perchlorate and iodide interfered when triethylenetetramine and 1,10-phenanthroline were added as masking agent. (auth.)

  19. Using T2-Exchange from Ln3+DOTA-Based Chelates for Contrast-Enhanced Molecular Imaging of Prostate Cancer with MRI

    Science.gov (United States)

    2016-04-01

    thereby performing disease staging entirely non-invasively. Also, in contrast to PET/CT or SPECT/CT, disease diagnostics and therapy monitoring would...2011;6.e27370. 11. Zhang SR, Sherry AD. Physical characteristics of lanthanide com- plexes that act as magnetization transfer (MT) contrast agents. J...reper- fused and nonreperfused myocardial infarctions - MR imaging with dysprosium-DTPA-BMA in the pig. Acta Radiol 1996;37:18–26. 28. Nilsson S

  20. The study of heat conductivity properties of GdS1.48 and DyS1.48

    International Nuclear Information System (INIS)

    Ahmadov, O.R.

    2009-01-01

    The heat conductivity properties of sulfides of gadolinium and dysprosium up to 900 K with use of the average speed of ultrasound distribution, a specific thermal capacity and Viderman-Frans law have been investigated. The value of Debay temperature, thermal extension coefficient and the temperature dependence are established. It is shown that the scattering on crystal lattice phonons plays the main role in lattice heat conductivity

  1. Energy dependence of thermoluminescent response of CaSO{sub 4}:Dy, LiF:Mg and micro LiF:Mg,Ti in clinical beams of electrons by using different simulator objects; Dependencia energetica da resposta TL de dosimetros de CaSO{sub 4}:Dy, LiF:Mg e microLiF:Mg,Ti em feixes clinicos de eletrons utilizando diferentes objetos simuladores

    Energy Technology Data Exchange (ETDEWEB)

    Bravim, Amanda; Campos, Leticia Lucente, E-mail: abravin@ipen.b, E-mail: rsakuraba@einstein.b, E-mail: lcrodri@ipen.b [Instituto de Pesquisas Energeticas e Nucleares (IPEN/CNEN-SP), Sao Paulo, SP (Brazil); Sakuraba, Roberto K.; Cruz, Jose Carlos da, E-mail: rsakuraba@einstein.b, E-mail: josecarlosc@einstein.b [Hospital Israelita Albert Einstein (HIAE), Sao Paulo, SP (Brazil)

    2011-10-26

    Yet not so widely applied in radiotherapy, the calcium sulfate doped with dysprosium (CaSO{sub 4}:Dy) is used in radioprotection and studies has been demonstrated its great potential for the dosimetry in radiotherapy. This work evaluates the energy dependence of the thermoluminescent answer of the CaSO{sub 4}:D, LiF:Mg,Ti (TLD-100) and micro LiF:Mg,Ti in clinical beams of electrons by using water simulators, PMMA and solid water

  2. Phosphor for thermoluminescent type radiation dosimeter

    International Nuclear Information System (INIS)

    Nada, N.; Yamashita, T.

    1975-01-01

    This has the accumulation effect of radiation energy and is mainly used as the element for thermoluminescent type radiation dosimeters. It has as the principal constituent a phosphor consisting of calcium sulfate as the principal constituent and other impurity elements such as dysprosium, thulium and the like. It is more sensitive by the order of 1 to 2 or more figures than the conventional ones and is excellent in the retention of absorbed radiation energy. (U.S.)

  3. Role of hydrogen in Nd–Fe–B sintered magnets with DyH{sub x} addition

    Energy Technology Data Exchange (ETDEWEB)

    Liu, Pan [State Key Laboratory of Silicon Materials, Department of Materials Science and Engineering, Zhejiang University, Hangzhou 310027 (China); Ma, Tianyu, E-mail: maty@zju.edu.cn [Key Laboratory of Novel Materials for Information Technology of Zhejiang Province, Zhejiang University, Hangzhou 310027 (China); Wang, Xinhua, E-mail: xinhwang@zju.edu.cn [State Key Laboratory of Silicon Materials, Department of Materials Science and Engineering, Zhejiang University, Hangzhou 310027 (China); Zhang, Yujing [State Key Laboratory of Silicon Materials, Department of Materials Science and Engineering, Zhejiang University, Hangzhou 310027 (China); Yan, Mi [State Key Laboratory of Silicon Materials, Department of Materials Science and Engineering, Zhejiang University, Hangzhou 310027 (China); Key Laboratory of Novel Materials for Information Technology of Zhejiang Province, Zhejiang University, Hangzhou 310027 (China)

    2015-04-15

    Highlights: • DyH{sub 2} and DyH{sub 3} fine powder were prepared. • Effect of DyH{sub x} on the magnetic properties of Nd–Fe–B sintered magnets was studied. • The effect mechanism of Dy hydrides was discussed. • The magnetic properties are greatly improved by DyH{sub 2} and DyH{sub 3} addition. - Abstract: In order to improve the coercivity of Nd–Fe–B sintered magnets, DyH{sub 2} and DyH{sub 3} fine powders were prepared and used as additive for preparing Nd–Fe–B sintered magnets. The effects of DyH{sub x} powders addition on the microstructures and the magnetic properties of the magnets have been investigated. It was found that hydrogen will react with oxygen of NdO{sub x} rich intergranular phases to form Nd rich phases by dysprosium hydride addition. The Nd-rich grain boundary phases are more homogenous and continuous because the volume fraction of Nd-rich grain boundary phases increases with respect to the Nd oxide phases. After desorption, fine dysprosium powders become more active and wrap matrix phases well so that the diffusion of dysprosium to the surface layer of matrix phases is convenient, so dysprosium decreases in grain boundary phases and aggregates in surface layer of matrix phases. Then, intrinsic coercivity of NdFeB sintered magnets is improved from 14.96 kOe to 20.5 kOe and 20.31 kOe by 2.0 wt.% DyH{sub 3} and 2.0 wt.% DyH{sub 2} addition, respectively. This study has shown that DyH{sub x} addition can reduce the content of oxygen in grain boundary phases. This can be an effective method for massive production.

  4. Neutron flux distribution measurement in the elementary cell of the RB reactor

    Energy Technology Data Exchange (ETDEWEB)

    Takac, S [Boris Kidric Institute of Nuclear Sciences Vinca, Beograd (Yugoslavia)

    1963-04-15

    The distribution of thermal neutrons was measured in the elementary cell with dysprosium foils for different lattice pitches and the results obtained were given. From the distributions measured average fluxes were determined for every single zone. By using the published data concerning effective absorption cross sections thermal utilization factors were calculated and their changes given as functions of lattice pitches: l = 8.0 cm; 11.3 cm and 17.9 cm. (author)

  5. Thermodynamics of ionic migration of simple and complex rare earth salts in mixed alcohol solvents

    International Nuclear Information System (INIS)

    Gorodyskij, A.V.; Fialkov, Yu.Ya.; Chernyj, D.B.

    1982-01-01

    The influence of the composition of double mixed solvents (water-methanol and methanol-propanol) on thermodynamic characteristics of electrolytic dissociation process-enthalpy and entropy, dissociation constants of chlorides and diphenanthroline chlorides of lanthanum, neodymium, europium and dysprosium, is analyzed. It is shown that when passing from water to methanol, that is, with decrease of dielectric permeability, the endothermicity of electrolytic dissociation process increases

  6. Thermodynamics of ionic migration of simple and complex rare earth salts in mixed alcohol solvents

    Energy Technology Data Exchange (ETDEWEB)

    Gorodyskij, A.V.; Fialkov, Yu.Ya.; Chernyj, D.B. (AN Ukrainskoj SSR, Kiev. Inst. Obshchej i Neorganicheskoj Khimii; Kievskij Politekhnicheskij Inst. (Ukrainian SSR))

    1982-04-01

    The influence of the composition of double mixed solvents (water-methanol and methanol-propanol) on thermodynamic characteristics of electrolytic dissociation process-enthalpy and entropy, dissociation constants of chlorides and diphenanthroline chlorides of lanthanum, neodymium, europium and dysprosium, is analyzed. It is shown that when passing from water to methanol, that is, with decrease of dielectric permeability, the endothermicity of electrolytic dissociation process increases.

  7. Application of Atomic Fluorescence to Measurement of Combustion Temperature in Solid Propellants.

    Science.gov (United States)

    1986-12-04

    into a cytal (yttrium- aluminum -garnet) is shown to be an ideal seed, the fluoresce. f which is stimulated by the ultra-violet output of a Nd:YAG...been successfully employed in atmospheric flames for making thermometric measurements. However, because of the amorphous nature of energetic materials...be determined. R. 6 A .6 An example of this type of behavior is found in trivalent dysprosium, doped at 3% in yttrium- aluminum -garnet (Dy+3 :YAG

  8. Surface Thermometry of Energetic Materials by Laser-Induced Fluorescence

    Science.gov (United States)

    1989-09-01

    at 34 yttrium- aluminum -garnet (Dy:YAG). The simplified energy diagram of Dy:YAG is shown in Fig. 1. Absorbed laser light (at 355 nrm) can 5 excite the...the thermometric technique on a surface similar to that of an energetic material, a thermal-setting plastic supplied by Buehler, Ltd., was employed...temperature over the temperature range of interest. The rare-earth ion dysprosium (Dy) doped into a yttrium- aluminum -garnet (YAG) crystal was I determined

  9. Surface analysis of model systems: From a metal-graphite interface to an intermetallic catalyst

    Energy Technology Data Exchange (ETDEWEB)

    Kwolek, Emma J. [Iowa State Univ., Ames, IA (United States)

    2016-10-25

    This thesis summarizes research completed on two different model systems. In the first system, we investigate the deposition of the elemental metal dysprosium on highly-oriented pyrolytic graphite (HOPG) and its resulting nucleation and growth. The goal of this research is to better understand the metal-carbon interactions that occur on HOPG and to apply those to an array of other carbon surfaces. This insight may prove beneficial to developing and using new materials for electronic applications, magnetic applications and catalysis.

  10. Labeling of fruitflies and their identification by tracer activation

    International Nuclear Information System (INIS)

    Haisch, A.; Forster, S.; Staerk, H.

    1975-01-01

    A technique was worked out to label and identify cherry fruit flies (Rhagoletic cerasi L.) in large numbers. For that purpose, the tracers dysprosium and samarium were mingled with a carrier substance (silica gel) which, mixed with silica sand, formed the substrate for emergence. The flies, the pupae of which were in this substrate, took up with their ptilinum-labeled silica gel during their crawling through the sand up to the surface. The tracer was detected after its activation by neutron irradiation

  11. Pushing the pseudo-SU(3) model towards its limits: Excited bands in even-even Dy isotopes

    International Nuclear Information System (INIS)

    Vargas, Carlos E.; Hirsch, Jorge G.

    2004-01-01

    The energetics of states belonging to normal parity bands in even-even dysprosium isotopes, and their B(E2) transition strengths, are studied using an extended pseudo-SU(3) shell model. States with pseudospin 1 are added to the standard pseudospin 0 space, allowing for a proper description of known excited normal parity bands. A realistic Hamiltonian is employed. Both the success of model and its limitations are discussed

  12. Concepts for using trapped-flux bulk high-temperature superconductor in motors and generators

    International Nuclear Information System (INIS)

    Hull, John R; Strasik, Michael

    2010-01-01

    We review previous concepts for using bulk high-temperature superconductors (HTSs) in motors and generators and discuss methods for using trapped-flux (TF) HTSs in motors and generators that have been recently investigated in our laboratory. We examine the expected performance of a brushless motor/generator that uses TF bulk HTSs to provide magnetomotive force, where the stator windings are used to create the TF. A key feature is the use of dysprosium for the stator and rotor cores.

  13. 46 CFR 173.058 - Double bottom requirements.

    Science.gov (United States)

    2010-10-01

    ... PERTAINING TO VESSEL USE School Ships § 173.058 Double bottom requirements. Each new sailing school vessel... service must comply with the double bottom requirements in §§ 171.105 through 171.109, inclusive, of this...

  14. Ethnologische Nahrungsforschung im östlichen Europa. Esskultur und kulturelle Identität

    Czech Academy of Sciences Publication Activity Database

    Nosková, Jana

    2008-01-01

    Roč. 18, č. 3 (2008), s. 171-171 ISSN 0862-8351 Institutional research plan: CEZ:AV0Z90580513 Keywords : East Europe * ethnology * conference review Subject RIV: AC - Archeology, Anthropology, Ethnology

  15. Structure, magnetic behavior, and anisotropy of homoleptic trinuclear lanthanoid 8-quinolinolate complexes.

    Science.gov (United States)

    Chilton, Nicholas F; Deacon, Glen B; Gazukin, Olga; Junk, Peter C; Kersting, Berthold; Langley, Stuart K; Moubaraki, Boujemaa; Murray, Keith S; Schleife, Frederik; Shome, Mahasish; Turner, David R; Walker, Julia A

    2014-03-03

    Three complexes of the form [Ln(III)3(OQ)9] (Ln = Gd, Tb, Dy; OQ = 8-quinolinolate) have been synthesized and their magnetic properties studied. The trinuclear complexes adopt V-shaped geometries with three bridging 8-quinolinolate oxygen atoms between the central and peripheral eight-coordinate metal atoms. The magnetic properties of these three complexes differ greatly. Variable-temperature direct-current (dc) magnetic susceptibility measurements reveal that the gadolinium and terbium complexes display weak antiferromagnetic nearest-neighbor magnetic exchange interactions. This was quantified in the isotropic gadolinium case with an exchangecoupling parameter of J = -0.068(2) cm(-1). The dysprosium compound displays weak ferromagnetic exchange. Variable-frequency and -temperature alternating-current magnetic susceptibility measurements on the anisotropic cases reveal that the dysprosium complex displays single-molecule-magnet behavior, in zero dc field, with two distinct relaxation modes of differing time scales within the same molecule. Analysis of the data revealed anisotropy barriers of Ueff = 92 and 48 K for the two processes. The terbium complex, on the other hand, displays no such behavior in zero dc field, but upon application of a static dc field, slow magnetic relaxation can be observed. Ab initio and electrostatic calculations were used in an attempt to explain the origin of the experimentally observed slow relaxation of the magnetization for the dysprosium complex.

  16. Determination of trace amounts of rare earth elements in samarium, terbium and disprosium oxides by graphite furnace atomic-absorption spectrometry

    International Nuclear Information System (INIS)

    Dantas, E.S.K.

    1990-01-01

    A graphite furnace atomic-absorption spectrometry method for the determination of neodymium, europium, terbium, dysprosium and yttrium at trace level in samarium oxide; of samarium, europium, dysprosium, holmium, erbium and yttrium in terbium oxide and of europium, terbium, holmium, erbium and yttrium in dysprosium oxide was established. The best pyrolysis and atomization temperatures were determined for each lanthanide considered. Calibration curves were obtained for the pure elements, for binary mixtures formed by the matrix and each of the lanthanides studied and, finally, for the complex mixtures constituted by the matrix and all the other lanthanide of the group under scrutiny. This study has been carried out to examine the interference of the presence of one lanthanide on the behaviour of the other, since a lack of linearity on the calibration curves has been observed in some cases. Detection and determination limits have been determined as well. The detection limits encountered were within the range 0.002 to 0.3% for different elements. The precision of the method expressed as the relative standard deviation was calculated for each element present in each of the matrices studied. The conclusion arrived at is that the method can be applied for determining the above mentioned lanthanides present in the matrices studied with purity up to 99.50%. (author)

  17. The estimation of the control rods absorber burn-up during the VVER-1000 operation

    Energy Technology Data Exchange (ETDEWEB)

    Bolshagin, Sergey N.; Gorodkov, Sergey S.; Sukhino-Khomenko, Evgeniya A. [National Research Centre ' Kurchatov Institute' , Moscow (Russian Federation)

    2013-09-15

    The isotopic composition of the control rods absorber changes under the neutron flux influence, so the control rods efficiency can decrease. In the VVER-1000 control rods boron carbide and dysprosium titanate are used as absorbing materials. In boric part the efficiency decreases due to the {sup 10}B isotope burn-up. Dysprosium isotopes turn into other absorbing isotopes, so the absorbing properties of dysprosium part decrease to a lesser degree. Also the control rod's shells may be deformed as a consequence of boron carbide radiation swelling. This fact should be considered in substantiation of control rods durability. For the estimation of the control rods absorber burn-up two models are developed: VVER-1000 3-D fuel assembly with control rods partially immersed (imitation of the control rods operation in the working group) and VVER-1000 3-D fuel assembly with control rods, located at the upper limit switch (imitation of the control rods operation in groups of the emergency shutdown system). (orig.)

  18. Performance assessment of imaging plates for the JHR transfer Neutron Imaging System

    Science.gov (United States)

    Simon, E.; Guimbal, P. AB(; )

    2018-01-01

    The underwater Neutron Imaging System to be installed in the Jules Horowitz Reactor (JHR-NIS) is based on a transfer method using a neutron activated beta-emitter like Dysprosium. The information stored in the converter is to be offline transferred on a specific imaging system, still to be defined. Solutions are currently under investigation for the JHR-NIS in order to anticipate the disappearance of radiographic films commonly used in these applications. We report here the performance assessment of Computed Radiography imagers (Imaging Plates) performed at LLB/Orphée (CEA Saclay). Several imaging plate types are studied, in one hand in the configuration involving an intimate contact with an activated dysprosium foil converter: Fuji BAS-TR, Fuji UR-1 and Carestream Flex XL Blue imaging plates, and in the other hand by using a prototypal imaging plate doped with dysprosium and thus not needing any contact with a separate converter foil. The results for these imaging plates are compared with those obtained with gadolinium doped imaging plate used in direct neutron imaging (Fuji BAS-ND). The detection performances of the different imagers are compared regarding resolution and noise. The many advantages of using imaging plates over radiographic films (high sensitivity, linear response, high dynamic range) could palliate its lower intrinsic resolution.

  19. The archaeology of geological catastrophes. W.J. McGuire, D.R. Griffiths, P.L. Hancock , I.S. Stewart (Eds.); Special Publication 171, The Geological Society of London, 417 pages, hardcover, illustrated, £79.00 (available through the AAPG at a special price of $78.00)

    Science.gov (United States)

    Lomnitz, Cinna

    2001-04-01

    This is an interdisciplinary collection of 28 professional papers by geologists and archaeologists that addresses the identification and cultural significance of earthquakes and volcanic eruptions by archaeological techniques. While the majority of the papers are about Europe and the Mediterranean area, there are two papers on Mexico: one by Plunket and Uruñuela of the Universidad de las Américas on some excavations at the northeastern foothills of Popocatépetl Volcano in order to document a First Century AD eruption and the other by González, Pastrana, Siebe, and Duller on dating the eruption of Xitle Volcano from materials recovered at the site of Cuicuilco Pyramid in Mexico City.

  20. Report on the behalf of the Foreign Affairs, Defence and Armed Forces Commission on: the bill project (accelerated procedure) authorizing the ratification of the joint procurement agreement for a designation by auction of common bid platforms, and the bill project (accelerated procedure) authorizing the ratification of the joint procurement agreement for a designation by auction of an auction monitor. Nr 171

    International Nuclear Information System (INIS)

    Boulaud, Didier

    2011-01-01

    This document first presents the currently operating greenhouse gas emission quota trading scheme and its evolution according to which quotas will be put up for auction. Then, it more precisely describes different aspects of this arrangement: general economy of the auction system, common auction platforms, auction monitor, and market procedures. Consequences on the French law are presented. The ratification procedure is discussed