WorldWideScience

Sample records for dv stolet eskho

  1. Stoleté katastrofy

    Czech Academy of Sciences Publication Activity Database

    Cílek, Václav

    -, č. 7 (2005), s. 11-11 ISSN 0862-9587 Institutional research plan: CEZ:AV0Z30130516 Keywords : natural disaster * forrest * globalization Subject RIV: DG - Athmosphere Sciences, Meteorology http://vyhledavani.ihned.cz/109-15670400-on-stolet%E9++ AND +katastrofy+ AND +c%EDlek-M00000_d-7c

  2. DV or Not DV: That is the Question When Producing Video for the Internet

    Directory of Open Access Journals (Sweden)

    Gregory Gutenko

    2002-06-01

    Full Text Available Pervasive advertising and marketing efforts promote consumer market digital video (DV format camcorders as the ideal acquisition technology for Internet video production. A shared digital nature and simple interconnections between cameras and computers using IEEE1394/FireWire/i.Link® format digital cabling do suggest a natural affinity between DV and Internet production. However, experience with Web delivery reveals numerous obstacles associated with consumer-friendly camcorder design and feature sets that can severely compromise Internet streaming video quality. This paper describes the various features in consumer and industrial grade DV camcorder designs that lead to unnecessary image quality loss, and what must be done to avoid such loss. Conventional video production techniques that can lead to quality loss regardless of the camera technology used are also identified. A number of recommendations are offered that will help the videographer in an educational or production environment adapt to Internet limitations.

  3. Effective Protection Induced by a Monovalent DNA Vaccine against Dengue Virus (DV Serotype 1 and a Bivalent DNA Vaccine against DV1 and DV2 in Mice

    Directory of Open Access Journals (Sweden)

    Xiaoyan Zheng

    2017-05-01

    Full Text Available Dengue virus (DV is the causal pathogen of dengue fever, which is one of the most rapidly spread mosquito-borne disease worldwide and has become a severe public health problem. Currently, there is no specific treatment for dengue; thus, a vaccine would be an effective countermeasure to reduce the morbidity and mortality. Although, the chimeric Yellow fever dengue tetravalent vaccine has been approved in some countries, it is still necessary to develop safer, more effective, and less costly vaccines. In this study, a DNA vaccine candidate pVAX1-D1ME expressing the prME protein of DV1 was inoculated in BALB/c mice via intramuscular injection or electroporation, and the immunogenicity and protection were evaluated. Compared with traditional intramuscular injection, administration with 50 μg pVAX1-D1ME via electroporation with three immunizations induced persistent humoral and cellular immune responses and effectively protected mice against lethal DV1 challenge. In addition, immunization with a bivalent vaccine consisting of pVAX1-D1ME and pVAX1-D2ME via electroporation generated a balanced IgG response and neutralizing antibodies against DV1 and DV2 and could protect mice from lethal challenge with DV1 and DV2. This study sheds new light on developing a dengue tetravalent DNA vaccine.

  4. Effective Protection Induced by a Monovalent DNA Vaccine against Dengue Virus (DV) Serotype 1 and a Bivalent DNA Vaccine against DV1 and DV2 in Mice.

    Science.gov (United States)

    Zheng, Xiaoyan; Chen, Hui; Wang, Ran; Fan, Dongying; Feng, Kaihao; Gao, Na; An, Jing

    2017-01-01

    Dengue virus (DV) is the causal pathogen of dengue fever, which is one of the most rapidly spread mosquito-borne disease worldwide and has become a severe public health problem. Currently, there is no specific treatment for dengue; thus, a vaccine would be an effective countermeasure to reduce the morbidity and mortality. Although, the chimeric Yellow fever dengue tetravalent vaccine has been approved in some countries, it is still necessary to develop safer, more effective, and less costly vaccines. In this study, a DNA vaccine candidate pVAX1-D1ME expressing the prME protein of DV1 was inoculated in BALB/c mice via intramuscular injection or electroporation, and the immunogenicity and protection were evaluated. Compared with traditional intramuscular injection, administration with 50 μg pVAX1-D1ME via electroporation with three immunizations induced persistent humoral and cellular immune responses and effectively protected mice against lethal DV1 challenge. In addition, immunization with a bivalent vaccine consisting of pVAX1-D1ME and pVAX1-D2ME via electroporation generated a balanced IgG response and neutralizing antibodies against DV1 and DV2 and could protect mice from lethal challenge with DV1 and DV2. This study sheds new light on developing a dengue tetravalent DNA vaccine.

  5. A free sugars daily value (DV) identifies more "less healthy" prepackaged foods and beverages than a total sugars DV.

    Science.gov (United States)

    Bernstein, Jodi T; Labonté, Marie-Ève; Franco-Arellano, Beatriz; Schermel, Alyssa; L'Abbé, Mary R

    2018-04-01

    Regulatory changes in Canada will require food labels to have a benchmark [% Daily Value, %DV] for total sugars, based on 100 g/day, while US labels will require a %DV for added sugars, based on 50 g/day. The objective of this study was to compare two labelling policies, a total sugars DV (100 g/day) and a free sugars DV (50 g/day) on food labels. This cross-sectional analysis of the Food Label Information Program database focussed on top sources of total sugars intake in Canada (n = 6924 foods). Products were categorized as "less healthy" using two sets of criteria: a) free sugars levels exceeding the WHO guidelines (≥10% energy from free sugars); and b) exceeding healthfulness cut-offs of the Food Standards Australia New Zealand Nutrient Profiling Scoring Criterion (FSANZ-NPSC). The proportion of "less healthy" products with ≥15%DV (defined as "a lot" of sugars i.e. high in sugars, based on Health Canada's %DV labelling footnote and educational message for dietary guidance) were compared for each sugar labelling scenario. The free sugars DV showed better alignment with both methods for assessing "healthfulness" than the total sugars DV. The free sugars DV identified a greater proportion of "less healthy" foods with ≥15%DV, based on both the FSANZ-NPSC (70% vs. 45%, p chocolate bars, confectionery, and frozen desserts categories. Compared to total sugars DV labelling, using a free sugars DV identified more "less healthy" foods. Findings support the adoption of free sugars labelling. Copyright © 2018 Elsevier Inc. All rights reserved.

  6. The DV-Xα molecular-orbital calculation method

    CERN Document Server

    Ishii, Tomohiko; Ogasawara, Kazuyoshi

    2014-01-01

    This multi-author contributed volume contains chapters featuring the development of the DV-Xα method and its application to a variety of problems in Materials Science and Spectroscopy written by leaders of the respective fields. The volume contains a Foreword written by the Chairs of Japanese and Korea DV-X alpha Societies. This book is aimed at individuals working in Quantum Chemistry.

  7. Project Date SMART: a Dating Violence (DV) and Sexual Risk Prevention Program for Adolescent Girls with Prior DV Exposure.

    Science.gov (United States)

    Rizzo, Christie J; Joppa, Meredith; Barker, David; Collibee, Charlene; Zlotnick, Caron; Brown, Larry K

    2018-05-01

    This study assessed the initial feasibility, acceptability, and efficacy of an intervention aimed at reducing dating violence and sexual risk behavior in a sample of adolescent girls (ages 14-17) with prior exposure to physical dating violence (DV). One hundred and nine girls were randomly assigned to Date SMART (Skills to Manage Aggression in Relationships for Teens) or a Knowledge-only (KO) comparison group. Both intervention arms consisted of six, weekly 2-h sessions and one "booster" session 6 weeks later. Based on principles of cognitive behavioral therapy, the Date SMART intervention was designed to target common underlying skills deficits linked to both DV and sexual risk behavior in adolescent females: depression, self-regulation deficits, and interpersonal skills deficits. Assessments were administered at four time points (baseline, 3, 6, and 9 months). The Date SMART group was effective as reducing sexual DV involvement across the 9-month follow-up period. Both groups evidenced clinically meaningful reductions in physical, emotional, and digital DV involvement, total time in dating relationships, as well as reductions in depression. Findings indicate that delivering a DV and sexual risk prevention intervention to DV-affected adolescent girls is feasible and well-received. Furthermore, a skills-based approach that addresses the co-occurrence of DV and sexual risk behavior may be particularly useful for promoting reductions of sexual DV among high-risk adolescent girls. A future, large-scale trial with an inactive comparison condition is needed to evaluate the efficacy of Date SMART further. Clinical Trials, NCT01326195, and http://www.clinicaltrials.gov.

  8. Mezinárodní konference Slovanská lexikografie počátkem 21. století

    Czech Academy of Sciences Publication Activity Database

    Michalec, Vít; Neprašová, Renáta

    2017-01-01

    Roč. 54, 1/2 (2017), s. 70-73 ISSN 1212-5326. [Mezinárodní konference Slovanská lexikografie počátkem 21. století. Praha, 20.04.2016-22.04.2016] Institutional support: RVO:68378092 Keywords : conference * lexicography * dictionary Subject RIV: AI - Linguistics OBOR OECD: Linguistics

  9. Research on Improved DV-HOP Algorithm against Wormhole Attacks in WSN

    Directory of Open Access Journals (Sweden)

    Wang Xue-Wen

    2016-01-01

    Full Text Available The secure location of node is significant in the WSN (Wireless Sensor Networks of the troop frontier defence system. The wormhole attack is a big threat in the secure location. The credibility of the beacon node was used to determine the malicious nodes produced by wormhole attack in the WSN. The estimated method of multibeacon nodes was adopted to improve DV-HOP algorithm after excluding the malicious nodes. In this paper, we compared the basic DV-HOP algorithm and the improved DV-HOP algorithm in the coverage percentage and the error of network localization by simulating. The simulation results indicate that the improved DV-HOP algorithm makes the localization coverage percentage can reach 90% on a certain scale of the network, and it makes the error percentage lower when the number of beacons is different.

  10. Modeling of flux, binding and substitution of urea molecules in the urea transporter dvUT.

    Science.gov (United States)

    Zhang, Hai-Tian; Wang, Zhe; Yu, Tao; Sang, Jian-Ping; Zou, Xian-Wu; Zou, Xiaoqin

    2017-09-01

    Urea transporters (UTs) are transmembrane proteins that transport urea molecules across cell membranes and play a crucial role in urea excretion and water balance. Modeling the functional characteristics of UTs helps us understand how their structures accomplish the functions at the atomic level, and facilitates future therapeutic design targeting the UTs. This study was based on the crystal structure of Desulfovibrio vulgaris urea transporter (dvUT). To model the binding behavior of urea molecules in dvUT, we constructed a cooperative binding model. To model the substitution of urea by the urea analogue N,N'-dimethylurea (DMU) in dvUT, we calculated the occupation probability of DMU along the urea pore and the ratio of the occupation probabilities of DMU at the external (S ext ) and internal (S int ) binding sites, and we established the mutual substitution rule for binding and substitution of urea and DMU. Based on these calculations and modelings, together with the use of the Monte Carlo (MC) method, we further modeled the urea flux in dvUT, equilibrium urea binding to dvUT, and the substitution of urea by DMU in the dvUT. Our modeling results are in good agreement with the existing experimental functional data. Furthermore, the modelings have discovered the microscopic process and mechanisms of those functional characteristics. The methods and the results would help our future understanding of the underlying mechanisms of the diseases associated with impaired UT functions and rational drug design for the treatment of these diseases. Copyright © 2017 Elsevier Inc. All rights reserved.

  11. Multiple-scattering and DV-Xα analyses of a Cl-passivated Ge(111) surface

    International Nuclear Information System (INIS)

    Cao, S; Tang, J-C; Shen, S-L

    2003-01-01

    The multiple-scattering cluster and DV-Xα methods have been employed to analyse the chlorine 1s near edge x-ray absorption fine structure (NEXAFS) of a Cl-passivated Ge(111) surface. Our detailed analysis demonstrates how the chlorine atoms form a perfect monochloride structure with Cl bonding to the topmost Ge atom. Our calculation reveals the interaction in the chlorine layer is multipolar electrostatic forces. Furthermore, the DV-Xα cluster calculation shows that the orbital contour of the sharp Cl-Ge resonance exhibits a global symmetry, which confirms it to be σ * -like. The above studies are found to enrich previous experimental NEXAFS investigations

  12. Status on the heavy elements research using the DV-DFS method

    International Nuclear Information System (INIS)

    Hirata, Masaru; Bastug, T.; Sekine, Rika; Onoe, Jun; Nakamatsu, Hirohide; Mukoyama, Takeshi

    1999-03-01

    In this review report, we describe recent progress on the heavy elements research using the discrete-variational Dirac-Fock-Slater (DV-DFS) method which is being improved by Kyoto University, Shizuoka University, RIKEN and JAERI. The DV-DFS is a versatile method for interpreting spectroscopic data and predicting chemical bonding of polyatomic systems including heavy elements. This review is based on the lectures given in 74th spring meeting of chemical Society of Japan (March, 1998) and also at the workshop on the XAFS-relativistic electronic structure calculation for the actinides research which was held at Tokai Research Establishment of JAERI (November, 1998). (author)

  13. Contaminant Attenuation and Transport Characterization of 200-DV-1 Operable Unit Sediment Samples

    Energy Technology Data Exchange (ETDEWEB)

    Truex, Michael J. [Pacific Northwest National Lab. (PNNL), Richland, WA (United States); Szecsody, James E. [Pacific Northwest National Lab. (PNNL), Richland, WA (United States); Qafoku, Nikolla [Pacific Northwest National Lab. (PNNL), Richland, WA (United States); Strickland, Christopher E. [Pacific Northwest National Lab. (PNNL), Richland, WA (United States); Moran, James J. [Pacific Northwest National Lab. (PNNL), Richland, WA (United States); Lee, Brady D. [Pacific Northwest National Lab. (PNNL), Richland, WA (United States); Snyder, Michelle M.V. [Pacific Northwest National Lab. (PNNL), Richland, WA (United States); Lawter, Amanda R. [Pacific Northwest National Lab. (PNNL), Richland, WA (United States); Resch, Charles T. [Pacific Northwest National Lab. (PNNL), Richland, WA (United States); Gartman, Brandy N. [Pacific Northwest National Lab. (PNNL), Richland, WA (United States); Zhong, Lirong [Pacific Northwest National Lab. (PNNL), Richland, WA (United States); Nims, Megan K. [Pacific Northwest National Lab. (PNNL), Richland, WA (United States); Saunders, Danielle L. [Pacific Northwest National Lab. (PNNL), Richland, WA (United States); Williams, Benjamin D. [Pacific Northwest National Lab. (PNNL), Richland, WA (United States); Horner, Jacob A. [Pacific Northwest National Lab. (PNNL), Richland, WA (United States); Leavy, Ian I. [Pacific Northwest National Lab. (PNNL), Richland, WA (United States); Baum, Steven R. [Pacific Northwest National Lab. (PNNL), Richland, WA (United States); Christiansen, Beren B. [Pacific Northwest National Lab. (PNNL), Richland, WA (United States); Clayton, Ray E. [Pacific Northwest National Lab. (PNNL), Richland, WA (United States); McElroy, Erin M. [Pacific Northwest National Lab. (PNNL), Richland, WA (United States); Appriou, Delphine [Pacific Northwest National Lab. (PNNL), Richland, WA (United States); Tyrrell, Kimberly J. [Pacific Northwest National Lab. (PNNL), Richland, WA (United States); Striluk, Miranda L. [Pacific Northwest National Lab. (PNNL), Richland, WA (United States)

    2017-05-15

    A laboratory study was conducted to quantify contaminant attenuation processes and associated contaminant transport parameters that are needed to evaluate transport of contaminants through the vadose zone to the groundwater. The laboratory study information, in conjunction with transport analyses, can be used as input to evaluate the feasibility of Monitored Natural Attenuation and other remedies for the 200-DV-1 Operable Unit at the Hanford Site.

  14. Exploratory Climate Data Visualization and Analysis Using DV3D and UVCDAT

    Science.gov (United States)

    Maxwell, Thomas

    2012-01-01

    Earth system scientists are being inundated by an explosion of data generated by ever-increasing resolution in both global models and remote sensors. Advanced tools for accessing, analyzing, and visualizing very large and complex climate data are required to maintain rapid progress in Earth system research. To meet this need, NASA, in collaboration with the Ultra-scale Visualization Climate Data Analysis Tools (UVCOAT) consortium, is developing exploratory climate data analysis and visualization tools which provide data analysis capabilities for the Earth System Grid (ESG). This paper describes DV3D, a UV-COAT package that enables exploratory analysis of climate simulation and observation datasets. OV3D provides user-friendly interfaces for visualization and analysis of climate data at a level appropriate for scientists. It features workflow inte rfaces, interactive 40 data exploration, hyperwall and stereo visualization, automated provenance generation, and parallel task execution. DV30's integration with CDAT's climate data management system (COMS) and other climate data analysis tools provides a wide range of high performance climate data analysis operations. DV3D expands the scientists' toolbox by incorporating a suite of rich new exploratory visualization and analysis methods for addressing the complexity of climate datasets.

  15. Naphthalene degradation by bacterial consortium (DV-AL) developed from Alang-Sosiya ship breaking yard, Gujarat, India.

    Science.gov (United States)

    Patel, Vilas; Jain, Siddharth; Madamwar, Datta

    2012-03-01

    Naphthalene degrading bacterial consortium (DV-AL) was developed by enrichment culture technique from sediment collected from the Alang-Sosiya ship breaking yard, Gujarat, India. The 16S rRNA gene based molecular analyzes revealed that the bacterial consortium (DV-AL) consisted of four strains namely, Achromobacter sp. BAB239, Pseudomonas sp. DV-AL2, Enterobacter sp. BAB240 and Pseudomonas sp. BAB241. Consortium DV-AL was able to degrade 1000 ppm of naphthalene in Bushnell Haas medium (BHM) containing peptone (0.1%) as co-substrate with an initial pH of 8.0 at 37°C under shaking conditions (150 rpm) within 24h. Maximum growth rate and naphthalene degradation rate were found to be 0.0389 h(-1) and 80 mg h(-1), respectively. Consortium DV-AL was able to utilize other aromatic and aliphatic hydrocarbons such as benzene, phenol, carbazole, petroleum oil, diesel fuel, and phenanthrene and 2-methyl naphthalene as sole carbon source. Consortium DV-AL was also efficient to degrade naphthalene in the presence of other pollutants such as petroleum hydrocarbons and heavy metals. Copyright © 2011 Elsevier Ltd. All rights reserved.

  16. A Hybrid DV-Hop Algorithm Using RSSI for Localization in Large-Scale Wireless Sensor Networks.

    Science.gov (United States)

    Cheikhrouhou, Omar; M Bhatti, Ghulam; Alroobaea, Roobaea

    2018-05-08

    With the increasing realization of the Internet-of-Things (IoT) and rapid proliferation of wireless sensor networks (WSN), estimating the location of wireless sensor nodes is emerging as an important issue. Traditional ranging based localization algorithms use triangulation for estimating the physical location of only those wireless nodes that are within one-hop distance from the anchor nodes. Multi-hop localization algorithms, on the other hand, aim at localizing the wireless nodes that can physically be residing at multiple hops away from anchor nodes. These latter algorithms have attracted a growing interest from research community due to the smaller number of required anchor nodes. One such algorithm, known as DV-Hop (Distance Vector Hop), has gained popularity due to its simplicity and lower cost. However, DV-Hop suffers from reduced accuracy due to the fact that it exploits only the network topology (i.e., number of hops to anchors) rather than the distances between pairs of nodes. In this paper, we propose an enhanced DV-Hop localization algorithm that also uses the RSSI values associated with links between one-hop neighbors. Moreover, we exploit already localized nodes by promoting them to become additional anchor nodes. Our simulations have shown that the proposed algorithm significantly outperforms the original DV-Hop localization algorithm and two of its recently published variants, namely RSSI Auxiliary Ranging and the Selective 3-Anchor DV-hop algorithm. More precisely, in some scenarios, the proposed algorithm improves the localization accuracy by almost 95%, 90% and 70% as compared to the basic DV-Hop, Selective 3-Anchor, and RSSI DV-Hop algorithms, respectively.

  17. Experimental Investigation of Sulfuric Acid Condensation and Corrosion Rate in Motored Bukh DV24 Diesel Engine

    DEFF Research Database (Denmark)

    Kjemtrup, Lars; Cordtz, Rasmus Faurskov; Meyer, Martin

    2017-01-01

    The work conducted in this paper presents a novel experimental setup to study sulfuric acid cold corrosion of cylinder liners in large two-stroke marine diesel engines. The process is simulated in a motored light duty BUKH DV24 diesel engine where the charge air contain known amounts of H2SO4 and H......2O vapor. Liner corrosion is measured as iron accumulation in the lubeoil. Similarly sulfuric acid condensation is assessed by measuring the accumulation of sulfur in the lube oil. To clarify the corrosive effect of sulfuric acid the lube oil utilized for experiments is a sulfur free neutral oil...... without alkaline additives (Chevron Neutral Oil 600R). Iron and sulfur accumulation in the lube oil is analyzed withan Energy Dispersive X-Ray Fluorescence (ED-XRF) apparatus. Three test cases with different H2SO4 concentrations are run. Results reveal good agreement between sulfuric acid injection flow...

  18. 15 CFR Supplement No. 4 to Part 748 - Authorities Administering Import Certificate/Delivery Verification (IC/DV) and End-User Statement...

    Science.gov (United States)

    2010-01-01

    ... China, People's Republic of Ministry of Commerce; Department of Mechanic, Electronic and High Technology... Industry, Trade, Commerce and Tourism, Frederick House, South Frederick Street, Dublin 2 IC/DV Italy... point of entry DV United Kingdom Department of Trade and Industry Export Licensing Branch Millbank Tower...

  19. Analysis of Wave Reflection from Structures with Berms Through an Extensive Database and 2DV Numerical Modelling

    DEFF Research Database (Denmark)

    Zanuttigh, Barbara; van der Meer, Jentsje W.; Andersen, Thomas Lykke

    2009-01-01

    This paper analyses wave reflection from permeable structures with a berm, including reshaping cases. Data are obtained from recent wave flume experiments and from 2DV numerical simulations performed with the COBRAS-UC code. The objectives of this research were to identify the proper representation...

  20. Development of duplex real-time PCR for the detection of WSSV and PstDV1 in cultivated shrimp.

    Science.gov (United States)

    Leal, Carlos A G; Carvalho, Alex F; Leite, Rômulo C; Figueiredo, Henrique C P

    2014-07-05

    The White spot syndrome virus (WSSV) and Penaeus stylirostris penstyldensovirus 1 (previously named Infectious hypodermal and hematopoietic necrosis virus-IHHNV) are two of the most important viral pathogens of penaeid shrimp. Different methods have been applied for diagnosis of these viruses, including Real-time PCR (qPCR) assays. A duplex qPCR method allows the simultaneous detection of two viruses in the same sample, which is more cost-effective than assaying for each virus separately. Currently, an assay for the simultaneous detection of the WSSV and the PstDV1 in shrimp is unavailable. The aim of this study was to develop and standardize a duplex qPCR assay for the simultaneous detection of the WSSV and the PstDV1 in clinical samples of diseased L. vannamei. In addition, to evaluate the performance of two qPCR master mixes with regard to the clinical sensitivity of the qPCR assay, as well as, different methods for qPCR results evaluation. The duplex qPCR assay for detecting WSSV and PstDV1 in clinical samples was successfully standardized. No difference in the amplification of the standard curves was observed between the duplex and singleplex assays. Specificities and sensitivities similar to those of the singleplex assays were obtained using the optimized duplex qPCR. The analytical sensitivities of duplex qPCR were two copies of WSSV control plasmid and 20 copies of PstDV1 control plasmid. The standardized duplex qPCR confirmed the presence of viral DNA in 28 from 43 samples tested. There was no difference for WSSV detection using the two kits and the distinct methods for qPCR results evaluation. High clinical sensitivity for PstDV1 was obtained with TaqMan Universal Master Mix associated with relative threshold evaluation. Three cases of simultaneous infection by the WSSV and the PstDV1 were identified with duplex qPCR. The standardized duplex qPCR was shown to be a robust, highly sensitive, and feasible diagnostic tool for the simultaneous detection of the

  1. The better growth phenotype of DvGS1-transgenic arabidopsis thaliana is attributed to the improved efficiency of nitrogen assimilation

    Directory of Open Access Journals (Sweden)

    Zhu Chenguang

    2015-01-01

    Full Text Available The overexpression of the algal glutamine synthetase (GS gene DvGS1 in Arabidopsis thaliana resulted in higher plant biomass and better growth phenotype. The purpose of this study was to recognize the biological mechanism for the growth improvement of DvGS1-transgenic Arabidopsis. A series of molecular and biochemical investigations related to nitrogen and carbon metabolism in the DvGS1-transgenic line was conducted. Analysis of nitrogen use efficiency (NUE-related gene transcription and enzymatic activity revealed that the transcriptional level and enzymatic activity of the genes encoding GS, glutamate synthase, glutamate dehydrogenase, alanine aminotransferase and aspartate aminotransferase, were significantly upregulated, especially from leaf tissues of the DvGS1-transgenic line under two nitrate conditions. The DvGS1-transgenic line showed increased total nitrogen content and decreased carbon: nitrogen ratio compared to wild-type plants. Significant reduced concentrations of free nitrate, ammonium, sucrose, glucose and starch, together with higher concentrations of total amino acids, individual amino acids (glutamate, aspartate, asparagine, methionine, soluble proteins and fructose in leaf tissues confirmed that the DvGS1-transgenic line demonstrated a higher efficiency of nitrogen assimilation, which subsequently affected carbon metabolism. These improved metabolisms of nitrogen and carbon conferred the DvGS1-transgenic Arabidopsis higher NUE, more biomass and better growth phenotype compared with the wild-type plants.

  2. LLNL-G3Dv3: Global P wave tomography model for improved regional and teleseismic travel time prediction: LLNL-G3DV3---GLOBAL P WAVE TOMOGRAPHY

    Energy Technology Data Exchange (ETDEWEB)

    Simmons, N. A. [Lawrence Livermore National Lab. (LLNL), Livermore, CA (United States); Myers, S. C. [Lawrence Livermore National Lab. (LLNL), Livermore, CA (United States); Johannesson, G. [Lawrence Livermore National Lab. (LLNL), Livermore, CA (United States); Matzel, E. [Lawrence Livermore National Lab. (LLNL), Livermore, CA (United States)

    2012-10-06

    [1] We develop a global-scale P wave velocity model (LLNL-G3Dv3) designed to accurately predict seismic travel times at regional and teleseismic distances simultaneously. The model provides a new image of Earth's interior, but the underlying practical purpose of the model is to provide enhanced seismic event location capabilities. The LLNL-G3Dv3 model is based on ∼2.8 millionP and Pnarrivals that are re-processed using our global multiple-event locator called Bayesloc. We construct LLNL-G3Dv3 within a spherical tessellation based framework, allowing for explicit representation of undulating and discontinuous layers including the crust and transition zone layers. Using a multiscale inversion technique, regional trends as well as fine details are captured where the data allow. LLNL-G3Dv3 exhibits large-scale structures including cratons and superplumes as well numerous complex details in the upper mantle including within the transition zone. Particularly, the model reveals new details of a vast network of subducted slabs trapped within the transition beneath much of Eurasia, including beneath the Tibetan Plateau. We demonstrate the impact of Bayesloc multiple-event location on the resulting tomographic images through comparison with images produced without the benefit of multiple-event constraints (single-event locations). We find that the multiple-event locations allow for better reconciliation of the large set of direct P phases recorded at 0–97° distance and yield a smoother and more continuous image relative to the single-event locations. Travel times predicted from a 3-D model are also found to be strongly influenced by the initial locations of the input data, even when an iterative inversion/relocation technique is employed.

  3. Hartree-fock-slater method for materials science the DV-X alpha method for design and characterization of materials

    CERN Document Server

    Adachi, H; Kawai, J

    2006-01-01

    Molecular-orbital calculations for materials design such as alloys, ceramics, and coordination compounds are now possible for experimentalists. Molecuar-orbital calculations for the interpretation of chemical effect of spectra are also possible for experimentalists. The most suitable molecular-orbital calculation method for these purpose is the DV-Xa method, which is robust in such a way that the calculation converges to a result even if the structure of the molecule or solid is impossible in the pressure and temperature ranges on earth. This book specially addresses the methods to design novel materials and to predict the spectralline shape of unknown materials using the DV-Xa molecular-orbital method, but is also useful for those who want to calculate electronic structures of materials using any kind of method.

  4. Listvenite logging on D/V CHIKYU: Hole BT1B, Oman Drilling Project

    Science.gov (United States)

    Kelemen, P. B.; Beinlich, A.; Morishita, T.; Greenberger, R. N.; Johnson, K. T. M.; Lafay, R.; Michibayashi, K.; Harris, M.; Phase I Science Party, T. O. D. P.

    2017-12-01

    Listvenite, quartz-carbonate altered ultramafic rock containing minor fuchsite (Cr-muscovite) forms by complete carbonation of peridotite and is thus an attractive objective for carbon mitigation studies. However, reaction controls and evolution of listvenite are still enigmatic. Here we present the first results of Phase 1 of the ICDP (International Continental Drilling Program) Oman Drilling Project and subsequent core logging using the analytical facilities on board the research vessel D/V CHIKYU. Hole BT1B contains 300 m of continuous drill core intersecting alluvium, listvenite-altered serpentinite, serpentinite, ophicarbonate and the underlying metamorphic sole of the Semail ophiolite, Oman. The drill core has been systematically investigated by visual core description, thin section petrography, X-ray fluorescence core logging, X-ray diffractometry, visible-shortwave infrared imaging spectroscopy and X-ray Computer Tomography. Our observations show that listvenite is highly variable in texture and color on the mm to m scale. Listvenite was visually categorized into 5 principal color groups: the dominant dark red (47 %), light red (19 %), orange (14 %), pale (2 %) and green (16 %). The presence of hematite/goethite results in dark reddish, red and orange hues. Light grey or pale colored listvenite lacks hematite and/or goethite veins and may represent the `true' listvenite. Green listvenite is characterized by the presence of cm-sized quartz-fuchsite intergrowths. Five zones of serpentinite, which vary in thickness between several tens of cm and 4 m, are intercalated within the massive listvenite of Hole BT1B. Gradational listvenite-serpentinite transition zones contain the ophicarbonate assemblage (magnesite + serpentine) and sometimes additional talc, representing intermediate carbonation reaction progress. Preservation of the former mesh texture and bastite after orthopyroxene in the listvenite suggest that the listvenite precursor had already been

  5. Research reports 'nuclear research' (BMFT-KBK) (1965-1975). Research reports 'data processing' (BMFT-FB DV) (1971-1975)

    International Nuclear Information System (INIS)

    1975-01-01

    The BMFT catalogue compiled by ZAED, contains a bibliography of research reports in nuclear engineering (BMFT-KN K) from 1965 to 1975 and reports on data processing (BMFT-FB DV) from 1971 to 1975. (HK) [de

  6. Structure and transcription of the Helicoverpa armigera densovirus (HaDV2) genome and its expression strategy in LD652 cells.

    Science.gov (United States)

    Xu, Pengjun; Graham, Robert I; Wilson, Kenneth; Wu, Kongming

    2017-02-07

    Densoviruses (DVs) are highly pathogenic to their hosts. However, we previously reported a mutualistic DV (HaDV2). Very little was known about the characteristics of this virus, so herein we undertook a series of experiments to explore the molecular biology of HaDV2 further. Phylogenetic analysis showed that HaDV2 was similar to members of the genus Iteradensovirus. However, compared to current members of the genus Iteradensovirus, the sequence identity of HaDV2 is less than 44% at the nucleotide-level, and lower than 36, 28 and 19% at the amino-acid-level of VP, NS1 and NS2 proteins, respectively. Moreover, NS1 and NS2 proteins from HaDV2 were smaller than those from other iteradensoviruses due to their shorter N-terminal sequences. Two transcripts of about 2.2 kb coding for the NS proteins and the VP proteins were identified by Northern Blot and RACE analysis. Using specific anti-NS1 and anti-NS2 antibodies, Western Blot analysis revealed a 78 kDa and a 48 kDa protein, respectively. Finally, the localization of both NS1 and NS2 proteins within the cell nucleus was determined by using Green Fluorescent Protein (GFP) labelling. The genome organization, terminal hairpin structure, transcription and expression strategies as well as the mutualistic relationship with its host, suggested that HaDV2 was a novel member of the genus Iteradensovirus within the subfamily Densovirinae.

  7. Pipe-dependent ventral processing of Easter by Snake is the defining step in Drosophila embryo DV axis formation.

    Science.gov (United States)

    Cho, Yong Suk; Stevens, Leslie M; Stein, David

    2010-06-22

    The establishment of Drosophila embryonic dorsal-ventral (DV) polarity relies on serine proteolytic activity in the perivitelline space between the embryonic membrane and the eggshell. Gastrulation Defective cleaves and activates Snake, which processes and activates Easter, which cleaves Spätzle to form the activating ligand for the Toll receptor. Ventral restriction of ligand formation depends on the Pipe sulfotransferase, which is expressed in ventral cells of the follicular epithelium surrounding the developing oocyte. Pipe modifies components of the developing eggshell to produce a ventral cue embedded in the vitelline membrane. This ventral cue is believed to promote one or more of the proteolysis steps in the perivitelline space. By examining the processing of transgenic, tagged versions of the perivitelline proteins during DV patterning, we find that the proteolysis of Easter by Snake is the first Pipe-dependent step and therefore the key ventrally restricted event in the protease cascade. We also find that Snake and Easter associate together in a complex in both wild-type and pipe mutant-derived embryos. This observation suggests a mechanism in which the sulfated target of Pipe promotes a productive interaction between Snake and Easter, perhaps by facilitating conformational changes in a complex containing the two proteins. Copyright 2010 Elsevier Ltd. All rights reserved.

  8. Genome sequence of the acid-tolerant Desulfovibrio sp. DV isolated from the sediments of a Pb-Zn mine tailings dam in the Chita region, Russia

    Directory of Open Access Journals (Sweden)

    Anastasiia Kovaliova

    2017-03-01

    Full Text Available Here we report the draft genome sequence of the acid-tolerant Desulfovibrio sp. DV isolated from the sediments of a Pb-Zn mine tailings dam in the Chita region, Russia. The draft genome has a size of 4.9 Mb and encodes multiple K+-transporters and proton-consuming decarboxylases. The phylogenetic analysis based on concatenated ribosomal proteins revealed that strain DV clusters together with the acid-tolerant Desulfovibrio sp. TomC and Desulfovibrio magneticus. The draft genome sequence and annotation have been deposited at GenBank under the accession number MLBG00000000.

  9. Single DV-DXCCII Based Voltage Controlled First Order All-pass Filter with Inverting and Non-inverting responses

    Directory of Open Access Journals (Sweden)

    B Chaturvedi

    2015-12-01

    Full Text Available In this paper, a new voltage controlled first order all-pass filter is presented. The proposed circuit employs a single differential voltage dual-X second generation current conveyor (DV-DXCCII and a grounded capacitor only. The proposed all-pass filter provides both inverting and non inverting voltage-mode outputs from the same configuration simultaneously without any matching condition. Non-ideal analysis along with sensitivity analysis is also investigated. The proposed circuit has low active and passive sensitivities. As an application the proposed all-pass filter is connected in cascade to get higher order filter. The theoretical results are validated thorough PSPICE simulations using TSMC 0.18µm CMOS process parameters.

  10. Three semi-direct sum Lie algebras and three discrete integrable couplings associated with the modified K dV lattice equation

    International Nuclear Information System (INIS)

    Yu Zhang; Zhang Yufeng

    2009-01-01

    Three semi-direct sum Lie algebras are constructed, which is an efficient and new way to obtain discrete integrable couplings. As its applications, three discrete integrable couplings associated with the modified K dV lattice equation are worked out. The approach can be used to produce other discrete integrable couplings of the discrete hierarchies of soliton equations.

  11. Toetsing van het gehalte duurzame veiligheid met Safer Transportation Network Planning : integratie van de ‘DV-gehaltemeter’ in het ontwerpprogramma ‘Safer-TNP’

    NARCIS (Netherlands)

    Hummel, T.

    2001-01-01

    Testing the sustainable-safety contents with Safer Transportation Network Planning. In the publication entitled “Developing a sustainable-safety meter (DV-meter) for measuring the sustainable-safety contents” (Van der Kooi & Dijkstra, 2000), the development of and a pilot measurement with a

  12. On the development of a coupled regional climate-vegetation model RCM-CLM-CN-DV and its validation in Tropical Africa

    Science.gov (United States)

    Wang, Guiling; Yu, Miao; Pal, Jeremy S.; Mei, Rui; Bonan, Gordon B.; Levis, Samuel; Thornton, Peter E.

    2016-01-01

    This paper presents a regional climate system model RCM-CLM-CN-DV and its validation over Tropical Africa. The model development involves the initial coupling between the ICTP regional climate model RegCM4.3.4 (RCM) and the Community Land Model version 4 (CLM4) including models of carbon-nitrogen dynamics (CN) and vegetation dynamics (DV), and further improvements of the models. Model improvements derive from the new parameterization from CLM4.5 that addresses the well documented overestimation of gross primary production (GPP), a refinement of stress deciduous phenology scheme in CN that addresses a spurious LAI fluctuation for drought-deciduous plants, and the incorporation of a survival rule into the DV model to prevent tropical broadleaf evergreens trees from growing in areas with a prolonged drought season. The impact of the modifications on model results is documented based on numerical experiments using various subcomponents of the model. The performance of the coupled model is then validated against observational data based on three configurations with increasing capacity: RCM-CLM with prescribed leaf area index and fractional coverage of different plant functional types (PFTs); RCM-CLM-CN with prescribed PFTs coverage but prognostic plant phenology; RCM-CLM-CN-DV in which both the plant phenology and PFTs coverage are simulated by the model. Results from these three models are compared against the FLUXNET up-scaled GPP and ET data, LAI and PFT coverages from remote sensing data including MODIS and GIMMS, University of Delaware precipitation and temperature data, and surface radiation data from MVIRI and SRB. Our results indicate that the models perform well in reproducing the physical climate and surface radiative budgets in the domain of interest. However, PFTs coverage is significantly underestimated by the model over arid and semi-arid regions of Tropical Africa, caused by an underestimation of LAI in these regions by the CN model that gets exacerbated

  13. Totally extraperitoneal (TEP) bilateral hernioplasty using the Single Site® robotic da Vinci platform (DV-SS TEP): description of the technique and preliminary results.

    Science.gov (United States)

    Cestari, A; Galli, A C; Sangalli, M N; Zanoni, M; Ferrari, M; Roviaro, G

    2017-06-01

    Laparoendoscopic single site totally extraperitoneal (TEP) hernia repair showed to be a feasible alternative to conventional laparoscopic hernia repair; nevertheless single site surgery, with the loss of instruments triangulation can be a demanding procedure. To overcome those hurdles, the Single Site® (SS) platform of the da Vinci (DV) Si robotic system enables to perform surgical procedures through a 25-mm skin incision, with a stable 3D vision and restoring an adequate triangulation of the surgical instruments. We present in details the technique and the preliminary results of DV-SS TEP, to our knowledge the first cases reported in literature. In March 2016, three consecutive male patients (mean age 46.6 years-mean BMI 25.3) with bilateral symptomatic inguinal hernia were submitted to DV-SS TEP in our institutions. Feasibility, codification of the technique, operative time and perioperative outcomes were recorded. All the procedures were completed as scheduled, with no conversion to other techniques. Mean operative time was 98.6 min, ranging between 155 and 55 min, reflecting the learning curve of the operating room team on this new procedure. No intraoperative or postoperative complications were experienced and all the patients were discharged within 24 h after surgery. Patients reported satisfactory postoperative course, with no recurrence of inguinal hernia and satisfaction in cosmetic result at 6-month follow-up. DV-SS TEP inguinal hernia repair showed to be feasible and effective surgical option for bilateral groin hernia repair. Patients' outcome was uneventful, with optimal cosmetic results. Further studies comparing this innovative technique to TEP or LESS TEP should be promoted.

  14. Projected effects of vegetation feedbacks on drought characteristics with SPEI over West Africa using the RegCM-CLM-CN-DV

    Science.gov (United States)

    Jaehyeong, L.; Kim, Y.; Erfanian, A.; Wang, G.; Um, M. J.

    2017-12-01

    This study utilizes the Standardized Precipitation-Evapotranspiration Index (SPEI) to investigate the projected effect of vegetation feedbacks on drought in West Africa using the Regional Climate Model coupled to the NCAR Community Land Model with both the Carbon and Nitrogen module (CN) and Dynamic Vegetation module (DV) activated (RegCM-CLM-CN-DV). The role of vegetation feedbacks is examined based on simulations with and without dynamic vegetation. The four different future climate scenarios from CCSM, GFDL, MIROC and MPI are used as the boundary conditions of RegCM for two historical and future periods, i.e., for 1981 to 2000 and for 2081 to 2100, respectively. Using SPEI, the duration, frequency, severity and spatial extents are quantified over West Africa and analyzed for two regions of the Sahel and the Gulf of Guinea. In this study, we find that the estimated annual SPEIs clearly indicate that the projected future droughts over the Sahel are enhanced and prolonged when DV is activated. The opposite is shown over the Gulf of Guinea in general. AcknowledgementsThis work was supported by Basic Science Research Program through the National Research Foundation of Korea (NRF) funded by the Ministry of Science, ICT & Future Planning (2015R1C1A2A01054800), by the Korea Meteorological Administration R&D Program under Grant KMIPA 2015-6180 and by the Yonsei University Future-leading Research Initiative of 2015(2016-22-0061).

  15. Quantifying K, U and Th contents of marine sediments using shipboard natural gamma radiation spectra measured on DV JOIDES Resolution

    Science.gov (United States)

    De Vleeschouwer, David; Dunlea, Ann G.; Auer, Gerald; Anderson, Chloe H.; Brumsack, Hans; de Loach, Aaron; Gurnis, Michael C.; Huh, Youngsook; Ishiwa, Takeshige; Jang, Kwangchul; Kominz, Michelle A.; März, Christian; Schnetger, Bernhard; Murray, Richard W.; Pälike, Heiko; Expedition 356 shipboard scientists, IODP

    2017-04-01

    During International Ocean Discovery Program (IODP) expeditions, shipboard-generated data provide the first insights into the cored sequences. The natural gamma radiation (NGR) of the recovered material, for example, is routinely measured on the ocean drilling research vessel DV JOIDES Resolution. At present, only total NGR counts are readily available as shipboard data, although full NGR spectra (counts as a function of gamma-ray energy level) are produced and archived. These spectra contain unexploited information, as one can estimate the sedimentary contents of potassium (K), thorium (Th), and uranium (U) from the characteristic gamma-ray energies of isotopes in the 40K, 232Th, and 238U radioactive decay series. Dunlea et al. [2013] quantified K, Th and U contents in sediment from the South Pacific Gyre by integrating counts over specific energy levels of the NGR spectrum. However, the algorithm used in their study is unavailable to the wider scientific community due to commercial proprietary reasons. Here, we present a new MATLAB algorithm for the quantification of NGR spectra that is transparent and accessible to future NGR users. We demonstrate the algorithm's performance by comparing its results to shore-based inductively coupled plasma-mass spectrometry (ICP-MS), inductively coupled plasma-emission spectrometry (ICP-ES), and quantitative wavelength-dispersive X-ray fluorescence (XRF) analyses. Samples for these comparisons come from eleven sites (U1341, U1343, U1366-U1369, U1414, U1428-U1430, U1463) cored in two oceans during five expeditions. In short, our algorithm rapidly produces detailed high-quality information on sediment properties during IODP expeditions at no extra cost. Dunlea, A. G., R. W. Murray, R. N. Harris, M. A. Vasiliev, H. Evans, A. J. Spivack, and S. D'Hondt (2013), Assessment and use of NGR instrumentation on the JOIDES Resolution to quantify U, Th, and K concentrations in marine sediment, Scientific Drilling, 15, 57-63.

  16. In-Situ Sampling and Characterization of Naturally Occurring Marine Methane Hydrate Using the D/V JOIDES Resolution

    Energy Technology Data Exchange (ETDEWEB)

    Frank R. Rack

    2006-09-20

    Cooperative Agreement DE-FC26-01NT41329 between Joint Oceanographic Institutions and DOE-NETL was divided into two phases based on successive proposals and negotiated statements of work pertaining to activities to sample and characterize methane hydrates on ODP Leg 204 (Phase 1) and on IODP Expedition 311 (Phase 2). The Phase 1 Final Report was submitted to DOE-NETL in April 2004. This report is the Phase 2 Final Report to DOE-NETL. The primary objectives of Phase 2 were to sample and characterize methane hydrates using the systems and capabilities of the D/V JOIDES Resolution during IODP Expedition 311, to enable scientists the opportunity to establish the mass and distribution of naturally occurring gas and gas hydrate at all relevant spatial and temporal scales, and to contribute to the DOE methane hydrate research and development effort. The goal of the work was to provide expanded measurement capabilities on the JOIDES Resolution for a dedicated hydrate cruise to the Cascadia continental margin off Vancouver Island, British Columbia, Canada (IODP Expedition 311) so that hydrate deposits in this region would be well characterized and technology development continued for hydrate research. IODP Expedition 311 shipboard activities on the JOIDES Resolution began on August 28 and were concluded on October 28, 2005. The statement of work for this project included three primary tasks: (1) research management oversight, provided by JOI; (2) mobilization, deployment and demobilization of pressure coring and core logging systems, through a subcontract with Geotek Ltd.; and, (3) mobilization, deployment and demobilization of a refrigerated container van that will be used for degassing of the Pressure Core Sampler and density logging of these pressure cores, through a subcontract with the Texas A&M Research Foundation (TAMRF). Additional small tasks that arose during the course of the research were included under these three primary tasks in consultation with the DOE

  17. A Narrative about a “Resurrected Woman” in the Reception of D.V. Batov, an Old Believer of Tula

    Directory of Open Access Journals (Sweden)

    Alexander V. Pigin

    2017-12-01

    Full Text Available The article deals with one of the genres of Russian folklore, the so-called obmiraniye narratives about a human soul visiting the other world during the lethargy state. It dis- cusses the problem of perception of such texts on the example of the following case study. At the turn of the century, a famous Tula-based Old Believer and publisher D.V. Batov (1825–1910 wrote a short article “On the Reading of Brochure Phrases” (reprinted as “On the Reading of Fictitious Brochures”. In this article, he strongly criticized the nar- rative about a “resurrected woman” recorded by Archimandrite Macarius (Glukharyov of Altai in the early 1830s. In this narrative, a local Cossack’s wife sank into lethargy and was ascended to heaven where she met the Lord who heard the prayers for her and let her go back but instead ordered to bring him the soul of a different woman bearing the same name. D.V. Batov interpreted this obmiraniye narrative as sheer fiction circulated by the dominant church, alongside other fictitious stories, and causing damage to the faith. The article examines other D.V. Batov’s arguments against this text: the main one is dis- crepancy between the narrative and the Orthodox doctrine of the soul’s afterlife ordeals as represented in the Byzantine Life of Vassily Novy (10 th century. The Old Believer of Tula reads a text belonging to folk culture through the lenses of church literature and bookish topoi. Thus, the process of text verification by the bearer of religious conscious- ness consists in its juxtaposing with the tradition that the recipient sees as the only true one. The article also analyzes the actual obmiraniye narrative recorded by Archimandrite Macarius and finds its parallels in oral and written texts of the visionary genre.

  18. A safe vaccine (DV-STM-07 against Salmonella infection prevents abortion and confers protective immunity to the pregnant and new born mice.

    Directory of Open Access Journals (Sweden)

    Vidya Devi Negi

    Full Text Available Pregnancy is a transient immuno-compromised condition which has evolved to avoid the immune rejection of the fetus by the maternal immune system. The altered immune response of the pregnant female leads to increased susceptibility to invading pathogens, resulting in abortion and congenital defects of the fetus and a subnormal response to vaccination. Active vaccination during pregnancy may lead to abortion induced by heightened cell mediated immune response. In this study, we have administered the highly attenuated vaccine strain DeltapmrG-HM-D (DV-STM-07 in female mice before the onset of pregnancy and followed the immune reaction against challenge with virulent S. Typhimurium in pregnant mice. Here we demonstrate that DV-STM-07 vaccine gives protection against Salmonella in pregnant mice and also prevents Salmonella induced abortion. This protection is conferred by directing the immune response towards Th2 activation and Th1 suppression. The low Th1 response prevents abortion. The use of live attenuated vaccine just before pregnancy carries the risk of transmission to the fetus. We have shown that this vaccine is safe as the vaccine strain is quickly eliminated from the mother and is not transmitted to the fetus. This vaccine also confers immunity to the new born mice of vaccinated mothers. Since there is no evidence of the vaccine candidate reaching the new born mice, we hypothesize that it may be due to trans-colostral transfer of protective anti-Salmonella antibodies. These results suggest that our vaccine DV-STM-07 can be very useful in preventing abortion in the pregnant individuals and confer immunity to the new born. Since there are no such vaccine candidates which can be given to the new born and to the pregnant women, this vaccine holds a very bright future to combat Salmonella induced pregnancy loss.

  19. Screening for trisomy 21 based on maternal age, nuchal translucency measurement, first trimester biochemistry and quantitative and qualitative assessment of the flow in the DV - the assessment of efficacy.

    Science.gov (United States)

    Czuba, Bartosz; Zarotyński, Dariusz; Dubiel, Mariusz; Borowski, Dariusz; Węgrzyn, Piotr; Cnota, Wojciech; Reska-Nycz, Małgorzata; Mączka, Marek; Wielgoś, Mirosław; Sodowski, Krzysztof; Serafin, Dawid; Kubaty, Anna; Bręborowicz, Grzegorz H

    2017-01-01

    The aim of the study was to compare effects of addition of two methods of ductus venosus (DV) flow assessment: qualitative - the assessment of shape of the A-wave (positive or negative), and quantitative - based on the pulsatility index for veins (DVPI) to the basic screening for trisomy 21 at 11 to 13 + 6 weeks of pregnancy. The ultrasound examination was performed in 8230 fetuses in singleton pregnancies at 11- -13 + 6 wks, as a part of a routine screening for chromosomal defects. In DV A-wave was assessed and DVPI was calculated. After the scan blood sample was taken for first trimester biochemistry (BC). Risk for chromosomal defects was calculated and high-risk patients were offered an invasive test for karyotyping. Basic screening with following combination of markers: MA, NT and BC provided lowest detection rate (DR) 87.50% for FPR = 6.94%. After adding qualitative DV A-wave assessment DR increased to 88.75% for FPR = 5.65%. The best DR = 93.75% for FPR = 5.55% was achieved when quantitative DVPI was added. The application of the Receiver Operating Curves curve confirmed validity of the addition of DV flow assessment to the screening model. The highest diagnostic power of the test was achieved when DVPI was added, with the ROC AUC of 0.974. The assessment of DV flow performed at 11-13 + 6 weeks increases DR for trisomy 21 and reduces FPR. The screening model based on the quantitative DV flow analysis (DVPI) gives better results compared to the qualitative flow assessment.

  20. THE RECENT STRUCTURE AND THE ASSUMED HISTORY OF FORMATION OF THE CRUST IN THE SOUTH-EASTERN SEGMENT OF THE NORTH ASIAN CRATON ALONG REFERENCE PROFILE 3-DV

    Directory of Open Access Journals (Sweden)

    E. Yu. Goshko

    2014-01-01

    Full Text Available The article presents results of specialized processing of the deep seismic profile along a part of Reference Profile 3-DV which crosses the Aldan-Stanovoi shield in the meridian direction and goes across its buried northern slope. The study is aimed at determining frequency-energy characteristics of the seismic wave field which are related to physical conditions of geological features of the crust. Based on analysis and interpretation of the dynamic profiles, it is possible to reveal and contour the Archean cores of consolidation of the Aldan shield and its buried continuation that is covered by sediments of the Middle Lena monocline and to input new facts in the proposed geodynamic model showing formation of the crust in the south-eastern segment of the North Asian craton.

  1. A prospective, single-arm study on the use of the da Vinci® Table Motion with the Trumpf TS7000dV operating table.

    Science.gov (United States)

    Morelli, Luca; Palmeri, Matteo; Simoncini, Tommaso; Cela, Vito; Perutelli, Alessandra; Selli, Cesare; Buccianti, Piero; Francesca, Francesco; Cecchi, Massimo; Zirafa, Cristina; Bastiani, Luca; Cuschieri, Alfred; Melfi, Franca

    2018-03-30

    The da Vinci® Table Motion (dVTM) comprises a combination of a unique operating table (Trumpf Medical™ TruSystem® 7000dV) capable of isocenter motion connected wirelessly with the da Vinci Xi® robotic platform, thereby enabling patients to be repositioned without removal of instruments and or undocking the robot. Between May 2015 to October 2015, the first human use of dVTM was carried out in this prospective, single-arm, post-market study in the EU, for which 40 patients from general surgery (GS), urology (U), or gynecology (G) were enrolled prospectively. Primary endpoints of the study were dVTM feasibility, efficacy, and safety. Surgeons from the three specialties obtained targeting success and the required table positioning in all cases. Table movement/repositioning was necessary to gain exposure of the operating field in 106/116 table moves (91.3%), change target in 2/116 table moves (1.7%), achieve hemodynamic relief in 4/116 table moves (3.5%), and improve external access for tumor removal in 4/116 table moves (3.5%). There was a significantly higher use of tilt and tilt plus Trendelenburg in GS group (GS vs. U p = 0.055 and GS vs. G p = 0.054). There were no dVTM safety-related or adverse events. The dVTM with TruSystem 7000dV operating table in wireless communication with the da Vinci Xi is a perfectly safe and effective synergistic combination, which allows repositioning of the patient whenever needed without imposing any delay in the execution of the operation. Moreover, it is helpful in avoiding extreme positions and enables the anesthesiologist to provide immediate and effective hemodynamic relief to the patient when needed.

  2. Lothar de Maizière: Stasil on praegu rohkemgi võimu kui Saksa DV ajal / Lothar de Maizière ; intervjueerinud Külli-Riin Tigasson

    Index Scriptorium Estoniae

    Maizière, Lothar de

    2009-01-01

    Intervjuu Saksa DV esimese ja ühtlasi viimase demokraatlikult valitud peaministriga Berliini müüri langemisest 20 aastat tagasi, 21. sajandi peamistest väljakutsetest. SDV ajaloo uurimisest läänesakslaste poolt, ajaloo läbitöötamise käigus sündinud vildakast pildist SDV ühiskonnast, Stasi toimikutest

  3. X-ray Fluorescence Core Scanning of Oman Drilling Project Holes BT1B and GT3A Cores on D/V CHIKYU

    Science.gov (United States)

    Johnson, K. T. M.; Kelemen, P. B.; Michibayashi, K.; Greenberger, R. N.; Koepke, J.; Beinlich, A.; Morishita, T.; Jesus, A. P. M.; Lefay, R.

    2017-12-01

    The JEOL JSX-3600CA1 energy dispersive X-ray fluorescence core logger (XRF-CL) on the D/V Chikyu provides quantitative element concentrations of scanned cores. Scans of selected intervals are made on an x-y grid with point spacing of 5 mm. Element concentrations for Si, Al, Ti, Ca, Mg, Mn, Fe, Na, K, Cr, Ni, S and Zn are collected for each point on the grid. Accuracy of element concentrations provided by the instrument software is improved by applying empirical correction algorithms. Element concentrations were collected for 9,289 points from twenty-seven core intervals in Hole BT1B (basal thrust) and for 6,389 points from forty core intervals in Hole GT3A (sheeted dike-gabbro transition) of the Oman Drilling Project on the D/V Chikyu XRF-CL during Leg 2 of the Oman Drilling Project in August-September, 2017. The geochemical data are used for evaluating downhole compositional details associated with lithological changes, unit contacts and mineralogical variations and are particularly informative when plotted as concentration contour maps or downhole concentration diagrams. On Leg 2 additional core scans were made with X-ray Computed Tomography (X-ray CT) and infrared images from the visible-shortwave infrared imaging spectroscopy (IR) systems on board. XRF-CL, X-ray CT and IR imaging plots used together provide detailed information on rock compositions, textures and mineralogy that assist naked eye visual observations. Examples of some uses of XRF-CL geochemical maps and downhole data are shown. XRF-CL and IR scans of listvenite clearly show zones of magnesite, dolomite and the Cr-rich mica, fuchsite that are subdued in visual observation, and these scans can be used to calculate variations in proportions of these minerals in Hole BT1B cores. In Hole GT3A XRF-CL data can be used to distinguish compositional changes in different generations of sheeted dikes and gabbros and when combined with visual observations of intrusive relationships the detailed geochemical

  4. The first microbiological contamination assessment by deep-sea drilling and coring by the D/V Chikyu at the Iheya North hydrothermal field in the Mid-Okinawa Trough (IODP Expedition 331

    Directory of Open Access Journals (Sweden)

    Katsunori eYanagawa

    2013-11-01

    Full Text Available During the Integrated Ocean Drilling Program (IODP Expedition 331 at the Iheya North hydrothermal system in the Mid-Okinawa Trough by the D/V Chikyu, we conducted microbiological contamination tests of the drilling and coring operations. The contamination from the drilling mud fluids was assessed using both perfluorocarbon tracers (PFT and fluorescent microsphere beads. PFT infiltration was detected from the periphery of almost all whole round cores. By contrast, fluorescent microspheres were not detected in hydrothermally active core samples, possibly due to thermal decomposition of the microspheres under high-temperature conditions. Microbial contamination from drilling mud fluids to the core interior subsamples was further characterized by molecular-based evaluation. The microbial 16S rRNA gene phylotype compositions in the drilling mud fluids were mainly composed of sequences of Beta- and Gammaproteobacteria, and Bacteroidetes and not archaeal sequences. The phylotypes that displayed more than 97% similarity to the sequences obtained from the drilling mud fluids were defined as possible contaminants in this study and were detected as minor components of the bacterial phylotype compositions in 13 of 37 core samples. The degree of microbiological contamination was consistent with that determined by the PFT and/or microsphere assessments. This study suggests a constructive approach for evaluation and eliminating microbial contamination during riser-less drilling and coring operations by the D/V Chikyu.

  5. Novostavba rodinného domu se dvěma bytovými jednotkami v Galantě v části Kolónia

    OpenAIRE

    Varjú, Marián

    2015-01-01

    Bakalářská práce „Novostavba rodinného domu se dvěma bytovými jednotkami v Galanta v části Kolónia“ je zpracována ve formě prováděcí projektové dokumentace a obsahuje všechny náležitosti dle platných předpisů. Navržený objekt leží na parcelách s číslem 5184/143, 5184/40 v Galantě v části Kolónia. Svým charakterem se jedná o samostatně stojící objekt. Rodinný dům je navržen systémem Durisol od Leier. Konstrukce střechy je rozdělena do dvou úrovní. Střecha je tvořena z pultové vaznicové konstru...

  6. ASSESSMENT OF THE LOCALIZATION OF HYPOCENTERS OF CRUSTAL EARTHQUAKES RELATIVE TO THE DEPTH AND RELIEF OF THE BORDER DENSITY STRATIFICATION IN THE CRUST OF THE NORTHEASTERN SECTION OF THE REFERENCE GEOLOGICAL-GEOPHYSICAL PROFILE 3-DV

    Directory of Open Access Journals (Sweden)

    N. K. Gayday

    2017-01-01

    Full Text Available The total length of the seismic profiles in the northeastern regions ofRussiaand, accordingly, the area of the territories covered by the seismic data interpretations, remains insignificant in comparison with the total area of these regions. At the same time, the geological objects in the northeastern regions attract much attention in view of their prospects, including potential mineral resources. The challenge is to construct the regional models of the crust structure without deep seismic survey data, and to analyze the regional seismicity that depends on the features of the deep crust structure. We develop a density model of the crust structure using the new interpretational gravimetry method. The density modeling results show that the density changes in the crust can be used to estimate the position of a surface separating the lower (quasi-homogeneous and upper (heterogeneous parts of the crust, i.e. to assess the density boundary of stratification. This boundary is formed due to a complex of physical and chemical processes that facilitate the transition of the material in the lower part of the crust into the quasi-uniform (homogeneous state. The study area is the junction zone of the Ayan-Yuryakh anticlinorium and Inyali-Debin synclinorium (62‒63°N, 148‒152° E. The initial interpretation of the deep seismic survey data on the reference geological-geophysical profile 3-DV was available, so the ambiguity of the density modeling was reduced. In turn, the density modeling results can provide additional information for geological-geophysical interpretation of the DSS results on the sites wherein the seismic profiles go along the fault zones. The relationship between seismic events and the relief of the density boundary of stratification in the crust was studied quantitatively on the basis of the data from the regional catalog of seismic events and the results of the earlier analysis of seismicity in the study area. The analysis shows that

  7. Rozvod v 21. století

    OpenAIRE

    Tučková, Markéta

    2013-01-01

    This bachelor thesis deals with divorce and the history of divorce situation till the beginning of the 21st century. It describes the essential divorce problem areas, lists both negative and positive divorce consequences, specific effects of divorce on children, historical evolvement of legal regulations of divorce and their present-day form and current development trends in the Czech Republic. Empirical part of the thesis analyses opinion shifts on family and divorce in Czech population betw...

  8. Kunsten at dvæle i dialogen

    DEFF Research Database (Denmark)

    Stelter, Reinhard

    en drøm, nemlig at føre dialoger, som beriger begge parter – vel vidende, at dialogholderen, fx coachen, har et særligt ansvar for dialogens fremgang. Bogen henvender sig til alle, der ønsker at styrke deres evner som samskabende dialogpartner – uanset om man er coach, mentor, leder, kollega......I denne bog forholder Reinhard Stelter sig til de kritiske stemmer, som har rejst sig i forhold til coaching. Denne kritik anses for berettiget, især når man placerer coaching som middel til optimering af den enkeltes præstationsræs og som simpelt motivationsinstrument. Præstationssubjektet har...... nået sine grænser og skal mødes med omsorg og forståelse. Forfatterens ambition er at inddrage tredje generations coaching i en søgen efter en bæredygtig, frugtbar og åben dialogform, som kan bruges I mange livskontekster. Dialogpartneren frigøres ved at inviteres til at finde sit etiske ståsted...

  9. Altri collegamenti a lavori del gruppo di DV

    Directory of Open Access Journals (Sweden)

    Doctor Virtualis Redazione

    2008-08-01

    Full Text Available • Giovanni di Mirecourt, Commento alle Sentenze, libro I Attualmente non raggiungibile perché il server del Dipartimento di filosofia è stato oggetto di un attacco da parte di un hacker Edizione provvisoria on-line Il lavoro nasce dalla collaborazione tra Eugenio Randi e Massimo Parodi, e giunge alla pubblicazione on-line (provvisoria grazie all'intervento di Lucia Caccia Dominioni, che ha ordinato e ripulito il materiale a disposizione. • Seminario su Tommaso De ente et essentia - 1995/96 Il materiale prodotto dagli studenti che hanno partecipato al lavoro di discussione seminariale del De ente et essentia di Tommaso d'Aquino.

  10. Management a leadership ve 20. století

    OpenAIRE

    Šafránková, Noemi

    2009-01-01

    The bachelor thesis describes the development of most famous theories of management and leadership in 20th century that had and still do have great influence over our managerial and organisational thinking. The focus of this paper is to describe and critically evaluate the contribution of these theoretical disciplines from a human factor's perception of organisation. The first part of the thesis is focused on "big theoretical concepts" of "taylorism", Fayol's concept of managerial functions a...

  11. Active gate driver for dv/dt control and active voltage clamping in an IGBT stack

    DEFF Research Database (Denmark)

    Rasmussen, Tonny Wederberg

    2005-01-01

    For high voltages converters stacks of IGBTs can be used if the static and dynamic voltage sharing among the IGBTs can be applied. dVCE/dt should also be controlled in order not to damage insulation material. This paper describes theory and measurements of an active gate driver for stacking IGBTs....... For the measurements two series connected standard IGBTs made for hard switching applications are used. Problems are shown and proposals for improvements are given....

  12. Dvakrát dvě se nerovná čtyři

    Czech Academy of Sciences Publication Activity Database

    Olšovský, Miroslav

    2015-01-01

    Roč. 25, č. 52 (2015), s. 86-91 ISSN 0862-8440 Institutional support: RVO:68378017 Keywords : modern narrative * maelstrom of reality * plane of immanence * literary criticism Subject RIV: AJ - Letters, Mass-media, Audiovision

  13. 78 FR 59743 - Bureau of Consular Affairs; Registration for the Diversity Immigrant (DV-2015) Visa Program

    Science.gov (United States)

    2013-09-27

    ... result in Web site delays. No late entries or paper entries will be accepted. The law allows only one... Dominica Grenada Guatemala Guyana Honduras Nicaragua Panama Paraguay Saint Kitts and Nevis Saint Lucia...

  14. Berlinale 2003 : "Lenin" - poeg lavastab ema jaoks Saksa DV edasikestmise / Jaak Lõhmus

    Index Scriptorium Estoniae

    Lõhmus, Jaak

    2003-01-01

    Festivalist, mis toimub loosungi all "Towards tolerance" ja võistluskava filmidest : briti režissööri Michael Winterbottomi "Siin maailmas", sakslase Wolfgang Beckeri absurdikomöödia "Jumalaga, Lenin!" ning Steven Soderberghi "Solaris"

  15. DV142 The application of the LOICZ-model on the Sacco di Goro Lagoon, Italy

    NARCIS (Netherlands)

    Edel, I.M.A.

    2002-01-01

    This report examines the application of the LOICZ-model to the Sacca di Goro lagoon. This estuary is located in the Po river delta, along de North Adriatic Coast, in Northern Italy. Activities in the lagoon itself, like fishery, aquaculture, tourism and activities in the hinterland, like:

  16. Dvě ontologie české demokracie: T. G. Masaryk a J. L. Fischer

    Czech Academy of Sciences Publication Activity Database

    Pauza, Miroslav

    2015-01-01

    Roč. 63, č. 2 (2015), s. 233-245 ISSN 0015-1831 Institutional support: RVO:67985955 Keywords : Masaryk * Fischer * democracy * providence * order * structure * function * individuality * sociality * crisis Subject RIV: AA - Philosophy ; Religion

  17. A High dV Miniature Ion Thruster for SmallSat Primary Propulsion

    Data.gov (United States)

    National Aeronautics and Space Administration — CubeSats enable a wide range of important, low-cost space missions, leveraging increasing densification of electronics and communications equipment to perform tasks...

  18. Proti dvěma nepřátelům

    Czech Academy of Sciences Publication Activity Database

    Friedl, Jiří

    2015-01-01

    Roč. 28, 9.5.2015 (2015), 22/4-22/4 ISSN 0862-5921 Institutional support: RVO:67985963 Keywords : Second World War * liberation of Czechoslovakia * Holy Cross Brigade * Polish armed forces Subject RIV: AB - History

  19. X-ray CT core imaging of Oman Drilling Project on D/V CHIKYU

    Science.gov (United States)

    Michibayashi, K.; Okazaki, K.; Leong, J. A. M.; Kelemen, P. B.; Johnson, K. T. M.; Greenberger, R. N.; Manning, C. E.; Harris, M.; de Obeso, J. C.; Abe, N.; Hatakeyama, K.; Ildefonse, B.; Takazawa, E.; Teagle, D. A. H.; Coggon, J. A.

    2017-12-01

    We obtained X-ray computed tomography (X-ray CT) images for all cores (GT1A, GT2A, GT3A and BT1A) in Oman Drilling Project Phase 1 (OmanDP cores), since X-ray CT scanning is a routine measurement of the IODP measurement plan onboard Chikyu, which enables the non-destructive observation of the internal structure of core samples. X-ray CT images provide information about chemical compositions and densities of the cores and is useful for assessing sample locations and the quality of the whole-round samples. The X-ray CT scanner (Discovery CT 750HD, GE Medical Systems) on Chikyu scans and reconstructs the image of a 1.4 m section in 10 minutes and produces a series of scan images, each 0.625 mm thick. The X-ray tube (as an X-ray source) and the X-ray detector are installed inside of the gantry at an opposing position to each other. The core sample is scanned in the gantry with the scanning rate of 20 mm/sec. The distribution of attenuation values mapped to an individual slice comprises the raw data that are used for subsequent image processing. Successive two-dimensional (2-D) slices of 512 x 512 pixels yield a representation of attenuation values in three-dimensional (3-D) voxels of 512 x 512 by 1600 in length. Data generated for each core consist of core-axis-normal planes (XY planes) of X-ray attenuation values with dimensions of 512 × 512 pixels in 9 cm × 9 cm cross-section, meaning at the dimensions of a core section, the resolution is 0.176 mm/pixel. X-ray intensity varies as a function of X-ray path length and the linear attenuation coefficient (LAC) of the target material is a function of the chemical composition and density of the target material. The basic measure of attenuation, or radiodensity, is the CT number given in Hounsfield units (HU). CT numbers of air and water are -1000 and 0, respectively. Our preliminary results show that CT numbers of OmanDP cores are well correlated to gamma ray attenuation density (GRA density) as a function of chemical composition and mineral density, so that their profiles with respect to the core depth provide quick lithological information such as mineral identification and phase boundary etc. Moreover, X-ray CT images can be used for 3-D fabric analyses of the whole core even after core cutting into halves for individual analyses.

  20. 76 FR 62134 - Bureau of Consular Affairs; Registration for the Diversity Immigrant (DV-2013) Visa Program

    Science.gov (United States)

    2011-10-06

    ... provide an immigration opportunity for persons from countries other than the countries that send large... Immigration and Nationality Act, as amended, (8 U.S.C. 1151, 1153, and 1154(a)(1)(I)). Instructions for the... Immigration and Nationality Act (INA). Section 131 of the Immigration Act of 1990 (Pub. L. 101-649) amended...

  1. 75 FR 60846 - Bureau of Consular Affairs; Registration for the Diversity Immigrant (DV-2012) Visa Program

    Science.gov (United States)

    2010-10-01

    ...? Diversity Visas are intended to provide an immigration opportunity for persons from countries other than the... Immigration and Nationality Act, as amended, (8 U.S.C. 1151, 1153, and 1154(a)(1)(I)). Instructions for the... Section 203(c) of the Immigration and Nationality Act (INA). Section 131 of the Immigration Act of 1990...

  2. Hydrogen spillover on DV (555-777) graphene – vanadium cluster system: First principles study

    Energy Technology Data Exchange (ETDEWEB)

    Kumar, E. Mathan, E-mail: ranjit.t@res.srmuniv.ac.in, E-mail: mathanranjitha@gmail.com; Thapa, Ranjit, E-mail: ranjit.t@res.srmuniv.ac.in, E-mail: mathanranjitha@gmail.com [SRM Research Institute, SRM University, Kattankulathur, Tamil Nadu - 603203 (India); P, Sabarikirishwaran [Department of Physics and Nanotechnology, SRM University, Kattankulathur, Tamil Nadu - 603203 (India)

    2015-06-24

    Using dispersion corrected density functional theory (DFT+D), the interaction of Vanadium adatom and cluster with divacancy (555-777) defective graphene sheet has been studied elaborately. We explore the prospect of hydrogen storage on V{sub 4} cluster adsorbed divacancy graphene system. It has been observed that V{sub 4} cluster (acting as a catalyst) can dissociate the H{sub 2} molecule into H atoms with very low barrier energy. We introduce the spillover of the atomic hydrogen throughout the surface via external mediator gallane (GaH{sub 3}) to form a hydrogenated system.

  3. Zahraniční politika Japonska v 21. století

    OpenAIRE

    Mikšovská, Petra

    2017-01-01

    Foreign Policy plays an important role in setting of national interests and influences the position of the country in international relations. For a global power in the 21.century, as Japan, foreign policy setting means an important tool or building its position on international political scene. There are many factors incluencing directly creating of the foreing policy, this paper concentrates on teritorrial disputes with neighbor states of Japan - China, Russia, South Korea,that cause tensio...

  4. Jan Hus v proměnách šesti století

    Czech Academy of Sciences Publication Activity Database

    Čornej, Petr

    2015-01-01

    Roč. 17, č. 4 (2015), s. 19-35 ISSN 1212-8570 R&D Projects: GA ČR(CZ) GBP405/12/G148 Institutional support: RVO:68378092 Keywords : Jan Hus * Hussitism * historical tradition * František Palacký * Czech Lands * Catholic church * communist concept Subject RIV: AB - History

  5. Meče 11.-13. století z území Moravy

    Czech Academy of Sciences Publication Activity Database

    Žákovský, P.; Hošek, Jiří; Sedláčková, L.

    2013-01-01

    Roč. 38, č. 1 (2013), s. 219-270 ISSN 0231-5823 R&D Projects: GA ČR GAP405/12/2289 Institutional support: RVO:67985912 Keywords : sword * Middle Ages * Moravia Subject RIV: AC - Archeology, Anthropology, Ethnology

  6. Problematika sebereflexe v románu 20. století

    OpenAIRE

    KOUDELKOVÁ, Jana

    2011-01-01

    This diploma thesis deals with the problems of the self-reflection in the prose of the 20th century. At first there are described the techniques of the narration, which appeared in the 20th century. Then there are defined the general signs of the self-reflection and the influence of social situation on the increase of the self-reflection. In the next section the work involves the analysis of the novel Život a názory blahorodého pana Tristrama Shandyho. The conception of the self-reflection is...

  7. Marketing středověkého hradu ve 21. století

    OpenAIRE

    Mendlová, Hana

    2010-01-01

    This master's thesis deals with marketing of the historical monument, specifically private castle Horní hrad. The thesis consists of two parts. The first part is devoted to theoretical background as marketing, marketing mix of historical monuments and enterprise in the field of culture. The practical part deals with past and present of Horní hrad castle. Afterwards the thesis analyses the elements of marketing mix. Based on the information from this part of the thesis and information from mar...

  8. Přestavba kostela sv. Martina v Sedlčanech ve 14. století

    Czech Academy of Sciences Publication Activity Database

    Prix, Dalibor

    2017-01-01

    Roč. 24, č. 1 (2017), s. 3-38 ISSN 1212-1487 Institutional support: RVO:68378033 Keywords : Bohemia * Sedlčany * church of St. Martin * 13th - 14th century Subject RIV: AL - Art, Architecture, Cultural Heritage OBOR OECD: Architectural design

  9. Ze zlaté Prahy až do Chorvatska 19. století

    Czech Academy of Sciences Publication Activity Database

    Černý, Marcel

    2012-01-01

    Roč. 81, č. 4 (2012), s. 476-481 ISSN 0037-6736 Institutional support: RVO:68378017 Keywords : Czech literature * Croatian-Czech literary relations * Croatian literary journals * literary reception Subject RIV: AJ - Letters, Mass-media, Audiovision

  10. Determinanty zahraniční politiky Japonska v 21. století

    OpenAIRE

    Hojzáková, Věra

    2011-01-01

    The aim of this thesis is to analyze Japan`s foreign policy in the first ten years of the 21st century. The basis for the analysis is the development of Japan`s foreign policy since the end of the World War II until present. The analysis of Japan`s foreign policy takes place on several levels; the author of the thesis examines factors and events that have major impact on Japan`s foreign policy. At the end of the thesis, the author formulates both general as well as specific determinants of Ja...

  11. Grafen - zázračný materiál 21. století

    Czech Academy of Sciences Publication Activity Database

    Fejfar, Antonín; Hájková, Zdeňka

    2014-01-01

    Roč. 23, - (2014), s. 171-175 ISSN 1210-3349 R&D Projects: GA ČR GA14-15357S; GA MŠk(CZ) LM2011026 Institutional support: RVO:68378271 Keywords : graphene * two-dimensional material Subject RIV: AM - Education

  12. Co se četlo v Klementinu v 90. letech 18. století?

    Czech Academy of Sciences Publication Activity Database

    Madl, Claire

    -, Č. 2 (2014), s. 91-105 ISSN 1804-5367 R&D Projects: GA ČR GA15-22253S Institutional support: RVO:68378068 Keywords : Klementinum * public libraries * Karel Rafael Ungar * Enlightenment * book culture * reading Subject RIV: AJ - Letters, Mass-media, Audiovision

  13. Typy venkovských kostelů v 17. století

    Czech Academy of Sciences Publication Activity Database

    Švácha, Rostislav

    2017-01-01

    Roč. 77, 1/2 (2017), s. 87-98 ISSN 1210-5538 Institutional support: RVO:68378033 Keywords : rural churches * 18th century architecture * typology of sacral architecture * Bohemia and Moravia Subject RIV: AL - Art, Architecture, Cultural Heritage

  14. Rekonstrukce podoby hradu Křivoklátu v 13. století

    Czech Academy of Sciences Publication Activity Database

    Durdík, Tomáš

    45/115, 3-4 (2007), s. 251-254 ISSN 0027-5255 Grant - others:EU(DE) EU Culture 2000 CLT2005/A1/DE-492 Institutional research plan: CEZ:AV0Z80020508 Keywords : castle * castellology * Křivoklát * architecture * visualisation * medieval archaeology * Middle Ages * Bohemia Subject RIV: AC - Archeology, Anthropology, Ethnology

  15. Století letectví v zemích Koruny České

    Czech Academy of Sciences Publication Activity Database

    Řípa, Milan

    2011-01-01

    Roč. 59, č. 4 (2011), s. 27-27 ISSN 0040-1064 Institutional research plan: CEZ:AV0Z20430508 Keywords : recension * flying * flying * airplane * air-balloon Subject RIV: BL - Plasma and Gas Discharge Physics

  16. Aristotelova etika ctností a její renesance ve 20. století

    OpenAIRE

    PODZIMKOVÁ, Markéta

    2015-01-01

    This diploma thesis deals with the Aristotelian virtue ethics and its renaissance in the twentieth century. Ethics is first defined generally as a separate science which belongs to the practical sciences. Subsequently, the emphasis on virtue ethics as one of the directions of normative ethics. A key part of the thesis deals with the ethics of virtue in Aristotle and interpretation corresponding more or less to the interpretation of the work of Nicomachean Ethics. The emphasis is on concepts o...

  17. Faustovská postava ve francouzsky psaném dramatu 20. století

    OpenAIRE

    Tschornová, Kateřina

    2007-01-01

    The diploma work Faustian Character in 20th Century French Language Drama summarizes the history and circumstances of Faustian legend, Faust's mythological and archetypical aspect. Compares Goethe's classical work to three French dramas by Valéry, Ghelderode and Tardieu. An analysis follows of three contemporary plays (Catheriene Anne: Trois Femmes / L'échappée, Xaviera Durringer: Bal-Trap and Jacques Languirand: Faust et les radicaux libres) and an overview of Czech and European Fausts.

  18. Konference Knižní kultura 19. století

    Czech Academy of Sciences Publication Activity Database

    Holubová, Markéta

    2017-01-01

    Roč. 104, č. 4 (2017), s. 518-519 ISSN 0009-0794 Institutional support: RVO:68378076 Keywords : book culture * conference * 19. century Subject RIV: AC - Archeology, Anthropology, Ethnology OBOR OECD: 6.5 Other Humanities and the Arts

  19. Egypt v literatuře před polovinou 19. století

    Czech Academy of Sciences Publication Activity Database

    Baďurová, Anežka

    -, č. 4 (2013) E-ISSN 1805-2800 Keywords : egypt ian literature * literature * Week of science and technology 2013 http://www.lib.cas.cz/casopis-informace/ egypt -v-literature-pred-polovinou-19-stoleti/

  20. Guatemala: Ozbrojený konflikt 1960-1996 a současná situace: se zvláštním zaměřením na Máje

    OpenAIRE

    Vilímková, Olga

    2009-01-01

    Tématem disertační práce je Guatemala: ozbrojený konflikt v letech 1960 - 1996 a současná situace se zvláštním zaměřením na Máje. Příčiny ozbrojeného konfliktu druhé ploviny XX. století (a mnoha současných problémů) v Guatemale se nacházejí v hluboké minulosti země. Už v době koloniální se začaly formovat ekonomicko - sociální vztahy mezi dvěma antagonistickými vrstvami společnosti: kolonizátory a původním obyvatelstvem, které bylo porobeno, vytlačeno na okraj společnosti a využíváno jako pra...

  1. Dolní Věstonice (okr. Břeclav). Lokalita DV-IIa (Lahmhöfe, Pod lesem); DV-III (Rajny). Gravettien. Záchranný a zjišťovací výzkum

    Czech Academy of Sciences Publication Activity Database

    Svoboda, Jiří; Hladilová, Š.; Králík, M.; Novák, J.; Novák, Martin; Pokorný, P.; Sázelová, Sandra

    2013-01-01

    Roč. 54, č. 1 (2013), s. 117-120 ISSN 1211-7250 R&D Projects: GA MŠk(CZ) EE2.3.20.0181 Institutional support: RVO:68081758 Keywords : Dolní Věstonice * Gravettian * settlement structure * microstratigraphy Subject RIV: AC - Archeology, Anthropology, Ethnology

  2. The First D/V Chikyu IODP Operations: Successful Logging and Coring During NanTroSEIZE Stage 1 Expeditions

    Directory of Open Access Journals (Sweden)

    Moe Kyaw Thu

    2008-07-01

    Full Text Available The Nankai Trough Seismogenic Zone Experiment (NanTroSEIZE is a multi-expedition IODP drilling project aimed at drilling, coring, logging, and instrumenting the seismogenic zone of an active subduction margin , in a region thought to generate megathrust earthquakes of magnitude >8.0 on the moment-magnitude scale (Tobin and Kinoshita, 2006. The Nankai Trough, offshore of the Kii Peninsula, Honshu, Japan (Fig. 1 was chosen as the location for thisproject based on a number of scientific drilling proposals to IODP. These reviewed existing drilling data in the region, the long-term historical and recent record of great earthquakes, the social and societal relevance of the area, and the accessibility of the seismogenic zone to present drilling technology. The first stage of this multi-stage project was intended to accomplish a broad characterization of the shallow geology, geophysics, physical properties, heat flow, and fluid flow in a transect across the downgoing Philippine Sea Plate, the toe of the Nankai accretionary prism, the megasplay fault zone region on the continental slope, and the Kumano Basin that lies between the accretionary prism and the KiiPeninsula, on the continental shelf (Fig. 2.

  3. Development and Preliminary Psychometric Evaluation of the Domestic Violence-Related Financial Issues Scale (DV-FI)

    Science.gov (United States)

    Weaver, Terri L.; Sanders, Cynthia K.; Campbell, Carole L.; Schnabel, Meg

    2009-01-01

    Intimate partner violence (IPV) occurs at disproportionate rates within impoverished groups of women and can include economic abuse as a form of psychological maltreatment. The current study developed a comprehensive assessment of the unique financial issues facing female victims of IPV using a sheltered sample (N = 113). An exploratory factor…

  4. Zdraví a rodinný stav: dvě stránky jedné mince?

    Czech Academy of Sciences Publication Activity Database

    Hamplová, Dana

    2012-01-01

    Roč. 48, č. 4 (2012), s. 737-755 ISSN 0038-0288 R&D Projects: GA ČR(CZ) GAP404/11/0145 Institutional support: RVO:68378025 Keywords : health * family * social inequality in health Subject RIV: AO - Sociology, Demography Impact factor: 0.652, year: 2012

  5. Gleaning Images From Others And Myself with a Dv Camera: Agnès Varda's The Gleaners And I

    Directory of Open Access Journals (Sweden)

    Miguel A Lomillos

    2011-08-01

    Full Text Available Agnès Varda‘s critically acclaimed documentary The Gleaners and I isone of the most exciting and revealing digital works within European auteurist cinema. The all-embracing metaphor of gleaning constitutes a creatively critical reconsideration of some depreciated attitudes in our consumer society. This film essay made of factual and personalmaterials is also a kind of work in progress through which the filmmaker herself calls her life into question and shows her fascination for art and mainly painting.

  6. Dvě výročí Ronalda Richtra – rodáka ze Sokolova

    Czech Academy of Sciences Publication Activity Database

    Řípa, Milan

    2011-01-01

    Roč. 59, č. 23 (2011), s. 28-28 ISSN 0040-1064 Institutional research plan: CEZ:AV0Z20430508 Keywords : fusion * Huemul Project * Juan Peron * Matterhorn * Dmitrij Sacharov * Jevgenij Tamm * Lyman Spitzer * Ronald Richter Subject RIV: BL - Plasma and Gas Discharge Physics

  7. Dvě koncentrace epigravettských artefaktů v Mohelně-Plevovcích

    Czech Academy of Sciences Publication Activity Database

    Škrdla, Petr; Bartík, J.; Rychtaříková, Tereza

    2015-01-01

    Roč. 56, č. 1 (2015), s. 9-29 ISSN 1211-7250 Institutional support: RVO:68081758 Keywords : Moravia * Mohelno * Late Upper Paleolithic * Epigravettian * backed rectangles Subject RIV: AC - Archeology, Anthropology, Ethnology http://arub.avcr.cz/miranda2/ export /sitesavcr/arub/prehled-vyzkumu/prehled-vydanych-cisel/files/PV56_1_studie_1.pdf

  8. In-Situ Sampling and Characterization of Naturally Occurring Marine Methane Hydrate Using the D/V JOIDES Resolution

    Energy Technology Data Exchange (ETDEWEB)

    Frank Rack

    2005-06-30

    The primary accomplishments of the JOI Cooperative Agreement with DOE/NETL in this quarter were to refine budgets and operational plans for Phase 2 of this cooperative agreement based on the scheduling of a scientific ocean drilling expedition to study marine methane hydrates along the Cascadia margin, in the NE Pacific as part of the Integrated Ocean Drilling Program (IODP) using the R/V JOIDES Resolution. The proposed statement of work for Phase 2 will include three primary tasks: (1) research management oversight, provided by JOI; (2) mobilization, deployment and demobilization of pressure coring and core logging systems, through a subcontract with Geotek Ltd., who will work with Fugro and Lawrence Berkeley National Laboratory to accomplish some of the subtasks; and, (3) mobilization, deployment and demobilization of a refrigerated container van that will be used for degassing of the Pressure Core Sampler and density logging of these pressure cores, through a subcontract with the Texas A&M Research Foundation (TAMRF). More details about these tasks are provided in the following sections of this report. The appendices to this report contain a copy of the scientific prospectus for the upcoming IODP Expedition 311 (Cascadia Margin Hydrates), which provides details of operational and scientific planning for this expedition.

  9. Measurement of angle-correlated differential (n,2n) reaction cross section with pencil-beam DV neutron source

    International Nuclear Information System (INIS)

    Takaki, S.; Kondo, K.; Shido, S.; Miyamaru, H.; Murata, I.; Ochiai, Kentaro; Nishitani, Takeo

    2006-01-01

    Angle-correlated differential cross-section for 9 Be(n,2n) reaction has been measured with the coincidence detection technique and a pencil-beam DT neutron source at FNS, JAEA. Energy spectra of two emitted neutrons were obtained for azimuthal and polar direction independently. It was made clear from the experiment that there are noise signals caused by inter-detector scattering. The ratio of the inter-detector scattering components in the detected signals was estimated by MCNP calculation to correct the measured result. By considering the inter-detector scattering components, the total 9 Be(n,2n) reaction cross-section agreed with the evaluated nuclear data within the experimental error. (author)

  10. Kostel sv. Vavřince - jeho architektura a výzdoba od 16. do konce 19. století. II. část (19. století)

    Czech Academy of Sciences Publication Activity Database

    Kaplanová, Kristina

    č. 1 (2001), s. 4-8 ISSN 1214-2794 Institutional research plan: CEZ:AV0Z8033913 Keywords : St Lawrence church * architecture * interior equipment Subject RIV: AL - Art, Architecture , Cultural Heritage

  11. Kostel sv. Vavřince - jeho architektura a výzdoba od 16. do konce 19. století. I. část (od 2. poloviny 16. až do konce 18. století)

    Czech Academy of Sciences Publication Activity Database

    Kaplanová, Kristina

    č. 4 (2000), s. 6-9 ISSN 1214-2794 Institutional research plan: CEZ:AV0Z8033913 Keywords : St Lawrence church * architecture * interior equipment Subject RIV: AL - Art, Architecture , Cultural Heritage

  12. Švýcarská ekonomika na počátku 21. století

    OpenAIRE

    Skalická, Veronika

    2012-01-01

    The bachelor thesis deals with the Swiss economy in the early 21st century. The economy of Switzerland is one of the most developed in the world, but recent events such as the eurozone debt crisis could threaten its position. The aim of this thesis is to analyse the current state of the Swiss economy, while defining the main sources of risks and predicting the future development of the Swiss economy. A significiant part of the thesis also focuses on the characteristics of each sector in Switz...

  13. Empirismus, naturalismus a ideje. Humovy vlivné doktríny ve 20. století

    Czech Academy of Sciences Publication Activity Database

    Hříbek, Tomáš

    2017-01-01

    Roč. 65, č. 2 (2017), s. 297-315 ISSN 0015-1831 R&D Projects: GA ČR(CZ) GAP401/12/0833 Institutional support: RVO:67985955 Keywords : David Hume * W. V. O. Quine * Jerry Fodor * empiricism * naturalism * ideas Subject RIV: AA - Philosophy ; Religion OBOR OECD: Philosophy , History and Philosophy of science and technology

  14. Kantův kategorický imperativ a jeho kritika u myslitelů 19. století

    OpenAIRE

    Vašků, Kateřina

    2011-01-01

    Diploma thesis "Kant's Categorical Imperative and Its Critique by Nineteenth Century Philosophers" deals with a question of Kant's fundamental principle known as the Categorical Imperative or Moral Law. The aim of this work is at first to discuss two other moral principles because of their great impact on Kant seeking the moral principle. These are Hume's moral code called Moral sense and Rousseau' moral views relating to the freedom of individuals. Secondly, to find out how both moral theori...

  15. Pluralizace sluncí v 17. století a její důsledky

    Czech Academy of Sciences Publication Activity Database

    Špelda, Daniel

    2017-01-01

    Roč. 50, č. 2 (2017), s. 83-105 ISSN 0300-4414 R&D Projects: GA ČR GB14-37038G Institutional support: RVO:67985955 Keywords : 17th-century astronomy * heliocentrism * geocentrism * Riccioli * Gassendi * Kircher Subject RIV: AA - Philosophy ; Religion OBOR OECD: Philosophy, History and Philosophy of science and technology

  16. Kryptoměna jako prostředek směny v 21. století

    OpenAIRE

    Kubricht, Adam

    2014-01-01

    The thesis aims to identify the potential use of a cryptocurrency in the international trade and the level of fulfillment of that potential. First of all, the thesis describes how cryptocurrencies work. In the second part, the potential of a cryptocurrency is investigated. In the third part, the market of the most used cryptocurrency - Bitcoin is analyzed. The thesis finds out to what extent Bitcoin is used nowadays and whether bitcoin as a cryptocurrency fulfills its potential.

  17. Hudba pro století luterské reformace I. Martin Luther a duchovní hudba

    Czech Academy of Sciences Publication Activity Database

    Vytlačil, Lukáš

    2017-01-01

    Roč. 25, č. 9 (2017), s. 28-30 ISSN 1210-8081 Institutional support: RVO:68378076 Keywords : lutheran reformation * Martin Luther * sacred music * Johann Walter * Leonhard Lechner * music and liturgy * gospels * 16th century music history * renaissance music * evangelic church (sacred) music Subject RIV: AL - Art, Architecture, Cultural Heritage OBOR OECD: Performing arts studies ( Music ology, Theater science, Dramaturgy)

  18. Doklady neželezné metalurgie ze sklonku 12. století z Brna, Josefské ulice

    Czech Academy of Sciences Publication Activity Database

    Procházka, Rudolf; Hložek, M.; Holubová-Závodná, B.

    2011-01-01

    Roč. 63, č. 1 (2011), s. 65-89 ISSN 0323-1267 R&D Projects: GA ČR GA404/09/1966 Institutional research plan: CEZ:AV0Z80010507 Keywords : early Middle Age * Brno * non-ferrous metallurgy Subject RIV: AC - Archeology, Anthropology, Ethnology

  19. Fyzická geografie – vize české vědy pro 21. století

    Czech Academy of Sciences Publication Activity Database

    Kirchner, Karel; Kolejka, Jaromír

    -, - (2009), s. 25-25 [Mezinárodní vědecká konference k 50. výročí geografie na PřF UP v Olomouci. 10.06.2009-11.06.2009, Olomouc] Institutional research plan: CEZ:AV0Z30860518 Keywords : physical geography * landscape Subject RIV: DE - Earth Magnetism, Geodesy, Geography

  20. Hotel Thermal a problém památkové ochrany staveb 2. poloviny 20. století

    OpenAIRE

    Kordovská, Marie

    2016-01-01

    Name of the thesis: Hotel Thermal and the problem of heritage preservation of buildings constructed in the second half of the 20th century
 Abstract:
 The student will work on a monograph of the hotel Thermal in Carlsbad, especially emphasising the development of its perception and evaluation in a broader social context and its related issues of heritage preservation. She will clarify the circumstances which lead to the decision to build a big festival and conference hotel with an outside swi...

  1. Ke dvěma východiskům filosofického tázání po Bohu

    Czech Academy of Sciences Publication Activity Database

    Frei, Jan

    2013-01-01

    Roč. 3, č. 1 (2013), s. 65-77 ISSN 1804-5588 Institutional support: RVO:67985955 Keywords : philosophy * question of God * cosmology * human existence Subject RIV: AA - Philosophy ; Religion http://www.cupress.cuni.cz/ink2_stat/index.jsp?include=AUC_clanek&id=2634&id=3541&casopis=921&zalozka=0&predkl=0

  2. Skolplikten och samhällsordningen - Om nödvändigheten och önskvärdheten av obligatorisk skolgång

    Directory of Open Access Journals (Sweden)

    Mats Dahlkvist

    2002-01-01

    Full Text Available The article starts with a question of whether school obligatory with its officially established educational objectives is consistent with the fundamental principles of the modern state governed by law and political democracy. How do we think and reason about school obligatory and how could we think differently? The main conclusion conveyed in the article is that liberal political philosophy neither in terms of rights theory or utilitarian thinking is consistent with the idea of school obligatory. Because of this, the author argues, we will either have to abandon the obligatory in order to maintain liberal political philosophy or we must keep the obligatory, but would then have to abandon or radically modify liberal political philosophy. The communitarian political philosophy is elaborated as an alternative and is supplemented by a discussion on how Jürgen Habermas would possibly regard school obligatory.

  3. Dynamics of cold acclimation and complex phytohormone responses in Triticum monococcum lines G3116 and DV92 differing in vernalization and frost tolerance level

    Czech Academy of Sciences Publication Activity Database

    Vaňková, Radomíra; Kosová, K.; Dobrev, Petre; Vítámvás, P.; Trávníčková, Alena; Cvikrová, Milena; Pešek, Bedřich; Gaudinová, Alena; Přerostová, Sylva; Musilová, J.; Galiba, G.; Prášil, I.T.

    2014-01-01

    Roč. 101, MAY 2014 (2014), s. 12-25 ISSN 0098-8472 R&D Projects: GA ČR GA522/09/2058 Grant - others:GA ČR GPP501/11/P637 Program:GP Institutional support: RVO:61389030 Keywords : Cold stress * Dehydrin * Einkorn wheat Subject RIV: ED - Physiology Impact factor: 3.359, year: 2014

  4. Graptolites of the Králův Dvůr Formation (mid Katian to earliest Hirnantian, Czech Republic)

    Czech Academy of Sciences Publication Activity Database

    Kraft, P.; Štorch, Petr; Mitchell, C. E.

    2015-01-01

    Roč. 90, č. 1 (2015), s. 195-225 ISSN 1214-1119 R&D Projects: GA AV ČR IAA301110908 Institutional support: RVO:67985831 Keywords : graptolite * Ordovician * Katian * Hirnantian * Prague Basin * biostratigraphy Subject RIV: DB - Geology ; Mineralogy Impact factor: 1.700, year: 2015

  5. Dvě konference o Němcích ze středovýchodní Evropy ve Freiburku

    Czech Academy of Sciences Publication Activity Database

    Nosková, Jana

    2017-01-01

    Roč. 104, č. 2 (2017), s. 264-267 ISSN 0009-0794 Institutional support: RVO:68378076 Keywords : Germans * Central Eastern Europe * Freiburg * Ethnology * Anthropology Subject RIV: AC - Archeology, Anthropology , Ethnology OBOR OECD: Antropology, ethnology

  6. Dvě nálezové ptolemaiovské mince z českého území - Lubenec (okr. Louny) a Stradonice (okr. Beroun)

    Czech Academy of Sciences Publication Activity Database

    Militký, Jiří

    2013-01-01

    Roč. 27, č. 1 (2013), s. 109-115 ISSN 0546-9414 R&D Projects: GA ČR(CZ) GAP405/10/1588; GA ČR GA13-24707S Institutional support: RVO:67985912 Keywords : Egypt * Ptolemies * Boians * import Subject RIV: AC - Archeology, Anthropology, Ethnology

  7. Raně scholastické univerzálie formulace a transformace otázky v 11. století (tzv. vokalismus a Anselm z Canterbury)

    Czech Academy of Sciences Publication Activity Database

    Otisk, Marek

    2012-01-01

    Roč. 9, Supp.1 (2012), s. 32-47 ISSN 1214-8407 Institutional support: RVO:67985955 Keywords : vocalismus * John Roscellinus of Compiègne * Anselm of Canterbury Subject RIV: AA - Philosophy ; Religion

  8. Dobrodružství cestujících (Model polemiky ve třicátých letech 19. století)

    Czech Academy of Sciences Publication Activity Database

    Piorecká, Kateřina

    Suppl., 14/2 (2011), s. 108-118 ISSN 1211-975X. [Karel Jaromír Erben a úloha paměťových institucí v historických proměnách. Malá Skála, 15.04.2011-16.04.2011] Institutional research plan: CEZ:AV0Z90560517 Keywords : Czech literature * Erben, Karel Jaromír * polemics Subject RIV: AJ - Letters, Mass-media, Audiovision

  9. Český lid a příbuzné vědecké časopisy v 19.-21. století

    Czech Academy of Sciences Publication Activity Database

    Woitsch, Jiří

    2013-01-01

    Roč. 100, č. 1 (2013), s. 121-127 ISSN 0009-0794 Institutional support: RVO:68378076 Keywords : academic journals * academic writing * history of 19th and 20th century * social science s and humanities * history of science Subject RIV: AC - Archeology, Anthropology, Ethnology Impact factor: 0.094, year: 2012

  10. American Medical Association a její vliv na snahy o reformu zdravotnictví v USA ve 20. století

    OpenAIRE

    Vojtíšek, Martin

    2010-01-01

    The main aim of this thesis is to analyze the history of evolution of American health care system with respect to influence of interest groups. Further, I will try to find reasons, why American health care costs grew enormously during 20th century.

  11. Zpráva ze studia českých iluminovaných rukopisů 14. století v Bodleian Library

    Czech Academy of Sciences Publication Activity Database

    Gaudek, Tomáš

    42 /2012/, č. 0 (2013), s. 145-159 ISSN 0585-5691 R&D Projects: GA ČR GA13-39192S Institutional support: RVO:68378033 Keywords : Bodleian Library , Oxford * illuminated manuscripts * Bohemia * 14th century Subject RIV: AL - Art, Architecture, Cultural Heritage

  12. Cesta Martinické bible z 15. do 21. století [Rozhovor s Jarmilou a Davidem Frankovými

    Czech Academy of Sciences Publication Activity Database

    Baďurová, Anežka; Hartmanová, Dagmar; Franková, J.; Frank, D.

    -, č. 6 (2006), s. 22-24 ISSN 1210-9525 Institutional research plan: CEZ:AV0Z70830501 Keywords : restoration of medieval books * conservation of medieval manuscripts * book culture Subject RIV: AF - Documentation, Librarianship, Information Studies

  13. Postavení Rwandy a Burundi v mezinárodních vztazích od 90. let 20. století

    OpenAIRE

    Špundová, Kateřina

    2008-01-01

    Rwanda and Burundi are two countries that, in the beginning of 1990s, attracted attention of the whole international community. The genocide in Rwanda, the civil war in Burundi, and the following spill-over of conflict to neighbouring countries caused hundreds upon thousands of deaths and hundreds upon thousands of refugees. This work compares the internal development of these countries and their influence on other countries in Great Lake Region.

  14. Možnosti a meze intervence: František Palacký a rakouská cenzura ve 20. letech 19. století

    Czech Academy of Sciences Publication Activity Database

    Píša, Petr

    2011-01-01

    Roč. 15, - (2011), s. 91-102 ISSN 0862-2892 R&D Projects: GA ČR GAP406/10/2127 Institutional research plan: CEZ:AV0Z90560517 Keywords : censorship * Palacký, František * Vormärz period * Bohemia Subject RIV: AJ - Letters, Mass-media, Audiovision

  15. Reflexe indiánského světa v hispanoamerickém eseji 20. století

    OpenAIRE

    Núňez Tayupanta, Lucie

    2013-01-01

    Reflection of the Indigenous World in the 20th Century Latin American Essay PhDr. Lucie Núñez Tayupanta Abstract This dissertation focuses on the study of essayistic works which reflect the presence of indigenous world and its cultural traditions in Latin America. The aim of this work is to answer the question of how Latin-American essayists consider the contribution of the indigenous heritage to the creation of national identity. Furthermore, the work aims to point out the differences in app...

  16. O vydávání Bible gdaňské v 18. a 19. století

    Czech Academy of Sciences Publication Activity Database

    Pišna, Jan

    -, č. 2017 (2017), s. 66-79. ISBN 978-80-89303-56-4. ISSN 1337-0723 Institutional support: RVO:68378068 Keywords : history of book culture, biblical editions, Bible in Polish, Evangelical church in Poland, 17 th– 20th century * biblical editions * Bible in Polish * Evangelical church in Poland * 17th– 20th century Subject RIV: AJ - Letters, Mass-media, Audiovision OBOR OECD: Specific literatures

  17. Mýtus židovského konvertity - Šimon Abeles v literatuře 19. a 20. století

    Czech Academy of Sciences Publication Activity Database

    Soukup, Daniel

    2011-01-01

    Roč. 3, č. 1 (2011), s. 39-48 ISSN 0231-634X Institutional research plan: CEZ:AV0Z90560517 Keywords : Czech literature * Jews * Abeles, Shimon * Jesuits Subject RIV: AJ - Letters, Mass-media, Audiovision

  18. Hydrokraté a česká vodohospodářská mise ve dvacátém století (1930-1960)

    Czech Academy of Sciences Publication Activity Database

    Janáč, Jiří

    2017-01-01

    Roč. 24, 1/2 (2017), s. 19-53 ISSN 1210-7050 R&D Projects: GA ČR GA15-04902S Institutional support: RVO:68378114 Keywords : Czechoslovakia * water management * planning Subject RIV: AB - History OBOR OECD: History ( history of science and technology to be 6.3, history of specific sciences to be under the respective headings)

  19. Analogia entis v nominalistické tradici. Poznámky na okraj sémantiky 14. století

    Czech Academy of Sciences Publication Activity Database

    Hanke, Miroslav

    2017-01-01

    Roč. 9, č. 17 (2017), s. 48-73 ISSN 1803-7860 Institutional support: RVO:67985955 Keywords : semantics * ontology * nominalism * philosophy of the 14th century Subject RIV: AA - Philosophy ; Religion OBOR OECD: Philosophy, History and Philosophy of science and technology http://aither.eu/wp-content/uploads/2017/08/A17-1.pdf

  20. Konference Násilné migrační procesy v českých zemích ve 20. století

    Czech Academy of Sciences Publication Activity Database

    Sulitka, Andrej

    2015-01-01

    Roč. 102, č. 4 (2015), s. 496-497 ISSN 0009-0794 Institutional support: RVO:68378076 Keywords : migration * compatriots * the Czech lands in the 20th century * migration as a result of war * resettlement due to the economic and political reasons Subject RIV: AC - Archeology, Anthropology, Ethnology

  1. Mezinárodní měnový fond a jeho role ve 21. století

    OpenAIRE

    Štych, Jan

    2011-01-01

    This bachelor thesis focuses on the International monetary fund, specifically on its impact on world economic. The objective of this thesis is to assess the Funds function in the recent years and based on this assessment decide, how should the Fund act in the future. After the introduction, where the IMF is described as an institution, the thesis looks on economic crisis from the turn of the century and the Funds role regarding these crisis. Finally, the thesis describes reforms, necessary to...

  2. Hudba pro století luterské reformace II. Německá reformace v Čechách

    Czech Academy of Sciences Publication Activity Database

    Vytlačil, Lukáš

    2017-01-01

    Roč. 25, č. 10 (2017), s. 32-33 ISSN 1210-8081 Institutional support: RVO:68378076 Keywords : music history * lutheran reformation * renaissance music * composers * Balthasar Resinarius * Kliment Ursin Bosák * Nikolaus Herman * 16th century music * sacred music Subject RIV: AL - Art, Architecture, Cultural Heritage OBOR OECD: Performing arts studies ( Music ology, Theater science, Dramaturgy)

  3. Hudba pro století luterské reformace III. Od Rudolfa II. do víru třicetileté války

    Czech Academy of Sciences Publication Activity Database

    Vytlačil, Lukáš

    2017-01-01

    Roč. 25, č. 12 (2017), s. 34-35 ISSN 1210-8081 Institutional support: RVO:68378076 Keywords : music history * renaissance music * early baroque music * lutheran reformation * lutheran music * composers * Johann Knöfel * Jiří Třanovský * Andreas Hammerschmidt Subject RIV: AL - Art, Architecture, Cultural Heritage OBOR OECD: Performing arts studies ( Music ology, Theater science, Dramaturgy)

  4. Od ne-hudby k hudbě. Hudební využití hluku ve 20. století

    Czech Academy of Sciences Publication Activity Database

    Kratochvíl, Matěj

    2016-01-01

    Roč. 13, č. 26 (2016), s. 54-60 ISSN 1214-7915 Institutional support: RVO:68378076 Keywords : music * noise * technology * sound recording * musique concrète Subject RIV: AC - Archeology, Anthropology, Ethnology

  5. Cestování Čechů na jihoslovanské pobřeží ve 20. letech 20. století

    Directory of Open Access Journals (Sweden)

    Jiří Šoukal

    2014-12-01

    Full Text Available This article centres around the Czechoslovakian perception of holiday travel to Yugoslavia in the 1920s with particular attention to the typology of Czech tourists. It has been shown that travel to Yugoslavia was very popular among the middle classes who had enough time and money. The wealthier classes preferred France. The main selling points travel agents and hotel owners used to promote travel to Yugoslavia were affordability, service targeted to Czechs and Pan-slavism. The idea of a mutual Slavonic tradition had been in existence since the 19th century. Evidence would seem to show that the most significant factor for repeat travel was affordability. Conservative Czech tourists remained loyal guests of Yugoslavia during the 1920s and 1930s.

  6. Důsledky světové hospodářské krize pro Československo ve 30. letech 20. století

    OpenAIRE

    PAŘIL, Aleš

    2013-01-01

    This Bachelor's work deals with the consequences of the Great Depression for Czechoslovakia in the 1930's. To better understand the situation before the Great Depression the work begins with characteristic of Czechoslovakia in the 1920's. The course of this crisis is also shortly outlined there. This bachelor's work focuses primarily on the consequences of the Great Depression on the Czechoslovakian economy connected with the social security of the inhabitants. In this work we can also read a...

  7. Hans Hellmann : Životní příběh vědce ve 20. století

    Czech Academy of Sciences Publication Activity Database

    Zahradník, Rudolf

    2004-01-01

    Roč. 98, č. 1 (2004), s. 98-101 ISSN 0009-2770 Institutional research plan: CEZ:AV0Z4040901 Keywords : quantum chemistry of pioneers * Hans Hellmann * weak interactions Subject RIV: CF - Physical ; Theoretical Chemistry Impact factor: 0.348, year: 2004

  8. Výzkum cizojazyčných tiskařských bohemik 16. - 18. století v Drážďanech

    Czech Academy of Sciences Publication Activity Database

    Vorlíčková, Anna

    -, č. 4 (2009), s. 19 ISSN 1210-8502 Institutional research plan: CEZ:AV0Z70830501 Keywords : collection of old and rare books * book culture * czech historical bibliography * national retrospective bibliography * historical bibliography

  9. K těžbě stříbra na Horách Vrbických v 16. století

    Czech Academy of Sciences Publication Activity Database

    Doležel, Jiří

    2016-01-01

    Roč. 57, č. 2 (2016), s. 197-249 ISSN 1211-7250 R&D Projects: GA MK(CZ) DF13P01OVV005 Keywords : Silver mining * Bohemia * Czech-Moravian Highlands * 16th century * mining and processing complex Subject RIV: AC - Archeology, Anthropology, Ethnology http://prehled-vyzkumu.arub.avcr.cz/miranda2/export/sitesavcr/arub-prehled-vyzkumu/prehled-cisel-a-clanku/prehled-vydanych-cisel/files/PV-57_2_studie-5.pdf

  10. Česká folková hudba 60. -80. let 20. století v pohledu sociologie náboženství

    Czech Academy of Sciences Publication Activity Database

    Nešpor, Zdeněk

    2003-01-01

    Roč. 39, č. 1 (2003), s. 79-97 ISSN 0038-0288 Institutional research plan: CEZ:AV0Z7028912 Keywords : Sociology of Religion * Czech Folk Music * Czechoslovakia Subject RIV: AO - Sociology, Demography Impact factor: 0.063, year: 2003

  11. Konference Násilné migrační procesy v českých zemích ve 20. století

    Czech Academy of Sciences Publication Activity Database

    Sulitka, Andrej

    2016-01-01

    Roč. 103, č. 2 (2016), s. 286-288 ISSN 0009-0794 Institutional support: RVO:68378076 Keywords : conference * Regional State Archives Prague * Museum Podblanicko * Institute of Contemporary History of the Academy of Sciences of the Czech Republic * the forced displacement of the population * migration * the 20th century Subject RIV: AC - Archeology, Anthropology, Ethnology

  12. Aktualizace tureckého nebezpečí v iluminovaných hudebních rukopisech 16. století

    Czech Academy of Sciences Publication Activity Database

    Šárovcová, Martina

    2014-01-01

    Roč. 6, č. 2 (2014), s. 72-84 ISSN 1804-1132 Institutional support: RVO:68378033 Keywords : illuminated manuscripts * music manuscripts * iconography * Turkish threat * Turks * Fabián Puléř († 1562) Subject RIV: AL - Art, Architecture, Cultural Heritage

  13. Obrazy ze života mezi ironií a snem. Máchova Marinka a kontury protorealismu v polovině 30. let 19. století

    Czech Academy of Sciences Publication Activity Database

    Piorecká, Kateřina

    2014-01-01

    Roč. 17, č. 1 (2014), s. 9-43 ISSN 1213-2144 Institutional support: RVO:68378068 Keywords : Mácha, Karel Hynek * Czech prose * Protorealism * 19th century Subject RIV: AJ - Letters, Mass-media, Audiovision

  14. "Zde bydlel W. A. Mozart". Ke stavebním dějinám domu usedlosti Bertramka v 19. a 20. století

    Czech Academy of Sciences Publication Activity Database

    Mezihoráková, Klára

    2014-01-01

    Roč. 74, č. 2 (2014), s. 115-123 ISSN 1210-5538 Institutional support: RVO:68378033 Keywords : Bertramka * estate * 19th century architecture * Mozart Subject RIV: AL - Art, Architecture, Cultural Heritage

  15. Reemigrace českých západních emigrantů v 90. letech 20. století z hlediska ekonomické sociologie

    Czech Academy of Sciences Publication Activity Database

    Nešpor, Zdeněk

    2005-01-01

    Roč. 41, č. 1 (2005), s. 31-55 ISSN 0038-0288 R&D Projects: GA ČR(CZ) GA403/03/0339 Institutional research plan: CEZ:AV0Z70280505 Keywords : migration studies * Czech Republic * Re-emigration Subject RIV: AO - Sociology, Demography Impact factor: 0.113, year: 2005

  16. Královské Vinohrady a jejich urbanizační vývoj v 19. a 20. století

    Czech Academy of Sciences Publication Activity Database

    Platovská, Marie

    2009-01-01

    Roč. 57, č. 3 (2009), s. 236-247 ISSN 0049-5123 R&D Projects: GA ČR GA408/04/1404 Institutional research plan: CEZ:AV0Z80330511 Keywords : urbanism * architecture * 19th century Subject RIV: AL - Art, Architecture, Cultural Heritage

  17. Motiv ochrany domova v motlitbách a písních podle ústní tradice 19. a 20. století

    Czech Academy of Sciences Publication Activity Database

    Frolcová, Věra

    2010-01-01

    Roč. 44, č. 1 (2010), s. 69-84 ISSN 0862-1209 Institutional research plan: CEZ:AV0Z90580513 Keywords : prayer * religious folk song * wedding feast * caroling Subject RIV: AC - Archeology, Anthropology, Ethnology

  18. Konec všeho - probuzení ve století úpadků : špatná kniha s dobrou myšlenkou

    Czech Academy of Sciences Publication Activity Database

    Cílek, Václav

    2008-01-01

    Roč. 87, č. 2 (2008), s. 132-133 ISSN 0042-4544 Institutional research plan: CEZ:AV0Z30130516 Keywords : energy * civilization * Richard Heinberg Subject RIV: DB - Geology ; Mineralogy http://www.vesmir.cz/clanek.php3?CID=7569

  19. Databáze českých meter a výzkum českého verše 19. století

    Czech Academy of Sciences Publication Activity Database

    Plecháč, Petr; Kolár, Robert

    2015-01-01

    Roč. 63, č. 2 (2015), s. 236-246 ISSN 0009-0468 R&D Projects: GA ČR GAP406/11/1825 Institutional support: RVO:68378068 Keywords : literature theory * theory of verse * versology * Czech poetry Subject RIV: AJ - Letters, Mass-media, Audiovision

  20. Cestovní ruch a česká společnost na přelomu 19. a 20. století

    Directory of Open Access Journals (Sweden)

    Jan Štemberk

    2018-01-01

    Full Text Available This contribution is dealing with an evaluation of tourism position in the Czech society in the end of the 19th century and in the first decades of the 20th century. Tourism depending on social and economic state of society is examined as one of the attributes of modern society. The attention is preliminary paid to tourism development trends in the 19th century and to its position in the modernizing Czech society. The main part analyses tourism importance for individual social strata of the Czech society in the period under consideration. Analysis of tourism form from individual tourists’ view and their preferences didn’t stay out of attention.

  1. Humanismus v novém konceptu literatury českých zemí (1. pol. 16. století)

    Czech Academy of Sciences Publication Activity Database

    Voit, Petr

    2017-01-01

    Roč. 65, č. 2 (2017), s. 181-212 ISSN 0009-0468 R&D Projects: GA ČR(CZ) GA16-09064S Institutional support: RVO:67985955 Keywords : humanism * Czech lands * reformation Subject RIV: AI - Linguistics OBOR OECD: Specific literatures

  2. Historik ve víru dějin a dlouhé století ve Víře v pokrok

    Czech Academy of Sciences Publication Activity Database

    Hermann, Tomáš

    2009-01-01

    Roč. 6, č. 2 (2009), s. 273-297 ISSN 1214-7249 R&D Projects: GA AV ČR KJB800630701 Institutional research plan: CEZ:AV0Z80630520 Keywords : Bedřich Loewenstein * faith in progress * 19th century Subject RIV: AB - History

  3. Christomimésis. Habsburkové jako Kristovi následovníci v 17. a 18. století

    Czech Academy of Sciences Publication Activity Database

    Hrbek, Jiří

    2016-01-01

    Roč. 114, č. 1 (2016), s. 32-63 ISSN 0862-6111 Institutional support: RVO:67985963 Keywords : Coronation * Easter ceremonials * the Hapsburgs * 17th and 18th centuries * royal piety Subject RIV: AB - History

  4. Umělecký vliv, jeho průkaznost a relevance: k typologii odkazů v beletrii 19. století

    Czech Academy of Sciences Publication Activity Database

    Charypar, Michal

    2016-01-01

    Roč. 64, č. 5 (2016), s. 668-695 ISSN 0009-0468 Institutional support: RVO:68378068 Keywords : artistic influence * intertextuality * literature * 19th century * The Queen's Court and The Green Mountain Manuscripts Subject RIV: AJ - Letters, Mass-media, Audiovision

  5. Proměny českého chorálu v 16. století - pokus o klasifikaci redakcí českého chorálu 16. století na příkladu aleluja ke svátku Nanebevzetí Panny Marie

    Czech Academy of Sciences Publication Activity Database

    Žůrek, Jiří

    2010-01-01

    Roč. 47, č. 4 (2010), s. 333-350 ISSN 0018-7003 R&D Projects: GA ČR GA401/09/0419 Institutional research plan: CEZ:AV0Z90090514 Keywords : plainchant * Utraquism * liturgical music Subject RIV: AA - Philosophy ; Religion

  6. Knowledge of Primary Care Physicians Regarding Domestic Violence.

    African Journals Online (AJOL)

    Knowledge of Primary Care Physicians Regarding Domestic Violence. ... prevalence of DV, and 4 main aspects relevant to DV, namely deprivation, psychological, ... and instructions about DV from scientific formal sources as medical schools, ...

  7. Emanuel Chalupný a Ferdinand Peroutka o J.A. Komenském

    Czech Academy of Sciences Publication Activity Database

    Beneš, Jiří

    2000-01-01

    Roč. 30, 63-64 (2000), s. 171-176 ISSN 0323-2220. [Obraz Jana Amose Komenského ve 20. století. Věda-mýtus-ideologie /22./. Uherský Brod, 07.10.1999-08.10.1999] Institutional research plan: CEZ:AV0Z9009908 Keywords : Comeniology Subject RIV: AA - Philosophy ; Religion

  8. Kamillo Horn und das Melodram

    Czech Academy of Sciences Publication Activity Database

    Bajgarová, Jitka

    2010-01-01

    Roč. 12, - (2010), s. 229-237 ISSN 1212-1193. [Zdeněk Fibich, středoevropský skladatel konce 19. století. Olomouc, 19.05.2010–21.05.2010] Institutional research plan: CEZ:AV0Z90580513 Keywords : Kamillo Horn * concert melodrama Subject RIV: AL - Art, Architecture, Cultural Heritage

  9. Labyrinthus - Emendatio - Paradisus. Několik poznámek o ráji v didaktických spisech Komenského

    Czech Academy of Sciences Publication Activity Database

    Steiner, Martin

    2002-01-01

    Roč. 32, 67-68 (2002), s. 85-88 ISSN 0323-2220. [J.A. Komenský - milenarismus a eschatologie 17. století /23./. Uherský Brod, 17.10.2001-18.10.2001] Institutional research plan: CEZ:AV0Z9009908 Keywords : J.A. Comenius * paradisus Subject RIV: AA - Philosophy ; Religion

  10. Äro fängelser nödvändiga? : Socialistisk agitation och påverkan på det svenska rättssystemet 1880-1900

    OpenAIRE

    Runbäck, David

    2015-01-01

    In this thesis, the author seeks to investigate the origin, development and consequenses of socialist critisismagainst prison policy and the legal system in Sweden during the last decades of the 19th century. It shows thatbefore the year of 1885 critisism against society was largely confined to the politically involved upper classes ofsociety. It then shows a dramatic increase in interest for criminal policy after the indictment of prison directorLagerberg in 1887, and the following indictmen...

  11. Workshop ''actual data processing supported applications in the area of soil protection and contaminated sites''; Workshop ''Aktuelle DV-gestuetzte Anwendungen im Bodenschutz- und Altlastenbereich''

    Energy Technology Data Exchange (ETDEWEB)

    Mathews, Jeannette; Frauenstein, Joerg; Mahrle, Sabine (comps.)

    2011-05-15

    Within the 5th workshop at the Federal Environment Agency (Dessau-Rosslau, Federal Republic of Germany) from 28th to 29th September, 2010, the following lectures were held: (1) Information systems for the contaminated site management in Baden-Wuerttemberg (I. Blankenhorn); (2) SALKA 7 - A web based solution for a central data handling of the Saxonian register of contaminated sites (S. Gruhne); (3) Information system (ABuDIS) for contaminated sites, soil conservation and disposal sites in the Free State of Bavaria - Experiences from the project 'Data quality' (O. Klammer); (4) Environmental specimen bank - Web interface (M. Ruether); (5) Biocides in the Web - A portal for the publicity (G. Minx); (6) INSPIRE - Thematic work group (TWG) Appendix III Soil (S. Marahrens); (6) INSPIRE - State of the art, requirements (R. Baritz); (7) Requirements for the interoperability of soil data from the view of the Federal Environment Agency (F. Hilliges); (8) Implementation of the PortalU-Software in the European context - The project GS Soil (K. Feiden); (9) What is offered by PRTR - Pollutant Release and Transfer Register? (E. Six); (10) GSBL - Application for web recherche (B. Liebscher); (11) New Web Map Service for ground water background values (B. Wagner); (12) Visualized information on contaminated sites - A status (J. Frauenstein); (13) Utilization of industrial wastelands - An idea makes soil good. A project of BAFU for revitalization of industrial wastelands (K. Schenk); (14) Information on the status of ground water for the governmental real estates (H.-O. Zintz); (15) Application of data processing procedures of the artificial intelligence on an area-based representation of pollutant contents in settlement areas (T. Hertwig).

  12. Dvě stě let od narození Františka Schmoranze staršího, architekta, stavitele a konzervátora památek

    Czech Academy of Sciences Publication Activity Database

    Uhlík, Jan

    2014-01-01

    Roč. 74, č. 6 (2014), s. 519-520 ISSN 1210-5538 Institutional support: RVO:68378033 Keywords : František Schmoranz * architecture * 19th century Subject RIV: AL - Art, Architecture, Cultural Heritage

  13. Dolní Věstonice (okr. Břeclav). Lokalita DV-IIa („Lahmhöfe“, „Pod Lesem“). Gravettien. Povrchový průzkum

    Czech Academy of Sciences Publication Activity Database

    Svoboda, Jiří; Novák, Martin; Sázelová, Sandra

    2015-01-01

    Roč. 56, č. 1 (2015), s. 134-135 ISSN 1211-7250 Institutional support: RVO:68081758 Keywords : Gravettian * Upper Paleolithic * Dolní Věstonice * Czech Republic * surface collection Subject RIV: AC - Archeology, Anthropology, Ethnology

  14. Dvě zprávy o raně křesťanské liturgii. Pokus o analýzu narativní struktury

    Czech Academy of Sciences Publication Activity Database

    Fialová, Radka

    -, č. 24 (2014), s. 83-111 ISSN 1805-2762 R&D Projects: GA ČR(CZ) GBP401/12/G168 Institutional support: RVO:67985955 Keywords : Early Christian liturgy * baptism and Eucharist in the 2nd Century * Didache * Justin Martyr's Apology Subject RIV: AA - Philosophy ; Religion https://www.etf.cuni.cz/ sat /2014-1.html

  15. Dvě hypotézy o původu nekatolíků z řad banátských a bulharských Čechů

    Czech Academy of Sciences Publication Activity Database

    Nešpor, Zdeněk; Jakoubek, M.

    2011-01-01

    Roč. 98, č. 1 (2011), s. 73-79 ISSN 0009-0794 Institutional research plan: CEZ:AV0Z70280505 Keywords : Religious communities * Czech minorities * Romania * Bulgaria Subject RIV: AC - Archeology, Anthropology, Ethnology Impact factor: 0.094, year: 2011

  16. Dvě poznámky : O provokativní výstavě I.N.R.I.; O smrti Mohamedově v středověkých pramenech

    Czech Academy of Sciences Publication Activity Database

    Spunar, Pavel

    2001-01-01

    Roč. 9, č. 2 (2001), s. 197-198 ISSN 1210-3640 Institutional research plan: CEZ:AV0Z9062906 Keywords : commentar on exhibition "I.N.R.I." and on middleage text about Mohammed Subject RIV: AA - Philosophy ; Religion

  17. Dvě zaniklé středověké osady u Radomyšle (okres Strakonice). Památce Bohumíra Lifky (1900-1987)

    Czech Academy of Sciences Publication Activity Database

    Nechvátal, Bořivoj

    2017-01-01

    Roč. 42, č. 2 (2017), s. 773-787 ISSN 0231-5823 Institutional support: RVO:67985912 Keywords : deserted villages * location * homestead * pottery finds Subject RIV: AC - Archeology, Anthropology, Ethnology OBOR OECD: Archaeology http://hdl.handle.net/11222.digilib/137055

  18. Buškové z Velhartic. Historie pánů z Velhartic ve 14. století ve světle kartoték Augusta Sedláčka

    Czech Academy of Sciences Publication Activity Database

    Doležalová, Eva

    2015-01-01

    Roč. 18, č. 2 (2015), s. 181-191 ISSN 0862-979X R&D Projects: GA MK(CZ) DF12P01OVV019 Keywords : lord of Velhartice * 14th century * Czech lands * Charles IV * Bušek of Velhartice Subject RIV: AB - History

  19. Zpěv a slovo posvátné - ke studiu obřadní komunikace na počátku 21. století

    Czech Academy of Sciences Publication Activity Database

    Frolcová, Věra

    2009-01-01

    Roč. 57, č. 2 (2009), s. 195-206 ISSN 1335-1303 R&D Projects: GA ČR GA404/05/0182 Institutional research plan: CEZ:AV0Z90580513 Keywords : advent - folk catholic piety * lical spiritual culture * Virgin Mary * Ratíškovice Subject RIV: AC - Archeology, Anthropology, Ethnology

  20. Stimulace poptávky versus stimulace nabídky: daňové reformy v USA ve druhé polovině dvacátého století

    OpenAIRE

    Jirásek, Vojtěch

    2016-01-01

    The aim of the thesis is to compare the Reagan tax reforms in the US in the 80s with the Kennedy-Johnson tax policy from the 60s. Tax policy is a key tool to influence the economic situation in a country. The topic of tax reform is particularly timely in connection with the United States presidential elections. The thesis responds to criticism of Hillary Clinton and of economic policy of R. W. Reagan. Stimulation of demand in the 1960s and stimulation of supply in the 80s (both stimuli conduc...

  1. Druhý život Kralické bible v 18. a na začátku 19. století - edice hallská a prešpurská

    Czech Academy of Sciences Publication Activity Database

    Pišna, Jan

    2014-01-01

    Roč. 5, č. 2 (2014), s. 175-193 ISSN 1804-1132 Institutional support: RVO:68378068 Keywords : old printed Bible s * Bible Czech * Pietism * editing Subject RIV: AJ - Letters, Mass-media, Audiovision

  2. Symbolismus jako inspirace pro 20. století. Pojem „kulturního paradigmatu“ // Symbolism as inspiration for the 20th century: a concept of a cultural paradigm

    Directory of Open Access Journals (Sweden)

    Vladimír Svatoň

    2017-05-01

    Full Text Available Literary history commonly grounds itself in the heritage of philosophical positivism. It is not only its predilection for facts, but also a belief that the facts themselves can provide for the contours of syntheses and concepts of major styles and genres. The era of symbolism marked the renewed interest in philosophical hermeneutics, and, consequently, the realization that empirical knowledge is structured by a ground of a-priori assumptions (the rehabilitation of “prejudice”. This ground gave rise to a series of major concepts, the best known of which are Ferdinand Saussure’s “langue” and “parole”, but there are many more of similar pairs: Viktor Shklovsky “story” (fabula and “plot” (syuzhet, Jan Mukařovský’s “semantic gesture” and “structure”, or Yury Tynianov’s “tightness of a verse line” and “syntax”. In the field of philosophy it is Arnold Toynbee’s pair of terms “challenge” and “answer”. Husserl’s concept of “Lebenswelt” is the most important explication of this approach in philosophy.

  3. Komise pro dějiny a vývoj evropského zemědělství SIEF a česká etnografie v 60.-80. letech 20. století

    Czech Academy of Sciences Publication Activity Database

    Woitsch, Jiří

    2017-01-01

    Roč. 34, č. 1 (2017), s. 48-76 ISSN 1211-8117 R&D Projects: GA ČR GA15-03754S Institutional support: RVO:68378076 Keywords : SIEF * Commission for History and Development of European Agriculture * Ethnologia Europaea * agriculture * international projects Subject RIV: AC - Archeology, Anthropology, Ethnology OBOR OECD: Antropology, ethnology

  4. Aplikovaná tělesná výchova v USA v první polovině 20. století American adapted physical education in the first half of the 20th century

    Directory of Open Access Journals (Sweden)

    Martin Kudláček

    2006-02-01

    Full Text Available Aplikovaná tělesná výchova se v USA vyvinula z léčebné, zdravotní tělesné výchovy. Původní vliv švédské léčebné tělesné výchovy na americké vysoké školy mají "na svědomí" Hartwig Nissen (1855–1924, Nils Posse (1862–1895 a William Skarstrom (1896–1951. Mezi první americké průkopníky zdravotní tělesné výchovy patřily Lilian Curtis Drew a Louisa Lipin. Korektivní přístup zdravotní tělesné výchovy byl dominantní v období 1920–1950. Vůdčími osobnostmi té doby byli Charles Kosman (1879–1977, George Stafford (1894–1968 a Josephina Rathbone (1899–1989. Tito odborníci v té době velmi úzce spolupracovali s fyzioterapeuty. Velký počet veteránů z druhé světové války způsobil významné změny v přístupu k pohybovým aktivitám osob se zdravotním postižením. Toto později vedlo k oddělení korektivní fyzioterapie od aplikované tělesné výchovy v roce 1952. Adapted physical education in the U. S. has evolved from medical, corrective gymnastics. The original influence of Swedish gymnastics was passed on to American Universities via Hartwig Nissen (1855–1924, Nils Posse (1862–1895 and William Skarstrom (1896–1951. The first American leaders of corrective gymnastics were Lillian Curtis Drew and Louisa Lippitt. The corrective approach was the philosophy of physical education for students with special needs from the 1920 till the 1950. Leaders of APE in that era were Charles Lowman (1879–1977, George Stafford (1894–1968 and Josephine Rathbone (1899–1989. They very closely cooperated with physical therapists. A great number of World War II veterans influenced the major changes in sport for people with disabilities. World War II significantly changed the approach to physical activities for people with disabilities, which led to the separation of corrective physical therapy and adapted physical education in 1952.

  5. Od folklivsforskning k evropské etnologii, antropologii a zpět: švédská etnologie v 19. až 21. století

    Czech Academy of Sciences Publication Activity Database

    Woitsch, Jiří

    2017-01-01

    Roč. 27, č. 3 (2017), s. 224-235 ISSN 0862-8351 R&D Projects: GA ČR GA15-03754S Institutional support: RVO:68378076 Keywords : European ethnology * history of ethnology * cultural studies * Sweden * Scandinavia * Sigurd Erixon Subject RIV: AC - Archeology, Anthropology, Ethnology OBOR OECD: History (history of science and technology to be 6.3, history of specific sciences to be under the respective headings)

  6. Augustiniánská knihovna u sv. Tomáše v Praze. II. část: Období reformace a protireformace (do konce 17. století)

    Czech Academy of Sciences Publication Activity Database

    Sladká, Veronika

    2017-01-01

    Roč. 24, 1/2 (2017), s. 29-66 ISSN 1210-8510 Institutional support: RVO:67985971 Keywords : the Augustinian monastery at St Thomas in Prague * monastic libraries * provenance research * early modern period Subject RIV: AB - History OBOR OECD: History (history of science and technology to be 6.3, history of specific sciences to be under the respective headings)

  7. Švýcarští vychovatelé protestantské šlechty z českých zemí v 16. a raném 17. století

    Czech Academy of Sciences Publication Activity Database

    Holý, Martin

    2016-01-01

    Roč. 46, 95-96 (2016), s. 132-146 ISSN 0323-2220 R&D Projects: GA ČR(CZ) GA16-11332S Institutional support: RVO:67985963 Keywords : private tutors * Czech nobility * Switzerland * Early Modern Period Subject RIV: AB - History OBOR OECD: History (history of science and technology to be 6.3, history of specific sciences to be under the respective headings)

  8. Malí gratulanti: k podobě a úloze sbírek veršovaných přání v 19. století

    Czech Academy of Sciences Publication Activity Database

    Vítová, Andrea

    2016-01-01

    Roč. 48, R. 2016 (2016), s. 158-175 ISSN 0231-5904 Institutional support: RVO:68378068 Keywords : Nineteenth century * literature for children and young adults * congratulations Subject RIV: AJ - Letters, Mass-media, Audiovision OBOR OECD: Specific literatures

  9. Rostlinné zbytky ze zaniklé studny. Svědci historie Jiřského náměstí na Pražském hradu ve 13. století

    Czech Academy of Sciences Publication Activity Database

    Čulíková, Věra

    2012-01-01

    Roč. 64, č. 3 (2012), s. 479-502 ISSN 0323-1267 Institutional research plan: CEZ:AV0Z80020508 Keywords : archaeobotany * Middle Ages * Prague Castle * carpological analysis * well Subject RIV: AC - Archeology, Anthropology, Ethnology

  10. Organizace a vybavení vojska v 15. století: paralelní vývoj ve Francii, Burgundsku a střední Evropě

    OpenAIRE

    Biederman, Jan

    2016-01-01

    Organization and equipment of the army in 15th century: parallel development in France, Burgundy and in the Central Europe The form of the military organization, providing of food supply, technical possibilities and conditions of transport and, of course, a character of armament had share in qualities of the army during the late Middle Ages as well as in the other eras. In this context were important contemporary technical possibilities of the weapon production, commerce of weapons and last b...

  11. Stylový vývoj českého flakónu od druhé poloviny 19. do počátku 20. století

    OpenAIRE

    Lisnyak, Vlada

    2015-01-01

    English abstract The fundamental goal of this thesis includes a closer look at the glass-making industry of flaconware in Bohemia during the 19th century and the early 20th century. The first chapter provides a brief introduction to the history of flacons as containers for fragrances and their use in different countries. Perfume bottles have been in use since ancient times for the preservation of fragrances. The chapter describes the emergence of the first flacons and different techniques for...

  12. Karolinské importy a jejich napodobování v Čechách, případně na Moravě (konec 8. - 10. století)

    Czech Academy of Sciences Publication Activity Database

    Profantová, Naďa

    Suppl. 4, - (2011), s. 71-104 ISSN 1336-6637. [Karolínska doba a Slovensko. Bratislava, 23.02.2010] Institutional research plan: CEZ:AV0Z80020508 Keywords : Carolingian imports * Bohemia * Early Middle Ages * military equipment * weapons * luxurious jewellery Subject RIV: AC - Archeology, Anthropology, Ethnology

  13. Jazykový purismus v Čechách a v Lužici v poslední třetině 19. a v první třetině 20. století

    Czech Academy of Sciences Publication Activity Database

    Brankatschk, Katja; Martínek, František; Futtera, Ladislav

    2017-01-01

    Roč. 100, č. 4 (2017), s. 243-257 ISSN 0027-8203 R&D Projects: GA ČR GA16-10866S Institutional support: RVO:68378017 Keywords : Czech * Sorbian * national revival * purism * standardisation Subject RIV: AI - Linguistics OBOR OECD: Specific languages

  14. Transformace stoletého německého archivu lidových písní a posun koncepce bádání

    Czech Academy of Sciences Publication Activity Database

    Frolcová, Věra

    2015-01-01

    Roč. 12, č. 1 (2015), s. 153-159 ISSN 1210-1109 Institutional support: RVO:68378076 Keywords : Transformation Centre for Popular Culture and Music * folk song * popular song * interdisciplinary research of songs * national and international reception of songs * Freiburg im Breisgau Subject RIV: AC - Archeology, Anthropology, Ethnology

  15. Růže chuti přerozkošné. Antologie moravských rukopisných kancionálů 17. a 18. století

    Czech Academy of Sciences Publication Activity Database

    Frolcová, Věra

    2016-01-01

    Roč. 26, č. 2 (2016), s. 169-170 ISSN 0862-8351 Institutional support: RVO:68378076 Keywords : Moravia * hymn book * manuscript * anthology * 17th century * 18th century Subject RIV: AC - Archeology, Anthropology, Ethnology

  16. Angažované vyprávění. Narativní strategie literárně-historických děl na přelomu 13. a 14. století

    Czech Academy of Sciences Publication Activity Database

    Dvořáčková-Malá, Dana

    2017-01-01

    Roč. 20, č. 1 (2017), s. 23-38 ISSN 0862-979X Institutional support: RVO:67985963 Keywords : Literary sources * narrative sources * Wenceslas II * German literature * Peter of Zittau * Zbraslav Chronicle (Chronicon Aulae Regiae) * Chronicle of the so-called Dalimil, * Alexandreis * Wilhelm von Wenden Subject RIV: AB - History OBOR OECD: History (history of science and technology to be 6.3, history of specific sciences to be under the respective headings)

  17. Čeští kantoři a hudba u pražských alžbětinek v 18. a 19. století

    Czech Academy of Sciences Publication Activity Database

    Michl, Jakub

    2015-01-01

    Roč. 6, č. 2 (2015), s. 51-59 ISSN 1804-5367 Institutional support: RVO:68378076 Keywords : Sisters of Saint Elizabeth * convents * cantors * music in convents * music collections * pedagogy of music * Lužec nad Vltavou * Prague * Hořovice * Jan Pavel Slavík * 18th century * 19th century * Zikmund Václav Josef Suchý Subject RIV: AL - Art, Architecture, Cultural Heritage

  18. Zítra se bude tančit všude, aneb jak jsme se protancovali ke svobodě. Dichotomie tzv. folklorního hnutí druhé poloviny 20. století

    Czech Academy of Sciences Publication Activity Database

    Stavělová, Daniela

    2017-01-01

    Roč. 104, č. 4 (2017), s. 411-432 ISSN 0009-0794 R&D Projects: GA ČR(CZ) GA17-26672S Institutional support: RVO:68378076 Keywords : folklore revival movement * folklorism * folk ensembles * oral history * narratives * Czech Republic Subject RIV: AC - Archeology, Anthropology, Ethnology OBOR OECD: Antropology, ethnology

  19. Řešení nezaměstnanosti v Německu ve třicátých letech 20. století

    OpenAIRE

    Liptáková, Alexandra

    2010-01-01

    This paper mediates a view on economic policies of avoiding mass unemployment in Germany in the 1930s. It is concerned with the causations and development, it introduces a number of programs for dealing with the unemployment, which originate in the Weimar Republic, during the cabinet of Heinrich Brüning, Franz von Papen and Kurt von Schleicher. A major arttention will be given to the national socialist economic policy of Adolf Hitler and his cabinet. In more detail it will concern the system ...

  20. České zahrádkaření v druhé polovině 20. století očima chalupářů

    Czech Academy of Sciences Publication Activity Database

    Schindler-Wisten, Petra

    2017-01-01

    Roč. 51, č. 1 (2017), s. 35-42 ISSN 0862-1209 R&D Projects: GA ČR GA15-08130S Institutional support: RVO:68378114 Keywords : gardening * spending weekends at cottages * oral history Subject RIV: AB - History OBOR OECD: History (history of science and technology to be 6.3, history of specific sciences to be under the respective headings)

  1. Obrázky z pekla. Souvislosti několika vyobrazení Posledního soudu z počátku 14. století

    Czech Academy of Sciences Publication Activity Database

    Dienstbier, Jan; Faktor, Ondřej

    2015-01-01

    Roč. 63, č. 6 (2015), s. 434-457 ISSN 0049-5123 R&D Projects: GA ČR GA13-39192S Institutional support: RVO:68378033 Keywords : medieval wall paintings * hell * alewife Subject RIV: AL - Art, Architecture, Cultural Heritage

  2. Obraz Židů v českém kazatelství přelomu 17. a 18. století: předběžné poznámky

    Czech Academy of Sciences Publication Activity Database

    Soukup, Daniel

    2016-01-01

    Roč. 19, č. 1 (2016), s. 72-106 ISSN 1213-2144 Institutional support: RVO:68378068 Keywords : Preaching and the Image of Jews * Catholic Sermons * Early Modern Homiletics * Representation of Jews in Literature * Anti-Jewish Rhetoric Subject RIV: AJ - Letters, Mass-media, Audiovision

  3. Syndrom vyhoření v podmínkách výkonově orientované společnosti 21.století

    OpenAIRE

    Petrlíková, Adelheid

    2013-01-01

    The first part of this thesis is focused on the literature review that is concerned with Burnout syndrome. The work analyses the development of the burnout concept from the early start in 70th of the 20th century till present-day. It covers major topics that include the definition of the Burnout Syndrome, the difference among Burnout Syndrome and other mental states, signs, symptoms, diagnostics and phases of the Burnout Syndrome and last but least the analysis of the factors, that contribute...

  4. Rozjímání iuxta morem Societatis v české provincii Tovaryšstva Ježíšova aneb Lanciciovo století (1636-1739)

    Czech Academy of Sciences Publication Activity Database

    Linka, Jan

    2011-01-01

    Roč. 26, č. 1 (2011), s. 57-75 ISSN 0231-7494 Institutional research plan: CEZ:AV0Z90560517 Keywords : early modern literature * Jesuits * early modern spirituality * meditation * Bohemian-Polish cultural relations * Lancicius, Nicolaus * St. Philip of Neri * Kadlinský, Felix Subject RIV: AJ - Letters, Mass-media, Audiovision

  5. Kronikářské záznamy v Pamětní knize Velvar (Historiografické narativní prameny druhé poloviny 16. století)

    Czech Academy of Sciences Publication Activity Database

    Tošnerová, Marie

    2017-01-01

    Roč. 47, č. [0] (2017), s. 71-92 ISSN 0585-5691 R&D Projects: GA MK(CZ) DG16P02H015 Keywords : Velvary, Czech Republic * historiography * narrative sources Subject RIV: AB - History OBOR OECD: History (history of science and technology to be 6.3, history of specific sciences to be under the respective headings)

  6. Odborný zájem o menšiny na počátku 20. století a menšinové muzeum v Praze

    Czech Academy of Sciences Publication Activity Database

    Sulitka, Andrej

    -, č. 1 (2014), s. 225-237 ISSN 0323-0619 Institutional support: RVO:68378076 Keywords : Czech minority trade unions in the early 20th century * Czech-German coexistence * Czech minorities in border areas * professional interest in minorities * the emergence of Minority Museum in Prague 1909 * The activities of the Museum * Private population census * questionnaire survey * publishing activity * Minority revue (1912-1913)/Menšinová revue (1912-1913) * Minority proceedings (1914)/Sborník menšinový (1914) Subject RIV: AC - Archeology, Anthropology, Ethnology

  7. Vývoj kvalitativně nových látek pro léčbu epilepsie - naděje pro 21. století?

    Czech Academy of Sciences Publication Activity Database

    Kubová, Hana

    2006-01-01

    Roč. 5, - (2006), s. 284-286 ISSN 1335-9592 Institutional research plan: CEZ:AV0Z50110509 Keywords : antiepileptic drugs * pharmacoresistant epilepsy * neuroprotective and antiepileptogenic interventions Subject RIV: ED - Physiology

  8. Od ne-hudby k hudbě. Hudební využití hluku ve 20. století // From non-music to music. Musical use of noise in the 20th century

    Directory of Open Access Journals (Sweden)

    Matěj Kratochvíl

    2016-12-01

    Full Text Available The range of sounds available to musicians has grown considerably during the 20th century. The invention of sound recording has made it possible to document any sonic event and to use it in a musical way. This text summarizes the history of this development and tries to show how the use of nonmusical sounds can be explained as the next stage in the history of western classical and how we can compare it with so called emancipation of dissonance at the end of the 20th century. It also analyzes various esthetic trends concerning the use of non-musical sounds and the ways in which the broadening of sonic possibilities influenced our understanding of what music is and how it functions as a way of human communication.

  9. K železářské výrobě kolem přelomu 12. a 13. století v Knovízi, okr. Kladno

    Czech Academy of Sciences Publication Activity Database

    Ježek, Martin; Řídký, Jaroslav; Varadzin, Ladislav; Zavřel, J.

    2011-01-01

    Roč. 63, č. 2 (2011), s. 331-339 ISSN 0323-1267 Institutional research plan: CEZ:AV0Z80020508 Keywords : Middle Ages * Central Bohemia * countryside * ironworks * metallurgy * raw mining Subject RIV: AC - Archeology, Anthropology, Ethnology

  10. Charakterizace chemického a mineralogického složení keramických nálezů z 6.-11. století z Roztok u Prahy

    Czech Academy of Sciences Publication Activity Database

    Kloužková, A.; Zemenová, P.; Profantová, Naďa

    2014-01-01

    Roč. 39, č. 1 (2014), s. 53-73 ISSN 0231-5823 R&D Projects: GA ČR(CZ) GAP405/10/2289 Institutional support: RVO:67985912 Keywords : pottery * Prague-type culture * hillfort period * Bohemia * analyses Subject RIV: AC - Archeology, Anthropology, Ethnology

  11. Vnější označení a sebeoznačení českých nekatolíků v 18. - 19. století

    Czech Academy of Sciences Publication Activity Database

    Nešpor, Zdeněk

    2002-01-01

    Roč. 10, č. 2 (2002), s. 175-196 ISSN 1210-3640 Institutional research plan: CEZ:AV0Z7028912 Keywords : Czech history * 18th and 19th centuries * Czech Protestantism Subject RIV: AO - Sociology, Demography

  12. Vývoj a funkce tradičního korejského ženského oděvu od začátku 19. století do současnosti

    OpenAIRE

    Marešová, Kateřina

    2015-01-01

    This thesis analyses the development of traditional Korean women's clothing from the early 19th century to the present. It briefly describes the different kinds of female hanbok by corresponding occasions or by the status of its owner. It also concerns the themes of symbolism of colours and embroidery. The main objective of the thesis is the characteristics of the changing form and function of traditional female clothing with regard to the developing Korean society. The work is divided into c...

  13. Prostor města a jeho fázový růst v českých zemích od konce 19. století

    Czech Academy of Sciences Publication Activity Database

    Semotanová, Eva

    2010-01-01

    Roč. 36, č. 2 (2010), s. 225-254 ISSN 0323-0988 R&D Projects: GA ČR GA404/09/0897 Institutional research plan: CEZ:AV0Z80150510 Keywords : Urbanization * Towns * Landscape Subject RIV: AB - History

  14. Archeologické doklady výroby z 12.-13./14. století v jihovýchodní části Brna ve vztahu k vývoji zástavby

    Czech Academy of Sciences Publication Activity Database

    Procházka, Rudolf

    2011-01-01

    Roč. 6, č. 2012 (2011), 212-251 ISSN 1803-1749. [Forum urbes medii aevi /7./. Křtiny, 13.05.2008-16.05.2008] R&D Projects: GA ČR GA404/09/1966 Institutional research plan: CEZ:AV0Z80010507 Keywords : Early and High Middle Ages * production * Brno Subject RIV: AC - Archeology, Anthropology, Ethnology

  15. Debata o památkové péči v 60. letech 20. století. Ivo Loos, Jindřich Malátek a Transgas

    Czech Academy of Sciences Publication Activity Database

    Švácha, Rostislav

    2017-01-01

    Roč. 77, č. 4 (2017), s. 361-372 ISSN 1210-5538 Institutional support: RVO:68378033 Keywords : Jindřich Malátek * Ivo Loos * postwar architecture * theory of architecture and heritage care * Transgas Subject RIV: AL - Art, Architecture, Cultural Heritage

  16. Výstava "Růžová zahrádka". Rukopisné modlitební knížky 18. a 19. století

    Czech Academy of Sciences Publication Activity Database

    Holubová, Markéta

    2010-01-01

    Roč. 97, č. 1 (2010), s. 79-81 ISSN 0009-0794 Institutional research plan: CEZ:AV0Z90580513 Keywords : prayer book * exhibition Subject RIV: AC - Archeology, Anthropology, Ethnology Impact factor: 0.343, year: 2010

  17. Každodenní život městských protestantských komunit pozdního 18. století. Brno a nové Město na Moravě

    Czech Academy of Sciences Publication Activity Database

    Bolom-Kotari, Sixtus

    2014-01-01

    Roč. 33, č. 1 (2014), s. 269-298 ISSN 0231-7443 Institutional support: RVO:67985963 Keywords : 1781 * Brno * Nové Město na Moravě * Edict of Tolerance * Enlightenment * Protestantism Subject RIV: AB - History

  18. Tchangské křesťanství („nestoriánství“) v Číně a jeho jesuitská reflexe v 17. století

    Czech Academy of Sciences Publication Activity Database

    Liščák, Vladimír

    -, 9-10 (2016), s. 193-276. ISBN 978-80-87378-84-7. ISSN 1802-8209 Institutional support: RVO:68378009 Keywords : Christianity in China * Nestorianism * Luminous Religion * Xi’an stele * Jesuit stele Subject RIV: AB - History OBOR OECD: Religious studies

  19. Diskurs o husitství v české společnosti dvacátého století a jeho ilustrace Vávrovou husitskou trilogií

    OpenAIRE

    Hlaváčková, Terezie

    2013-01-01

    The angle under which Czech society sees Hussitism has undergone a rapid turn over the last few decades. The planned B.Sc. thesis aims to contribute to the identification of roots and prerequisites of this turnaround laid by previous development of Czech society and culture, especially after the World War II. It is obviously also necessary to analyse the preceding long- term development, from the beginnings of the national revival through Tyl and Palacký up to Jirásek and Nejedlý. The main su...

  20. Historický atlas revolučního hnutí – historickokartografické dílo jako nástroj politické propagandy v Československu 50. let 20. století

    Czech Academy of Sciences Publication Activity Database

    Močičková, Jitka

    2016-01-01

    Roč. 42, č. 2 (2016), s. 329-368 ISSN 0323-0988 R&D Projects: GA MK(CZ) DG16P02H010 Keywords : Czechoslovakia * historical atlases * propaganda * communism * history of cartography Subject RIV: AB - History

  1. České církevní azylové právo 17. a 18. století (Případ Karla Škréty)

    Czech Academy of Sciences Publication Activity Database

    Adamová, Karolina; Lojek, Antonín

    2010-01-01

    Roč. 8, č. 1 (2010), s. 39-50 ISSN 1214-4878 Institutional research plan: CEZ:AV0Z70680506 Keywords : right of asylum * refugee * application of the right of asylum in the Czech lands Subject RIV: AG - Legal Sciences

  2. Antonín Mandl – svědek diskusí mezi katolíky ve druhé polovině 60. let 20. století

    Directory of Open Access Journals (Sweden)

    Vojtěch Novotný

    2014-04-01

    Full Text Available The general character of the memory of the contemporary witnesses and the fact that nearly no Christian samizdat of the 1960s has been preserved do not allow to offer a closer look to the topics discussed by the priests released from prison with their friends. We can only offer it through the witness of one of them, Antonín Mandl (1917–1972. His work from 1965 to 1967 is only a voice of an individual, but we can suppose that it echoes a broader debate, in which the experience of the earlier years has been confronted both with the contemporary form of the Czechoslovak society ruled by the Communist totalitarian regime and with the results of the Vatican Council II. The paper focuses on Mandl’s answer to the following three questions: In the relation to the Communism, is it proper to choose opposition, or collaboration? How should the priesthood in the contemporary society look like? What are the major axioms of Christian life, pastoral work and evangelisation?

  3. Budování lokální a regionální organizace Národní strany v Čechách v 60. a 70. letech 19. století

    Czech Academy of Sciences Publication Activity Database

    Velek, Luboš

    2014-01-01

    Roč. 6, č. 1 (2014), s. 9-37 ISSN 1803-9243 Institutional support: RVO:67985921 Keywords : Organisation of political parties * National Party (Old Czechs) * Notable political parties Subject RIV: AB - History

  4. Nenaplněný příslib sociologické teorie: vzestup a pád americké sociologie ve druhé polovině dvacátého století

    Czech Academy of Sciences Publication Activity Database

    Balon, Jan

    Roč. 44, č. 5 ( 2008 ), s. 943-967 ISSN 0038-0288 Institutional research plan: CEZ:AV0Z90090514 Keywords : American sociology * unified theory * crisis Subject RIV: AA - Philosophy ; Religion Impact factor: 0.427, year: 2008

  5. Doklady přítomnosti elity 6.-5. století př. Kr. v regionu na soutoku Labe a Vltavy ve středních Čechách

    Czech Academy of Sciences Publication Activity Database

    Chytráček, Miloslav

    2013-01-01

    Roč. 65, č. 2 (2013), s. 285-320 ISSN 0323-1267 Grant - others:Rada Programu interní podpory projektů mezinárodní spolupráce AV ČR(CZ) M300021201 Program:M Institutional support: RVO:67985912 Keywords : late Hallstatt period * early La Tène period * cemetery * settlement * cult * foliate crown * bronze bowls * drinking horns Subject RIV: AC - Archeology, Anthropology, Ethnology

  6. Musarum et patriae fulgida stella suae. Inscenace Bohuslava Hasištejnského z Lobkovic a sebeidentifikační praktiky českých humanistů poloviny 16.století

    Czech Academy of Sciences Publication Activity Database

    Storchová, Lucie

    2007-01-01

    Roč. 52, 1-4 (2007), s. 9-18 ISSN 0036-5351. [Bohuslav Hasištejnský z Lobkovic a kultura jeho doby. Praha, 25.05.2007] Institutional research plan: CEZ:AV0Z90090514 Keywords : Bohuslav Hasištejnský of Lobkowicz * Renaissance Humanism * Bohemia Subject RIV: AB - History

  7. Být hercem. Řečtí thespidové od 5. století před Kristem do nástupu helénismu

    Czech Academy of Sciences Publication Activity Database

    Sarkissian, Alena

    2017-01-01

    Roč. 28, č. 1 (2017), s. 7-26 ISSN 0862-5409 Institutional support: RVO:67985955 Keywords : Ancient Greek Theatre * Greek Actor Subject RIV: AJ - Letters, Mass-media, Audiovision OBOR OECD: Specific languages

  8. Transatlantické obchodní a investiční partnerství - nadstandardní ekonomické vztahy mezi oběma břehy Atlantiku ve 21. století?

    OpenAIRE

    Hlavnička, Jindřich

    2016-01-01

    The aim of this thesis it to offer a complex overview of the Transatlantic Trade and Investment Partnership (TTIP). This international agreement is being negotiated between the United States and the European Union. The main goal of this agreement is to create the largest free trade area to date. I wish to claim that the TTIP does not merely concern trade, but there is a clear geopolitical underlining for it too. When the communist world collapsed, the United States became the sole remaining s...

  9. Ruská pravoslavná církev a “pravá” víra na počátku 19. století

    Czech Academy of Sciences Publication Activity Database

    Vlček, Radomír

    2017-01-01

    Roč. 27, č. 56 (2017), s. 131-147 ISSN 0862-8440 Institutional support: RVO:67985963 Keywords : Russian orthodox church * patriotic war * holy synod Subject RIV: AB - History OBOR OECD: History (history of science and technology to be 6.3, history of specific sciences to be under the respective headings)

  10. Správa a každodenní provoz koleje Českého národa na pražské univerzitě v 16. století

    Czech Academy of Sciences Publication Activity Database

    Holá, M.; Holý, Martin

    2014-01-01

    Roč. 22, č. 2 (2014), s. 115-123 ISSN 1211-9768 R&D Projects: GA ČR GPP405/12/P422 Institutional support: RVO:67985963 Keywords : educational patronage * Prague University * students colleges Subject RIV: AB - History

  11. Ruský stát a ruská pravoslavná církev v prvních desetiletích 19. století. Ruská identita od Kutuzova po Uvarova

    Czech Academy of Sciences Publication Activity Database

    Vlček, Radomír

    2016-01-01

    Roč. 63, č. 1 (2016), s. 49-69 ISSN 1803-7429 Institutional support: RVO:67985963 Keywords : Russia * 19th century * national identity * Russia n orthodox church * orthodox faith Subject RIV: AB - History OBOR OECD: History (history of science and technology to be 6.3, history of specific sciences to be under the respective headings)

  12. Podoby motivů výměnkářství v české próze 2. poloviny 19. století

    Czech Academy of Sciences Publication Activity Database

    Fránek, Michal

    2014-01-01

    Roč. 17, č. 1 (2014), s. 107-130 ISSN 1213-2144 Institutional support: RVO:68378068 Keywords : Czech literature * 19th century * Hálek, Vítězslav * Hansmann, Leopold * Pravda, František * Rais, Karel Václav * Šlejhar, Josef Karel Subject RIV: AJ - Letters, Mass-media, Audiovision

  13. Realismus v české literatuře 19. století. Pohledy současníků, historické interpretace a badatelské perspektivy

    Czech Academy of Sciences Publication Activity Database

    Hrdina, Martin

    2014-01-01

    Roč. 62, č. 3 (2014), s. 372-394 ISSN 0009-0468 R&D Projects: GA ČR GPP406/12/P839 Institutional support: RVO:68378068 Keywords : literary realism * Czech literature of the 19th century * methodology of literary history Subject RIV: AJ - Letters, Mass-media, Audiovision

  14. K problematice ženské obsluhy v českých zemích v 19. a první polovině 20. století

    Czech Academy of Sciences Publication Activity Database

    Altman, Karel

    2007-01-01

    Roč. 41, - (2007), s. 25-43 ISSN 0862-1209 Institutional research plan: CEZ:AV0Z90580513 Keywords : Czech lands * public houses * female work * female emancipation Subject RIV: AC - Archeology, Anthropology, Ethnology

  15. Analysis of a Mathematical Model to Investigate the Dynamics of ...

    African Journals Online (AJOL)

    ADOWIE PERE

    4. 3. 6. **. DH. DV. H. H. H. H. H. H. H. DV. V. H. H. H. H. H. H. V. H. H. DH. DV. H. V. V. H. V. VH. DV gg ggg gggg gg ggg gggg gg g λλ γτ. µγ. µ. µ. λµ γτ. µγ. µ. µ. µ. µ λλ. µ γ. ηµ β λ. Λ. +. Λ+. Λ+. Λ+. Λ. +. Λ+. Λ+. Λ. +. +. Λ. = (33) substituting. **. DH λ to. **. DV λ we have. 0. 3. **. 2. 2**. 1. = +. +. A. A. A. Dv. Dv λ λ. (34) where.

  16. Dicty_cDB: Contig-U06933-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available Aedes aegypti infected with Dengue viru... 42 1.5 2 ( DV277062 ) NAAGT55TF Aedes aegypti - Fat Bodie...hrome oxid... 36 1.6 2 ( DV275464 ) NAAH730TR Aedes aegypti - Fat Bodies Normalized (... 42 1.7 2 ( DV399876...h Dengue viru... 42 1.8 2 ( DV275462 ) NAAH730TF Aedes aegypti - Fat Bodies Normalized (... 42 1.8 2 ( DV399

  17. Účast D. Stránské na Soupisovém výzkumu NSČ

    Czech Academy of Sciences Publication Activity Database

    Motyčková, Dana

    15[57]-16[58], - (1999), s. 99-102 ISSN 1211-8117. [Lidová kultura 20. století, její výzkum, dokumentace a prezentace. Věnováno 100. výročí narození doc. dr. Drahomíry Stránské. Rožnov pod Radhoštěm, 08.09.1999] Subject RIV: AC - Archeology, Anthropology, Ethnology

  18. Komika v díle Bohumíra Hynka Josefa Bílovského

    Czech Academy of Sciences Publication Activity Database

    Havelka, Tomáš

    2004-01-01

    Roč. 34, 71-72 (2004), s. 142-154 ISSN 0323-2220. [Morava na křižovatce duchovních proudů 16. a 17. století /24./. Uherský Brod, 15.10.2003-17.10.2003] Institutional research plan: CEZ:AV0Z9009908 Keywords : comic * Czech baroque homiletic * rhetoric Subject RIV: AA - Philosophy ; Religion

  19. K nestandardním jazykovým jevům ve staročeských textech

    Czech Academy of Sciences Publication Activity Database

    Svobodová, Andrea; Voleková, Kateřina

    2016-01-01

    Roč. 8, č. 3 (2016), s. 16-36 ISSN 1803-876X. [Jazykovědný strukturalismus na počátku 21. století. Olomouc, 24.04.2014-24.04.2014] R&D Projects: GA ČR GAP406/10/1140 Institutional support: RVO:68378092 Keywords : Old Czech * historical dialectology * non-standard language phenomena * transcription * ortography Subject RIV: AI - Linguistics OBOR OECD: Linguistics

  20. Synthesis, characterization and fluorescence performance of a waterborne polyurethane-based polymeric dye

    Energy Technology Data Exchange (ETDEWEB)

    Xianhai, Hu, E-mail: hxyh@aiai.edu.cn [CAS Key Laboratory of Soft Matter Chemistry, Department of Polymer Science and Engineering, University of Science and Technology of China, Hefei 230026 (China); School of Materials and Chemical Engineering, Building Energy Efficiency Research Institute, Anhui University of Architecture, Hefei 230022 (China); Zhang, Xingyuan, E-mail: zxym@ustc.edu.cn [CAS Key Laboratory of Soft Matter Chemistry, Department of Polymer Science and Engineering, University of Science and Technology of China, Hefei 230026 (China); Liu, Jin [School of Materials and Chemical Engineering, Building Energy Efficiency Research Institute, Anhui University of Architecture, Hefei 230022 (China); Dai, Jiabing [CAS Key Laboratory of Soft Matter Chemistry, Department of Polymer Science and Engineering, University of Science and Technology of China, Hefei 230026 (China)

    2013-10-15

    A novel anionic waterborne polyurethane-based fluorescent dye WPU-DV26 was synthesized by incorporating the molecular structure of disperse violet 26 (DV26) into the polyurethane chain. The structure of WPU-DV26 was confirmed by means of Fourier transform infrared spectroscopy and UV–vis absorption analysis. Comparing to the UV–vis spectrum of DV26, WPU-DV26 showed a hypsochromic shift from the absorption maxima of 518, 558, 609 nm to 510, 548, 586 nm, respectively. WPU-DV26 can form stable latex in water. The number average molecular weight and its distribution index, and average latex particle size for WPU-DV26 were determined to be 2.33×10{sup 4}, 1.36 and 80 nm, respectively. The improved thermal stability of WPU-DV26 can be attributed to the embedded anthraquinone unit of DV26. It was found that both the intensity and stability of the fluorescence of WPU-DV26 latex were improved significantly compared with those of DV26. -- Highlights: ► A waterborne polyurethane-based polymeric dye was synthesized. ► The fluorescence intensity of WPU-DV26 emulsion was enhanced greatly compared with that of DV26. ► The fluorescence stability of WPU-DV26 emulsion was fine not only for long term storage but also for fluorescence quencher.

  1. Dicty_cDB: Contig-U16376-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available egypti infected with Dengue viru... 50 2e-09 2 ( DV283960 ) NAAG514TR Aedes aegypti - Fat Bodies Normalized ...(... 50 2e-09 2 ( DV283959 ) NAAG514TF Aedes aegypti - Fat Bodies Normalized (...... 2e-09 2 ( DV288110 ) NAAHX47TR Aedes aegypti - Fat Bodies Normalized (... 50 2e-...7TF Aedes aegypti - Fat Bodies Normalized (... 50 2e-09 2 ( DV408036 ) NADX707TF Aedes aegypti infected with... 50 2e-09 2 ( DV247339 ) A2FMT46TV Aedes aegypti full length cDNA library,... 50 2e-09 2 ( DV288109 ) NAAHX4

  2. Profile and programming needs of federal offenders with histories of intimate partner violence.

    Science.gov (United States)

    Stewart, Lynn A; Power, Jenelle

    2014-10-01

    This study presents data on male perpetrators of domestic violence (DV) in the Correctional Service of Canada (CSC) using two samples: (a) a snapshot of all male offenders in CSC who had been assessed for DV (n = 15,166) and (b) a cumulative sample of male offenders in CSC from 2002-2010 who had been assessed as moderate or high risk for further DV (n = 4,261) DV offenders were compared to a cohort sample of non-DV offenders (n = 4,261). Analyses were disaggregated for Aboriginal and non-Aboriginal offenders. Results indicated that 40% of the federal male population had a suspected history of DV and were therefore screened in for in-depth DV risk assessment. Of these, 45% were assessed as moderate or high risk for future DV. DV offenders had higher risk and criminogenic need ratings, more learning disabilities, more mental health problems, and more extensive criminal histories than those without DV histories. Aboriginal DV offenders had high levels of alcohol dependence, suggesting a need for substance abuse treatment as part of DV programming. Most federal offenders with DV histories would be described as belonging to the Antisocial/Generalized Aggressive typology and, therefore, adhering to the Risk-Need-Responsivity principles of the effective correctional literature, cognitive-behavioral treatment that focuses on teaching skills of self-management, and changing attitudes supporting relationship violence would be recommended. © The Author(s) 2014.

  3. Knowledge of primary care nurses regarding domestic violence ...

    African Journals Online (AJOL)

    Knowledge of primary care nurses regarding domestic violence. ... It included also knowledge about prevalence of DV, and four main aspects relevant to DV, namely deprivation, psychological, ... schools, training courses and conferences.

  4. Perpetration of gross human rights violations in South Africa ...

    African Journals Online (AJOL)

    ... rights violations, purposeful injury, accidental injury and domestic violence. ... Socio-demographic profiles of perpetrators of HRV and DV in South Africa differ. ... is possible that some HRV and DV perpetrators were themselves once victims.

  5. Decidual vasculopathy in preeclampsia: Lesion characteristics relate to disease severity and perinatal outcome

    NARCIS (Netherlands)

    Stevens, D.U.; Al-Nasiry, S.; Bulten, J.; Spaanderman, M.E.A.

    2013-01-01

    OBJECTIVE: In a proportion of patients with preeclampsia, unremodeled spiral arteries develop additional pathological changes, termed decidual vasculopathy (DV), or acute atherosis. DV has been correlated to adverse clinical outcome and increased placental pathology. However, it was unclear whether

  6. Dicty_cDB: Contig-U07003-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available aegypti infected with Brugia Mal... 50 0.090 1 ( DV278108 ) NAAF224TF Aedes aegypti - Fat Bodies Normalized ...(... 50 0.090 1 ( DV276715 ) NAAHF49TR Aedes aegypti - Fat Bodies Normalized (...

  7. Domestic Violence in the Canadian Workplace: Are Coworkers Aware?

    Directory of Open Access Journals (Sweden)

    Jennifer C.D. MacGregor

    2016-09-01

    Conclusion: Our findings have implications for a coordinated workplace response to DV. Further research is urgently needed to examine how best to address DV in the workplace and improve outcomes for victims, perpetrators, and their coworkers.

  8. Transfer of the lambdadv plasmid to new bacterial hosts

    International Nuclear Information System (INIS)

    Kellenberger-Gujer, G.; Boy de la Tour, E.; Berg, D.E.

    1974-01-01

    Lambda dv, which was derived from bacteriophage lambda, replicates autonomously as a plasmid in Escherichia coli and consists of only the immunity region (imm/sup lambda/) and DNA replication genes (O, P) of the ancestral phage. Addition phages (lambda imm 21 --lambda dv) carry the lambda dv fragment inserted as a tandem duplication in their genome (sequence A imm 21 O P imm/sup lambda/ O P R) are formed as recombinants after lambda imm 21 infection of strains carrying lambda dv. Addition phages were used to transfer lambda dv to new bacterial hosts. Lambda dv transfer by excision of the lambda dv segment from the addition phage genome requires a bacterial Rec or a phage Red recombination system. Successful transfer is stimulated by uv irradiation of the addition phage before infection. Some properties of the newly transferred lambda dv plasmids are described. (U.S.)

  9. Dengue and dengue haemorrhagic fever: Indian perspective

    Indian Academy of Sciences (India)

    PRAKASH KUMAR

    ). They are transmitted mainly by the Aedes aegypti mosquito and also by Aedes albopictus. Biologically, DV are highly adapted to the mosquito and are maintained by vertical transmission. DV produces from a subclinical infection to a mild ...

  10. Activation of TLR2 and TLR6 by Dengue NS1 Protein and Its Implications in the Immunopathogenesis of Dengue Virus Infection.

    Directory of Open Access Journals (Sweden)

    Jincheng Chen

    2015-07-01

    Full Text Available Dengue virus (DV infection is the most prevalent mosquito-borne viral disease and its manifestation has been shown to be contributed in part by the host immune responses. In this study, pathogen recognition receptors, Toll-like receptor (TLR 2 and TLR6 were found to be up-regulated in DV-infected human PBMC using immunofluorescence staining, flow cytometry and Western blot analyses. Using ELISA, IL-6 and TNF-α, cytokines downstream of TLR2 and TLR6 signaling pathways were also found to be up-regulated in DV-infected PBMC. IL-6 and TNF-α production by PBMC were reduced when TLR2 and TLR6 were blocked using TLR2 and TLR6 neutralizing antibodies during DV infection. These results suggested that signaling pathways of TLR2 and TLR6 were activated during DV infection and its activation contributed to IL-6 and TNF-α production. DV NS1 protein was found to significantly increase the production of IL-6 and TNF-α when added to PBMC. The amount of IL-6 and TNF-α stimulated by DV NS1 protein was reduced when TLR2 and TLR6 were blocked, suggesting that DV NS1 protein is the viral protein responsible for the activation of TLR2 and TLR6 during DV infection. Secreted alkaline phosphatase (SEAP reporter assay was used to further confirm activation of TLR2 and TLR6 by DV NS1 protein. In addition, DV-infected and DV NS1 protein-treated TLR6-/- mice have higher survivability compared to DV-infected and DV NS1 protein-treated wild-type mice. Hence, activation of TLR6 via DV NS1 protein could potentially play an important role in the immunopathogenesis of DV infection.

  11. Dicty_cDB: Contig-U16342-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available .. 44 3.7 1 ( DV275889 ) NAAHC82TF Aedes aegypti - Fat Bodies Normalized (... 44 3.7 1 ( DV275869 ) NAAHC82TR Aedes aegypti - Fat Bod...ies Normalized (... 44 3.7 1 ( DV274316 ) NAAH317TR Aedes aegypti - Fat Bodie...s Normalized (... 44 3.7 1 ( DV274315 ) NAAH317TF Aedes aegypti - Fat Bodies Normalized

  12. The Role and Education of Dental Care Professionals in Identifying Domestic Violence: Report of an Audience Participation Exercise and Round Table Discussion

    Science.gov (United States)

    Lea, Susan J.; Quinn, Barry; Reynolds, Patricia A.

    2017-01-01

    Domestic violence (DV) is a major public problem affecting 30% of women over 16. Three quarters of victims have violence to the head and neck, and therefore the role of the dentist is paramount in DV identification. Only one-third of dental schools in the UK include DV in their curricula and there is a need to introduce effective education for the…

  13. Out with the Old

    Science.gov (United States)

    Rydeen, James E.; Stofferahn, Terry; Lange, Jim

    2010-01-01

    Displacement ventilation (DV) units use the natural buoyancy of warm air to improve ventilation and comfort. Although relatively new to the United States, DV has been used in Scandinavian countries since the 1970s. Two types of DV can be used in a classroom: (1) Conventional displacement ventilation (CDV) units which are situated on an interior…

  14. Conspicuous by its absence: Domestic violence intervention in ...

    African Journals Online (AJOL)

    Domestic violence (DV) is common globally. In South Africa, emergency care providers (ECPs) lack a clear policy framework and the necessary training to identify DV and intervene when it is encountered. We investigate the knowledge, attitudes and beliefs of ECPs towards DV, and identify factors affecting early ...

  15. Dicty_cDB: Contig-U11844-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 2 ( DV237992 ) A2FLE69TO Aedes aegypti full length cDNA library,... 32 9.1 2 ( DV284078 ) NAAG584TF Aedes aegypti - Fat Bodie...s Normalized (... 32 9.2 2 ( DV273445 ) NAAFZ58TR Aedes aegypti - Fat Bodie

  16. Dicty_cDB: Contig-U05163-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available nondirectional cD... 48 0.48 1 ( DV283772 ) NAAG406TR Aedes aegypti - Fat Bodies Normalized (... 48 0.48 1 ...( DV283771 ) NAAG406TF Aedes aegypti - Fat Bodies Normalized (... 48 0.48 1 ( DV189293 ) BCT040_A07_BCT040_3

  17. On the inverse transform of Laplace transforms that contain (products of) the parabolic cylinder function

    NARCIS (Netherlands)

    Veestraeten, D.

    2015-01-01

    The Laplace transforms of the transition probability density and distribution functions for the Ornstein-Uhlenbeck process contain the product of two parabolic cylinder functions, namely Dv(x)Dv(y) and Dv(x)Dv−1(y), respectively. The inverse transforms of these products have as yet not been

  18. 76 FR 38997 - Approval and Promulgation of Implementation Plans; State of Oregon; Regional Haze State...

    Science.gov (United States)

    2011-07-05

    ... dollars/dv cost effectiveness threshold of $10 million/dv based on what it considered the most relevant... such as a dollars/dv cost effectiveness threshold but rather on the full range of relevant factors. In... could also meet ODEQ's cost-effectiveness threshold, even if used for only a few years as in the case...

  19. An ethnographic-feminist study of Jordanian women's experiences of domestic violence and process of resolution.

    Science.gov (United States)

    Safadi, Reema; Swigart, Valerie; Hamdan-Mansour, Ayman M; Banimustafa, Radwan; Constantino, Rose E

    2013-01-01

    We interviewed 12 Jordanian women who had experienced domestic violence (DV) and were receiving assistance at the Jordanian Women's Union (JWU). Our aim was to explore the history and factors supporting attainment of freedom from DV. Narratives revealed themes of DV toward girls; forced marriage; physical, psychological, or sexual abuse before and during marriage; and escalation and enduring DV. Escaping from DV required family and JWU support. In the context of a strongly patriarchal, religious society, we observed a process of resolution by shifting cultural values and themes of empowerment, with an undercurrent of suffering blamed on inequalities in the legal process.

  20. Dicty_cDB: Contig-U15589-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available DV288387 ) NAAHZ89TF Aedes aegypti - Fat Bodies Normalized (... 111 7e-31 3 ( DW611127 ) CLJ261-B09.y1d-s S...251 Rhizopus oryzae Company Rhizopus oryz... 84 2e-29 3 ( DV279302 ) NAAF564TF Aedes aegypti - Fat Bodies No...2 ( DV281619 ) NAAGT04TF Aedes aegypti - Fat Bodies Normalized (... 74 2e-27 4 ( ...404141 ) 293792124 Nasonia vitripennis Female Pupae Nasoni... 105 3e-27 2 ( DV288878 ) NAAHH95TF Aedes aegypti - Fat Bodie...-25 7 ( DV279303 ) NAAF564TR Aedes aegypti - Fat Bodies Normalized (... 119 5e-25 2 ( GE353884 ) 289177336 N

  1. Beliefs and Recommendations Regarding Child Custody and Visitation in Cases Involving Domestic Violence: A Comparison of Professionals in Different Roles.

    Science.gov (United States)

    Saunders, Daniel G; Faller, Kathleen C; Tolman, Richard M

    2016-05-01

    Research is lacking on differing perspectives regarding custody cases involving domestic violence (DV). In a survey of judges, legal aid attorneys, private attorneys, DV program workers, and child custody evaluators (n = 1,187), judges, private attorneys, and evaluators were more likely to believe that mothers make false DV allegations and alienate their children. In response to a vignette, evaluators and private attorneys were most likely to recommend joint custody and least likely to recommend sole custody to the survivor. Legal aid attorneys and DV workers were similar on many variables. Gender, DV knowledge, and knowing victims explained many group differences. © The Author(s) 2015.

  2. Exposure to Spousal Violence in the Family, Attitudes and Dating Violence Perpetration Among High School Students in Port-au-Prince.

    Science.gov (United States)

    Gage, Anastasia J

    2016-09-01

    This study examined the associations of exposure to spousal violence in the family and personal and peer attitudes with dating violence (DV) perpetration among high school students in Port-au-Prince, Haiti. Participants were 342 high school students in Grades 10 to 12 who stated that they had ever been on a date. Multiple linear regression methods were used to examine correlates of the scale of DV perpetration. Findings showed that personal acceptance of DV mediated the association between exposure to wife-perpetrated and husband-perpetrated spousal violence in the family and DV perpetration for girls. Boys who were exposed to husband-perpetrated spousal violence in the family had significantly higher levels of psychological DV perpetration than those who were not. Contrary to expectations, exposure to wife-perpetrated spousal violence in the family was negatively associated with psychological and physical/sexual DV perpetration by boys, after controlling for other factors. Overall, perceived peer tolerance of DV was more strongly associated with DV perpetration than personal tolerance of DV, and was the only significant correlate of psychological DV perpetration for girls. Perceived peer attitudes also moderated the association between boys' exposure to spousal violence in the family and DV perpetration. Implications for future research and policy are discussed. © The Author(s) 2015.

  3. The relationship between temperament, gender, and childhood dysfunctional voiding.

    Science.gov (United States)

    Colaco, Marc; Dobkin, Roseanne D; Sterling, Matthew; Schneider, Dona; Barone, Joseph

    2013-08-01

    Dysfunctional voiding (DV) is an extremely common pediatric complaint. The goal of this study was to examine the relationship between DV and childhood temperament. Information about the voiding behaviors and temperaments of 50 children was examined using a case-control model. Caregivers were asked to fill out the Children's Behavior Questionnaire in order to rate their child on the dimensions of surgency, negative affect, and effortful control. The relationship between DV and these dimensions was then evaluated. Males with DV were found to have lower effortful control than males with normal voiding habits. Females with DV did not demonstrate a difference in effortful control, but did demonstrate a higher rate of surgency. The results suggest that temperament does have an association with DV. These findings are in line with temperamental associations with other externalizing trouble behaviors and may inform potential treatment strategies for DV.

  4. Osamocený dvůr s opevněným sídlem v pozdním středověku: Rychvald u Dřevíče (okr. Rakovník) a jeho analogie

    Czech Academy of Sciences Publication Activity Database

    Kypta, J.; Laval, Filip; Neustupný, Z.; Šimůnek, Robert

    2012-01-01

    Roč. 64, č. 3 (2012), s. 549-570 ISSN 0323-1267 Institutional support: RVO:67985912 ; RVO:67985963 Keywords : Late Middle Ages * settlement history * farmyard * construction culture * surface survey Subject RIV: AC - Archeology, Anthropology, Ethnology; AB - History (HIU-Y)

  5. Dvě tváře dětství. Malí dospělí a děti hříšníci ve středověku

    Czech Academy of Sciences Publication Activity Database

    Nodl, Martin

    2006-01-01

    Roč. 28, č. 1 (2006), s. 30-33 ISSN 0418-5129 R&D Projects: GA MŠk(CZ) LC521 Institutional research plan: CEZ:AV0Z90090514 Keywords : child hood * devotion * medieval family Subject RIV: AA - Philosophy ; Religion

  6. Comment on 'Correlative amplitude-operational phase entanglement embodied by the EPR-pair eigenstate ({eta})'[42.50.Dv Nonclassical states of the electromagnetic field, including entangled photon states; quantum state engineering and measurements; 03.65.Ud Entanglement and quantum nonlocality (e.g. EPR paradox, Bell's inequalities, GHZ states, etc.);

    Energy Technology Data Exchange (ETDEWEB)

    Luis, Alfredo [Departamento de Optica, Facultad de Ciencias Fisicas, Universidad Complutense, 28040 Madrid (Spain)

    2003-01-10

    In a recent paper in this journal Fan (Fan H 2002 J. Phys. A: Math. Gen.35 1007) discards the possibility of using a genuine phase-difference operator to investigate number-phase entanglement because of the lack of unitarity of the Susskind-Glogower phase operators. However, Fan overlooked the existence of a bona fide unitary operator exponential of the phase difference. Here we find the amplitude-phase maximally entangled states as the simultaneous eigenstates of the total number and the phase-difference operators. (comment)

  7. Comment on "Correlative amplitude-operational phase entanglement embodied by the EPR-pair eigenstate |eta) 42.50.Dv Nonclassical states of the electromagnetic field, including entangled photon states; quantum state engineering and measurements; 03.65.Ud Entanglement and quantum nonlocality (e.g. EPR paradox, Bell's inequalities, GHZ states, etc.)"

    CERN Document Server

    Luis, A

    2003-01-01

    In a recent paper in this journal Fan (Fan H 2002 J. Phys. A: Math. Gen.35 1007) discards the possibility of using a genuine phase-difference operator to investigate number-phase entanglement because of the lack of unitarity of the Susskind-Glogower phase operators. However, Fan overlooked the existence of a bona fide unitary operator exponential of the phase difference. Here we find the amplitude-phase maximally entangled states as the simultaneous eigenstates of the total number and the phase-difference operators. (comment)

  8. Reply to the comment on 'Correlative amplitude-operational phase entanglement embodied by the EPR-pair eigenstate ({eta})'[42.50.Dv Nonclassical states of the electromagnetic field, including entangled photon states; quantum state engineering and measurements; 03.65.Ud Entanglement and quantum nonlocality (e.g. EPR paradox, Bell's inequalities, GHZ states, etc.);

    Energy Technology Data Exchange (ETDEWEB)

    Fan, Hongyi [CCAST (World Laboratory), PO Box 8730, Beijing 100080, People' s Republic of (China); Hu, Haipeng [Department of Material Science and Engineering, University of Science and Technology of China, Hefei, Anhui 230026, People' s Republic of China (China)

    2003-01-10

    We compare and contrast our amplitude-phase entanglement with that of Luis in his comment. Luis's entangled state is defined in a finite Fock space. His comment on the operational phase operator seems to be contradicting the original meaning of Mandel et al. (reply)

  9. Reply to the comment on "Correlative amplitude-operational phase entanglement embodied by the EPR-pair eigenstate |eta) 42.50.Dv Nonclassical states of the electromagnetic field, including entangled photon states; quantum state engineering and measurements; 03.65.Ud Entanglement and quantum nonlocality (e.g. EPR paradox, Bell's inequalities, GHZ states, etc.)"

    CERN Document Server

    Fan, H

    2003-01-01

    We compare and contrast our amplitude-phase entanglement with that of Luis in his comment. Luis's entangled state is defined in a finite Fock space. His comment on the operational phase operator seems to be contradicting the original meaning of Mandel et al. (reply)

  10. Přístup ke spravedlnosti ve věcech životního prostředí a Soudní dvůr EU: navzdory Aarhuské úmluvě stále zavřeno

    Czech Academy of Sciences Publication Activity Database

    Müllerová, Hana

    2016-01-01

    Roč. 16, č. 2 (2016), s. 8-40 ISSN 1213-5542 Institutional support: RVO:68378122 Keywords : access to justice in environmental matters * Court of Justice of the EU * non-privileged applicants Subject RIV: AG - Legal Sciences

  11. Latinské a české verše o pražském pogromu roku 1389. Ke dvěma pozapomenutým žákovským skladbám

    Czech Academy of Sciences Publication Activity Database

    Soukup, Daniel

    2012-01-01

    Roč. 60, č. 5 (2012), s. 711-726 ISSN 0009-0468 Institutional support: RVO:68378068 Keywords : medieval student poetry * medieval parody * medieval and humanist historiography * Jews * 1389 pogrom * Passion of the Prague Jews * Matyáš/Matěj of Lehnice Subject RIV: AJ - Letters, Mass-media, Audiovision

  12. Perlecan Domain V induces VEGf secretion in brain endothelial cells through integrin α5β1 and ERK-dependent signaling pathways.

    Directory of Open Access Journals (Sweden)

    Douglas N Clarke

    Full Text Available Perlecan Domain V (DV promotes brain angiogenesis by inducing VEGF release from brain endothelial cells (BECs following stroke. In this study, we define the specific mechanism of DV interaction with the α(5β(1 integrin, identify the downstream signal transduction pathway, and further investigate the functional significance of resultant VEGF release. Interestingly, we found that the LG3 portion of DV, which has been suggested to possess most of DV's angio-modulatory activity outside of the brain, binds poorly to α(5β(1 and induces less BEC proliferation compared to full length DV. Additionally, we implicate DV's DGR sequence as an important element for the interaction of DV with α(5β(1. Furthermore, we investigated the importance of AKT and ERK signaling in DV-induced VEGF expression and secretion. We show that DV increases the phosphorylation of ERK, which leads to subsequent activation and stabilization of eIF4E and HIF-1α. Inhibition of ERK activity by U0126 suppressed DV-induced expression and secretion of VEGR in BECs. While DV was capable of phosphorylating AKT we show that AKT phosphorylation does not play a role in DV's induction of VEGF expression or secretion using two separate inhibitors, LY294002 and Akt IV. Lastly, we demonstrate that VEGF activity is critical for DV increases in BEC proliferation, as well as angiogenesis in a BEC-neuronal co-culture system. Collectively, our findings expand our understanding of DV's mechanism of action on BECs, and further support its potential as a novel stroke therapy.

  13. Generation of a non-transmissive Borna disease virus vector lacking both matrix and glycoprotein genes.

    Science.gov (United States)

    Fujino, Kan; Yamamoto, Yusuke; Daito, Takuji; Makino, Akiko; Honda, Tomoyuki; Tomonaga, Keizo

    2017-09-01

    Borna disease virus (BoDV), a prototype of mammalian bornavirus, is a non-segmented, negative strand RNA virus that often causes severe neurological disorders in infected animals, including horses and sheep. Unique among animal RNA viruses, BoDV transcribes and replicates non-cytopathically in the cell nucleus, leading to establishment of long-lasting persistent infection. This striking feature of BoDV indicates its potential as an RNA virus vector system. It has previously been demonstrated by our team that recombinant BoDV (rBoDV) lacking an envelope glycoprotein (G) gene develops persistent infections in transduced cells without loss of the viral genome. In this study, a novel non-transmissive rBoDV, rBoDV ΔMG, which lacks both matrix (M) and G genes in the genome, is reported. rBoDV-ΔMG expressing green fluorescence protein (GFP), rBoDV ΔMG-GFP, was efficiently generated in Vero/MG cells stably expressing both BoDV M and G proteins. Infection with rBoDV ΔMG-GFP was persistently maintained in the parent Vero cells without propagation within cell culture. The optimal ratio of M and G for efficient viral particle production by transient transfection of M and G expression plasmids into cells persistently infected with rBoDV ΔMG-GFP was also demonstrated. These findings indicate that the rBoDV ΔMG-based BoDV vector may provide an extremely safe virus vector system and could be a novel strategy for investigating the function of M and G proteins and the host range of bornaviruses. © 2017 The Societies and John Wiley & Sons Australia, Ltd.

  14. Drahomíra Stránská a studium lidové obuvi prostřednictvím dotazníkové akce Národopisné společnosti

    Czech Academy of Sciences Publication Activity Database

    Holubová, Markéta

    15[57]-16[58], - (1999), s. 95-98 ISSN 1211-8117. [Lidová kultura 20. století, její výzkum, dokumentace a prezentace. Věnováno 100. výročí narození doc. dr. Drahomíry Stránské. Rožnov pod Radhoštěm, 08.09.1999] Institutional research plan: CEZ:AV0Z9058907 Subject RIV: AC - Archeology, Anthropology, Ethnology

  15. Ještě ke slovu ještě

    Czech Academy of Sciences Publication Activity Database

    Nejedlý, Petr

    2016-01-01

    Roč. 8, č. 3 (2016), s. 38-48 ISSN 1803-876X. [Jazykovědný strukturalismus na počátku 21. století. Olomouc, 24.04.2014-24.04.2014] R&D Projects: GA ČR GAP406/10/1153 Institutional support: RVO:68378092 Keywords : Miroslav Komárek * lexical unit ještě (= still, yet) * grammatical analysis * lexicological analysis * lexical meaning Subject RIV: AI - Linguistics OBOR OECD: Linguistics

  16. Fotografové ve službách aristokracie. Vizuální reprezentace buquoyského panství za Jiřího Jana Jindřicha Buquoye v polovině 19. století

    Czech Academy of Sciences Publication Activity Database

    Trnková, Petra

    2011-01-01

    Roč. 59, č. 2 (2011), s. 145-160 ISSN 0049-5123 R&D Projects: GA MŠk(CZ) 7F09107 Institutional research plan: CEZ:AV0Z80330511 Keywords : Buquoy * photography * 19th century Subject RIV: AL - Art , Architecture, Cultural Heritage

  17. Socialistická propagace - reklama v podmínkách centrálně plánovaného hospodářství v Československu 70. a 80. let 20.století

    OpenAIRE

    Šimečková, Barbora

    2012-01-01

    This bachelor thesis analyses the theory and practice of socialistic advertising in the 70s and 80s od the 20th century in Czechoslovakia. The first part is based on current theories of advertising -- it analysis on the basis of of contemporary theoretical literature (textbooks for students of the Faculty of Journalism at Charles University in Prague, the magazin "Propagace") with theoretical approaches to advertising in the 70s and 80s of the last century in Czechoslovakia. The thesis states...

  18. Černá vlajka pirátů znovu nahání strach? Opatření proti pirátství a ozbrojenému lupičství na moři na začátku 21. století

    Czech Academy of Sciences Publication Activity Database

    Šturma, Pavel

    2009-01-01

    Roč. 8, č. 7 (2009), s. 193-197 ISSN 1213-5313 Institutional research plan: CEZ:AV0Z70680506 Keywords : maritime law * public international law * fight against piracy Subject RIV: AG - Legal Sciences

  19. Muži ve válce, válka v mužích. Maskulinity a světové války 20. století v současné kulturní historiografii

    Czech Academy of Sciences Publication Activity Database

    Kučera, Rudolf

    2011-01-01

    Roč. 19, č. 4 (2011), s. 549-562 ISSN 1210-7050 R&D Projects: GA ČR GPP410/10/P316 Institutional research plan: CEZ:AV0Z70900502 Keywords : World War I * World War II * masculinity, history Subject RIV: AB - History

  20. Rybník jako součást hospodářství vrchnostenského panství a indikátor podoby krajiny jižního Valašska v 15. až 17. století

    Czech Academy of Sciences Publication Activity Database

    Petřík, J.; Hlavica, M.; Petr, L.; Chmela, T.; Schenk, Z.; Lukšíková, H.; Milo, P.; Vrla, R.; Odehnal, P.; Petrůj, Z.; Petrůj, M.; Kočár, Petr

    2017-01-01

    Roč. 42, č. 2 (2017), s. 789-817 ISSN 0231-5823 Institutional support: RVO:67985912 Keywords : fish farming * southern Moravian Wallachia (Czech Republic) * late Middle Ages Subject RIV: AC - Archeology, Anthropology, Ethnology OBOR OECD: Archaeology http://hdl.handle.net/11222.digilib/137056

  1. Stromy v horském zemědělství 19. století. Historie a současnost lesozemědělských ploch v katastrálním území Velký Uhřínov

    Czech Academy of Sciences Publication Activity Database

    Krčmářová, Jana

    22/2015, 1/2 (2016), s. 13-36 ISSN 0475-0640 R&D Projects: GA ČR(CZ) GA16-15716S Institutional support: RVO:68378076 Keywords : agroforestry history * working trees * Franciscan cadaster * Czech Republic * Orlice mountains Subject RIV: AC - Archeology, Anthropology, Ethnology

  2. DIY or Die! Proměny českých a slovenských hardcore-punkových scén a fanzinů od 90. let 20. století do současnosti

    Directory of Open Access Journals (Sweden)

    Jiří Almer

    2017-01-01

    Full Text Available This study deals with the changes within Czech and Slovak hardcore-punk fanzines from the beginning of 90s up to the present time. It’s based on research into youth subculture and also on the interpretation of “independent” literature in accordance with media studies. Firstly, it analyzes marginal subculture (or scene of hardcore-punk and focuses on its production, meaning printed fanzines. Secondly the study asks whether those fanzines could be considered as “contraculture”, therefore an independent or antagonistic sphere against so called mainstream cultural production. The main object of the thesis is the enumeration of Czech and Slovak fanzines in the above mentioned period and mainly interpretations of political topics reflected in that mags, as well as their changes and corrections.

  3. Berní zatížení českého venkova v první polovině 19. století a úskalí jeho studia // The tax burden on the Czech countryside in the first half of the 19th century and some pitfalls in its studies

    Directory of Open Access Journals (Sweden)

    Jan Lhoták

    2017-08-01

    Full Text Available The paper summarises the possibilities of studying the tax burden on the Czech countryside in 1780–1850. For its analysis it proposes to use the archival collection ‘Contribution Funds’, consisting of individual schedules for the planned contributions (so-called sub-repartitions, and contributory accounts recording all receipts and outlays. Due to the limited ‘sub-repartition’ for land tax only, it recommends to use the sums in the contributory accounts and to work with values for the whole estate. The most suitable comparative figures are grain prices, preserved from commodity prices that are important for the rural environment in the most comprehensive price ranges. Both series of numbers need to be subjected to source criticism (the most important for the period under review is the variability of the currencies used and then compared with each other.

  4. Geograficko-správní staroslověnská terminologie v právních památkách 9. století a její řecké (byzantské) a latinské paralely

    Czech Academy of Sciences Publication Activity Database

    Havlíková, Lubomíra

    2009-01-01

    Roč. 5, č. 1 (2009), s. 9-20 ISSN 1803-8301 Institutional research plan: CEZ:AV0Z90920516 Keywords : history * Great Moravia * Slavonic law * Byzantine law * linguistics * terminology Subject RIV: AB - History

  5. "Krista tedy hlásat v národu svém". Několik poznámek ke kořenům a proměnám cyrilometodějství v 19. století.

    Czech Academy of Sciences Publication Activity Database

    Zobačová, Andrea

    2014-01-01

    Roč. 17, č. 1 (2014), s. 101-113 ISSN 1212-1509 Institutional support: RVO:68378076 Keywords : Saints Cyril and Methodius * church * national movement * Czech language Subject RIV: AC - Archeology, Anthropology, Ethnology

  6. G-korály v raně středověkých náhrdelnících z Čech v kontextu evropské sklářské produkce přelomu 9. a 10. století

    Czech Academy of Sciences Publication Activity Database

    Košta, J.; Tomková, Kateřina; Hulínský, V.; Zavřel, J.

    2011-01-01

    Roč. 63, č. 4 (2011), s. 586-607 ISSN 0323-1267 R&D Projects: GA AV ČR IAA800020903; GA ČR GA404/09/1135 Institutional research plan: CEZ:AV0Z80020508 Keywords : glass production * Early Middle Ages * Bohemia * beads Subject RIV: AC - Archeology, Anthropology, Ethnology

  7. Etické aspekty občanského fotožurnalismu se zaměřením na fotografické a audiovizuální záznamy od konce dvacátého století po současnost

    OpenAIRE

    Hrdličková, Lucie

    2016-01-01

    The bachelor thesis Ethical aspects of citizen photojournalism with a focus on photographic and audiovisual record from late twenties until present follows up the phenomenon of citizen journalism, which recorded especially in the last decade a sharp rise thanks to the development of information and communication technologies and looks at it from an ethical perspective. The thesis is divided into three parts. The first part deals with theoretical notions of ethics and citizen journalism, inclu...

  8. Katechismové písně a zpívané katechismy. Příspěvek jezuitů ke katolickému modu catechizandi přelomu 16. a 17. století

    Czech Academy of Sciences Publication Activity Database

    Slavický, Tomáš; Škarpová, Marie

    2011-01-01

    Roč. 26, č. 1 (2011), s. 131-141 ISSN 0231-7494 R&D Projects: GA ČR(CZ) GAP406/10/1454 Institutional research plan: CEZ:AV0Z90580513 Keywords : catechism * catechism songs * Jesuit literature * hymnography of the early modern period Subject RIV: AL - Art, Architecture, Cultural Heritage

  9. Rooseveltův muž v Trumanově době: Henry A. Wallace a jeho postoje k zahraniční politice Spojených států amerických ve 40. a 50. letech 20. století

    OpenAIRE

    Rýgrová, Pavla

    2016-01-01

    This thesis is dedicated to the rupture between Henry A. Wallace and Truman's administration during the forties of the twentieth century, that is mainly to the Wallace's disagreement with the Democratic Party regarding U. S.-Soviet relations. Disapproval of the former Roosevelt's vicepresident with the official standing of the American foreign policy ultimately lead to his presidency candidacy in 1948 and to the creation of protest Progressive Party, which was supposed to shield this candidac...

  10. Etnografie jako výzkumný nástroj na počátku 21. století. Příspěvek k diskusi o etnologické metodologii v podmínkách České republiky

    Czech Academy of Sciences Publication Activity Database

    Uherek, Zdeněk

    31 /73/, č. 1 (2014), s. 4-30 ISSN 1211-8117 Institutional support: RVO:68378076 Keywords : ethnography * ethnology * social and cultural anthropology * Czech Republic * methodology of social sciences Subject RIV: AC - Archeology, Anthropology, Ethnology

  11. Vzdělanostní mecenát Jiřího II. Lehnicko-Břežského, gymnázium v Břehu a šlechta z českých zemí v 16. a raném 17. století

    Czech Academy of Sciences Publication Activity Database

    Holý, Martin

    2015-01-01

    Roč. 70, č. 1 (2015), s. 5-19 ISSN 0037-7511 R&D Projects: GA ČR GPP405/12/P422 Institutional support: RVO:67985963 Keywords : educational patronage * Silesia * Brieg * Early Modern Period Subject RIV: AB - History

  12. Jan Vetter. Příspěvek k tématu zahraničních učeneckých kontaktů Jednoty bratrské na počátku 17. století

    Czech Academy of Sciences Publication Activity Database

    Just, Jiří

    2014-01-01

    Roč. 44, 91/92 (2014), s. 156-204 ISSN 0323-2220 R&D Projects: GA ČR GA13-08740S Institutional support: RVO:67985955 Keywords : Bohemian Brethren * religious education * correspondence networks Subject RIV: AB - History

  13. Ustanovený řád. Koncept morového řádu pro Čechy v kontextu normativních textů střední Evropy z přelomu 70. a 80. let 17. století

    Czech Academy of Sciences Publication Activity Database

    Jirková, Pavla

    2016-01-01

    Roč. 31, č. 1 (2016), s. 25-51 ISSN 0231-7494 R&D Projects: GA ČR GA13-35304S Institutional support: RVO:67985998 Keywords : plague epidemics * infection rules * normative texts Subject RIV: AH - Economics

  14. Augustiniánská knihovna u sv. Tomáše v Praze. I. část: Od založení kláštera do počátku 16. století

    Czech Academy of Sciences Publication Activity Database

    Sladká, Veronika

    2016-01-01

    Roč. 23, 1/2 (2016), s. 127-146 ISSN 1210-8510 Institutional support: RVO:67985971 Keywords : Augustinian convent of Saint Thomas in Prague * monastic libraries * provenance research * library history * librarian practice in the Order of Saint Augustine * Codex Thomaeus Subject RIV: AB - History

  15. Vyšehrad v době Karla IV. a Václava IV. Neznámá tvář královského hradu v ikonografii z počátku 17. století

    Czech Academy of Sciences Publication Activity Database

    Uličný, Petr

    2017-01-01

    Roč. 33, č. 1 (2017), s. 120-143 ISSN 0231-6056 Institutional support: RVO:68378033 Keywords : Prague * Vyšehrad Castle * palace * fortification * rotunda of St Martin * Giovanni Pieroni * Aegidius Sadeler * Roelandt Savery * Paulus van Vianen Subject RIV: AL - Art, Architecture, Cultural Heritage OBOR OECD: Arts, Art history

  16. Egyptské výtvarné umění XX. století a jeho role ve společnosti (se zaměřením na malbu a sochařství)

    OpenAIRE

    Nováková, Hana

    2011-01-01

    EGYPTIAN ART OF THE 20TH CENTURY AND ITS ROLE IN THE EGYPTIAN SOCIETY (CONCERNING THE ARTS OF PAINTING AND SCULPTURE Hana Nováková Abstract This thesis is a contribution to the research of the Egyptian Visual Arts in the 20th century. Egypt has long tradition of pre-Islamic and Islamic arts. Early in the 20th century the new phenomenon emerged - the modern Egyptian art. This term does not mean the visual art influenced by the modern Western art, but just the visual art influenced by the style...

  17. Matouš Konečný a jeho podíl na výchově a vzdělávání bratrských duchovních na počátku 17. století

    Czech Academy of Sciences Publication Activity Database

    Just, Jiří

    -, č. 18 (2016), s. 75-88 ISSN 1802-2502 R&D Projects: GA ČR GA13-08740S Institutional support: RVO:67985955 Keywords : Matouš Konečný * education of clergy * protestant ecclesiastical administration * Matthias Martini * gymnasium illustre in Bremen * peregrinatio academica * protestant schoolbooks * Bohemian Brethren Subject RIV: AB - History

  18. Sir Horatio Herbert Kitchener, pouštní železnice a britské znovudobytí Súdánu v letech 1896-1898. (Příspěvek k dějinám Britského impéria v 19. století)

    OpenAIRE

    Valkoun, Jaroslav

    2006-01-01

    Britské znovudobytí Súdánu probíhalo oficiálně od března 1896 do září 1898. Fakticky však začalo již v lednu 1885, pádem Chartúmu a smrtí generála Gordona. Tyto události se staly latentním "hnacím motorem", který vytvořil celospolečenskou oporu pro jakékoliv akce proti mahdistům, v britské společnosti. Veřejně zmiňovaným důvodem bylo potrestání teroru a násilí, kterého se derviši dopouštěli na "súdánském lidu". Oficiálním a současně i politickým důvodem k tažení byla snaha pomoci zvrátit potu...

  19. Výpověď archeologických pramenů o prostorovém vývoji jihovýchodní části Brna ve 12.–15. století na příkladu parcely někdejšího domu Josefská 7

    Czech Academy of Sciences Publication Activity Database

    Procházka, Rudolf; Zůbek, A.

    2012-01-01

    Roč. 37, č. 1 (2012), s. 189-208 ISSN 0231-5823 R&D Projects: GA ČR GA404/09/1966 Institutional research plan: CEZ:AV0Z80010507 Keywords : town * Brno * middle ages Subject RIV: AC - Archeology, Anthropology, Ethnology

  20. Listina na zápis pusté vsi Jiříkovice u Milotic z roku 1425 (K sekularizaci církevních statků na jihovýchodní Moravě v 15. a 16. století)

    Czech Academy of Sciences Publication Activity Database

    Doležel, Jiří

    2016-01-01

    Roč. 52, č. 55 (2016), s. 65-81 ISSN 0449-0436 Institutional support: RVO:68081758 Keywords : Late Middle Ages * Moravia * Hussitism * monastic estates * nobility * secularism * deserted settlements Subject RIV: AC - Archeology, Anthropology, Ethnology OBOR OECD: Archaeology

  1. Nebezpečné „veřejné“ mínění lidu v 18. století v českých zemích (Dangerous Common Opinion of People in the Czech Lands in 18th Century

    Directory of Open Access Journals (Sweden)

    Kateřina Soukalová

    2017-03-01

    Full Text Available The article deals with the advent of the formation of public opinion in the Czech lands in the end of 18th century. Specific attention focuses on the reflection of the French Revolution and its effects on the Czech environment, especially on minds of serfs. The article deals with unofficially disseminated information described by sheriffs in their reports, censorship of the press, surveys of the mood of the population and contemporary legends spread among the people. In this context, the paper shows that the given historical period gave birth to the modern public opinion in the Czech lands.

  2. "Růžová zahrádka". Rukopisné modlitební knížky 18. a 19. století. Sbírka Jana Poše. Arcidiecézní muzeum v Olomouci 19. února-3. května 2009.

    Czech Academy of Sciences Publication Activity Database

    Holubová, Markéta

    26 /68/, č. 2 (2009), s. 156-157 ISSN 1211-8117 Institutional research plan: CEZ:AV0Z90580513 Keywords : prayer book * Jan Poš * collection * 18. and 19. century Subject RIV: AC - Archeology, Anthropology, Ethnology

  3. Provensálská ves a moravská města mezi středověkem a raným novověkem. Alleins 16. století v kontextu vědeckého díla Jaroslava Marka

    Czech Academy of Sciences Publication Activity Database

    Sterneck, Tomáš

    2016-01-01

    Roč. 135, č. 2 (2016), s. 421-443 ISSN 0323-052X Institutional support: RVO:67985963 Keywords : history * historians * Jaroslav Marek Subject RIV: AB - History OBOR OECD: History (history of science and technology to be 6.3, history of specific sciences to be under the respective headings)

  4. Kroniky Jana Jiřího Millauera a Jana Eichlera a jeho syna Jana Antonína Eichlera – analýza dvou kronik měšťanů Českých Budějovic z druhé poloviny 18. století

    Czech Academy of Sciences Publication Activity Database

    Květová, Miroslava

    2017-01-01

    Roč. 85/2016, [0] (2017), s. 403-433 ISSN 0323-004X R&D Projects: GA ČR GA16-12145S Institutional support: RVO:67985921 Keywords : České Budějovice, Czech Republic * burgher chronicles Subject RIV: AB - History OBOR OECD: History (history of science and technology to be 6.3, history of specific sciences to be under the respective headings)

  5. 'Slyšme jeden strašlivý příběh': k exemplům v 17. a 18 století, zvláště v českých postilách

    Czech Academy of Sciences Publication Activity Database

    Havelka, Tomáš

    2016-01-01

    Roč. 64, č. 3 (2016), s. 341-371 ISSN 0009-0468 R&D Projects: GA ČR GB14-37038G Institutional support: RVO:67985955 Keywords : early modern bohemical literature * homiletics * exempla * postils * genology Subject RIV: AJ - Letters, Mass-media, Audiovision

  6. Významná centra na Moravě v 10. – 11. století pohledem nálezů mincí – aktuální stav poznání. I. Hradiště Staré zámky v Brně-Líšni

    Czech Academy of Sciences Publication Activity Database

    Videman, Jan

    2015-01-01

    Roč. 56, č. 2 (2015), s. 201-219 ISSN 1211-7250 R&D Projects: GA ČR GA15-22658S Keywords : Moravia * Staré zámky hillfort * coins * 10th – 11th century Subject RIV: AC - Archeology, Anthropology, Ethnology http://prehled-vyzkumu.arub.avcr.cz/miranda2/ export /sitesavcr/arub-prehled-vyzkumu/prehled-cisel-a-clanku/prehled-vydanych-cisel/files/PV56_2_studie_5_Videman.pdf

  7. Jak se detektivka stala detektivkou: Sonda do vývoje žánrového povědomí v české literární kultuře přelomu 19. a 20. století

    Czech Academy of Sciences Publication Activity Database

    Holanová, Markéta

    2017-01-01

    Roč. 65, č. 1 (2017), s. 48-71 ISSN 0009-0468 Institutional support: RVO:68378068 Keywords : Poe, Edgar Allan * Collins, Wilkie * Gaboriau, Émile * Doyle, Arthur Conan * detective prose * genre awareness * Czech literary culture Subject RIV: AJ - Letters, Mass-media, Audiovision OBOR OECD: Specific literatures

  8. Kaizl versus Bráf. Ekonomický liberalismus versus hospodářský nacionalismus v českých zemích na přelomu 19. a 20. století?

    OpenAIRE

    Slavík, Jan

    2011-01-01

    The bachelor thesis, called "Kaizl versus Bráf. Economic liberalism versus economic nationalism in Czech lands at the turn of the 19th and 20th century?", concerns with economic nationalism in Czech lands and understands it as a definite kind of protectionism. The thesis wants to prove that economic nationalism is aimed only at restriction of competition and for achieve this aim is used national question. The opposite of this interpreted economic nationalism is liberal theory, which gradually...

  9. Nechtěné „tě pic!“ Politika paměti představitelů nuceně vysídlených brněnských Němců na počátku padesátých let 20. století

    Czech Academy of Sciences Publication Activity Database

    Nosková, Jana

    2016-01-01

    Roč. 26, č. 4 (2016), s. 296-305 ISSN 0862-8351 Institutional support: RVO:68378076 Keywords : Germans * Brno * politics of memory * cultural memory * forced migration * journalism * Brünner Heimatbote Subject RIV: AC - Archeology, Anthropology, Ethnology

  10. „Medicinisches Pest-Consilium” a další lékařská pojednání publikovaná s podporou úředních autorit v habsburské monarchii v druhé polovině 17. století

    Czech Academy of Sciences Publication Activity Database

    Jirková, Pavla

    2017-01-01

    Roč. 50, č. 2 (2017), s. 122-140 ISSN 0300-4414 R&D Projects: GA ČR GA13-35304S Institutional support: RVO:67985998 Keywords : plague * epidemics * medicine Subject RIV: AB - History OBOR OECD: History (history of science and technology to be 6.3, history of specific sciences to be under the respective headings)

  11. Neoliberální politika a špatné ekonomické výsledky programů masové privatizace v post-komunistických státech v 90. letech 20. století

    Czech Academy of Sciences Publication Activity Database

    Vojtíšková, Kateřina

    -, - (2012) ISSN 1213-1792 Institutional support: RVO:68378025 Keywords : mass privatisation * post-communist countries * economic performance Subject RIV: AO - Sociology, Demography http://www.blisty.cz/art/63551.html

  12. Náhrdelníky byzantského (?) původu a bronzové kruhové ozdoby ve slovanském prostředí 6.-7. století. K interkulturním vztahům

    Czech Academy of Sciences Publication Activity Database

    Profantová, Naďa

    2013-01-01

    Roč. 104, prosinec (2013), s. 149-182 ISSN 0031-0506 R&D Projects: GA ČR(CZ) GAP405/10/2289 Institutional support: RVO:67985912 Keywords : Culture with Prague-type pottery * Bohemia * metal necklace * female ornaments * interregional contacts Subject RIV: AC - Archeology, Anthropology, Ethnology

  13. Narativy křížových výprav v českých středoškolských učebnicích dějepisu 20. století

    OpenAIRE

    Kroupová, Pavlína

    2014-01-01

    This thesis deals with different narratives of the crusades found in czech high school history textbooks published during the 20th century. The paper shows various narrative strategies, use of languages and figures of speech that allow for many different points of view and a wide range of explanations of the same historical material. The paper is grounded in the historical narrativism paradigm and organized as follows: the first chapter introduces the theoretical background of narrativism, th...

  14. Human T Lymphocytes Are Permissive for Dengue Virus Replication.

    Science.gov (United States)

    Silveira, Guilherme F; Wowk, Pryscilla F; Cataneo, Allan H D; Dos Santos, Paula F; Delgobo, Murilo; Stimamiglio, Marco A; Lo Sarzi, Maria; Thomazelli, Ana Paula F S; Conchon-Costa, Ivete; Pavanelli, Wander R; Antonelli, Lis R V; Báfica, André; Mansur, Daniel S; Dos Santos, Claudia N Duarte; Bordignon, Juliano

    2018-05-15

    Dengue virus (DV) infection can cause either a self-limiting flu-like disease or a threatening hemorrhage that may evolve to shock and death. A variety of cell types, such as dendritic cells, monocytes, and B cells, can be infected by DV. However, despite the role of T lymphocytes in the control of DV replication, there remains a paucity of information on possible DV-T cell interactions during the disease course. In the present study, we have demonstrated that primary human naive CD4 + and CD8 + T cells are permissive for DV infection. Importantly, both T cell subtypes support viral replication and secrete viable virus particles. DV infection triggers the activation of both CD4 + and CD8 + T lymphocytes, but preactivation of T cells reduces the susceptibility of T cells to DV infection. Interestingly, the cytotoxicity-inducing protein granzyme A is highly secreted by human CD4 + but not CD8 + T cells after exposure to DV in vitro Additionally, using annexin V and polycaspase assays, we have demonstrated that T lymphocytes, in contrast to monocytes, are resistant to DV-induced apoptosis. Strikingly, both CD4 + and CD8 + T cells were found to be infected with DV in acutely infected dengue patients. Together, these results show that T cells are permissive for DV infection in vitro and in vivo , suggesting that this cell population may be a viral reservoir during the acute phase of the disease. IMPORTANCE Infection by dengue virus (DV) causes a flu-like disease that can evolve to severe hemorrhaging and death. T lymphocytes are important cells that regulate antibody secretion by B cells and trigger the death of infected cells. However, little is known about the direct interaction between DV and T lymphocytes. Here, we show that T lymphocytes from healthy donors are susceptible to infection by DV, leading to cell activation. Additionally, T cells seem to be resistant to DV-induced apoptosis, suggesting a potential role as a viral reservoir in humans. Finally, we show

  15. Fixing broken bones and broken homes: domestic violence as a patient safety issue.

    Science.gov (United States)

    Cohn, Felicia; Rudman, William J

    2004-11-01

    Domestic violence (DV) is a significant problem in terms of both patient harm and cost. To better address this problem, the diagnosis and treatment of DV are considered within the emerging model of patient safety and medical error reduction. The case of a female patient who presents in the clinical setting following an incident of DV shows how medical errors can be analyzed as they are in medical cases not involving DV, such as when a person with abdominal pain is sent away from the emergency department with instructions to take an acid reducer and later suffers a burst appendix. A number of factors inhibit the correct diagnosis and treatment of DV victims seeking additional treatment. Physicians often fail to screen for DV, misidentify symptoms, or deny the possibility of underlying DV, and patients often hide the symptoms and refuse to admit the problem. However, human factor errors related to knowledge, cultural norms, and individual biases; organizational factors, including lack of training and reimbursement; and technology factors related to information accessibility appear to play significant roles. Failure to diagnose or adequately address DV can be interpreted as medical errors. Addressing DV requires a systemic response, which might begin with integrating education and training about DV into the clinical setting, ensuring the use of existing screening tools, and providing adequate and appropriate reimbursement levels.

  16. Association between domestic violence and HIV serostatus among married and formerly married women in Kenya.

    Science.gov (United States)

    Onsomu, Elijah O; Abuya, Benta A; Okech, Irene N; Rosen, David L; Duren-Winfield, Vanessa; Simmons, Amber C

    2015-01-01

    The prevalence of both domestic violence (DV) and HIV among Kenyan women is known to be high, but the relationship between them is unknown. Nationally representative cross-sectional data from married and formerly married (MFM) women responding to the Kenya Demographic and Health Survey 2008/2009 were analyzed adjusting for complex survey design. Multivariable logistic regressions were used to assess the covariate-adjusted associations between HIV serostatus and any reported DV as well as four constituent DV measures: physical, emotional, sexual, and aggravated bodily harm, adjusting for covariates entered into each model using a forward stepwise selection process. Covariates of a priori interest included those representing marriage history, risky sexual behavior, substance use, perceived HIV risk, and sociodemographic characteristics. The prevalence of HIV among MFM women was 10.7% (any DV: 13.1%, no DV: 8.6%); overall prevalence of DV was 43.4%. Among all DV measures, only physical DV was associated with HIV (11.9%; adjusted odds ratio: 2.01, p <.05). Efforts by the government and women's groups to monitor and improve policies to reduce DV, such as the Sexual Offences Act of 2006, are urgently needed to curb HIV, as are policies that seek to provide DV counseling and treatment to MFM women.

  17. Domestic violence in pregnant adolescents: Characterization of the partners and prevalence of the different forms of expression

    Directory of Open Access Journals (Sweden)

    Monterrosa-Castro, Álvaro

    2017-01-01

    Full Text Available Introduction: Pregnancy in adolescents and domestic violence (DV are worldwide problems. Their prevalence is influenced by cultural factors. Objectives: To characterize pregnant adolescents and their sexual partners, and to determine the prevalence of psychological, physical and sexual DV. Methodology: Cross-sectional study of 406 Colombian pregnant teenagers. Socio-demographic data were collected, and the scales “Are you being abused?” and “Abuse Assessment Screen” were applied. The former identifies domestic violence by the partner, and the latter, DV at any moment, the last year or during pregnancy. Results: Age: 16.5 ± 1.5 years, 92.9 % were in late adolescence, average years of schooling: nine; 50 % dropped out from school when they became pregnant; 70 % depended on their parents, both before and after pregnancy. DV by the partner: 7.1 %; physical DV: 6.7 %; psychological DV: 3.7 %; sexual DV: 2.2 %. DV by partner/husband/other person: 12.4 %; physical or emotional abuse by partner/another person: 21.7 %; fear from the partner: 3.4 %. There was significant association between alcohol consumption by the partner every weekend and DV. Conclusion: Frequency of DV against pregnant adolescents is high and alcohol consumption by the partner is an important risk factor for it.

  18. Association of Domestic Violence Against Women With Sociodemographic Factors, Clinical Features, and Dissociative Symptoms in Patients Who Receive Services From Psychiatric Outpatient Units in Turkey.

    Science.gov (United States)

    Kotan, Zeynep; Kotan, Vahap Ozan; Yalvaç, Hayriye Dilek; Demir, Sibel

    2017-04-01

    Domestic violence (DV) against women is a serious problem with its negative effects on all family members and the society. Women exposed to DV not only have physical but also psychological damage. This study investigates prevalence of DV and its relations with some descriptive and clinical features in a psychiatric outpatient population in Turkey. A total of 277 female outpatients were included in the study. After a semistructured clinical interview, they were assessed by sociodemographic data form, DV questionnaire, Hamilton Depression Rating Scale (HDRS), Hamilton Anxiety Rating Scale (HARS), Dissociative Experiences Scale (DES), and Somatoform Dissociation Questionnaire (SDQ). Prevalence of exposure to DV by intimate partner is found to be 58.8% ( n = 163). The current study provided strong evidence that occupation status of the woman, education level of the partner, and family type are predictors of DV. Another predictor of DV exists where the child is battered by either parent. Prevalence of depression, conversion disorder, and other somatoform disorders are higher in women exposed to DV. These women also have higher scores from HDRS, HARS, DES, and SDQ compared with female patients who have not experienced DV ( p < .001). Number of women scoring above cutoff levels for DES and SDQ were significantly higher in women exposed to DV ( p < .001).

  19. Dual function of the nuclear export signal of the Borna disease virus nucleoprotein in nuclear export activity and binding to viral phosphoprotein.

    Science.gov (United States)

    Yanai, Mako; Sakai, Madoka; Makino, Akiko; Tomonaga, Keizo

    2017-07-11

    Borna disease virus (BoDV), which has a negative-sense, single-stranded RNA genome, causes persistent infection in the cell nucleus. The nuclear export signal (NES) of the viral nucleoprotein (N) consisting of leucine at positions 128 and 131 and isoleucine at positions 133 and 136 overlaps with one of two predicted binding sites for the viral phosphoprotein (P). A previous study demonstrated that higher expression of BoDV-P inhibits nuclear export of N; however, the function of N NES in the interaction with P remains unclear. We examined the subcellular localization, viral polymerase activity, and P-binding ability of BoDV-N NES mutants. We also characterized a recombinant BoDV (rBoDV) harboring an NES mutation of N. BoDV-N with four alanine-substitutions in the leucine and isoleucine residues of the NES impaired its cytoplasmic localization and abolished polymerase activity and P-binding ability. Although an alanine-substitution at position 131 markedly enhanced viral polymerase activity as determined by a minigenome assay, rBoDV harboring this mutation showed expression of viral RNAs and proteins relative to that of wild-type rBoDV. Our results demonstrate that BoDV-N NES has a dual function in BoDV replication, i.e., nuclear export of N and an interaction with P, affecting viral polymerase activity in the nucleus.

  20. An examination of the factors related to dating violence perpetration among young men and women and associated theoretical explanations: a review of the literature.

    Science.gov (United States)

    Dardis, Christina M; Dixon, Kristiana J; Edwards, Katie M; Turchik, Jessica A

    2015-04-01

    This article provides a review of the literature on dating violence (DV) perpetration, specifically sex similarities and differences in the correlates and predictors of DV perpetration and the utility of current theories to explain young men's and women's DV perpetration. Overall, many of the correlates and predictors of DV perpetration are similar among young men and women (e.g., witnessing interparental violence, experiencing child abuse, alcohol abuse, traditional gender roles, relationship power dynamics). However, young women's perpetration of DV is more strongly related to internalizing symptoms (e.g., depression), trait anger and hostility, and experiencing DV victimization than young men's perpetration, whereas young men's perpetration of DV is more consistently related to lower socioeconomic status and educational attainment, antisocial personality characteristics, and increased relationship length than young women's perpetration. Each theory offers insights into but does not fully account for the correlates and predictors of DV perpetration. Sociocultural theories may be useful in explaining the use of coercive control in relationships, and learning/intergenerational transmission of violence theories may be useful in explaining bidirectional couple violence. Future research should focus on integrative theories, such as in the social-ecological theory, in order to explain various forms of DV. Our understanding of young men's and young women's DV perpetration is limited by cross-sectional research designs, methodological inconsistencies, a lack of sex-specific analytic approaches, and a lack of focus on contextual factors; more multivariate and longitudinal studies are needed. Further, as DV prevention programming is often presented in mixed-sex formats, a critical understanding of sex differences and similarities in DV perpetration could ultimately refine and improve effectiveness of programming efforts aimed at reducing DV. © The Author(s) 2014.

  1. Simplified quantification of nicotinic receptors with 2[18F]F-A-85380 PET

    International Nuclear Information System (INIS)

    Mitkovski, Sascha; Villemagne, Victor L.; Novakovic, Kathy E.; O'Keefe, Graeme; Tochon-Danguy, Henri; Mulligan, Rachel S.; Dickinson, Kerryn L.; Saunder, Tim; Gregoire, Marie-Claude; Bottlaender, Michel; Dolle, Frederic; Rowe, Christopher C.

    2005-01-01

    Introduction: Neuronal nicotinic acetylcholine receptors (nAChRs), widely distributed in the human brain, are implicated in various neurophysiological processes as well as being particularly affected in neurodegenerative conditions such as Alzheimer's disease. We sought to evaluate a minimally invasive method for quantification of nAChR distribution in the normal human brain, suitable for routine clinical application, using 2[ 18 F]F-A-85380 and positron emission tomography (PET). Methods: Ten normal volunteers (four females and six males, aged 63.40±9.22 years) underwent a dynamic 120-min PET scan after injection of 226 MBq 2[ 18 F]F-A-85380 along with arterial blood sampling. Regional binding was assessed through standardized uptake value (SUV) and distribution volumes (DV) obtained using both compartmental (DV 2CM ) and graphical analysis (DV Logan ). A simplified approach to the estimation of DV (DV simplified ), defined as the region-to-plasma ratio at apparent steady state (90-120 min post injection), was compared with the other quantification approaches. Results: DV Logan values were higher than DV 2CM . A strong correlation was observed between DV simplified , DV Logan (r=.94) and DV 2CM (r=.90) in cortical regions, with lower correlations in thalamus (r=.71 and .82, respectively). Standardized uptake value showed low correlation against DV Logan and DV 2CM . Conclusion: DV simplified determined by the ratio of tissue to metabolite-corrected plasma using a single 90- to 120-min PET acquisition appears acceptable for quantification of cortical nAChR binding with 2[ 18 F]F-A-85380 and suitable for clinical application

  2. Sexual Safety Planning as an HIV Prevention Strategy for Survivors of Domestic Violence.

    Science.gov (United States)

    Foster, Jill; Núñez, Ana; Spencer, Susan; Wolf, Judith; Robertson-James, Candace

    2016-06-01

    Victims of domestic violence (DV) are not only subject to physical and emotional abuse but may also be at increased risk for less recognized dangers from infection with human immunodeficiency virus (HIV) and other sexually transmitted pathogens. Because of the close link between DV and sexual risk, women need to be educated about the consequences of acquiring a life-threatening sexually transmitted infection, risk reduction measures, and how to access appropriate HIV services for diagnosis and treatment. It is therefore critical for DV workers to receive sufficient training about the link between DV and HIV risk so that sexual safety planning can be incorporated into activities with their clients in the same way as physical safety plans. In this article, we discuss how the Many Hands Working Together project provides interactive training for workers in DV and DV-affiliated agencies to increase their knowledge about HIV and teach sexual safety planning skills to achieve HIV risk reduction.

  3. Dicty_cDB: SHI783 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 34, mRNA sequence. 42 5.0 1 DV288069 |DV288069.1 NAAHW80TF Aedes aegypti - Fat Bodie...583TR Aedes aegypti - Fat Bodies Normalized (NAFFB2) Aedes aegypti cDNA clone NAAG583, mRNA sequence. 42 5.0... 1 DV284076 |DV284076.1 NAAG583TF Aedes aegypti - Fat Bodies Normalized (NAFFB2) ...Aedes aegypti cDNA clone NAAG583, mRNA sequence. 42 5.0 1 DV276964 |DV276964.1 NAAFQ66TR Aedes aegypti - Fat Bodie...AAFQ66TF Aedes aegypti - Fat Bodies Normalized (NAFFB2) Aedes aegypti cDNA clone NAAFQ66, mRNA sequence. 42

  4. Dicty_cDB: Contig-U10208-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 0.97 2 ( DV285001 ) NAAIC55TF Aedes aegypti - Fat Bodies Normalized (... 32 1.0 3 ( CR318626 ) Zebrafish DNA...F T37 testes subtractive Aedes aegypti... 32 1.3 3 ( DV286020 ) NAAI485TF Aedes aegypti - Fat Bodie...ti cDNA ... 32 1.4 3 ( DV276168 ) NAAHD62TF Aedes aegypti - Fat Bodies Normalized... (... 32 1.4 3 ( DV290027 ) NAAHO86TF Aedes aegypti - Fat Bodies Normalized (... 32 1.4 3 ( DV434601 ) NADCW...8 ) NADA239TF Aedes aegypti infected with Dengue viru... 32 1.6 3 ( DV283216 ) NAAGJ68TF Aedes aegypti - Fat Bodie

  5. Stěžejní východiska a koncepce současné anglické náboženské pedagogiky

    Directory of Open Access Journals (Sweden)

    Karim Sidibe

    2017-08-01

    Full Text Available Tento článek si klade za cíl analyzovat didaktické koncepce výuky náboženství pěti hlavních teoretiků současné anglické náboženské pedagogiky, Harolda Loukese, Niniana Smarta, Davida Haye, Cliva Errickera a Andrewa Wrighta. Loukes a Smart položili základy současné náboženské pedagogiky v Anglii v 60. letech 20. století. Loukes využil poznatky vývojové psychologie a Smart výuku sekularizoval. Hayovo pojetí z 80. let 20. století akcentuje niternou duchovní skutečnost žáků. V současné době Erricker aplikuje postmoderní filosofická východiska na výuku a akcentuje individualitu a nezávislost žáků, zatímco Wright vychází z filosofických východisek kritického realismu a akcentuje nutnost teologické a filosofické diskuze na hodinách náboženství.

  6. Slovinské národní divadlo v Lublani

    OpenAIRE

    Semela, Ladislav

    2010-01-01

    Řešením nové scény Slovinského Národního Divadla v Lublani sleduji i motto projektu „TACE“ (Theatre Architecture in Central Europe), tedy hledání formy a typu objektu pro "Nové Divadlo 21. století“. V rámci Workshopu konaného v březnu 2009 v Lublani, vznikly různé směry řešení včetně utopistických. Konfrontuji tedy tři témata: 1/ konvenční kukátkovou koncepci pro činohru „Národního Divadla“, 2/ nekonvenční řešení „Nového Divadla pro 21. století“ a 3/ urbanistický koncept dané lokality, tzv. „...

  7. The changes in Doppler indices of fetal ductus venosus and umbilical artery after amnioinfusion for women with preterm premature rupture of membranes before 26 weeks' gestation.

    Science.gov (United States)

    Hsu, Te-Yao; Hsu, Jenn-Jeih; Fu, Hung-Chun; Ou, Chia-Yu; Tsai, Chih-Chang; Cheng, Bi-Hua; Fang, Fu-Min; Kao, Hui-Fen; Yang, Chun-Yuh; Tsai, Wen Lin; Sung, Chuen Chu; Tsai, Men-Yi

    2009-09-01

    To investigate the changes in Doppler indices of the fetal ductus venosus (DV) and umbilical artery (UMA) after amnioinfusion in pregnant women with preterm premature rupture of membranes (pPROM). Pregnancies with pPROM and severe oligohydramnios cause sequelae in newborns and mothers. This cross-sectional study included a group of 25 patients with pPROM before 26 weeks' gestation. Color Doppler imaging was used to measure the impedance index and quantitative blood flow in the DV and systolic/diastolic ratio (S/D) of the UMA before and 30 minutes after the end of amnioinfusion. The following velocity parameters were measured: (1) DV peak systolic velocity; (2) DV time-averaged velocity; (3) DV maximum forward velocity during atrial contraction; (4) DV S/D; (5) DV pulsatility index (PI); (6) DV Pourcelots resistance index (RI); (7) fetal heart rate; and (8) UMA S/D. Twenty-one of the 25 patients underwent a total of 27 amnioinfusions. The mean PI and RI of the DV, and S/D of the DV and UMA decreased significantly after amnioinfusion (PI, 0.75 +/- 0.24 vs. 0.60 +/- 0.18, p = 0.009; RI, 0.60 +/- 0.15 vs. 0.50 +/- 0.13; DV S/D, 3.07 +/- 1.81 vs. 2.13 +/- 0.66, p = 0.008; UMA S/D, 3.58 +/- 0.87 vs. 2.88 +/- 0.62, p = 0.001). Amnioinfusion increases the space for the fetuses and reduces the impedance of the fetoplacental circulation. Improvements in DV and UMA flow may benefit fetuses suffering severe oligohydramnios in mid-pregnancy.

  8. Prevalence and associated factors of domestic violence among pregnant women attending routine antenatal care in Nepal.

    Science.gov (United States)

    Rishal, Poonam; Pun, Kunta Devi; Darj, Elisabeth; Joshi, Sunil Kumar; Bjørngaard, Johan Håkon; Swahnberg, Katarina; Schei, Berit; Lukasse, Mirjam

    2017-08-01

    The primary aim of this study was to assess the prevalence of domestic violence (DV) and its associated factors among pregnant women in Nepal. The secondary aims were to investigate disclosure of DV by women to health-care personnel and to assess whether health-care personnel had asked women about their experience of DV. This cross-sectional study included 2004 pregnant women between 12 and 28 weeks of gestation attending routine antenatal care at two hospitals in Nepal from August 2014 to November 2015. In this study, DV was defined as fear of a family member and/or an experience of physical, emotional or sexual violence. Associated risk factors were analysed using logistic regression analyses. Twenty-one per cent of the women had experienced DV; 12.5% experienced fear only, 3.6% violence only and 4.9% experienced both violence and fear. Less than 2% per cent reported physical violence during pregnancy. This study found that just 17.7% had ever been asked by health-care personnel about DV, and of the women who had reported DV, only 9.5% had disclosed their experience to health-care personnel. Women of young age and low socio-economic status were more likely to have experienced DV. Women who reported having their own income and the autonomy to use it were at significantly lower risk of DV compared to women with no income. A substantial proportion of women reported having experienced DV. Victims had rarely disclosed their experience of DV to health-care personnel. This study underlines the importance of integrating systematic assessment of DV in antenatal care.

  9. How Well Does the World Health Organization Definition of Domestic Violence Work for India?

    Science.gov (United States)

    Kalokhe, Ameeta S.; Potdar, Ratnaprabha R.; Stephenson, Rob; Dunkle, Kristin L.; Paranjape, Anuradha; del Rio, Carlos; Sahay, Seema

    2015-01-01

    Domestic violence (DV) is reported by 40% of married women in India and associated with substantial morbidity. An operational research definition is therefore needed to enhance understanding of DV epidemiology in India and inform DV interventions and measures. To arrive at a culturally-tailored definition, we aimed to better understand how definitions provided by the World Health Organization and the 2005 India Protection of Women from Domestic Violence Act match the perceptions of behaviors constituting DV among the Indian community. Between September 2012 and January 2013, 16 key informant interviews with experts in DV and family counseling and 2 gender-concordant focus groups of lay community members were conducted in Pune, India to understand community perceptions of the definition of DV, perpetrators of DV, and examples of DV encountered by married women in Pune, India. Several key themes emerged regarding behaviors and acts constituting DV including 1) the exertion of control over a woman’s reproductive decision-making, mobility, socializing with family and friends, finances, and access to food and nutrition, 2) the widespread acceptance of sexual abuse and the influences of affluence on sexual DV manifestations, 3) the shaping of physical abuse experiences by readily-available tools and the presence of witnesses, 4) psychological abuse for infertility, dowry, and girl-children, and 5) the perpetration of DV by the husband and other members of his family. Findings support the need for a culturally-tailored operational definition that expands on the WHO surveillance definition to inform the development of more effective DV intervention strategies and measures. PMID:25811374

  10. How well does the World Health Organization definition of domestic violence work for India?

    Directory of Open Access Journals (Sweden)

    Ameeta S Kalokhe

    Full Text Available Domestic violence (DV is reported by 40% of married women in India and associated with substantial morbidity. An operational research definition is therefore needed to enhance understanding of DV epidemiology in India and inform DV interventions and measures. To arrive at a culturally-tailored definition, we aimed to better understand how definitions provided by the World Health Organization and the 2005 India Protection of Women from Domestic Violence Act match the perceptions of behaviors constituting DV among the Indian community. Between September 2012 and January 2013, 16 key informant interviews with experts in DV and family counseling and 2 gender-concordant focus groups of lay community members were conducted in Pune, India to understand community perceptions of the definition of DV, perpetrators of DV, and examples of DV encountered by married women in Pune, India. Several key themes emerged regarding behaviors and acts constituting DV including 1 the exertion of control over a woman's reproductive decision-making, mobility, socializing with family and friends, finances, and access to food and nutrition, 2 the widespread acceptance of sexual abuse and the influences of affluence on sexual DV manifestations, 3 the shaping of physical abuse experiences by readily-available tools and the presence of witnesses, 4 psychological abuse for infertility, dowry, and girl-children, and 5 the perpetration of DV by the husband and other members of his family. Findings support the need for a culturally-tailored operational definition that expands on the WHO surveillance definition to inform the development of more effective DV intervention strategies and measures.

  11. How well does the World Health Organization definition of domestic violence work for India?

    Science.gov (United States)

    Kalokhe, Ameeta S; Potdar, Ratnaprabha R; Stephenson, Rob; Dunkle, Kristin L; Paranjape, Anuradha; Del Rio, Carlos; Sahay, Seema

    2015-01-01

    Domestic violence (DV) is reported by 40% of married women in India and associated with substantial morbidity. An operational research definition is therefore needed to enhance understanding of DV epidemiology in India and inform DV interventions and measures. To arrive at a culturally-tailored definition, we aimed to better understand how definitions provided by the World Health Organization and the 2005 India Protection of Women from Domestic Violence Act match the perceptions of behaviors constituting DV among the Indian community. Between September 2012 and January 2013, 16 key informant interviews with experts in DV and family counseling and 2 gender-concordant focus groups of lay community members were conducted in Pune, India to understand community perceptions of the definition of DV, perpetrators of DV, and examples of DV encountered by married women in Pune, India. Several key themes emerged regarding behaviors and acts constituting DV including 1) the exertion of control over a woman's reproductive decision-making, mobility, socializing with family and friends, finances, and access to food and nutrition, 2) the widespread acceptance of sexual abuse and the influences of affluence on sexual DV manifestations, 3) the shaping of physical abuse experiences by readily-available tools and the presence of witnesses, 4) psychological abuse for infertility, dowry, and girl-children, and 5) the perpetration of DV by the husband and other members of his family. Findings support the need for a culturally-tailored operational definition that expands on the WHO surveillance definition to inform the development of more effective DV intervention strategies and measures.

  12. A Gas-Kinetic Scheme for Turbulent Flow

    Science.gov (United States)

    2014-09-19

    is dΞ = dv1dv2dv3 dξ and: ψ = [ 1 v1 v2 v3 1 2 ( ui 2 + ξ2 )]T . (2) The numerical fluxes F related to a unit interface length normal to direction n... Rockets , 44(6):1232–1240. [Mandal and Deshpande, 1994] Mandal, J. and Desh- pande, S. (1994). Kinetic flux vector splitting for Euler equations. Comput

  13. Associations among Depressive Symptoms, Dating Violence, and Relationship Power in Urban, Adolescent Girls

    Science.gov (United States)

    Volpe, Ellen M.; Hardie, Thomas L.; Cerulli, Catherine

    2013-01-01

    Objective To explore the associations among dating violence (DV), aggression, relationship power, and depressive symptoms. Design A cross-sectional survey secondary analysis. Setting An urban, school based health center, October, 2009 through May, 2009. Participants Low income, adolescent girls (n= 155), ages 14–18. Methods Descriptive and bivariate analyses were conducted to illustrate patterns and associations among variables. Key variables included depressive symptoms, DV victimization and aggression, and relationship power. We used mediation analyses to determine the direct and indirect effects among variables. Results Both DV victimization and aggression were reported frequently. Furthermore, DV victimization had a significant direct effect on depression and an indirect effect through relationship power. Depressive symptoms and relationship power were associated with DV aggression. Although relationship power did have a significant inverse effect on depressive symptoms, it was not through DV aggression. Conclusions Complex associations remain between mental health and DV; however, relationship power partially accounts for DV victimization's effect on depressive symptoms. Depressive symptoms are associated with DV victimization and aggression; therefore, nurses should address relationship power in clinical and community interventions. PMID:22697267

  14. The Equation Δ u + ∇φ· ∇u = 8πc(1-heu) on a Riemann Surface

    International Nuclear Information System (INIS)

    Wang Meng

    2009-12-01

    Let M be a compact Riemann surface, h(x) a positive smooth function on M, and φ(x) a smooth function on M which satisfies that ∫ M e φ dV g = 1. In this paper, we consider the functional J(u) = 2 1 ∫ M |∇u| 2 e φ dV g +8πc ∫ M ue φ dV g -8πclog ∫ M he u+φ dV g . We give a sufficient condition under which J achieves its minimum for c ≤ inf xelement ofM Φ(x). (author)

  15. Domestic violence against women in India: A systematic review of a decade of quantitative studies.

    Science.gov (United States)

    Kalokhe, Ameeta; Del Rio, Carlos; Dunkle, Kristin; Stephenson, Rob; Metheny, Nicholas; Paranjape, Anuradha; Sahay, Seema

    2017-04-01

    Domestic violence (DV) is prevalent among women in India and has been associated with poor mental and physical health. We performed a systematic review of 137 quantitative studies published in the prior decade that directly evaluated the DV experiences of Indian women to summarise the breadth of recent work and identify gaps in the literature. Among studies surveying at least two forms of abuse, a median 41% of women reported experiencing DV during their lifetime and 30% in the past year. We noted substantial inter-study variance in DV prevalence estimates, attributable in part to different study populations and settings, but also to a lack of standardisation, validation, and cultural adaptation of DV survey instruments. There was paucity of studies evaluating the DV experiences of women over age 50, residing in live-in relationships, same-sex relationships, tribal villages, and of women from the northern regions of India. Additionally, our review highlighted a gap in research evaluating the impact of DV on physical health. We conclude with a research agenda calling for additional qualitative and longitudinal quantitative studies to explore the DV correlates proposed by this quantitative literature to inform the development of a culturally tailored DV scale and prevention strategies.

  16. The increase in domestic violence in Brazil from 2009-2014.

    Science.gov (United States)

    Rodrigues, Nádia Cristina Pinheiro; O'Dwyer, Gisele; Andrade, Mônica Kramer de Noronha; Flynn, Matthew Brian; Monteiro, Denise Leite Maia; Lino, Valéria Teresa Saraiva

    2017-09-01

    In recent decades, the rise violent phenomena in Brazil has reached epidemic proportions. However, the prevalence of domestic violence (DV) across different states in the country is not well established. The objective of this study was to describe the distribution of DV across Brazilian states from 2009 to 2014. An ecological study based on spatial analysis techniques was performed using Brazilian states as geographical units of analysis. A multilevel Poisson model was used to explain the risk of DV in Brazil according to age, sex, period (fixed effects), the Human Developing Index, and the victim's residence state (random effects). The overall average rate of DV almost tripled from 2009-2010 to 2013-2014. The rate of DV in Brazil in the 2013-2014 period was 3.52 times greater than the 2009-2010 period. The risk of DV in men was 74% lower than in women. The increase of DV against women during period under study occurred mainly in the Southeast, South, and Midwest. DV was more frequent in adolescence and adulthood. DV is gradually increasing in recent years in Brazil. More legislation and government programs are needed to combat the growth of violence in society.

  17. Ectoparasitic hematophagous dipters: potential reservoirs of dengue virus?

    Science.gov (United States)

    Setién, Álvaro Aguilar; Baltazar, Anahí García; Leyva, Ignacio Olave; Rojas, Mónica Salas; Koldenkova, Vadim Pérez; García, Mariem Pérez-Peña; Ceballos, Nidia Aréchiga; Romero, Guillermo Gálvez; Villegas, Edgar Olivier López; Malacara, Juan Bibiano Morales; Marín, Cenia Almazán

    2017-01-01

    Recently, the presence of antibodies and dengue virus (DV) RNA in neotropical wild mammals, including Desmodus rotundus, was reported. In a previous study, DV was also found in a high percentage (39.6%) of ectoparasitic hematophagous dipters specifics of these hematophagous bats. In order to verify the susceptibility of these ectoparasites to DV, in this work experimental infections with VD2 of organs explants of Strebla wiedemanni and of Melophagus ovinus were performed using C6/36 cells as control. Viral titers (UFP/mL) were determined at 0, 48 and 96 hrs pi. Infected organs were observed by electron microscopy and under the confocal microscopy indirect immunofluorescence (IIF) using specific conjugates against DV. The infected organs of both species of ectoparasites replicated DV at titers similar to those obtained with the C6/36 cell line (≥10 6 UFP/mL). Electron microscopy and IIF showed DV replication in the digestive tract, tracheoles, reproductive organs of males but not in females, and milk glands (MG) of both species. In the fatty bodies of the MG of M. ovinus, zones with a high affinity for the DV were observed. In this work the susceptibility of S. wiedemanni and M. ovinus to DV was demonstrated and consequently the probable role of this ectoparasites as wild reservoirs of DV. Copyright: © 2017 SecretarÍa de Salud.

  18. Double Jeopardy: Insurance, Animal Harm, and Domestic Violence.

    Science.gov (United States)

    Signal, Tania; Taylor, Nik; Burke, Karena J; Brownlow, Luke

    2018-05-01

    Although the role of companion animals within the dynamic of domestic violence (DV) is increasingly recognized, the overlap of animal harm and insurance discrimination for victims/survivors of DV has not been considered. Prompted by a case study presented in a National Link Coalition LINK-Letter, this research note examines "Pet Insurance" policies available in Australia and whether nonaccidental injury caused by an intimate partner would be covered. We discuss the implications of exclusion criteria for victims/survivors of DV, shelters providing places for animals within a DV dynamic, and, more broadly, for cross- or mandatory-reporting (of animal harm) initiatives.

  19. Medical students' clinical performance of dealing with patients in the context of domestic violence.

    Science.gov (United States)

    Kong, Hyun-Hee; Im, Sunju; Seo, Ji-Hyun; Kim, Do-Kyong; Roh, HyeRin

    2018-03-01

    The aim of this study was to inquire about the clinical performance and determine the performance pattern of medical students in standardized patient (SP) based examinations of domestic violence (DV). The clinical performance sores in DV station with SP of third-year (n=111, in 2014) and 4th-year (n=143, in 2016) medical students of five universities in the Busan-Gyeongnam Clinical Skills Examination Consortium were subjected in this study. The scenarios and checklists of DV cases were developed by the case development committee of the consortium. The students' performance was compared with other stations encountered in SP. The items of the checklists were categorized to determine the performance pattern of students investigating DV into six domains: disclosure strategy (D), DV related history taking (H), checking the perpetrator's psychosocial state (P), checking the victim's condition (V), negotiating and persuading the interviewee (N), and providing information about DV (I). Medical students showed poorer performance in DV stations than in the other stations with SP in the same examination. Most students did confirm the perpetrator and commented on confidentiality but ignored the perpetrator's state and patient's physical and psychological condition. The students performed well in the domains of D, H, and I but performed poorly in domains P, V, and N. Medical students showed poor clinical performance in the DV station. They performed an 'event oriented interview' rather than 'patient centered' communication. An integrated educational program of DV should be set to improve students' clinical performance.

  20. Physical domestic violence exposure is highly associated with suicidal attempts in both women and men. Results from the national public health survey in Sweden.

    Science.gov (United States)

    Dufort, Mariana; Stenbacka, Marlene; Gumpert, Clara Hellner

    2015-06-01

    Studies on a national level concerning domestic violence (DV) among both men and women are few. DV and its relation to other social and health outcomes within the framework of the Swedish Public Health Survey have remained unexplored. To compare women and men regarding their social situation and health status in relation to self-reported exposure to physical DV as measured in the Swedish National Public Health Survey. This study used cross-sectional data from the Swedish Public Health Survey, years 2004-09 with a total sample of 50 350 respondents, of which 205 women and 93 men reported DV exposure. Logistic regression analyses stratified by sex with physical DV exposure as the outcome measure were conducted, and the multivariate models were fitted using the likelihood ratio test. Being foreign-born [women odds ratio (OR) = 1.52, men OR = 1.92] and lack of social support (women OR = 2.81, men OR = 1.92) were associated with DV exposure among both sexes. Higher psychological distress (women OR = 2.81, men OR = 1.92) and hazardous drinking (women OR = 1.61, men OR = 2.33) were also associated with DV exposure. Among women, financial problems were associated with DV exposure (OR = 1.83), whereas among men, sum of medicines used and higher odds of DV were associated (OR = 1.17). Further, suicidal attempts were associated with DV exposure among both women (OR = 5.59) and men (OR = 8.34). In this national survey, prevalence rates of violence exposure were lower than in other studies, but despite this, both women and men exposed to physical DV reported increased odds of having attempted suicide. © The Author 2014. Published by Oxford University Press on behalf of the European Public Health Association.

  1. Using Social Media to Explore the Consequences of Domestic Violence on Mental Health.

    Science.gov (United States)

    Liu, Mingming; Xue, Jia; Zhao, Nan; Wang, Xuefei; Jiao, Dongdong; Zhu, Tingshao

    2018-02-01

    A great deal of research has focused on the negative consequences of domestic violence (DV) on mental health. However, current studies cannot provide direct and reliable evidence on the impacts of DV on mental health in a short term as it is not feasible to measure mental health shortly before and after an unpredictable event like DV. This study aims to explore the short-term outcomes of DV on individuals' mental health. We collected a sample of 232 victims (77% female) and 232 nonvictims (gender and location matched with 232 victims) on Sina Weibo. In both the victim and nonvictim groups, we measured their mental health status during the 4 weeks before the first DV incident and during the 4 weeks after the DV incident. We used our proposed Online Ecological Recognition (OER) system, which is based on several predictive models to identify individuals' mental health statuses. Mental health statuses were measured based on individuals' Weibo profiles and messages, which included "Depression," "Suicide Probability," and "Satisfaction With Life." The results showed that mental health in the victim group was impacted by DV while individuals in the nonvictim group were not. Furthermore, the victim group demonstrated an increase in depression symptoms, higher suicide risks, and decreased life satisfaction after their DV experience. In addition, the effect of DV on individuals' mental health could appear in the conditions of child abuse, intimate partner violence, and exposure to DV. These findings inform that DV significantly impacts individuals' mental health over the short term, as in 4 weeks. Our proposed new data collection and analyses approach, OER, has implications for employing "big data" from social networks to identify individuals' mental health.

  2. Attentional bias towards emotional facial expressions in survivors of dating violence.

    Science.gov (United States)

    Lee, Jeong-Ha; Lee, Jang-Han

    2014-01-01

    This study identified components of attentional bias (e.g. attentional vigilance, attentional avoidance and difficulty with disengagement) that are critical characteristics of survivors of dating violence (DV). Eye movements were recorded to obtain accurate and continuous information regarding attention. DV survivors with high post-traumatic stress symptoms (DV-High PTSS group; n = 20) and low post-traumatic stress symptoms (DV-Low PTSS group; n = 22) and participants who had never experienced DV (NDV group; n = 21) were shown screens displaying emotional (angry, fearful and happy) faces paired with neutral faces and negative (angry and fearful) faces paired with happy faces for 10 s. The results indicate that the DV-High PTSS group spent longer dwelling on angry faces over time compared with the DV-Low PTSS and NDV groups. This result implies that the DV-High PTSS group focused on specific trauma-related stimuli but does not provide evidence of an attentional bias towards threatening stimuli in general.

  3. Incidence and Outcomes of Dating Violence Victimization Among High School Youth: The Role of Gender and Sexual Orientation.

    Science.gov (United States)

    Edwards, Katie M

    2018-05-01

    The purpose of this study was to examine rates of dating violence (DV) victimization and DV victimization outcomes as a function of sex and sexual orientation. Participants were 25,122 high school students who participated in the 2013 New Hampshire Youth Risk Behavior Survey study. Heterosexual youth, especially heterosexual male youth, were less likely to report experiencing physical and sexual DV victimization than lesbian, gay, bisexual, and questioning (LGBQ) girls and boys. Among LGBQ girls and boys, there was little variability in rates of DV victimization with the exception of questioning boys being significantly more likely to experience physical and sexual DV victimization than several other LGBQ sub-groups. Furthermore, LGBQ DV victims reported worse outcomes than heterosexual DV victims on measures of depression, binge drinking, and poor academic performance. At the sub-group level, bisexual and questioning female victims were most at risk for depression; bisexual and questioning male victims were most at risk for binge drinking; bisexual male victims were most at risk for poor academic performance. The findings underscore the importance of better understanding variability in DV incidence and outcomes within the LGBQ population and using this information to inform clinical intervention and prevention efforts.

  4. Composing with New Technology: Teacher Reflections on Learning Digital Video

    Science.gov (United States)

    Bruce, David L.; Chiu, Ming Ming

    2015-01-01

    This study explores teachers' reflections on their learning to compose with new technologies in the context of teacher education and/or teacher professional development. English language arts (ELA) teachers (n = 240) in 15 courses learned to use digital video (DV), completed at least one DV group project, and responded to open-ended survey…

  5. Investigation of organic light-emitting diodes with novel organic electron injection layers

    Energy Technology Data Exchange (ETDEWEB)

    Lee, Sunae; Sethuraman, Kunjithapatham; An, Jongdeok; Im, Chan [Konkuk University, Seoul (Korea, Republic of); Hwang, Boseon [Jinwoong Industrial Co. Ltd., Seoul (Korea, Republic of)

    2012-03-15

    1-(diphenyl-phosphinoyl)-4-(2,2-diphenyl-vinyl)-benzene (DpDvB) and 4-(diphenyl-phosphinoyl)-4'-(2,2-diphenyl-vinyl)-biphenyl (DpDvBp) have been prepared and used as efficient electron injection layers (EILs) between aluminum cathode and tris (8-hydroxyquinoline) aluminum organic light emitting diodes (OLED). The performances of devices with different thicknesses of DpDvB and DpDvBp were investigated. Experimental results show that the turn-on voltage of the devices was decreased and the luminance of the devices was enhanced with increasing thickness of the EILs. Power efficiencies of 1.07 lm/W and 0.97 lm/W were obtained by inserting a 3-nm-thick EIL of DpDvB and a 5 nm thick EIL of DpDvBp, respectively. These efficiencies are comparable to that of the device using LiF as an EIL. The results prove that DpDvB and DpDvBp layers are also suitable for efficient EILs in OLEDs.

  6. How Useful Are Indices of Personality Pathology when Assessing Domestic Violence Perpetrators?

    Science.gov (United States)

    Gibbons, Peter; Collins, Marjorie; Reid, Corinne

    2011-01-01

    There has been considerable debate about profiling personality pathology when assessing and treating male perpetrators of domestic violence (DV). This study used the Millon Clinical Multiaxial Inventory (MCMI-III) to explore the severity and diversity of male perpetrator personality pathology and response bias in a group of DV perpetrators being…

  7. Attitudes towards domestic violence in Lebanon: a qualitative study of primary care practitioners.

    Science.gov (United States)

    Usta, Jinan; Feder, Gene; Antoun, Jumana

    2014-06-01

    Domestic violence (DV) is highly prevalent in the developing and developed world. Healthcare systems internationally are still not adequately addressing the needs of patients experiencing violence. To explore physicians' attitudes about responding to DV, their perception of the physician's role, and the factors that influence their response. Qualitative study using individual interviews among primary care practitioners working in Lebanon. Primary care clinicians practising for >5 years and with >100 patient consultations a week were interviewed. Physicians were asked about their practice when encountering women disclosing abuse, their opinion about the engagement of the health services with DV, their potential role, and the anticipated reaction of patients and society to this extended role. Physicians felt that they were well positioned to play a pivotal role in addressing DV; yet they had concerns related to personal safety, worry about losing patients, and opposing the norms of a largely conservative society. Several physicians justified DV or blamed the survivor rather than the perpetrator for triggering the violent behaviour. Moreover, religion was perceived as sanctioning DV. Perceived cultural norms and religious beliefs seem to be major barriers to physicians responding to DV in Lebanon, and possibly in the Arab world more generally. Financial concerns also need to be addressed to encourage physicians to address DV. © British Journal of General Practice 2014.

  8. Psychometric properties of a Dutch version of the Maslach Burnout Inventory General Survey (UBOS) in individuals with work-related problems

    NARCIS (Netherlands)

    Roelofs, J.; Verbraak, M.J.P.M.; Keijsers, G.P.J.; Bruin, M.B.N. de; Schmidt, A.J.M.

    2005-01-01

    Psychometric properties of the Dutch version of the Maslach Burnout Inventory General Survey, the MBI-DV, were examined in individuals with and without clinical burnout. The factor structure, the utility of the MBI-DV as a screening instrument in addition to a clinical interview for diagnosing

  9. Primary health care physicians’ approach toward domestic violence in Tehran, Iran

    Science.gov (United States)

    Rasoulian, Maryam; Shirazi, Mina; Nojomi, Marzieh

    2014-01-01

    Background: Primary health care physicians (PHCPs) are the first in the clinic to detect and help victims of intimate partner violence (IPV). Therefore, their attitude and practice toward domestic violence (DV) are important to manage this problem. The aim of current study was to compare the behavior and attitude of PHCPs about DV versus other health risk factors in Tehran, Iran. Methods: A convenience sample of 220 PHCPs was evaluated. The study was carried out in April 2012. Two self-administered questionnaires were used to identify physicians’ beliefs and behaviors on screening and intervention of DV and other health risk factors. All analyses were performed using SPSS version 18.0 (SPSS, Inc. Chicago, IL). Results: One hundred and ninety eight questionnaires were analyzed. PHCPs’ mean age was 39.06 (±7.5) years. Participants were just reported 10% screening of regular patients for DV compared with 29% to 48% for other health risk factors. Mean age of PHCPs was not associated with their approach toward the DV. Compared to male physicians, females spared more time for DV victims. Major of physicians (96%) believed that DV is not a private problem and is something that needs to be addressed cautiously. Conclusion: The results of this study indicated that DV screening occurs less than that of other health risk factors. Attitude of majority of PHCPs was positive for addressing this problem PMID:25695006

  10. Attitudes towards domestic violence in Lebanon: a qualitative study of primary care practitioners

    Science.gov (United States)

    Usta, Jinan; Feder, Gene; Antoun, Jumana

    2014-01-01

    Background Domestic violence (DV) is highly prevalent in the developing and developed world. Healthcare systems internationally are still not adequately addressing the needs of patients experiencing violence. Aim To explore physicians’ attitudes about responding to DV, their perception of the physician’s role, and the factors that influence their response. Design and setting Qualitative study using individual interviews among primary care practitioners working in Lebanon. Method Primary care clinicians practising for >5 years and with >100 patient consultations a week were interviewed. Physicians were asked about their practice when encountering women disclosing abuse, their opinion about the engagement of the health services with DV, their potential role, and the anticipated reaction of patients and society to this extended role. Results Physicians felt that they were well positioned to play a pivotal role in addressing DV; yet they had concerns related to personal safety, worry about losing patients, and opposing the norms of a largely conservative society. Several physicians justified DV or blamed the survivor rather than the perpetrator for triggering the violent behaviour. Moreover, religion was perceived as sanctioning DV. Conclusion Perceived cultural norms and religious beliefs seem to be major barriers to physicians responding to DV in Lebanon, and possibly in the Arab world more generally. Financial concerns also need to be addressed to encourage physicians to address DV. PMID:24868068

  11. A Meta-Analysis of Risk and Protective Factors for Dating Violence Victimization: The Role of Family and Peer Interpersonal Context.

    Science.gov (United States)

    Hébert, Martine; Daspe, Marie-Ève; Lapierre, Andréanne; Godbout, Natacha; Blais, Martin; Fernet, Mylène; Lavoie, Francine

    2017-01-01

    Dating violence (DV) is a widespread social issue that has numerous deleterious repercussions on youths' health. Family and peer risk factors for DV have been widely studied, but with inconsistent methodologies, which complicates global comprehension of the phenomenon. Protective factors, although understudied, constitutes a promising line of research for prevention. To date, there is no comprehensive quantitative review attempting to summarize knowledge on both family and peer factors that increase or decrease the risk for adolescents and emerging adults DV victimization. The current meta-analysis draws on 87 studies with a total sample of 278,712 adolescents and young adults to examine effect sizes of the association between various family and peer correlates of DV victimization. Results suggest small, significant effect sizes for all the family (various forms of child maltreatment, parental support, and parental monitoring) and peer factors (peer victimization, sexual harassment, affiliation with deviant peers, and supportive/prosocial peers) in the prediction of DV. With few exceptions, forms of DV (psychological, physical, and sexual), gender, and age did not moderate the strength of these associations. In addition, no difference was found between the magnitude of family and peer factors' effect sizes, suggesting that these determinants are equally important in predicting DV. The current results provide future directions for examining relations between risk and protective factors for DV and indicate that both peers and family should be part of the development of efficient prevention options.

  12. Attitudes and Beliefs About Domestic Violence: Results of a Public Opinion Survey. I. Definitions of Domestic Violence, Criminal Domestic Violence, and Prevalence

    Science.gov (United States)

    Carlson, Bonnie E.; Worden, Alissa Pollitz

    2005-01-01

    This study reports analyses and findings from a public opinion survey designed to explore beliefs about domestic violence (DV) -- what it is, when it is against the law, and how prevalent it is. The project interviewed 1,200 residents from six New York communities. The analyses reveal substantial first hand and second hand experience with DV and…

  13. Filtration Effects Due to Bioassay Cage Design and Screen Type

    Science.gov (United States)

    2010-01-01

    Optical Nonimaging Light- Scattering Instruments (ASTM, 2003). Droplet sizing data included volume median diam (DV50), and the 10% and 90% diam (DV10 and...optical nonimaging light-scattering instru- ments. In: Annual book of ASTM standards. West Conshohocken, PA: American Society for Testing and Materials

  14. Degree of Exposure to Domestic Violence, Psychopathology, and Functional Impairment in Children and Adolescents

    Science.gov (United States)

    Fernandez, Eduard Bayarri; Ezpeleta, Lourdes; Granero, Roser; de la Osa, Nuria; Domenech, Josep Maria

    2011-01-01

    There are discrepancies about whether children who witness and suffer domestic violence (DV) have similar outcomes in terms of psychopathology. This work examines the relationship between different types of exposure to DV and child psychopathology and functional impairment. One hundred and forty-four Spanish children aged from 4 to 17 years and…

  15. Domestic Violence Assessments in the Child Advocacy Center

    Science.gov (United States)

    Thackeray, Jonathan D.; Scribano, Philip V.; Rhoda, Dale

    2010-01-01

    Objective: This study was designed to identify the frequency, methods, and practices of universal assessments for domestic violence (DV) within child advocacy centers (CACs) and determine which factors are associated with CACs that conduct universal DV assessments. Methods: The study design was a cross-sectional, web-based survey distributed to…

  16. Cloning and expression analysis of a blue copperbinding protein ...

    African Journals Online (AJOL)

    Adifferentially expressed fragment EST145 was isolated by suppression subtractive hybridization (SSH) method. Using EST145 as the probe, a blue copper-binding protein gene designated as DvBCB was screened from Dasypyrum villosum cDNA Library. The DvBCB gene was 845 bp in length with an open reading frame ...

  17. Prenatal Diagnosis of Persistent Right Umbilical Vein Using Three-dimensional Sonography with Power Doppler

    Directory of Open Access Journals (Sweden)

    Pei-Yin Yang

    2007-03-01

    Conclusion: PRUV is a common vascular anomaly that is easy to be overlooked. Reconstruction of the portal system in the affected fetuses using 3D ultrasound facilitated the identification of the DV. If the DV is present, and other anomalies are excluded, the fetus with PRUV has a good outcome.

  18. Dicty_cDB: Contig-U05658-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available ted with Brugia Mala... 44 2.4 1 ( DV286265 ) NAAI621TR Aedes aegypti - Fat Bodie...s Normalized (... 44 2.4 1 ( DV286264 ) NAAI621TF Aedes aegypti - Fat Bodies Normalized (... 44 2.4 1 ( CP00

  19. Sex, Attribution, and Severity Influence Intervention Decisions of Informal Helpers in Domestic Violence

    Science.gov (United States)

    Chabot, Heather Frasier; Tracy, Tracy L.; Manning, Christine A.; Poisson, Chelsea A.

    2009-01-01

    Most domestic violence (DV) researchers examine professional intervention (e.g., police and nurses), but informal helpers (e.g., friends and bystanders) are critical. The authors measure undergraduates' intervention likelihood, type of involvement (i.e., contact with abuser), and the influence of attribution decisions in DV situations where the…

  20. Performance of Ductless Personalized Ventilation in Conjunction with Displacement Ventilation: Impact of Workstations Layout and Partitions

    DEFF Research Database (Denmark)

    Halvonova, Barbara; Melikov, Arsen Krikor

    2010-01-01

    cleaner for some of the layouts studied. The use of DPV in conjunction with DV substantially decreased the temperature of the inhaled air and increased the body cooling in comparison with use of DV alone, i.e., DPV also had potential for improving occupants' perceived air quality and thermal comfort....

  1. Correlates of domestic violence experience among recently-married women residing in slums in Pune, India.

    Science.gov (United States)

    Kalokhe, Ameeta S; Iyer, Sandhya R; Kolhe, Ambika R; Dhayarkar, Sampada; Paranjape, Anuradha; Del Rio, Carlos; Stephenson, Rob; Sahay, Seema

    2018-01-01

    The high risk of experiencing domestic violence (DV) among married women in India who reside in slum communities underscores the need for effective, evidence-based, and culturally-tailored primary prevention. To inform such DV primary prevention strategies for this population, we herein aimed to identify correlates of DV experience in early marriage. Utilizing a cross-sectional design, potential correlates of DV experience were explored among a geographically-clustered random sample of 100 recently-married women residing in slums in Pune, India. In multivariable regression, DV experience was associated with less educational attainment by the participant's spouse (standardized β = -0.281, p = 0.004), less satisfaction of the spouse's family with the maanpaan (wedding-related gifts provided by the bride's family) they received at the time of marriage (standardized β = -0.298, p<0.001), poorer conflict negotiation skills (standardized β = -0.308, p<0.001), and greater acknowledgement of DV occurrence in family and friends (standardized β = 0.436, p<0.001). These correlates suggest strategies that could be incorporated into future DV primary prevention interventions for this vulnerable population (i.e. promoting completion of formal education of boys alongside girls, mitigating causes of familial dowry harassment, improving conflict negotiation skills, and challenging norms surrounding DV).

  2. Dentists awareness and action towards domestic violence patients. A cross-sectional study among dentists in Western Saudi Arabia

    Directory of Open Access Journals (Sweden)

    Wafa S. AlAlyani

    2017-01-01

    Full Text Available Objectives: To identify the potential factors that would predict a dentist’s awareness of domestic violence (DV, as well as the factors that influence the probability of dentists to take the required action. Also, to list the common barriers that dentists face when managing DV victims. Methods: In this cross-sectional study, a self-administered, structured questionnaire was sent randomly to dentists practicing in Jeddah, Saudi Arabia. The online survey link was emailed with a cover message that illustrated the study context. Responses were accepted from January 2016 until the end of February 2016. The Statistical Package for the Social Sciences version 22 was used for data analysis. Descriptive statistics, bivariate and multivariate analysis carried out to identify significant variables at p<0.05 level of significance. Results: A sample size of 151 responses were recruited. The result of multivariate models indicated that the odds of dentists’ awareness and taking actions towards DV victims were influenced by their education, clinical experience, gender, practicing sector, and qualification. Lack of training in identifying DV and embarrassment to bring up DV with patients were the most common barriers for the respondents when treating DV victims. Conclusion: Continuing education with regards to DV was found to be the most relevant predictor. More educational courses in this regard would empower dentists to support DV victims.

  3. Addressing domestic violence in primary care: what the physician ...

    African Journals Online (AJOL)

    Domestic violence (DV) is quite prevalent and negatively impacts the health and mental wellbeing of those affected. Victims of DV are frequent users of health service, yet they are infrequently recognized. Physicians tend to treat the presenting complaints without addressing the root cause of the problem. Lack of knowledge ...

  4. Dentists awareness and action towards domestic violence patients

    Science.gov (United States)

    AlAlyani, Wafa S.; Alshouibi, Ehab N.

    2017-01-01

    Objectives: To identify the potential factors that would predict a dentist’s awareness of domestic violence (DV), as well as the factors that influence the probability of dentists to take the required action. Also, to list the common barriers that dentists face when managing DV victims. Methods: In this cross-sectional study, a self-administered, structured questionnaire was sent randomly to dentists practicing in Jeddah, Saudi Arabia. The online survey link was emailed with a cover message that illustrated the study context. Responses were accepted from January 2016 until the end of February 2016. The Statistical Package for the Social Sciences version 22 was used for data analysis. Descriptive statistics, bivariate and multivariate analysis carried out to identify significant variables at p<0.05 level of significance. Results: A sample size of 151 responses were recruited. The result of multivariate models indicated that the odds of dentists’ awareness and taking actions towards DV victims were influenced by their education, clinical experience, gender, practicing sector, and qualification. Lack of training in identifying DV and embarrassment to bring up DV with patients were the most common barriers for the respondents when treating DV victims. Conclusion: Continuing education with regards to DV was found to be the most relevant predictor. More educational courses in this regard would empower dentists to support DV victims. PMID:28042635

  5. Dentists awareness and action towards domestic violence patients. A cross-sectional study among dentists in Western Saudi Arabia.

    Science.gov (United States)

    AlAlyani, Wafa S; Alshouibi, Ehab N

    2017-01-01

    To identify the potential factors that would predict a dentist's awareness of domestic violence (DV), as well as the factors that influence the probability of dentists to take the required action. Also, to list the common barriers that dentists face when managing DV victims. Methods: In this cross-sectional study, a self-administered, structured questionnaire was sent randomly to dentists practicing in Jeddah, Saudi Arabia. The online survey link was emailed with a cover message that illustrated the study context. Responses were accepted from January 2016 until the end of February 2016. The Statistical Package for the Social Sciences version 22 was used for data analysis. Descriptive statistics, bivariate and multivariate analysis carried out to identify significant variables at p less than 0.05 level of significance.  Results: A sample size of 151 responses were recruited. The result of multivariate models indicated that the odds of dentists' awareness and taking actions towards DV victims were influenced by their education, clinical experience, gender, practicing sector, and qualification. Lack of training in identifying DV and embarrassment to bring up DV with patients were the most common barriers for the respondents when treating DV victims. Conclusion: Continuing education with regards to DV was found to be the most relevant predictor. More educational courses in this regard would empower dentists to support DV victims.

  6. Modelling offshore sand wave evolution

    NARCIS (Netherlands)

    Nemeth, Attila; Hulscher, Suzanne J.M.H.; van Damme, Rudolf M.J.

    2007-01-01

    We present a two-dimensional vertical (2DV) flow and morphological numerical model describing the behaviour of offshore sand waves. The model contains the 2DV shallow water equations, with a free water surface and a general bed load formula. The water movement is coupled to the sediment transport

  7. to view fulltext PDF

    Indian Academy of Sciences (India)

    cases the cross-correlation signal takes advantage of the different probes ..... correlation analysis are found to be quite competitive with other cosmological probes .... survey, it is possible to achieve the fiducial value δDV/DV = 2.0% from the ...

  8. Dicty_cDB: SHH135 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available and phloem from mature trees Picea glauca cDNA clone GenomeQuebec_Id:GQ00610_L03 5', mRNA sequence. 44 1e-0...RNA, partial cds. 1265 0.0 1 DV977319 |DV977319.1 GQ00610.B3.1_L03 GQ006: Cambium

  9. Dicty_cDB: Contig-U04691-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 63 ) GQ02748.B3_E01 GQ099: Mixed spruce tissues Picea ... 50 0.11 1 ( DV989931 ) GQ0223.B7_H01 GQ022: ROOT XYLEM - mature trees... Pi... 50 0.11 1 ( DV989830 ) GQ0222.B7_A17 GQ022: ROOT XYLEM - mature trees Pi... 50 0.1

  10. The Cognitive Symptom Checklist-Work in cancer patients is related with work functioning, fatigue and depressive symptoms : a validation study

    NARCIS (Netherlands)

    Dorland, H. F.; Abma, F. I.; Roelen, C. A. M.; Smink, A.; Feuerstein, M.; Amick, B. C.; Ranchor, A. V.; Bultmann, U.

    The study objectives are to translate the 21-item Cognitive Symptom Checklist-Work (CSC-W21) to Dutch (CSC-W DV) and to validate the CSC-W DV in working cancer patients. The CSC-W21 was cross-culturally translated and adapted to a Dutch version. In this 19-item version, the dichotomous response

  11. AcEST: BP912241 [AcEST

    Lifescience Database Archive (English)

    Full Text Available 8RVJ8|Q8RVJ8_POPCA Putative photosystem I reaction centre su... 96 2e-18 tr|Q01DV3|Q01DV3_OSTTA PsaE undef...ined product (IC) OS=Ostreococc... 96 2e-18 tr|B7FME3|B7FME3_MEDTR Putative unchara

  12. Lived Experiences of Diversity Visa Lottery Immigrants in the United States

    Science.gov (United States)

    Hailu, Tekleab Elos; Mendoza, Bernadette M.; Lahman, Maria K. E.; Richard, Veronica M.

    2012-01-01

    Every year approximately 50,000 people immigrate to the United States through the avenue referred to as the Diversity Visa (DV) Lottery. In this article, the authors present a literature review of immigration to the U.S. through the DV Lottery, reflect on their own immigration histories, and utilize phenomenology to investigate and describe…

  13. Development of a Dating Violence Assessment Tool for Late Adolescence Across Three Countries : The Violence in Adolescents' Dating Relationships Inventory (VADRI)

    NARCIS (Netherlands)

    Aizpitarte, Alazne; Alonso-Arbiol, Itziar; Van de Vijver, Fons J. R.; Perdomo, Maria Cristina; Andres Galvez-Sobral, J.; Garcia-Lopez, Eric

    2017-01-01

    Accurate assessment of dating violence (DV) is crucial for evaluation and intervention planning. However, extant self-report measurement tools of DV do not adequately consider age-, generation-, and culture-specific issues, which are essential for its accurate conceptualization. To address these

  14. Dicty_cDB: Contig-U16576-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 5.7 1 ( ES399554 ) MUT06-K17.y1d-s SHGC-MUT Mytilus californianus cD... 46 5.7 1 ( DV865787 ) CRP5519 Creep...ing bentgrass EST Agrostis stolonife... 46 5.7 1 ( DV860530 ) CRP262 Creeping ben

  15. Dicty_cDB: Contig-U16574-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available ( ES399554 ) MUT06-K17.y1d-s SHGC-MUT Mytilus californianus cD... 46 4.9 1 ( DV865787 ) CRP5519 Creeping ben...tgrass EST Agrostis stolonife... 46 4.9 1 ( DV860530 ) CRP262 Creeping bentgrass EST Agrostis stolonifer...

  16. Pět tisíc hřiven stříbra Ebruše Poplinova. Několik zamyšlení nad velikostí majetku pražských a kutnohorských městských elit ve 14. století na základě písemných pramenů

    Czech Academy of Sciences Publication Activity Database

    Musílek, Martin

    Roč. 26, č. 1 ( 2011 ), s. 117-135 ISSN 0546-9414 R&D Projects: GA ČR(CZ) GAP405/11/1982 Institutional research plan: CEZ:AV0Z90090514 Institutional support: RVO:67985955 Keywords : town elites * Prague * Kuttenberg * form books Subject RIV: AB - History

  17. Od latiny k němčině. Slezská města jako vydavatel i příjemce německých a latinských písemností ve 14. století / From latin to german. Silesian towns as the recipients and issuers of german and latin charters in the 14th century

    Directory of Open Access Journals (Sweden)

    Tomáš Velička

    2015-06-01

    Full Text Available The core of this article deals with the use of language in the diplomatic texts written in Silesia throughout the 14th century. Main focus is on the administrative offices of the territorial lord and their produce directed towards the towns, as well as the resources based in town’s offices and the language in which these are written. Individual towns are dealt with individually as well as from the viewpoint of belonging to a certain duchy and region, where the practice in terms of using a certain language may have been different.

  18. Long term changes in water areas and wetlands in an intensively farmed landscape: A case study from the Czech Republic

    Directory of Open Access Journals (Sweden)

    Šantrůčková Markéta

    2017-03-01

    Full Text Available Krajina České republiky v současnosti čelí nebezpečí sucha, které je způsobeno mnoha faktory. Mezi ně patří změny krajiny a krajinného pokryvu. V článku jsou sledovány změny vodních a mokřadních ploch a délky vodních toků na podkladě starých vojenských mapování a současného stavu. Vodní a mokřadní plochy v nížinách zásadně ubyly a krajina byla vysušována s cílem zvýšit zemědělskou a lesnickou produkci. Zatímco na konci 18. století vodní a mokřadní plochy zaujímaly skoro třetinu sledovaného území Novodvorska a Žehušicka ve středních Čechách, v současnosti je to jen 3,5 %. V každé ze sledovaných period ubylo přibližně 10 % jejich rozlohy, významný úbytek těchto ploch v krajině tak nastal již v 19. století. Vodní a mokřadní plochy byly změněny převážně na ornou půdu. Délka vodních toků poklesla zejména v průběhu 19. století. Současná data ukazují nárůst jejich délky, který je ale způsoben budováním zavodňovacích a odvodňovacích kanálů, jejichž délka je také započítána do celkové délky vodních toků, byť nejsou celoročně protékány vodou.

  19. Addressing domestic violence in primary care: what the physician needs to know

    Science.gov (United States)

    Usta, Jinan; Taleb, Rim

    2014-01-01

    Domestic violence (DV) is quite prevalent and negatively impacts the health and mental wellbeing of those affected. Victims of DV are frequent users of health service, yet they are infrequently recognized. Physicians tend to treat the presenting complaints without addressing the root cause of the problem. Lack of knowledge on adequately managing cases of DV and on appropriate ways to help survivors is commonly presented as a barrier. This article presents the magnitude of the problem of DV in the Arab world, highlights the role of the primary care physician in addressing this problem, and provides practical steps that can guide the clinician in the Arab world in giving a comprehensive and culturally sensitive service to the survivors of DV. PMID:24647277

  20. Decrease in domestic violence during pregnancy: a study from Turkey.

    Science.gov (United States)

    Bagcioglu, Erman; Vural, Mehmet; Karababa, Ibrahim Fatih; Aksin, Mahmut; Selek, Salih

    2014-01-01

    Our aim is to evaluate the prevalence of domestic violence (DV) among pregnant women and find out whether several factors were associated with DV or not. A total of 317 pregnant women applied at Sanliurfa Obstetrics Hospital and Harran University obstetrics and gynecology department outpatient clinic were interviewed using the modified form of Abuse Assessment Screen questionnaire. Several clinical and sociodemographic data were also obtained from the participants. Mean pregnancy number per woman (gravida) was 3.62 ± 0.13. 47.3% of women had experienced DV before pregnancy. However, the rate of DV exposure significantly decreased to 10.3% during pregnancy (p violence. Pregnancy appears to decrease DV in Sanliurfa.

  1. [Electroencephalographic characteristics of the deja vu phenomenon].

    Science.gov (United States)

    Vlasov, P N; Cherviakov, A V; Gnezdinsiĭ, V V

    2013-01-01

    Déjà vu (DV, from French "already seen") is an aberration of psychic activity associated with transitory erroneous perception of novel circumstances, objects, or people as already known. An aim of the study was to investigate EEG characteristics of DV in patients with epilepsy. We studied 166 people (63.2% women, mean age 25.17±9.19 years). The DV phenomenon was studied in patients (27 people) and in a control group (139 healthy people). Patients were interviewed for DV characteristics and underwent a long (12-16 h) ambulatory EEG-monitoring study. In EEG, DV episodes in patients began with polyspike activity in the right temporal lobe and, in some cases, ended with the slow-wave theta-delta activity in the right hemisphere.

  2. Perlecan Domain V Induces VEGf Secretion in Brain Endothelial Cells through Integrin α5β1 and ERK-Dependent Signaling Pathways

    Science.gov (United States)

    Clarke, Douglas N.; Al Ahmad, Abraham; Lee, Boyeon; Parham, Christi; Auckland, Lisa; Fertala, Andrezj; Kahle, Michael; Shaw, Courtney S.; Roberts, Jill; Bix, Gregory J.

    2012-01-01

    Perlecan Domain V (DV) promotes brain angiogenesis by inducing VEGF release from brain endothelial cells (BECs) following stroke. In this study, we define the specific mechanism of DV interaction with the α5β1 integrin, identify the downstream signal transduction pathway, and further investigate the functional significance of resultant VEGF release. Interestingly, we found that the LG3 portion of DV, which has been suggested to possess most of DV’s angio-modulatory activity outside of the brain, binds poorly to α5β1 and induces less BEC proliferation compared to full length DV. Additionally, we implicate DV’s DGR sequence as an important element for the interaction of DV with α5β1. Furthermore, we investigated the importance of AKT and ERK signaling in DV-induced VEGF expression and secretion. We show that DV increases the phosphorylation of ERK, which leads to subsequent activation and stabilization of eIF4E and HIF-1α. Inhibition of ERK activity by U0126 suppressed DV-induced expression and secretion of VEGR in BECs. While DV was capable of phosphorylating AKT we show that AKT phosphorylation does not play a role in DV’s induction of VEGF expression or secretion using two separate inhibitors, LY294002 and Akt IV. Lastly, we demonstrate that VEGF activity is critical for DV increases in BEC proliferation, as well as angiogenesis in a BEC-neuronal co-culture system. Collectively, our findings expand our understanding of DV’s mechanism of action on BECs, and further support its potential as a novel stroke therapy. PMID:23028886

  3. A method to identify early ventricular dysfunction using resting gated blood pool scans (GBPS) in patients with coronary artery disease (CAD)

    International Nuclear Information System (INIS)

    Schwarzberg, R.J.; Seldin, D.W.; Johnson, L.L.; Alderson, P.O.

    1984-01-01

    To determine the sensitivity of regional 1st and 2nd time derivative (1DV, 2DV) images to assess ventricular function (VF) in CAD, the resting GBPS of 8 normal patients (pts) and 20 pts with CAD who had coronary angiography and contrast ventriculography (CV) were analyzed. The 1DV and 2DV of the systolic time-activity curve were determined for each left ventricular pixel in the GBPS. These values were displayed as functional images that were reviewed by three readers to determine the presence of regional abnormalities. No regional abnormalities were seen in the conventional GBPS or 1DV or 2DV images of the 8 normal pts. Regional GBPS and DV image abnormalities were seen in all 10 pts with CAD and abnormal wall motion by CV. The DV image abnormalities were in the distribution of 18/22 coronary arteries (CA) with ≥50% stenoses; 2 of these regions showed normal wall motion by CV and conventional GBPS. DV images were abnormal in 2/8 CAs without significant stenoses. In addition, regional DV image abnormalities were present in 9 of 10 pts with CAD who had normal wall motion and global ejection fraction by both CV and resting GBPS. These 10 pts showed regional abnormalities in the distribution of 13/15 CAs with significant stenoses and 2/15 CAs without such stenoses. The results suggest that time derivative functional images derived from resting GBPS provide a more sensitive means for detecting regional left ventricular dysfunction than several other current methods, especially in pts with mild CAD

  4. Isotopic character of Cambro-Ordovician plutonism, southern Victoria Land

    International Nuclear Information System (INIS)

    Cox, S.C.; Parkinson, D.L.; Allibone, A.H.; Cooper, A.F.

    2000-01-01

    Previous mapping of granitoid rocks in the Dry Valleys area of southern Victoria Land, Antarctica, identified the calc-alkaline (DV1a), adakitic (DV1b), and monzonitic (DV2) suites. A fourth older suite comprising alkaline gabbro, syenite, and A-type granite occurs in the Mt Dromedary area c. 80 km to the south. U-Pb zircon dating of Bonney Pluton, the largest calc-alkaline DV1a intrusion, indicates emplacement of this regional-scale body at 505 +/- 2 Ma. Pb-loss and inherited zircon were common to Bonney Pluton analyses of this study. U-Pb dating of monazite from Valhalla Pluton, a principal DV1b suite adakitic intrusion, indicates emplacement at 488 +/- 2 Ma. The Bonney Pluton age constrains the peak of calc-alkaline plutonism at 505 Ma and the Valhalla Pluton age records the major pulse of adakitic plutonism that is inferred to mark the final stages of subduction c. 490 Ma along this section of the East Antarctic margin. Nd and Sr isotope data for the calc-alkaline DV1a suite and adakitic DV1b suite define distinct ranges for each suite, supporting their subdivision on the basis of field relationships, petrography, and whole-rock geochemistry. Calc-alkaline DV1a suite granite magmas have eNd(T) = -4.2 to -6.1 and Sri = 0.7071-0.7079, whereas the adakitic DV1b suite rocks have a wider range of eNd(T) = -1.9 to -7.2 and Sri = 0.7065-0.7097. The isotopic data suggest a significant mantle component and subordinate crustal component in the source region of both suites. Time-dependent variations in the isotopic ratios of DV1a and DV1b suites imply a progressive increase in the proportion of more radiogenic material in the source region of the granitoid rocks, either mantle- or crust-derived material. Larger adakitic DV1b plutons are more 'evolved' than equivalent, smaller plutons of the same DV1b suite. Vanda Dikes and monzonitic DV2 suite intrusions are characterised by particularly low Sri = 0.7044-0.7067 and near-constant eNd(T) = -4.8 to -5.3, which indicate a

  5. Initial digital vasculitis in a large multicenter cohort of childhood-onset systemic lupus erythematosus

    Directory of Open Access Journals (Sweden)

    Ana Paula Sakamoto

    Full Text Available Abstract Objectives: To assess clinical digital vasculitis (DV as an initial manifestation of childhood-onset systemic lupus erythematosus (cSLE within a large population. Methods: Multicenter cross-sectional study including 852 cSLE patients (ACR criteria followed in ten Pediatric Rheumatology centers in São Paulo State, Brazil. Results: DV was observed in 25/852 (3% cSLE patients. Periungual hemorrhage was diagnosed in 12 (48%, periungual infarction in 7 (28%, tip finger ulceration in 4 (16%, painful nodules in 1 (4% and gangrene in 1 (4%. A poor outcome, with digital resorption, occurred in 5 (20%. Comparison of patients with and without DV revealed higher frequency of malar rash (80% vs. 53%, p = 0.008, discoid rash (16% vs. 4%, p = 0.017, photosensitivity (76% vs. 45%, p = 0.002 and other cutaneous vasculitides (80% vs. 19%, p 0.05. SLEDAI-2K median, DV descriptor excluded, was significantly lower in patients with DV compared to those without this manifestation [10 (0-28 vs. 14 (0-58, p = 0.004]. Visceral vasculitis or death were not observed in this cSLE cohort. The frequency of cyclophosphamide use (0% vs. 18%, p = 0.014 was significantly lower in the DV group. Conclusion: Our large multicenter study identified clinical DV as one of the rare initial manifestation of active cSLE associated with a mild multisystemic disease, in spite of digital resorption in some of these patients.

  6. Domestic violence: prevalence in pregnant women and associations with physical and psychological health.

    Science.gov (United States)

    Bacchus, Loraine; Mezey, Gillian; Bewley, Susan

    2004-03-15

    To examine the prevalence of domestic violence (DV) and its associations with obstetric complications and psychological health in women on antenatal and postnatal wards. A cross-sectional survey conducted in an inner-London teaching hospital. Two hundred English-speaking women aged 16 and over, were interviewed between July 2001 and April 2002. The Abuse Assessment Screen was used to assess for experiences of DV. Depression was assessed using the Edinburgh Postnatal Depression Scale (EPDS). The analysis of predictors of obstetric complications grouped together those known to be associated with DV. 23.5% of women had lifetime experience of DV, 3% during the current pregnancy. Women with a history of DV were significantly more likely to be single, separated or in non-cohabiting relationship and to have smoked in the year prior to and/or during pregnancy. Higher EPDS scores were significantly associated with DV, single, separated or non-cohabiting status, and obstetric complications. Both a history of DV and increased EPDS scores were significantly associated with obstetric complications after controlling for other known risk factors. Domestic violence is regarded as an important risk marker for the development of obstetric complications and depressive symptomatology. This finding of itself justifies training and education of maternity health professionals to raise awareness.

  7. The Development and Validation of the Indian Family Violence and Control Scale.

    Science.gov (United States)

    Kalokhe, Ameeta S; Stephenson, Rob; Kelley, Mary E; Dunkle, Kristin L; Paranjape, Anuradha; Solas, Vikram; Karve, Latika; del Rio, Carlos; Sahay, Seema

    2016-01-01

    The high prevalence of domestic violence (DV) among married women in India and associated negative health repercussions highlight the need for effective prevention strategies and tools to measure the efficacy of such interventions. Literature supporting differing manifestations of DV by culture underscores the need for a culturally-tailored scale to more effectively measure DV in the Indian context. We therefore aimed to develop and validate such a tool, the Indian Family Violence and Control Scale (IFVCS), through a mixed-methods study. The psychometric development of IFVCS is herein discussed. After field pre-testing and expert review, a 63-item questionnaire was administered to a random sample of 630 married women from May-July 2013 in Pune, India. The item response theory approach for binary data to explore the IFVCS structure suggested that IFVCS is reliable, with the majority of items having high (>0.5) and significant factor loadings. Concurrent validity, assessed by comparing responses to IFVCS with the validated, abridged Conflict Tactics Scale-2, was high (r = 0.899, p<0.001) as was the construct validity, demonstrated by its significant association with several established DV correlates. Therefore, initial assessment of the IFVCS psychometric properties suggests that it is an effective tool for measuring DV among married women in India and speaks to its capacity for enhancing understanding of DV epidemiology and for evaluating the effectiveness of future DV interventions.

  8. RGMDV: An approach to requirements gathering and the management of data virtualization projects

    Science.gov (United States)

    Mousa, Ayad Hameed; Shiratuddin, Norshuhada; Bakar, Muhamad Shahbani Abu

    2015-12-01

    Data virtualization (DV) refers to a set of data stores that enable users to query, access, and manipulate data in a unified, abstracted, and encapsulated manner regardless of data location. Apart from reducing data movement, this system provides a unified, abstracted, real-time, and encapsulated view of information for query purposes. Through its provision of live, virtual data in a timely manner, the DV technique can overcome the obstacles faced by organizations and companies as a result of using other data integration techniques. The systematic planning for the period that precedes DV deployment enables organizations to avoid many challenges related to manageability, usability, data quality, and performance. DV requirements are among the most significant and challenging aspects of a DV project. In this study, an approach has been developed to gather and manage the requirements of a DV design model as an initial step in developing such projects. Expert methods are reviewed to validate and evaluate the proposed approach in terms of usability and related components; the results of this review demonstrate that the applied approaches benefit DV development projects.

  9. A Cross-Cultural Comparative Study of Undergraduate Health Care Professional Students’ Knowledge, Definitions, Education, and Training Experience of Domestic Violence in Northern Ireland and Jordan

    Directory of Open Access Journals (Sweden)

    Nahla Mansour Al-Ali

    2012-11-01

    Full Text Available The purpose of this study was to examine the cross-cultural differences in the knowledge, definitions, and current training and educational experiences of domestic violence (DV among third-year undergraduate nursing, dental, and medical students from two distinct universities in Northern Ireland and Jordan. A convenience sample of 774 undergraduate students was recruited. Analysis was based on gender, culture, and educational speciality, as seen through the integrated lens of a social ecological and feminist theory model. The results showed that a substantial percentage of all participants had never received any education or training on DV in their undergraduate programs. The majority of participants had good knowledge about DV, and half of the participants believed that DV is “common” in their respective countries. Significant gender and cultural differences in the definition of DV were also revealed, with Northern Irish students and female students in both cultures more likely to regard a range of behaviors as a form of DV. The research findings suggest several potential directions for change, emphasizing the importance of establishing a systematic evidence-based multidisciplinary and interagency approach to teaching and learning for student health care professionals on the topic of DV in their undergraduate programs.

  10. The Development and Validation of the Indian Family Violence and Control Scale.

    Directory of Open Access Journals (Sweden)

    Ameeta S Kalokhe

    Full Text Available The high prevalence of domestic violence (DV among married women in India and associated negative health repercussions highlight the need for effective prevention strategies and tools to measure the efficacy of such interventions. Literature supporting differing manifestations of DV by culture underscores the need for a culturally-tailored scale to more effectively measure DV in the Indian context. We therefore aimed to develop and validate such a tool, the Indian Family Violence and Control Scale (IFVCS, through a mixed-methods study. The psychometric development of IFVCS is herein discussed. After field pre-testing and expert review, a 63-item questionnaire was administered to a random sample of 630 married women from May-July 2013 in Pune, India. The item response theory approach for binary data to explore the IFVCS structure suggested that IFVCS is reliable, with the majority of items having high (>0.5 and significant factor loadings. Concurrent validity, assessed by comparing responses to IFVCS with the validated, abridged Conflict Tactics Scale-2, was high (r = 0.899, p<0.001 as was the construct validity, demonstrated by its significant association with several established DV correlates. Therefore, initial assessment of the IFVCS psychometric properties suggests that it is an effective tool for measuring DV among married women in India and speaks to its capacity for enhancing understanding of DV epidemiology and for evaluating the effectiveness of future DV interventions.

  11. Performance of Healthcare Providers Regarding Iranian Women Experiencing Physical Domestic Violence in Isfahan.

    Science.gov (United States)

    Yousefnia, Nasim; Nekuei, Nafisehsadat; Farajzadegan, Ziba; Yadegarfar, Ghasem

    2018-01-01

    Domestic violence (DV) can threaten women's health. Healthcare providers (HCPs) may be the first to come into contact with a victim of DV. Their appropriate performance regarding a DV victim can decrease its complications. The aim of the present study was to investigate HCPs' performance regarding women experiencing DV in emergency and maternity wards of hospitals in Isfahan, Iran. The present descriptive, cross-sectional study was conducted among 300 HCPs working in emergency and maternity wards in hospitals in Isfahan. The participants were selected using quota random sampling from February to May 2016. A researcher-made questionnaire containing the five items of HCPs performance regarding DV (assessment, intervention, documentation, reference, and follow-up) was used to collect data. The reliability and validity of the questionnaire were confirmed, and the collected data were analyzed using SPSS software. Cronbach's alpha was used to assess the reliability of the questionnaires. To present a general description of the data (variables, mean, and standard deviation), the table of frequencies was designed. The performance of the participants regarding DV in the assessment (mean = 64.22), intervention (mean = 68.55), and reference stages (mean = 68.32) were average. However, in the documentation (mean = 72.55) and follow-up stages (mean = 23.10), their performance was good and weak respectively (criterion from 100). Based on the results, because of defects in providing services for women experiencing DV, a practical indigenous guideline should be provided to treat and support these women.

  12. Correlates of domestic violence perpetration reporting among recently-married men residing in slums in Pune, India.

    Science.gov (United States)

    Kalokhe, Ameeta S; Iyer, Sandhya R; Gadhe, Keshav; Katendra, Tuman; Paranjape, Anuradha; Del Rio, Carlos; Stephenson, Rob; Sahay, Seema

    2018-01-01

    Domestic violence (DV) is prevalent in low-income and slum-dwelling communities in India. To date, the focus of DV prevention in resource-poor settings has largely been with women. We herein aim to identify correlates of DV perpetration to help inform future primary prevention efforts that focus on behavioral change in men. Utilizing a cross-sectional design, potential correlates of DV perpetration were explored among a geographically-clustered random sample of 100 recently-married men residing in slums in Pune, India. In multivariable regression, DV perpetration was associated with less time spent alone in the relationship post-marriage (standardized β = -0.230, p<0.01), not attaining the "husband ideal" (standardized β = -0.201, p<0.05), poor resilience (standardized β = -0.304, p < .01), having limited definitions of behaviors constituting DV (standardized β = -0.217, p<0.05), and reporting greater jealousy if the participant's spouse were to talk to men outside the family (standardized β = 0.272, p<0.01). The identified correlates should inform components of future DV primary prevention interventions that target men as potential perpetrators or the couple as a unit.

  13. Evolution and Analysis of Cultural and Cognitive Factors Related With Domestic Violence Against Women.

    Science.gov (United States)

    Alves, Maria João Vidal; Manita, Celina; Caldas, Inês Morais; Fernández-Martinez, Elena; Gomes da Silva, Angélica; Magalhães, Teresa

    2016-05-02

    Despite the occurrence of encouraging political and social changes in the past few years, many beliefs about women's role in intimate relationships persist, influencing their response to domestic violence (DV). This study aims to analyze the influence of recent policies against DV in Portugal, concerning particularly intimate partner violence against women and their perceptions about the victimization process. Two samples of women (n = 126 each) reporting an aggressive act allegedly perpetrated by the current or former male partner were interviewed with a hiatus of 5 years (before and after some most relevant policy updates). Results suggest a positive influence of the recent policies against DV. Many significant and encouraging changes were found in the more recent women sample (S2) relatively to the first sample (S1) regarding their information, awareness, perceptions, and attitudes toward DV. They seem to show less tolerance and endurance to DV, placing responsibility on the offender, as well as seem more empowered to report. In S2, there was a decrease in the acceptance of violent behaviors as normal and of reasons to explain violence; the fears, shame, and helplessness about DV; the elapsed time between the beginning of the abuse and its report; and the prevalence of more severe types of physical abuse. In S2, there was an increase on the acknowledgment of DV as a crime, the number of reports in cases without cohabitation, the report of psychological abuses, and the feeling of safety and assurance while reporting. © The Author(s) 2016.

  14. Dimensionality-varied deep convolutional neural network for spectral-spatial classification of hyperspectral data

    Science.gov (United States)

    Qu, Haicheng; Liang, Xuejian; Liang, Shichao; Liu, Wanjun

    2018-01-01

    Many methods of hyperspectral image classification have been proposed recently, and the convolutional neural network (CNN) achieves outstanding performance. However, spectral-spatial classification of CNN requires an excessively large model, tremendous computations, and complex network, and CNN is generally unable to use the noisy bands caused by water-vapor absorption. A dimensionality-varied CNN (DV-CNN) is proposed to address these issues. There are four stages in DV-CNN and the dimensionalities of spectral-spatial feature maps vary with the stages. DV-CNN can reduce the computation and simplify the structure of the network. All feature maps are processed by more kernels in higher stages to extract more precise features. DV-CNN also improves the classification accuracy and enhances the robustness to water-vapor absorption bands. The experiments are performed on data sets of Indian Pines and Pavia University scene. The classification performance of DV-CNN is compared with state-of-the-art methods, which contain the variations of CNN, traditional, and other deep learning methods. The experiment of performance analysis about DV-CNN itself is also carried out. The experimental results demonstrate that DV-CNN outperforms state-of-the-art methods for spectral-spatial classification and it is also robust to water-vapor absorption bands. Moreover, reasonable parameters selection is effective to improve classification accuracy.

  15. Matched trauma: The role of parents' and children's shared history of childhood domestic violence exposure in parents' report of children's trauma-related symptomatology.

    Science.gov (United States)

    Cohodes, Emily; Hagan, Melissa; Narayan, Angela; Lieberman, Alicia

    2016-01-01

    Parents' childhood experiences of trauma may influence their reports of their children's behavior, and this may be particularly true when children are also traumatized. The present study proposed and tested a matched trauma hypothesis, positing that compared to parents without a childhood history of witnessing domestic violence (DV), parents with a childhood history of witnessing DV may report their children's trauma-related symptomatology differently following children's exposure to DV. Of 137 included parents (M age = 32 years; 93% mothers), 81 reported witnessing childhood DV (matched group), whereas 56 reported no childhood DV exposure (nonmatched comparison group). All parents reported on their 3- to 6-year-old children's dissociation and posttraumatic stress symptoms following children's DV exposure. An analysis of covariance controlling for parental life stress, dissociation symptoms, and other childhood traumatic events revealed that parents who witnessed childhood DV reported significantly fewer child dissociation symptoms than comparison parents. No difference was found for parents' reports of children's posttraumatic stress symptoms. Exploratory analyses on a subsample of children with teacher reports of child dissociation symptoms (n = 75) revealed that the strength of the association between parent and teacher reports of dissociation symptoms was moderated by matched versus nonmatched group membership. Findings suggest the importance of considering a parent's history of trauma when using parents as informants for children's trauma symptoms.

  16. Breast-feeding counselling mitigates the negative association of domestic violence on exclusive breast-feeding duration in rural Bangladesh. The MINIMat randomized trial.

    Science.gov (United States)

    Frith, Amy L; Ziaei, Shirin; Naved, Ruchira Tabassum; Khan, Ashraful Islam; Kabir, Iqbal; Ekström, Eva-Charlotte

    2017-10-01

    To determine if exclusive breast-feeding counselling modifies the association of experience of any lifetime or specific forms of domestic violence (DV) on duration of exclusive breast-feeding (EBF). In the MINIMat trial pregnant women were randomized to receive either usual health messages (UHM) or usual health messages with breast-feeding counselling (BFC) in eight visits. During pregnancy (30 weeks), lifetime experience of any or specific forms of DV was measured. Infant feeding practice information was collected from 0 to 6 months at 15 d intervals. Matlab, Bangladesh. Pregnant and postpartum women (n 3186) and their infants. Among women in the UHM group, those who had experienced any lifetime DV exclusively breast-fed for a shorter duration than women who did not experience any lifetime DV (P=0·02). There was no difference, however, in duration of EBF among women in the BFC group based on their experience of any lifetime DV exposure (P=0·48). Using Cox regression analysis, there was an interaction of exposure to any lifetime DV, sexual violence and controlling behaviour, and counselling group with duration of breast-feeding at or before 6 months (P-interaction≤0·08). Among the UHM group, experience of any lifetime DV, sexual violence or controlling behaviour was associated with fewer days of EBF (Pgroup, experience of DV was not associated with duration of EBF. The experience of DV compromises EBF and the support of breast-feeding counselling programmes could assist this vulnerable group towards better infant feeding practices.

  17. Domestic violence as a threat to maternal and child well-being in an urban migrant community in Peru

    Directory of Open Access Journals (Sweden)

    Brieanne K. Kohrt

    Full Text Available OBJECTIVE: To examine the impact that domestic violence (DV has on hindering the success of urban migrants in Peru and any association with maternal depression, impaired parenting, social capital, and child development. METHODS: This was a cross-sectional study consisting of structured interviews with 97 mothers and their school-aged children in El Porvenir, a predominantly migrant area of the city of Trujillo, Peru. Data collection occurred in February-June 2011. Proven tools previously validated for use in Spanish were used to assess the following variables: maternal depression, social capital, domestic violence, parenting behaviors, child socioemotional development, and child cognitive development. Correlational, multiple regression, tests of interaction, and indirect/mediator models were used for analysis. RESULTS: Sixty-five percent of women reported currently experiencing DV. DV strongly predicted depression (P < 0.001. Women who reported DV were less likely to be employed (P < 0.05, had lower cognitive social capital (P < 0.01, engaged in fewer caregiving activities (P < 0.05, had less maternal energy (P < 0.05, and were less warm (P < 0.05. DV was associated with internalizing behaviors in children (P < 0.01, with impaired parenting partially mediating this relationship. CONCLUSIONS: DV compromises women's mental health and parenting ability. High rates of DV among urban migrants affect the whole community by hindering employment potential and reducing trust among community members. Interventions targeting DV-related variables (e.g., substance abuse and limited job opportunities for men could reduce the deleterious effects of DV on urban migrant communities across Latin America.

  18. Does the health status of intimate partner violence victims warrant pharmacies as portals for public health promotion?

    Science.gov (United States)

    Cerulli, Catherine; Cerulli, Jennifer; Santos, Elizabeth J; Lu, Najii; He, Hua; Kaukeinen, Kimberly; White, Anne Marie; Tu, Xin

    To explore whether the health status of intimate partner violence (IPV) victims warrants pharmacies to be portals for public health promotion. Specific objectives included (1) identifying prevalence of IPV including domestic violence (DV) and sexual assault (SA) in a community sample, (2) describing characteristics and correlates of DV/SA between participants who reported and did not report DV/SA, and (3) exploring whether DV/SA status is related to mental health medication use. Cross sectional. Upstate New York during 2006. English- and Spanish-speaking respondents younger than 65 years of age answering four questions to assess DV/SA. Secondary analysis of a countywide random telephone survey, the 2006 Monroe County Adult Health Survey, which collects prevalence data on health behaviors and health status indicators. To determine whether those reporting DV/SA are at increased odds for mental health medication use, controlling for other sociodemographic- and health-related variables. The survey response rate was 30.3%, with 1,881 respondents meeting inclusion criteria. Those reporting DV/SA were almost twice as likely to use mental health medications. However, when controlling for other variables, only poor mental and physical health were significant in increasing the odds of mental health medication use. The analyses reported here suggest that DV/SA victims in a community sample use mental health medications. When controlling for other variables, survey respondents reported worse physical and mental health. If pharmacies are suitable portals for DV/SA outreach, curricula would need to provide the knowledge and skills needed to take an active role in this public health promotion.

  19. Prevalence and Risk Factors of Domestic Violence Against Women Attending a Primary Care Center in Riyadh, Saudi Arabia.

    Science.gov (United States)

    Barnawi, Fatima Hamza

    2015-05-27

    Domestic violence (DV) against women can negatively affect the physical, mental, sexual, and reproductive health of the women as well as the well-being of their children. The objective was to estimate among Saudi women the prevalence of different types of DV, to identify its associated risk factors, and to determine the immediate victims' reactions to such violence. A cross-sectional study was carried between March and July, 2011. Self-administrated questionnaire was administered to ever-married Saudi women attending Al-Wazarat primary health care center, in Riyadh, Saudi Arabia. Out of the 720 women studied, 144 (20%) reported exposure to DV over the last year. The most common DV types were emotional (69%), social (34%), economic (26%), physical (20%), and sexual violence (10%). In multivariate logistic regression analysis, the following characteristics were independently associated with DV: younger women age, longer duration of marriage, higher women education, lower husband education, working husbands, military occupation, fewer children, husbands with multiple wives, smoking husbands, aggressive husbands, presence of chronic disease in women or husbands, and non-sufficient family income. The most common impacts of DV on women were medical or behavioral problems (72%) and psychiatric problems (58%). The most common reactions to DV were seeking separation (56%) and doing nothing (41%). More than 90% of children of abused women suffered psychological or behavioral problems. In conclusion, DV against Saudi women is considerable and the response is generally passive. Promoting a culture non-tolerant to DV and providing accessible, effective, and trustful social services to abused women are critically needed. © The Author(s) 2015.

  20. Inhibitory effect of glutathione on oxidative liver injury induced by dengue virus serotype 2 infections in mice.

    Directory of Open Access Journals (Sweden)

    Juan Wang

    Full Text Available The pathogenesis of dengue virus (DV infection has not been completely defined and change of redox status mediated by depletion of glutathione (GSH in host cell is a common result of viral infection. Our previous study has demonstrated that DV serotype 2 (DV2 infection alters host intracellular GSH levels, and exogenous GSH inhibits viral production by modulating the activity of NF-κB in HepG2 cells. GSH is the most powerful intracellular antioxidant and involved in viral infections. Thus, this study was to investigate whether DV2 infection can induce alteration in redox balance and effect of GSH on the disease in HepG2 xenografts SCID mice. Our results revealed that mice infected with DV2 showed alterations in oxidative stress by increasing the level of malondialdehyde (MDA, an end product of lipid peroxidation, and GSSG/GSH ratio. DV2-infected mice also showed a decrease in the activity of catalase (CAT and total superoxide dismutase (T-SOD in the serum and/or observed organs, especially the liver. Moreover, DV2 infection resulted in elevated serum levels of the cytokines tumor necrosis factor-α and interlukin-6 and obvious histopathological changes in the liver. The administration of exogenous GSH significantly reversed all of the aforementioned pathological changes and prevented significant liver damage. Furthermore, in vitro treatment of HepG2 cells with antioxidants such as GSH inhibited viral entry as well as the production of reactive oxygen species in HepG2 cells. These results suggest that GSH prevents DV2-induced oxidative stress and liver injury in mice by inhibiting proinflammatory cytokine production, and GSH and may be a promising therapeutic agent for prevention of oxidative liver damage during DV infection.

  1. Proceedings of the Workshop on Mobility and Control in Challenging Environments

    Science.gov (United States)

    2007-09-20

    gyros, odometry, articulation sensing etc. Kalman Filter Predict specific force that would be observed at the cg. Compare to the support polygon Can...forces are observable. Rigid Terrain Model: Extended Kalman -Bucy Filtering for Tire Force Estimation • Sensors – x and y accelerations, yaw rate...Layer D-V V-D V-D D-V Right Down Left D-V Right V-D Strain Gauge Antenna A/D Converter • Discretizes Bridge output to 1 of 7 levels

  2. Granitoids of the Dry Valleys area, southern Victoria Land : geochemistry and evolution along the early Paleozoic Antarctic Craton margin

    International Nuclear Information System (INIS)

    Allibone, A.H.; Cox, S.C.; Smillie, R.W.

    1993-01-01

    Field relationships and geochemistry indicate granitoid plutons of the Dry Valleys area comprise at least three petrogenetically distinct suites. The older Dry Valleys 1a (DV1a) suite, comprising the Bonney, Catspaw, Denton, Cavendish, and Wheeler Plutons and hornblende-biotite orthogneisses, and Dry Valleys 1b (DV1b) suite, comprising the Hedley, Valhalla, St Johns, Dun, Calkin, and Suess Plutons, biotite granitoid dikes and biotite orthogneisses, were emplaced before prominent swarms of Vanda mafic and felsic dikes. Both the DV1a and DV1b suites are time transgressive, with older intrusions in each suite being emplaced during the later stages of deformation of the Koettlitz Group. Younger granitoids that postdate the majority of the Vanda dikes include: the Dry Valleys 2 (DV2) suite, comprising the Pearse and Nibelungen Plutons plus several smaller, unnamed plugs; and the Harker, Swinford, Orestes, and Brownworth Plutons with identical field relationships and enclaves but distinct chemistries. Chemical characteristics and limited Rb-Sr isotopic dating indicate plutonism before c. 500 Ma was dominated by the Cordilleran I-type DV1a suite, inferred to have developed during melting above a west-dipping subduction zone along the Antarctic Craton margin. The chemical characteristics of the DV1b suite indicate large-scale melting of a quartzo-feldspathic protolith lacking residual plagioclase, but containing refractory garnet. Potential DV1b suite source rocks include metamorphosed immature sediments, possibly underplated along the subduction zone associated with DV1a magmatism, or older granitoid orthogneisses. Major DV1b plutonism at 490 Ma marks the end of subduction-related plutonism in southern Victoria Land. Younger DV2 alkali-calcic, Caledonian I-type plutonism is inferred to have formed in response to uplift and extension between 480 and 455 Ma. Lack of DV2 suite correlatives and Vanda mafic and felsic dikes in northern Victoria Land suggests significantly

  3. Decadal trends in the diurnal variation of galactic cosmic rays observed using neutron monitor data

    Energy Technology Data Exchange (ETDEWEB)

    Thomas, Simon [Reading Univ. (United Kingdom). Dept. of Meteorology; Univ. College London, Dorking (United Kingdom). Mullard Space Science Lab.; Owens, Mathew; Lockwood, Mike [Reading Univ. (United Kingdom). Dept. of Meteorology; Owen, Chris [Univ. College London, Dorking (United Kingdom). Mullard Space Science Lab.

    2017-10-01

    The diurnal variation (DV) in galactic cosmic ray (GCR) flux is a widely observed phenomenon in neutron monitor data. The background variation considered primarily in this study is due to the balance between the convection of energetic particles away from the Sun and the inward diffusion of energetic particles along magnetic field lines. However, there are also times of enhanced DV following geomagnetic disturbances caused by coronal mass ejections or corotating interaction regions. In this study we investigate changes in the DV over four solar cycles using ground-based neutron monitors at different magnetic latitudes and longitudes at Earth. We divide all of the hourly neutron monitor data into magnetic polarity cycles to investigate cycle-to-cycle variations in the phase and amplitude of the DV. The results show, in general, a similarity between each of the A<0 cycles and A>0 cycles, but with a phase change between the two. To investigate this further, we split the neutron monitor data by solar magnetic polarity between times when the dominant polarity was either directed outward (positive) or inward (negative) at the northern solar pole. We find that the maxima and minima of the DV changes by, typically, 1-2 h between the two polarity states for all non-polar neutron monitors. This difference between cycles becomes even larger in amplitude and phase with the removal of periods with enhanced DV caused by solar wind transients. The time difference between polarity cycles is found to vary in a 22-year cycle for both the maximum and minimum times of the DV. The times of the maximum and minimum in the DV do not always vary in the same manner between A>0 and A<0 polarity cycles, suggesting a slight change in the anisotropy vector of GCRs arriving at Earth between polarity cycles. Polar neutron monitors show differences in phase between polarity cycles which have asymptotic directions at mid-to-high latitudes. All neutron monitors show changes in the amplitude of the

  4. Changed and changing gender and family roles and domestic violence in African refugee background communities post-settlement in Perth, Australia.

    Science.gov (United States)

    Fisher, Colleen

    2013-07-01

    In this study, domestic violence (DV) in five African refugee background communities post-settlement in Perth, Australia, is investigated-specifically, the interrelationship between experiences of DV, and changed and changing gender and family roles and responsibilities. The participatory qualitative design utilized in-depth interviews with 54 members of the Somalian, Sierra Leonean, Ethiopian, Liberian and Sudanese Communities, and focus groups with 24 professionals who support them. Three key dimensions of this interrelationship are discussed: "male loss of the breadwinner role and status," "financial independence," and "mismatch between formal response and expectations." The importance of understanding experiences of DV within the context of cultural transition is highlighted here.

  5. Normalization in quantitative [18F]FDG PET imaging: the 'body surface area' may be a volume

    International Nuclear Information System (INIS)

    Laffon, Eric; Suarez, Kleydis; Berthoumieu, Yannick; Ducassou, Dominique; Marthan, Roger

    2006-01-01

    Non-invasive methods for quantifying [ 18 F]FDG uptake in tumours often require normalization to either body weight or body surface area (BSA), as a surrogate for [ 18 F]FDG distribution volume (DV). Whereas three dimensions are involved in DV and weight (assuming that weight is proportional to volume), only two dimensions are obviously involved in BSA. However, a fractal geometry interpretation, related to an allometric scaling, suggests that the so-called 'body surface area' may stand for DV. (note)

  6. Air quality Performance of Ductless Personalized Ventilation in Conjunction with Displacement Ventilation: Impact of Walking Person

    DEFF Research Database (Denmark)

    Bolashikov, Zhecho Dimitrov; Lu, Pengfei; Melikov, Arsen Krikor

    2015-01-01

    The present experiment evaluates the impact of air disturbances from a walking person on inhaled air by ductless personalized ventilation (DPV) with displacement ventilation (DV), when a seated occupant is the source of pollution: bio-effluents and exhaled air. The measurements took place in a full...... and the DV supply. Pollution from feet and exhaled air by one manikin was simulated with tracer gases. Room temperature of 26 °C and 90 L/s DV supply flow rate were kept constant. Measurements under numerous combinations of DPV operation modes and supply flow rates were performed. Tracer gas concentrations...

  7. The Whitham deformation of the Dijkgraaf-Vafa Theory

    International Nuclear Information System (INIS)

    Aoyama, Shogo; Masuda, Takahiro

    2004-01-01

    We discuss the Whitham deformation of the effective superpotential in the Dijkgraaf-Vafa (DV) theory. It amounts to discussing the Whitham deformation of an underlying (hyper)elliptic curve. Taking the elliptic case for simplicity we derive the Whitham equation for the period, which governs fowings of branch points on the Riemann surface. By studying the hodograph solution to the Whitham equation it is shown that the effective superpotential in the DV theory is realized by many different meromorphic differentials. Depending on which meromorphic differential to take, the effective superpotential undergoes different deformations. This aspect of the DV theory is discussed in detail by taking the N = 1* theory. (author)

  8. Domestic Violence Counseling in Rural Northern China: Gender, Social Harmony, and Human Rights.

    Science.gov (United States)

    Xie, Lijia; Eyre, Stephen L; Barker, Judith

    2018-03-01

    Domestic violence (DV) affects over a third of Chinese women in a relationship. Focusing on ethnographic data from six staff members and six DV survivors at a rural, state-affiliated women's center in China in 2010, this article relies on Henrietta Moore's notion of the poststructuralist gendered subject to examine how the staff draw on discourses about gender and social harmony in persuading women to stay in their marriages, rather than on human rights discourses that emphasize survivor safety. It shows that DV survivors are frequently sent back to dangerous homes where their health is placed at risk.

  9. Static Aeroelastic Effects on High Performance Aircraft

    Science.gov (United States)

    1987-06-01

    davis la rffrence 9. L’avion est instrurnent6, en plus des capteurs classiques des param~tres de n~ca- nique du vol. de plusleurs centaines de jauges de...crites §2.3.5, et lensemble dv l’analyse, pernet- tent le calcul des r~ponues des jauges en fonction dv X soit ar ( X) , lv procesnus de d~rivation...travissonique. Rema rque La smine technique d’identification par rtponne dv jauges s’applique (plus simple- ment) sur len essais en soufflerie, pour la

  10. Preliminary construction of a service provider--informed domestic violence research agenda.

    Science.gov (United States)

    Murray, Christine E; Welch, Metoka L

    2010-12-01

    This article presents the results of a statewide survey of domestic violence (DV) service providers that focused on the needs, background characteristics, and opinions of service providers related to research. The survey included an examination of service providers' motivation for working in the field, research background and training, and perceptions of research as well as the topics they believe are important for researchers to study, the resources they consult to learn about DV, and their suggestions to help researchers learn more about the nature of their work. The results are integrated into a preliminary agenda for future DV research that accounts for the needs and insight of service providers.

  11. Research Article Special Issue

    African Journals Online (AJOL)

    pc

    2018-03-07

    Mar 7, 2018 ... Research organization and stages. The work was conducted at ..... Rivman D.V., Ustinov V.S. Viktimologiya [Victimology]. St. Petersburg: Piter ... Culture in the Asia-Pacific Region Countries (Comparative Study)]. Available at:.

  12. Chapman's Reef Oculina Banks Clelia Dive 621 2001 Digital Imagery - Captured from Videotapes taken during Submersible Dives to the Oculina Banks Deep Sea Coral Reefs (NODC Accession 0047190)

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — Digitial imagery, mpegs and jpegs, captured from mini-DV magnetic videotapes collected with an underwater 3-chip CCD color video camera, deployed from the research...

  13. Sebastian Pinnacles, Oculina Banks Clelia Dive 615 2001 Digital Imagery - Captured from Videotapes taken during Submersible Dives to the Oculina Banks Deep Sea Coral Reefs (NODC Accession 0047190)

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — Digitial imagery, mpegs and jpegs, captured from mini-DV magnetic videotapes collected with an underwater 3-chip CCD color video camera, deployed from the research...

  14. Sebastian Pinnacles Oculina Banks Clelia Dive 619 2001 Digital Imagery - Captured from Videotapes taken during Submersible Dives to the Oculina Banks Deep Sea Coral Reefs (NODC Accession 0047190)

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — Digitial imagery, mpegs and jpegs, captured from mini-DV magnetic videotapes collected with an underwater 3-chip CCD color video camera, deployed from the research...

  15. Sebastian Pinnacles Oculina Banks Clelia Dive 618 2001 Digital Imagery - Captured from Videotapes taken during Submersible Dives to the Oculina Banks Deep Sea Coral Reefs (NODC Accession 0047190)

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — Digitial imagery, mpegs and jpegs, captured from mini-DV magnetic videotapes collected with an underwater 3-chip CCD color video camera, deployed from the research...

  16. Sebastian Pinnacles, Oculina Banks Clelia Dive 614 2001 Digital Imagery - Captured from Videotapes taken during Submersible Dives to the Oculina Banks Deep Sea Coral Reefs (NODC Accession 0047190)

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — Digitial imagery, mpegs and jpegs, captured from mini-DV magnetic videotapes collected with an underwater 3-chip CCD color video camera, deployed from the research...

  17. Innovative Applications of DoD Propulsion Technology for Low-Cost Satellite Missions, Phase II

    Data.gov (United States)

    National Aeronautics and Space Administration — We are proposing to leverage the Missile Defense Agency investments in high-performance propulsion systems for low-cost space missions with large Dv requirements,...

  18. Knowledge of primary care nurses regarding domestic violence

    African Journals Online (AJOL)

    Nagham N. Alsafy

    2011-06-12

    Jun 12, 2011 ... Conclusion: Overall, primary care nurses had poor knowledge regarding DV. Although female ... Physical abuse is defined as any behavior in which the body ... activity.5 Psychological abuse essentially and significantly dif-.

  19. ORF Alignment: NC_002929 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available a ... bronchiseptica RB50] ... Length = 249 ... Query: 32 ... RPVRLIVPYGAGGAADVLARIMAEKLSAIWKQPVIVEN...KPGGVGTIGIMATVQAEPDGYT 91 ... +PVR++V + AGG ... DV+ARIMA++L+ ... Q ... +VENKPGG ... ... I ... +A PDGYT Sbjct: 1 ... KPVRIVVGFSAGGTTDVIARIMAKELTEALGQSFVVENKPGGGSNIATDYVARATPDGYT 60 ... Query: 152 KPGY

  20. ORF Alignment: NC_002927 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available a ... bronchiseptica RB50] ... Length = 249 ... Query: 32 ... RPVRLIVPYGAGGAADVLARIMAEKLSAIWKQPVIVEN...KPGGVGTIGIMATVQAEPDGYT 91 ... +PVR++V + AGG ... DV+ARIMA++L+ ... Q ... +VENKPGG ... ... I ... +A PDGYT Sbjct: 1 ... KPVRIVVGFSAGGTTDVIARIMAKELTEALGQSFVVENKPGGGSNIATDYVARATPDGYT 60 ... Query: 152 KPGY

  1. South Experimental Oculina Research Reserve, Clelia Dive 610 2001 Digital Imagery - Captured from Videotapes taken during Submersible Dives to the Oculina Banks Deep Sea Coral Reefs (NODC Accession 0047190)

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — Digitial imagery, mpegs and jpegs, captured from mini-DV magnetic videotapes collected with an underwater 3-chip CCD color video camera, deployed from the research...

  2. Jeff's Reef Oculina Banks Clelia Dive 606 2001 Digital Imagery - Captured from Videotapes taken during Submersible Dives to the Oculina Banks Deep Sea Coral Reefs (NODC Accession 0047190)

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — Digitial imagery, mpegs and jpegs, captured from mini-DV magnetic videotapes collected with an underwater 3-chip CCD color video camera, deployed from the research...

  3. Eau Galllie Oculina Banks Clelia Dive 609 2001 Digital Imagery - Captured from Videotapes tken during Submersible Dives to the Oculina Banks Deep Sea Coral Reefs (NODC Accession 0047190)

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — Digitial imagery, mpegs and jpegs, captured from mini-DV magnetic videotapes collected with an underwater 3-chip CCD color video camera, deployed from the research...

  4. Experience of domestic violence and acceptance of intimate partner violence among out-of-school adolescent girls in Iwaya Community, Lagos State.

    Science.gov (United States)

    Kunnuji, Michael O N

    2015-02-01

    Gender-based domestic violence (DV) comes at great costs to the victims and society at large. Yet, many women hold the view that intimate partner violence (IPV) against women is appropriate behavior. This study aimed at exploring the nexus of experience of different forms of DV and acceptance of IPV as appropriate behavior. Using data from a survey of 480 out-of-school adolescent girls, the researcher shows that psychological abuse is a significant predictor of approval of DV resulting from the wife's failure to make food available for her husband with victims of abuse approving of violence against women. Conversely, victims of sexual abuse, more than nonvictims, disapproved of wife beating resulting from the wife going out without informing the husband. The implications of the findings are discussed and the study recommends deconstructing women's negative beliefs upon which DV rests. © The Author(s) 2014.

  5. Briti tantsufilm küsib, mis on elu hind / Tiit Tuumalu

    Index Scriptorium Estoniae

    Tuumalu, Tiit, 1971-

    2006-01-01

    Tantsufilm "Elu hind" ("The Cost of Living") : lavastaja ja koreograaf Lloyd Newson : peaosades jalutu tantsija David Toole ja Eddie Kay : Suurbritannia 2004. Filmi aluseks on Londoni tantsuteatri DV 8 Physical Theatre' 2000.a. valminud lavastus

  6. Jalutu David tantsib auhinna vääriliselt / Andres Laasik

    Index Scriptorium Estoniae

    Laasik, Andres, 1960-2016

    2006-01-01

    Tantsufilm "Elu hind" ("The Cost of Living") : lavastaja ja koreograaf Lloyd Newson : peaosades David Toole, Eddie Kay : Suurbritannia 2004. Filmi aluseks on Londoni tantsuteatri DV 8 Physical Theatre' 2000.a. valminud lavastus

  7. The Changes in Doppler Indices of Fetal Ductus Venosus and Umbilical Artery After Amnioinfusion for Women With Preterm Premature Rupture of Membranes Before 26 Weeks' Gestation

    Directory of Open Access Journals (Sweden)

    Te-Yao Hsu

    2009-09-01

    Conclusion: Amnioinfusion increases the space for the fetuses and reduces the impedance of the fetoplacental circulation. Improvements in DV and UMA flow may benefit fetuses suffering severe oligohydramnios in mid-pregnancy.

  8. Central Experimental Oculina Research Reserve, Clelia Dive 612 2001 Digital Imagery - Captured from Videotapes taken during Submersible Dives to the Oculina Banks Deep Sea Coral Reefs (NODC Accession 0047190)

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — Digitial imagery, mpegs and jpegs, captured from mini-DV magnetic videotapes collected with an underwater 3-chip CCD color video camera, deployed from the research...

  9. Cocoa Beach Oculina Banks Clelia Dive 617 2001 Digital Imagery - Captured from Videotapes taken during Submersible Dives to the Oculina Banks Deep Sea Coral Reefs (NODC Accession 0047190)

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — Digitial imagery, mpegs and jpegs, captured from mini-DV magnetic videotapes collected with an underwater 3-chip CCD color video camera, deployed from the research...

  10. Theoretical study of relativistic effects in the electronic structure and chemical bonding of UF6

    International Nuclear Information System (INIS)

    Onoe, Jun; Takeuchi, Kazuo; Sekine, Rika; Nakamatsu, Hirohide; Mukoyama, Takeshi; Adachi, Hirohiko.

    1992-01-01

    We have performed the relativistic molecular orbital calculation for the ground state of UF 6 , using the discrete-variational Dirac-Slater method (DV-DS), in order to elucidate the relativistic effects in the electronic structure and chemical bonding. Compared with the electronic structure calculated by the non-relativistic Hartree-Fock-Slater (DV-X α )MO method, not only the direct relativistic effects (spin-orbit splitting etc), but also the indirect effect due to the change in screening core potential charge are shown to be important in the MO level structure. From the U-F bond overlap population analysis, we found that the U-F bond formation can be explained only by the DV-DS, not by the DV-X α . The calculated electronic structure in valence energy region (-20-OeV) and excitation energies in UV region are in agreement with experiments. (author)

  11. Cape Canaveral Oculina Banks Clelia Dive 616 2001 Digital Imagery - Captured from Videotapes taken during Submersible Dives to the Oculina Banks Deep Sea Coral Reefs (NODC Accession 0047190)

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — Digitial imagery, mpegs and jpegs, captured from mini-DV magnetic videotapes collected with an underwater 3-chip CCD color video camera, deployed from the research...

  12. Barriers for administering primary health care services to battered ...

    African Journals Online (AJOL)

    Eman H. Alsabhan

    2011-09-15

    Sep 15, 2011 ... Abstract Background: Violence against women is an important public-health problem that draws attention of a wide ... try study on women's health and domestic violence (DV) showed that the lifetime ..... Malaysia. All Women's ...

  13. Role of Adult Attachment in the Intergenerational Transmission of Violence: Mediator, Moderator, or Independent Predictor?

    National Research Council Canada - National Science Library

    Merrill, Lex L; Thomsen, Cynthia J; Crouch, Julie L; May, Patricia; Gold, Steven R; Milner, Joel S

    2002-01-01

    ...], child sexual abuse [CSA], domestic violence [DV]) on adult CPA risk and examined whether adult attachment serves as a mediator or moderator of these relationships, or as an independent predictor of CPA risk...

  14. Association between domestic violence and miscarriage: a population-based cross-sectional study among women of childbearing ages, Sivas, Turkey.

    Science.gov (United States)

    Nur, Naim

    2014-01-01

    Violence against women is a global issue, with ramifications for the reproductive health of women. The current study examined the relation of domestic violence (DV) to miscarriage among women who were victimized during their last pregnancy. The study was conducted in Sivas city center, in Turkey. Associations between self-reported DV and miscarriage were analyzed using multiple regression modeling. Physical and/or sexual DV during the last pregnancy was reported by 10.0% and 6.2% of women, respectively. Women who experienced physical violence were 2.5 times as likely (Odds Ratio (OR) = 2.47, 95% confidence interval [CI]: 1.37-4.84, p = .003) to have experienced a miscarriage than women who did not report physical violence. These findings suggest that victims who experience physical violence during the last pregnancy may be more likely to experience miscarriage. Preventing DV, especially physical violence, may, therefore, be beneficial for avoiding adverse pregnancy outcomes.

  15. Jeff's Reef Oculina Banks Clelia Dive 607 2001 Digital Imagery - Captured from Videotapes taken during Submersible Dives to the Oculina Banks Deep Sea Coral Reefs (NODC Accession 0047190)

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — Digitial imagery, mpegs and jpegs, captured from mini-DV magnetic videotapes collected with an underwater 3-chip CCD color video camera, deployed from the research...

  16. Ending domestic violence against women: assessment of ...

    African Journals Online (AJOL)

    Ending domestic violence against women: assessment of knowledge and ... Methods: A descriptive cross-sectional design was utilized for this study. ... study documented poor knowledge and perception of DV among the studied population.

  17. DIAGNOSTIC VALUE OF THE DEJA VU PHENOMENON IN THE CLINICAL PICTURE OF GLIAL BRAIN TUMORS

    Directory of Open Access Journals (Sweden)

    Pavel Nikolaevich Vlasov

    2009-01-01

    This investigation was undertaken to study the implication of the DV phenomenon in the clinical picture of glial brain tumors (GBT. One hundred and sixty-one subjects (mean age 29,2±6,4 years; males 47%, including 129 healthy individuals and 32 patients with GBT, were examined. In the clinical picture of GBT with seizures, DV is a common symptom that is encountered in the involvement of predominantly the right temporal lobe and accompanied by generalized convulsive attacks and olfactory hallucinations. DV in GBT occurs more than once daily; its duration is a few (as many as 5 minutes; DV is characterized by a negative emotional tinge and attended by fear

  18. Autophagic machinery activated by dengue virus enhances virus replication

    International Nuclear Information System (INIS)

    Lee, Y.-R.; Lei, H.-Y.; Liu, M.-T.; Wang, J.-R.; Chen, S.-H.; Jiang-Shieh, Y.-F.; Lin, Y.-S.; Yeh, T.-M.; Liu, C.-C.; Liu, H.-S.

    2008-01-01

    Autophagy is a cellular response against stresses which include the infection of viruses and bacteria. We unravel that Dengue virus-2 (DV2) can trigger autophagic process in various infected cell lines demonstrated by GFP-LC3 dot formation and increased LC3-II formation. Autophagosome formation was also observed under the transmission electron microscope. DV2-induced autophagy further enhances the titers of extracellular and intracellular viruses indicating that autophagy can promote viral replication in the infected cells. Moreover, our data show that ATG5 protein is required to execute DV2-induced autophagy. All together, we are the first to demonstrate that DV can activate autophagic machinery that is favorable for viral replication

  19. Sea Star Wasting Disease 2 Years On: What We know, What We Don't Yet Know, and What We are Doing Now to Understand the Disease

    Science.gov (United States)

    Hewson, I.

    2016-02-01

    Sea star wasting disease has affected over 20 species of asterozoa in waters from central Alaska to Baja California, causing extensive mortality and disappearance entirely from some areas. Combined viral, bacterial, eukaryotic microbial, and histological investigations identified the core nano- and micro-biome of sea stars, and elucidated that the Sea Star Associated Densovirus (SSaDV) was the most likely candidate microorganism involved in disease etiology. Direct challenge experiments using tissue homogenates from symptomatic animals injected into asymptomatic individuals revealed that the disease is caused by a virus-sized entity. However, there remains much to be learned about the disease, especially how disease symptoms are generated by SSaDV, how the virus is transmitted between infected and uninfected animals, and why SSaDV may cause disease recently. We performed inoculation trials on SSaDV-naïve sea stars collected from a geographically distant population away from disease-affected areas, and observed viral, bacterial, archaeal, and host transcriptomic responses over time. We also performed surveys of SSaDV in juveniles and larval plankton, as well as the environmental distribution and stability of SSaDV in key regions where SSWD has all but wiped out adults. Our results suggest that SSaDV must move around either on particles or by direct contact between animals, since decay rates exceed reasonable transmission times based on sea star abundance. Global surveys of sea star-associated viruses also elucidate that SSaDV may have been present in populations of sea stars from Hong Kong around the same time of the 2013-2015 epidemic.

  20. ESLAV/ECLAM/LAVA/EVERI recommendations for the roles, responsibilities and training of the laboratory animal veterinarian and the designated veterinarian under Directive 2010/63/EU

    DEFF Research Database (Denmark)

    Poirier, G M; Bergmann, C; Denais-Lalieve, D G

    2015-01-01

    on the role of the DV. The role and responsibilities of the DV include the development, implementation and continuing review of an adequate programme for veterinary care at establishments breeding and/or using animals for scientific purposes. The programme should be tailored to the needs of the establishment...... professional development on the basis of a gap analysis. A tiered approach to further training in laboratory animal veterinary medicine and science offers career development pathways that are mutually beneficial to LAVs and establishments....

  1. Wireless Sensor Network Localization Research

    OpenAIRE

    Liang Xin

    2014-01-01

    DV-Hop algorithm is one of the important range-free localization algorithms. It performs better in isotropic density senor networks, however, it brings larger location errors in random distributed networks. According to the localization principle of the DV-Hop algorithm, this paper improves the estimation of average single hop distance by using the Least Equal Square Error, and revises the estimated distance between the unknown node and the anchor node with compensation coefficient considerin...

  2. Characterization of a genome-specific Gypsy-like retrotransposon ...

    Indian Academy of Sciences (India)

    Aegilops ventricosa. As 106. DvDvMvMv. Ae. uniaristata. As136. M. Ae. tauschii. 38. D. T. durum - D. villosum amphipoild. Th1w, Th2w, Th3w, Th1,Th3. ABV. T. aestivum (CS) - D. villorum additional lines. Add. *. 1V-7V. ABDV. *. Add. indicates wheat - D. villosum addition lines. Journal of Genetics, Vol. 92, No. 1, April 2013.

  3. Non-canonical dorsoventral patterning in the moth midge Clogmia albipunctata

    Directory of Open Access Journals (Sweden)

    Karl R. Wotton

    2017-11-01

    Full Text Available Abstract Background Bone morphogenetic proteins (BMPs are of central importance for dorsal–ventral (DV axis specification. They are core components of a signalling cascade that includes the BMP ligand decapentaplegic (DPP and its antagonist short gastrulation (SOG in Drosophila melanogaster. These components are very ancient, with orthologs involved in DV patterning in both protostomes and deuterostomes. Despite such strong conservation, recent comparative work in insects has revealed interesting differences in the way the patterning function of the DV system is achieved in different species. Results In this paper, we characterise the expression patterns of the principal components of the BMP DV patterning system, as well as its signalling outputs and downstream targets, in the non-cyclorrhaphan moth midge Clogmia albipunctata (Diptera: Psychodidae. We previously reported ventral expression patterns of dpp in the pole regions of C. albipunctata blastoderm embryos. Strikingly, we also find ventral sog and posteriorly restricted tkv expression, as well as expanded polar activity of pMad. We use our results from gene knock-down by embryonic RNA interference to propose a mechanism of polar morphogen shuttling in C. albipunctata. We compare these results to available data from other species and discuss scenarios for the evolution of DV signalling in the holometabolan insects. Conclusions A comparison of gene expression patterns across hemipteran and holometabolan insects reveals that expression of upstream signalling factors in the DV system is very variable, while signalling output is highly conserved. This has two major implications: first, as long as ligand shuttling and other upstream regulatory mechanisms lead to an appropriately localised activation of BMP signalling at the dorsal midline, it is of less importance exactly where the upstream components of the DV system are expressed. This, in turn, explains why the early-acting components of

  4. EEG characteristics of déjà vu phenomenon

    OpenAIRE

    Chervyakov, Alexander V.; Gnezditskii, Victor V.; Vlasov, Pavel N.; Kalmykova, Galina V.

    2013-01-01

    Introduction. Déjà vu (DV, from French “already seen”) is an aberration of psychic activity associated with transitory erroneous perception of novel circumstances, objects, or people as already known. Aim. Investigation of clinical and diagnostic significance of derealization episodes in epilepsy. Materials and methods. The study involved 166 individuals (mean age 25.2 ± 9.2 yrs; 63.2% women). DV episodes were characterized and compared in groups of healthy volunteers (n = 139) and epilepsy...

  5. A One-Dimensional, Noniterative Trajectory Model (With a C++ Implementation)

    Science.gov (United States)

    2014-03-01

    maF = (6) 2 2 1 AvC m a Dρ−=⇒ (7) Next, the definitions of speed and acceleration can be used to find acceleration as a function of speed and...position: dt dxv ≡ (8) and dt dx dx dv dt dva =≡ (9) dx dvva =⇒ (10) Combining equations 7 and 10, AvC mdx dv Dρ2 1 −= (11) Next

  6. Comparison of domestic violence against women in urban versus rural areas of southeast Nigeria

    Science.gov (United States)

    Ajah, Leonard Ogbonna; Iyoke, Chukwuemeka Anthony; Nkwo, Peter Onubiwe; Nwakoby, Boniface; Ezeonu, Paul

    2014-01-01

    Background The perception and prevalence of domestic violence (DV) in rural areas is poorly understood; the result is that most efforts at eradicating this harmful practice are concentrated in urban areas. The objective of the study was to compare the burden and perception of DV among women living in rural and urban Igbo communities of southeast Nigeria. Methods This was a comparative, cross-sectional study of women residing in rural and urban communities in Enugu, Nigeria, who had gathered for an annual religious meeting from August 1–7, 2011. Data analysis involved descriptive and inferential statistics and was conducted with the Statistical Package for Social Sciences, software version 17.0, at a 95% level of confidence. Results A total of 836 women who met the eligibility criteria participated in the survey. Of these, 376 were from Okpanku, a rural community, while 460 were from Ogui Nike, an urban community. The prevalence of DV among rural women was significantly higher than that among urban women (97% versus 81%, P<0.001). In particular, the prevalence of physical violence was significantly higher among rural women than among urban women (37.2% versus 23.5%; P=0.05). In contrast, rural and urban women did not differ significantly in the proportions that had experienced psychological or sexual violence. The proportion of women who believed that DV was excusable was significantly higher among rural dwellers than among urban dwellers (58.5% versus 29.6%; P=0.03). Conclusion The burden of DV against women may be higher in rural communities than in urban communities in southeast Nigeria. More rural women perceived DV as excusable; this finding suggests that factors that sustain DV could be strong in rural areas. A comprehensive program to curb DV in this area may need to significantly involve the rural areas. PMID:25336992

  7. The association of domestic violence and social resources with functioning in an adult trauma-affected sample living in Kurdistan, Northern Iraq

    Science.gov (United States)

    Kane, Jeremy C.; Hall, Brian J.; Bolton, Paul; Murray, Laura K.; Ahmed, Ahmed Mohammed Amin; Bass, Judith K.

    2016-01-01

    Ability to function in tasks and activities is an important aspect of daily living. There are factors that increase the risk for impaired functioning, such as experiences of domestic violence (DV) and other trauma types, and factors that provide a buffer to existing risks and allow the individual to continue and build functioning, such as access to social resources. This cross-sectional study investigated the direct effects of DV and access to social resources (perceived social support, social integration, and frequency of social contact), as well as their potential interactive effects, on daily functioning among 894 male and female trauma survivors who attended primary care clinics in Kurdistan, Iraq in 2009 and 2010. Experiencing DV was not associated with functioning for males (p=.15) or females (p=.60), suggesting that in the context of a trauma-affected sample, the experience of DV may not significantly increase the risk for functional impairment. Greater amounts of social integration were associated with less functional impairment among males (p<.01) and females (p<.05); social integration was associated with less functional impairment among males only (p<.01); and frequency of social contact was associated with less functional impairment among females only (p<.05), indicating that the association between social resource type and functioning differed by gender. Standardized beta coefficients indicated that social resources had a stronger effect on functioning among men compared to women. Among males who experienced DV, social integration was the only social resource associated with less functional impairment (p<.01); among male trauma survivors who did not experience DV, social support was the only resource associated with less functional impairment (p<.01). Further investigation into the association of social resources with functioning and how these differ by gender and DV exposure is warranted to inform intervention strategies for survivors of DV and other

  8. Human Deception Detection from Whole Body Motion Analysis

    Science.gov (United States)

    2015-12-01

    associated with incentivized deception, an initial reward /punishment protocol was designed to apply a level of stakes/significance to the checkpoint...questionnaire asking them about their emotions and deception strategy . Once completed, the participants removed all the markers and changed into their... Sony MiniDV Handycam® Camcorder, Model # DCR-HC38. All camera footage were saved to MiniDV tape and then transferred to a PC for processing. Once

  9. The Role of Social Support on the Relationship between Gender and Career Progression in STEM Academia

    Science.gov (United States)

    2015-03-26

    sciences. According to the article, gender stereotyping was still an issue for women in STEM while treatment in other fields improved. The authors...Minimum Maximum Sum Mean Std. Deviation Gender DV (1= Male ) .00 1.00 50.00 .7692 .42460 Google Scholar Articles 0 192 2658 42.87 38.863 Years...Predictors: (Constant), Gender DV (1= Male ) Dependent Variable: Rank Results of analysis supported the hypothesis that gender is a predictor of the

  10. Monitoring daily and sub-daily variations in crustal strain with seismic arrays

    Science.gov (United States)

    Mao, S.; Campillo, M.; van der Hilst, R. D.; Brenguier, F.; Hillers, G.

    2017-12-01

    We demonstrate that we can monitor deformation of the shallow crust (with hourly temporal resolution) directly with seismic waves, by measuring relative seismic wave speed changes (dv/v) due to relatively known periodical forcing (tides and changes in atmospheric temperature) at Piton de la Fournaise Volcano (PdF), La Réunion. We use ambient seismic noise recorded (for one month) at VolcArray, an experiment with three arrays of 49 vertical-component geophones deployed on a 7x7 grid of approximately 80 m spacing. Through noise-based coda wave interferometry we infer for each array the average relative changes in propagation speed of seismic waves (dv/v) as a function of time, which relate to temporal changes in medium properties within 100m depth. The variations in dv/v ( 0.05%) on time-scales longer than a day are best explained by effects of precipitation on pore pressure. In contrast, the (weaker) daily and sub-daily fluctuations of dv/v ( 0.01%) are likely to be caused by tidal and thermal effects. We verify that the inferred variations of dv/v are unrelated to spatiotemporal changes of noise wavefields. We further compare the power spectrum of dv/v with spectra of simulated tide-induced volumetric strain, temperature records, very broadband (VBB) seismograms, and borehole tilt records. In all five types of data, dominant peaks are found at around diurnal, semi-diurnal, and ter-diurnal frequencies. A comparison of phase and spectra of the data suggests that the tidal and thermal effects on dv/v are of similar magnitude but vary with frequency. Theoretical modeling of tide- and temperature-induced strain in different frequency bands agrees with the relative magnitude of the two effects on dv/v from passive monitoring.

  11. The Relationship Between Maternal Domestic Violence and Infant and Toddlers' Emotional Regulation: Highlighting the Need for Preventive Services.

    Science.gov (United States)

    Geyer, Chelsea; Ogbonnaya, Ijeoma Nwabuzor

    2017-11-01

    In an effort to further understand the impact of domestic violence (DV) on infant and toddlers' development, this research utilized data from the second cohort of National Survey of Child and Adolescent Well-Being (NSCAW II) to examine the relationship between maternal DV and infant and toddlers' emotional regulation, and determine whether mothers' receipt of DV services mediated this relationship. The sample was limited to children aged 0 to 3 years and included (a) infants less than 1 year old ( n = 603), (b) infants 1 to less than 2 years old ( n = 310), and (c) toddlers 2 to 3 years old ( n = 268). Infant/toddlers' emotional regulation was measured using mothers' response on the How My Infant/Toddler/Child Usually Acts questionnaire. In addition, data were collected to assess whether (a) active DV was present during the time of the Child Protective Services (CPS) investigation and (b) mothers received DV services during the past year. Study research questions were examined using a series of multiple regression analyses. Mediation was tested based on Baron and Kenny's recommended model for establishing mediation. The mediational model was not found to be significant; however, a positive relationship existed between maternal DV and emotional regulation among infants aged less than 1 year old (β = 1.61, p = .039). There were no statistically significant relationships between DV and emotional regulation in the other age groups. These findings highlight the need to provide CPS-involved families victimized by DV with services that focus on preventing poor infant emotional regulation.

  12. Simulating and Testing a DC-DC Half-Bridge SLR Converter

    Science.gov (United States)

    2013-06-01

    future pulse power demands with ship power, a large bank of capacitors or similar rapid discharge source is required. If capacitors are charged...Single Pulsed Avalanche Energy (j) I" Avalanche Current (i) E,, Repetilive Avalanche Energy (i) dv/dt Peak Diode Recovery dv/dt ® Po Total Power...SLR), battery charging, DC-DC, pulse power, power electronics, SLR converter 15. NUMBER OF PAGES 119 16. PRICE CODE 17. SECURITY CLASSIFICATION

  13. The Prospects of SAS Interferometry for Detection and Classification (SAS Interferometrie voor Detectie en Classificatie)

    Science.gov (United States)

    2008-10-01

    DV2008A176 Opdrachtnummer Datum October 2008 Auteur (s) dr. R. van Vossen B.A.J. Quesson dr.ir. J.C. Sabel Rubricering rapport Ongerubriceerd TH9...TNO report | TNO-DV 2008 A176 4/44 Summary This report presents an overview of the theory and implementation of interferometric SAS processing at TNO... theory in software has been tested on two types of data, simulated and measured. Chapter 3 presents results obtained with simulated data; Chapter 4

  14. Efficient Hybrid Watermarking Scheme for Security and Transmission Bit Rate Enhancement of 3D Color-Plus-Depth Video Communication

    Science.gov (United States)

    El-Shafai, W.; El-Rabaie, S.; El-Halawany, M.; Abd El-Samie, F. E.

    2018-03-01

    Three-Dimensional Video-plus-Depth (3DV + D) comprises diverse video streams captured by different cameras around an object. Therefore, there is a great need to fulfill efficient compression to transmit and store the 3DV + D content in compressed form to attain future resource bounds whilst preserving a decisive reception quality. Also, the security of the transmitted 3DV + D is a critical issue for protecting its copyright content. This paper proposes an efficient hybrid watermarking scheme for securing the 3DV + D transmission, which is the homomorphic transform based Singular Value Decomposition (SVD) in Discrete Wavelet Transform (DWT) domain. The objective of the proposed watermarking scheme is to increase the immunity of the watermarked 3DV + D to attacks and achieve adequate perceptual quality. Moreover, the proposed watermarking scheme reduces the transmission-bandwidth requirements for transmitting the color-plus-depth 3DV over limited-bandwidth wireless networks through embedding the depth frames into the color frames of the transmitted 3DV + D. Thus, it saves the transmission bit rate and subsequently it enhances the channel bandwidth-efficiency. The performance of the proposed watermarking scheme is compared with those of the state-of-the-art hybrid watermarking schemes. The comparisons depend on both the subjective visual results and the objective results; the Peak Signal-to-Noise Ratio (PSNR) of the watermarked frames and the Normalized Correlation (NC) of the extracted watermark frames. Extensive simulation results on standard 3DV + D sequences have been conducted in the presence of attacks. The obtained results confirm that the proposed hybrid watermarking scheme is robust in the presence of attacks. It achieves not only very good perceptual quality with appreciated PSNR values and saving in the transmission bit rate, but also high correlation coefficient values in the presence of attacks compared to the existing hybrid watermarking schemes.

  15. Modeling Plan-Related Clinical Complications Using Machine Learning Tools in a Multiplan IMRT Framework

    International Nuclear Information System (INIS)

    Zhang, Hao H.; D'Souza, Warren D.; Shi Leyuan; Meyer, Robert R.

    2009-01-01

    Purpose: To predict organ-at-risk (OAR) complications as a function of dose-volume (DV) constraint settings without explicit plan computation in a multiplan intensity-modulated radiotherapy (IMRT) framework. Methods and Materials: Several plans were generated by varying the DV constraints (input features) on the OARs (multiplan framework), and the DV levels achieved by the OARs in the plans (plan properties) were modeled as a function of the imposed DV constraint settings. OAR complications were then predicted for each of the plans by using the imposed DV constraints alone (features) or in combination with modeled DV levels (plan properties) as input to machine learning (ML) algorithms. These ML approaches were used to model two OAR complications after head-and-neck and prostate IMRT: xerostomia, and Grade 2 rectal bleeding. Two-fold cross-validation was used for model verification and mean errors are reported. Results: Errors for modeling the achieved DV values as a function of constraint settings were 0-6%. In the head-and-neck case, the mean absolute prediction error of the saliva flow rate normalized to the pretreatment saliva flow rate was 0.42% with a 95% confidence interval of (0.41-0.43%). In the prostate case, an average prediction accuracy of 97.04% with a 95% confidence interval of (96.67-97.41%) was achieved for Grade 2 rectal bleeding complications. Conclusions: ML can be used for predicting OAR complications during treatment planning allowing for alternative DV constraint settings to be assessed within the planning framework.

  16. 78 FR 69849 - Issuance of an Experimental Use Permit

    Science.gov (United States)

    2013-11-21

    ... http://www.regulations.gov or at the Office of Pesticide Programs Regulatory Public Docket (OPP Docket... Dv49 double stranded RNA (dsRNA) suppression cassette in combination with Bacillus thuringiensis (Bt....105, Cry2Ab2, Vip3Aa20, Dv49 dsRNA, Cry3Bb1, Cry34Ab1, Cry35Ab1, eCry3.1Ab, respectively) are to be...

  17. Development of Milestone Schedules for Selected Logistics Support Directorate Programs. Appendix A. Part 2. Task Summaries.

    Science.gov (United States)

    1987-09-15

    LOGISTIC SUPPORT (ILS) COST ESTIMATE SCODE NUMBER: NONE -ESPONSIBILITY: ROY & ILS ’,!,RATION: 22.00 WORK DAYS A-221 * .9 ..- 9 * PAGE: .LSMTEST SCHEDULE: CE...0/ TIPO SCHEDULE: DV CONDUCT A PERFORMANCE DEMONSTRATION PRIOR TO TECHNICAL TEST CODE NUMBER: NONE (TT) I AND USER TEST (UT) I. RESPONSIBILITY...RESPONSIBILITY: BELVOIR LAB DURATION: 20.00 WORK DAYS ENG DE I SCHEDULE: DV ENGINEERING DESIGN INITIATED. CODE NUMBER: NONE RESPONSIBILITY: BELVOIR LAB

  18. Incidence of Domestic Violence Against Pregnant Females After the Great East Japan Earthquake in Miyagi Prefecture: The Japan Environment and Children's Study.

    Science.gov (United States)

    Sakurai, Kasumi; Nishigori, Hidekazu; Nishigori, Toshie; Mizuno, Satoshi; Obara, Taku; Iwama, Noriyuki; Watanabe, Zen; Ishikuro, Mami; Tatsuta, Nozomi; Nishijima, Ichiko; Sugawara, Junichi; Fujiwara, Ikuma; Arima, Takahiro; Kuriyama, Shinichi; Metoki, Hirohito; Takahashi, Fumiaki; Nakai, Kunihiko; Yaegashi, Nobuo

    2017-04-01

    This study aimed to clarify the correlation between the 2011 Great East Japan Earthquake and domestic violence (DV) against pregnant females after the disaster in Miyagi Prefecture, an area damaged by the earthquake and tsunami. We analyzed 7600 pregnant females from June to December 2011. The incidence of physical and mental DV and the proportions in the inland, north coastal, and south coastal areas of Miyagi Prefecture and nationwide were calculated, and a chi-square test was conducted for comparison. The risk factors for DV were estimated with multivariate logistic regression analyses on a prefecture-wide basis. The incidence levels for physical DV were found to be 5.9% in the north coastal area, which was significantly higher than in the inland area (1.3%, P=0.0007) and nationwide (1.5%, P<0.0001). There were no significant differences in the incidence of mental DV between the 3 areas in Miyagi Prefecture (inland 15.2%, north coast 15.7%, and south coast 18.8%) or nationwide (13.8%). Experiencing disease or injury in someone close and changes in the family structure were significantly associated with mental DV in Miyagi Prefecture. Continuous monitoring and support for pregnant females may be necessary to address this issue in disaster-affected areas. (Disaster Med Public Health Preparedness. 2017;11:216-226).

  19. Associations between women's perceptions of domestic violence and contraceptive use in seven countries in West and Central Africa.

    Science.gov (United States)

    Olorunsaiye, Comfort Z; Brunner Huber, Larissa; Laditka, Sarah B; Kulkarni, Shanti; Boyd, A Suzanne

    2017-10-01

    This study examined associations of women's attitudes toward domestic violence (DV) and contraceptive use in West and Central Africa. We used data from the Multiple Indicator Cluster Surveys for women in seven countries in West and Central Africa (2009-2011, n=80,055). We measured contraceptive use as none, traditional, or modern contraceptives. DV approval was measured as no, low, or high tolerance of wife beating. Multinomial logistic regression estimated odds of using traditional or modern methods versus none, adjusting for age, education, wealth, residence, parity, marital structure, spousal age-difference, and religion. Many women had no or low DV tolerance (41%, 44%, respectively); most used no contraception (81%). In adjusted results, women with low DV tolerance had lower odds of using traditional contraceptive methods (odds ratio, OR=0.87; 95% confidence interval, CI: 0.78-0.98) or modern methods (OR=0.86; 95% CI: 0.78-0.95) compared to women with no tolerance. Women with high DV tolerance had 28% lower odds of traditional contraceptive use (95% CI: 0.60-0.90), and 38% lower odds of modern contraceptive use (95% CI: 0.59-0.88) compared to women with no tolerance. The high prevalence of DV approval may threaten the success of programs aimed at improving women's reproductive health, including contraceptive use. Copyright © 2017 Elsevier B.V. All rights reserved.

  20. Exploring domestic violence and social distress in Australian-Indian migrants through community theater.

    Science.gov (United States)

    O'Connor, Manjula; Colucci, Erminia

    2016-02-01

    In many parts of the world, young adult women have higher levels of common mental disorders than men. The exacerbation of domestic violence (DV) by migration is a salient social determinant of poor mental health. Ecological models describe factors contributing to DV as operating at individual, family, cultural, and societal levels. We explored the interplay among these factors in an Indian community living in Melbourne, Australia, in a qualitative participatory action research study using a modified Forum Theater approach. We here present findings on connections between migration, societal factors, and social/family/cultural factors in DV. The study captured the voices of women living in the community as they describe how DV contributes to their emotional difficulties. Improved understanding of the sociocultural dynamics of DV and the associated social distress in this migrant Indian community can be used to guide the development of culturally sensitive prevention and response programs to assist migrant women from the Indian subcontinent who present with psychopathology and suicidal behaviors associated with DV. © The Author(s) 2015.

  1. Three-dimensional reconstruction volume: a novel method for volume measurement in kidney cancer.

    Science.gov (United States)

    Durso, Timothy A; Carnell, Jonathan; Turk, Thomas T; Gupta, Gopal N

    2014-06-01

    The role of volumetric estimation is becoming increasingly important in the staging, management, and prognostication of benign and cancerous conditions of the kidney. We evaluated the use of three-dimensional reconstruction volume (3DV) in determining renal parenchymal volumes (RPV) and renal tumor volumes (RTV). We compared 3DV with the currently available methods of volume assessment and determined its interuser reliability. RPV and RTV were assessed in 28 patients who underwent robot-assisted laparoscopic partial nephrectomy for kidney cancer. Patients with a preoperative creatinine level of kidney pre- and postsurgery overestimated 3D reconstruction volumes by 15% to 102% and 12% to 101%, respectively. In addition, volumes obtained from 3DV displayed high interuser reliability regardless of experience. 3DV provides a highly reliable way of assessing kidney volumes. Given that 3DV takes into account visible anatomy, the differences observed using previously published methods can be attributed to the failure of geometry to accurately approximate kidney or tumor shape. 3DV provides a more accurate, reproducible, and clinically useful tool for urologists looking to improve patient care using analysis related to volume.

  2. The impact of domestic violence exposure on South Asian children in the United States: Perspectives of domestic violence agency staff.

    Science.gov (United States)

    Ragavan, Maya I; Fikre, Tsion; Millner, Uma; Bair-Merritt, Megan

    2018-02-01

    The South Asian community is the fastest growing ethnic group in the United States, and past research suggests that South Asian domestic violence (DV) survivors may require culturally-specific resources. Similarly, South Asian children in the US exposed to DV may have unique responses and needs, but this has not been explored to date. The objective of this study was to examine the specific needs of South Asian children exposed to DV from the vantage point of staff from South Asian DV agencies across the United States. Thirty interviews were conducted, with data coded and consolidated into larger themes using thematic analysis. Participants described several factors important to understanding the impact of DV on South Asian children including the role of the extended family, identifying with two cultures, fear about what the South Asian community will think, gender differences, and the importance of projecting an image of perfection. Participants also discussed development of culturally-tailored resources. This study suggests the importance of framing South Asian children's experiences within the context of interweaving South Asian and American cultural values, with careful attention paid to how potential culture clashes between parents and children may impact the way children process trauma. Further work should triangulate these themes with children, parents, and extended family, as well as collaborate with South Asian DV agencies to design child-focused programs. Copyright © 2017 Elsevier Ltd. All rights reserved.

  3. The TIM and TAM families of phosphatidylserine receptors mediate dengue virus entry.

    Science.gov (United States)

    Meertens, Laurent; Carnec, Xavier; Lecoin, Manuel Perera; Ramdasi, Rasika; Guivel-Benhassine, Florence; Lew, Erin; Lemke, Greg; Schwartz, Olivier; Amara, Ali

    2012-10-18

    Dengue viruses (DVs) are responsible for the most medically relevant arboviral diseases. However, the molecular interactions mediating DV entry are poorly understood. We determined that TIM and TAM proteins, two receptor families that mediate the phosphatidylserine (PtdSer)-dependent phagocytic removal of apoptotic cells, serve as DV entry factors. Cells poorly susceptible to DV are robustly infected after ectopic expression of TIM or TAM receptors. Conversely, DV infection of susceptible cells is inhibited by anti-TIM or anti-TAM antibodies or knockdown of TIM and TAM expression. TIM receptors facilitate DV entry by directly interacting with virion-associated PtdSer. TAM-mediated infection relies on indirect DV recognition, in which the TAM ligand Gas6 acts as a bridging molecule by binding to PtdSer within the virion. This dual mode of virus recognition by TIM and TAM receptors reveals how DVs usurp the apoptotic cell clearance pathway for infectious entry. Copyright © 2012 Elsevier Inc. All rights reserved.

  4. The relationship between women's mental health and domestic violence in semirural areas: a study in Turkey.

    Science.gov (United States)

    Savas, Nazan; Agridag, Gulseren

    2011-05-01

    The authors examine the relationship between emotional disorders and domestic violence (DV) in 395 women of different ethnicities in Turkey. PRIME MD (Primary Care Evaluation of Mental Disorders) was used for diagnosis. This is a cross-sectional and epidemiological research. showed that the prevalence of emotional disorders, anxiety, and somatoform disorders was 22.8%, 24.8%, and 16.9%, respectively. The mean DV score was 2.98±1.32 over 10.00. DV scores were higher when women did not want to get married or did not have their family's blessing for marriage. Observed scores were also high for civil marriage cases, or when women had a job, had low income, or were afraid of their husbands (P<.05). The number of comorbid diagnoses increased with increase in DV scores (P<.001). Mean DV scores were higher for women diagnosed with major depression, partial remission or recurrence of major depression, panic disorder, and common anxiety (P<.05). The authors recommend that if physicians suspect any emotional disorders in women in primary care, they should evaluate for DV.

  5. Comparison of injection pain caused by the DentalVibe Injection System versus a traditional syringe for inferior alveolar nerve block anaesthesia in paediatric patients.

    Science.gov (United States)

    Elbay, M; Şermet Elbay, Ü; Yıldırım, S; Uğurluel, C; Kaya, C; Baydemir, C

    2015-06-01

    To compare paediatric patients' pain during needle insertion and injection in inferior alveoler nerve block (IANB) anaesthesia injected by either a traditional syringe (TS) or the DentalVibe Injection Comfort System (DV). the study was a randomised controlled crossover clinical trial, comprised of 60 children aged 6-12 requiring an operative procedure with IANB anaesthesia on their mandibular molars bilaterally. One of the molar teeth was treated with TS and the contralateral tooth was treated with DV. On each visit, subjective and objective pain was evaluated using the Wond-Baker Faces Pain Rating Scale (PRS) and the Face, Legg, Cry, Consolability Scale (FLACC Scale). Patients were asked which anaesthesia technique they preferred. Data were analysed using Wilcoxon signed rank, Spearman correlation, and Mann-Whitney U tests. There were no statistically significant differences for pain evalution during needle insertion and injection of each injection system. However, a negative correlation was found on the FLACC between age and pain scores during injection after using DV. Paediatric patients experienced similar pain during IANB anaesthesia administered with TS and DV. With increased age, pain values reduced during anaesthetic agent injection with DV according to FLACC. The traditional procedure was preferred to DV in paediatric patients.

  6. Descompensación distal postoperatoria (D.D.P. en curvas lenke 1a tratadas con tornillos pediculares: una revisión de 63 casos Descompensação distal pós-operatória (DDP em curvaturas lenke 1a tratadas com parafusos pediculares: análise de 63 casos Postoperative distal decompensation (PDD in lenke 1a curvatures treated with pedicular screws: analysis of 63 cases

    Directory of Open Access Journals (Sweden)

    Norberto Ventura

    2012-06-01

    Full Text Available OBJETIVO: Identificar los factores de riesgo de descompensación distal postoperatoria (D.D.P. y definir una estrategia quirúrgica segura en curvas tipo Lenke 1A tratadas con tornillos pediculares. MÉTODO: Estudio radiológico retrospectivo de 63 pacientes con escoliosis Lenke 1A, con un seguimiento mínimo de un año. Se evaluó, edad, sexo, grados Cobb, signo de Risser, relación de la vértebra distal instrumentada (V.D.I. con la vértebra distal de la curva (V.D., vértebra estable (V.E. y con la vértebra, cuya distancia a la línea central vertical al sacro (L.V.S. era superior a 10 mm "distancia vertebral" (D.V.. RESULTADOS: 8 casos (12,7% desarrollaron D.D.P. El signo de Risser fue 0 en 2 pacientes (25% y I en 2 pacientes (25%. Relación de V.D.I. con V.D.: 4 pacientes (50% mismo nivel (V.D. +0, 4 pacientes (50% un nivel caudal (V.D. (+1; relación V.D.I. con V.E.: 5 pacientes (62,5% 2 niveles cefálicos (V.E -2, 3 pacientes (37,5% 1 nivel cefálico (V. E.-1; relación V.D.I. con D.V.: 5 pacientes (62,5% un nivel cefálico D.V. (-1, 3 pacientes mismo nivel (D.V.+ 0. CONCLUSIONES: Riesgo de descompensación distal postoperatoria: V.D.I. mismo nivel V.D. (V.D. + 0, 2 niveles cefálicos V.E. (V.E.-2, 1 nivel cefálico D.V. (D.V. -1. Estrategia quirúrgica curvas Lenke 1A: V.D.I: 1/2 niveles caudales a V.D. (V.D. +1/+2, un nivel cefálico a V.E. (V.E -1, mismo nivel D.V. (D.V. +0.OBJETIVO: Identificar os fatores de risco de descompensação distal pós-operatória (DDP e definir estratégia cirúrgica de segurança em curvaturas de Lenke 1A, tratadas com parafusos pediculares. MÉTODO: Estudo radiológico retrospectivo de 63 pacientes com escoliose Lenke 1A, com acompanhamento mínimo de um ano. Os parâmetros avaliados foram idade, sexo, graus do ângulo de Cobb, sinal de Risser, relação da vértebra distal instrumentada (VDI com a vértebra distal da curvatura (VD, com a vértebra estável (VE e com a vértebra cuja distância da linha

  7. Geometric and electronic structures of mono- and di-vacancies in phosphorene.

    Science.gov (United States)

    Hu, Ting; Dong, Jinming

    2015-02-13

    The geometric structures, stabilities and diffusions of the monovacancy (MV) and divacancy (DV) in two-dimensional phosphorene, as well as their influences on their vibrational and electronic properties have been studied by first-principles calculations. Two possible MVs and 14 possible DVs have been found in phosphorene, in which the MV-(5|9) with a pair of pentagon-nonagon is the ground state of MVs, and the DV-(5|8|5) with a pentagon-octagon-pentagon structure is the most stable DV. All 14 DVs could be divided into four basic types based upon their topological structures and transform between different configurations via bond rotations. The diffusion of MV-(5|9) is found to exhibit an anisotropic character, preferring to migrate along the zigzag direction in the same half-layer. The introduction of MV and DV in phosphorene influences its vibrational properties, inducing the localized defect modes, which could be used to distinguish different vacancy structures. The MVs and DVs also have a significant influence on the electronic properties of phosphorene. It is found that the phosphorene with MV-(5|9) is a ferromagnetic semiconductor with the magnetic moment of 1.0 μB and a band gap of about 0.211 eV, while the DV induces a direct-indirect band gap transition. Our calculation results on the MV and DV in phosphorene are important for the promising application of the phosphorene in the nanoelectronics.

  8. Multi-Rocket Thought Experiment

    Science.gov (United States)

    Smarandache, Florentin

    2014-03-01

    We consider n>=2 identical rockets: R1 ,R2 , ..., Rn. Each of them moving at constant different velocities respectively v1 ,v2 , ..., vn on parallel directions in the same sense. In each rocket there is a light clock, the observer on earth also has a light clock. All n + 1 light clocks are identical and synchronized. The proper time Δt' in each rocket is the same. (1) If we consider the observer on earth and the first rocket R1, then the non-proper time Δt of the observer on earth is dilated with the factor D(v1) : or Δt = Δt' D(v1) (1) But if we consider the observer on earth and the second rocket R2 , then the non-proper time Δt of the observer on earth is dilated with a different factor D(v2) : or Δt = Δt' D(v2) And so on. Therefore simultaneously Δt is dilated with different factors D(v1) , D(v2), ..., D(vn) , which is a multiple contradiction.

  9. Z předměstí na venkov: nucené přesunutí královéhradeckého obyvatelstva v důsledku výstavby pevnosti ve druhé polovině 18. století // From the oustkirts to the country: the forced relocation of the Hradec Králové population as a result of the construction of the fortress in the second half of the 18th century

    Directory of Open Access Journals (Sweden)

    Jana Vojtíšková

    2017-08-01

    Full Text Available The paper focuses on the case of the Hradec Králové suburban population, which was gradually forced to move after the second half of the 1760s in order to free the area for the building of a bastion fortress. While the first generation of the evacuees (“vybouranci”, as this population was called, moved to new suburban settlements on the very outskirts of the town district and remained in contact with the town community, though separated by the military zone, their descendants had converted their settlements by the mid-19th century to separate municipalities and became new neighbours of the fortress town of Hradec Králové. The present study aims to map this complex process, the consequences of which have been strongly reflected in the urban, demographic and economic development of the town and its immediate surroundings.

  10. Augusta Rozsypalová a Františka Jakubcová v zápase o zastřešující organizaci katolických žen (devadesátá léta 19. století — první světová válka / Augusta Rozsypalová and Františka Jakubcová in the struggle for an umbrella organisation of catholic women (the 1890s — WWI

    Directory of Open Access Journals (Sweden)

    Jiří Havelka

    2016-12-01

    Full Text Available The article focuses on the way in which social and modernization changes affected the thinking of two remarkable Catholic women. It is about negotiation strategies (for the Union of Catholic Women’s Foundation pursued by these women towards Catholic men. Despite a certain pluralism, the author shows that the thinking of Catholic women shifted — but this was not just a question of adopting liberal positions, but their transformation into a specific religious ideology. The image of femininity was still present in the concept of “motherhood“, but not in terms of biological sciences, but in cultural and social terms. It was Catholic feminism, which was not accepted by the mainstream in the Catholic milieu.

  11. Augusta Rozsypalová a Františka Jakubcová v zápase o zastřešující organizaci katolických žen (devadesátá léta 19. století — první světová válka) / Augusta Rozsypalová and Františka Jakubcová in the struggle for an umbrella organisation of catholic women (the 1890s — WWI)

    OpenAIRE

    Jiří Havelka

    2016-01-01

    The article focuses on the way in which social and modernization changes affected the thinking of two remarkable Catholic women. It is about negotiation strategies (for the Union of Catholic Women’s Foundation) pursued by these women towards Catholic men. Despite a certain pluralism, the author shows that the thinking of Catholic women shifted — but this was not just a question of adopting liberal positions, but their transformation into a specific religious ideology. The image of...

  12. The Association of Domestic Violence and Social Resources With Functioning in an Adult Trauma-Affected Sample Living in Kurdistan, Northern Iraq.

    Science.gov (United States)

    Kane, Jeremy C; Hall, Brian J; Bolton, Paul; Murray, Laura K; Mohammed Amin Ahmed, Ahmed; Bass, Judith K

    2016-03-27

    Domestic violence (DV) and other experienced trauma types increase the risk for impaired functioning. Access to social resources may provide a buffer to existing risks and allow individuals to continue and build functioning. This cross-sectional study investigated the direct effects of DV and access to social resources (perceived social support, social integration, and frequency of social contact), as well as their potential interactive effects, on daily functioning among 894 male and female trauma survivors who attended primary care clinics in Kurdistan, Iraq in 2009 and 2010. Experiencing DV was not associated with functioning for males (p=.15) or females (p=.60), suggesting that in the context of a trauma-affected sample, the experience of DV may not significantly increase the risk for functional impairment. Greater amounts of social integration were associated with less functional impairment among males (p<.01) and females (p<.05); social integration was associated with less functional impairment among males only (p<.01); and frequency of social contact was associated with less functional impairment among females only (p<.05), indicating that the association between social resource type and functioning differed by gender. Social resources had a stronger effect on functioning among men compared to women. Among males who experienced DV, social integration was the only social resource associated with less functional impairment (p<.01); among male trauma survivors who did not experience DV, social support was the only resource associated with less functional impairment (p<.01). Further investigation into these associations is warranted to inform intervention strategies for survivors of DV and other traumas in post-conflict settings. © The Author(s) 2016.

  13. Do Three-dimensional Visualization and Three-dimensional Printing Improve Hepatic Segment Anatomy Teaching? A Randomized Controlled Study.

    Science.gov (United States)

    Kong, Xiangxue; Nie, Lanying; Zhang, Huijian; Wang, Zhanglin; Ye, Qiang; Tang, Lei; Li, Jianyi; Huang, Wenhua

    2016-01-01

    Hepatic segment anatomy is difficult for medical students to learn. Three-dimensional visualization (3DV) is a useful tool in anatomy teaching, but current models do not capture haptic qualities. However, three-dimensional printing (3DP) can produce highly accurate complex physical models. Therefore, in this study we aimed to develop a novel 3DP hepatic segment model and compare the teaching effectiveness of a 3DV model, a 3DP model, and a traditional anatomical atlas. A healthy candidate (female, 50-years old) was recruited and scanned with computed tomography. After three-dimensional (3D) reconstruction, the computed 3D images of the hepatic structures were obtained. The parenchyma model was divided into 8 hepatic segments to produce the 3DV hepatic segment model. The computed 3DP model was designed by removing the surrounding parenchyma and leaving the segmental partitions. Then, 6 experts evaluated the 3DV and 3DP models using a 5-point Likert scale. A randomized controlled trial was conducted to evaluate the educational effectiveness of these models compared with that of the traditional anatomical atlas. The 3DP model successfully displayed the hepatic segment structures with partitions. All experts agreed or strongly agreed that the 3D models provided good realism for anatomical instruction, with no significant differences between the 3DV and 3DP models in each index (p > 0.05). Additionally, the teaching effects show that the 3DV and 3DP models were significantly better than traditional anatomical atlas in the first and second examinations (p < 0.05). Between the first and second examinations, only the traditional method group had significant declines (p < 0.05). A novel 3DP hepatic segment model was successfully developed. Both the 3DV and 3DP models could improve anatomy teaching significantly. Copyright © 2015 Association of Program Directors in Surgery. Published by Elsevier Inc. All rights reserved.

  14. Performance of healthcare providers regarding iranian women experiencing physical domestic violence in Isfahan

    Directory of Open Access Journals (Sweden)

    Nasim Yousefnia

    2018-01-01

    Full Text Available Background: Domestic violence (DV can threaten women's health. Healthcare providers (HCPs may be the first to come into contact with a victim of DV. Their appropriate performance regarding a DV victim can decrease its complications. The aim of the present study was to investigate HCPs' performance regarding women experiencing DV in emergency and maternity wards of hospitals in Isfahan, Iran. Materials and Methods: The present descriptive, cross-sectional study was conducted among 300 HCPs working in emergency and maternity wards in hospitals in Isfahan. The participants were selected using quota random sampling from February to May 2016. A researcher-made questionnaire containing the five items of HCPs performance regarding DV (assessment, intervention, documentation, reference, and follow-up was used to collect data. The reliability and validity of the questionnaire were confirmed, and the collected data were analyzed using SPSS software. Cronbach's alpha was used to assess the reliability of the questionnaires. To present a general description of the data (variables, mean, and standard deviation, the table of frequencies was designed. Results: The performance of the participants regarding DV in the assessment (mean = 64.22, intervention (mean = 68.55, and reference stages (mean = 68.32 were average. However, in the documentation (mean = 72.55 and follow-up stages (mean = 23.10, their performance was good and weak respectively (criterion from 100. Conclusions: Based on the results, because of defects in providing services for women experiencing DV, a practical indigenous guideline should be provided to treat and support these women.

  15. Drought increases cowpea (Vigna unguiculata [L.] Walp.) susceptibility to cowpea severe mosaic virus (CPSMV) at early stage of infection.

    Science.gov (United States)

    Silva, Rodolpho G G; Vasconcelos, Ilka M; Martins, Thiago F; Varela, Anna L N; Souza, Pedro F N; Lobo, Ana K M; Silva, Fredy D A; Silveira, Joaquim A G; Oliveira, Jose T A

    2016-12-01

    The physiological and biochemical responses of a drought tolerant, virus-susceptible cowpea genotype exposed to drought stress (D), infected by Cowpea severe mosaic virus (CPSMV) (V), and to these two combined stresses (DV), at 2 and 6 days post viral inoculation (DPI), were evaluated. Gas exchange parameters (net photosynthesis, transpiration rate, stomatal conductance, and internal CO 2 partial pressure) were reduced in D and DV at 2 and 6 DPI compared to control plants (C). Photosynthesis was reduced by stomatal and biochemical limitations. Water use efficiency increased at 2 DPI in D, DV, and V, but at 6 DPI only in D and DV compared to C. Photochemical parameters (effective quantum efficiency of photosystem II and electron transport rate) decreased in D and DV compared to C, especially at 6 DPI. The potential quantum efficiency of photosystem II did not change, indicating reversible photoinhibition of photosystem II. In DV, catalase decreased at 2 and 6 DPI, ascorbate peroxidase increased at 2 DPI, but decreased at 6 DPI. Hydrogen peroxide increased at 2 and 6 DPI. Peroxidase increased at 6 DPI and chitinase at 2 and 6 DPI. β-1,3-glucanase decreased in DV at 6 DPI compared to V. Drought increased cowpea susceptibility to CPSMV at 2 DPI, as verified by RT-PCR. However, at 6 DPI, the cowpea plants overcome this effect. Likewise, CPSMV increased the negative effects of drought at 2 DPI, but not at 6 DPI. It was concluded that the responses to combined stresses are not additive and cannot be extrapolated from the study of individual stresses. Copyright © 2016 Elsevier Masson SAS. All rights reserved.

  16. Comparative mapping of powdery mildew resistance gene Pm21 and functional characterization of resistance-related genes in wheat.

    Science.gov (United States)

    He, Huagang; Zhu, Shanying; Jiang, Zhengning; Ji, Yaoyong; Wang, Feng; Zhao, Renhui; Bie, Tongde

    2016-04-01

    The powdery mildew resistance gene Pm21 was physically and comparatively mapped by newly developed markers. Seven candidate genes were verified to be required for Pm21 -mediated resistance to wheat powdery mildew. Pm21, a gene derived from wheat wild relative Dasypyrum villosum, has been transferred into common wheat and widely utilized in wheat resistance breeding for powdery mildew. Previously, Pm21 has been located to the bin FL0.45-0.58 of 6VS by using deletion stocks. However, its fine mapping is still a hard work. In the present study, 30 gene-derived 6VS-specific markers were obtained based on the collinearity among genomes of Brachypodium distachyon, Oryza and Triticeae, and then physically and comparatively mapped in the bin FL0.45-0.58 and its nearby chromosome region. According to the maps, the bin FL0.45-0.58 carrying Pm21 was closely flanked by the markers 6VS-03 and 6VS-23, which further narrowed the orthologous regions to 1.06 Mb in Brachypodium and 1.38 Mb in rice, respectively. Among the conserved genes shared by Brachypodium and rice, four serine/threonine protein kinase genes (DvMPK1, DvMLPK, DvUPK and DvPSYR1), one protein phosphatase gene (DvPP2C) and two transcription factor genes (DvGATA and DvWHY) were confirmed to be required for Pm21-mediated resistance to wheat powdery mildew by barley stripe mosaic virus-induced gene silencing (BSMV-VIGS) and transcriptional pattern analyses. In summary, this study gives new insights into the genetic basis of the Pm21 locus and the disease resistance pathways mediated by Pm21.

  17. Assessing Domestic Violence Shelter Workers Views and Practices Pertaining to HIV Prevention Services for Women Residing in Domestic Violence Shelters.

    Science.gov (United States)

    Cavanaugh, Courtenay E; Harvey, Jenna; Alexander, Kamila A; Saraczewski, Samantha; Campbell, Jacquelyn C

    2018-06-01

    There is a need for studies to assess domestic violence (DV) shelter workers views about brief HIV prevention interventions for shelter residents to improve these workers' provision of HIV prevention interventions to shelter residents. This mixed methods study assessed DV shelter workers' views about the following: (a) the need for and appropriateness of HIV prevention services within DV shelters, (b) the utility (i.e., acceptability, systems support, understanding, and feasibility) of an HIV Risk Assessment and Safety Plan (HIV RASP) for women in DV shelters, and (c) suggested changes to or concerns about using the HIV RASP. Workers from DV shelters located in the 10 states in the United States with the highest rates of HIV reviewed the HIV RASP and answered survey questions about it including the Usage Rating Profile-Intervention (URP-I) Questionnaire and two open-ended questions. Although workers felt it was appropriate to provide HIV prevention interventions within DV shelters, only 23% reported that HIV prevention interventions had ever been implemented at their shelter and only 42% had provided residents with educational brochures about HIV prevention. Workers generally agreed that the HIV RASP was acceptable, understandable, and feasible. They somewhat disagreed about their ability to implement the tool independently. Findings suggest that little progress has been made in engaging DV shelter workers in HIV prevention efforts for residents during the past decade and reveal ways to improve the HIV RASP and overcome barriers to implementing it. The study findings may be used to help reduce gaps between the science and practice of HIV prevention for abused women.

  18. Polydeoxyribonucleotides and nitric oxide release from guinea-pig hearts during ischaemia and reperfusion.

    Science.gov (United States)

    Masini, E.; Lupini, M.; Mugnai, L.; Raspanti, S.; Mannaioni, P. F.

    1995-01-01

    1. Two polydeoxyribonucleotides, produced by the controlled hydrolysis of DNA of mammalian lung (defibrotide and its lower molecular weight fraction, P.O. 085 DV), were studied for their ability to modify the release of nitrite and the coronary flow in perfusates collected from isolated, normally perfused hearts of guinea-pigs and from hearts subjected to regional ischaemia and reperfusion. 2. In guinea-pig normally perfused hearts, both defibrotide (DFT) and its fraction, P.O. 085 DV, increase the amount of nitrite appearing in perfusates in a concentration-dependent fashion. At the highest concentration studied (10(-6) M), P.O. 085 DV was more effective than DFT. A concomitant increase in the coronary flow was observed. 3. The increase in nitrite in perfusates and the increase in coronary flow induced by both DFT and P.O. 085 DV were significantly reduced by NG-monomethyl-L-arginine (L-NMMA, 10(-4) M), an inhibitor of nitric oxide synthase (NOS). 4. The endothelium-dependent vasodilator, acetylcholine (ACh), enhances the formation of nitrite and the coronary flow. Both the increase in coronary flow and in the formation of nitrite were significantly reduced by L-NMMA (10(-4) M). 5. In guinea-pig hearts subjected to ischaemia and reperfusion, the effect of both compounds in increasing the amount of nitrite in perfusates was more evident and more pronounced with P.O. 085 DV. 6. Reperfusion-induced arrhythmias were significantly reduced by both compounds to the extent of complete protection afforded by compound P.O. 085 DV. 7. The cardioprotective and antiarrhythmic effects of DFT and P.O. 085 DV are discussed. PMID:7582482

  19. Canine distemper virus isolated from a monkey efficiently replicates on Vero cells expressing non-human primate SLAM receptors but not human SLAM receptor.

    Science.gov (United States)

    Feng, Na; Liu, Yuxiu; Wang, Jianzhong; Xu, Weiwei; Li, Tiansong; Wang, Tiecheng; Wang, Lei; Yu, Yicong; Wang, Hualei; Zhao, Yongkun; Yang, Songtao; Gao, Yuwei; Hu, Guixue; Xia, Xianzhu

    2016-08-02

    In 2008, an outbreak of canine distemper virus (CDV) infection in monkeys was reported in China. We isolated CDV strain (subsequently named Monkey-BJ01-DV) from lung tissue obtained from a rhesus monkey that died in this outbreak. We evaluated the ability of this virus on Vero cells expressing SLAM receptors from dog, monkey and human origin, and analyzed the H gene of Monkey-BJ01-DV with other strains. The Monkey-BJ01-DV isolate replicated to the highest titer on Vero cells expressing dog-origin SLAM (10(5.2±0.2) TCID50/ml) and monkey-origin SLAM (10(5.4±0.1) TCID50/ml), but achieved markedly lower titers on human-origin SLAM cells (10(3.3±0.3) TCID50/ml). Phylogenetic analysis of the full-length H gene showed that Monkey-BJ01-DV was highly related to other CDV strains obtained during recent CDV epidemics among species of the Canidae family in China, and these Monkey strains CDV (Monkey-BJ01-DV, CYN07-dV, Monkey-KM-01) possessed a number of amino acid specific substitutions (E276V, Q392R, D435Y and I542F) compared to the H protein of CDV epidemic in other animals at the same period. Our results suggested that the monkey origin-CDV-H protein could possess specific substitutions to adapt to the new host. Monkey-BJ01-DV can efficiently use monkey- and dog-origin SLAM to infect and replicate in host cells, but further adaptation may be required for efficient replication in host cells expressing the human SLAM receptor.

  20. Temporal Variability in Seismic Velocity at the Salton Sea Geothermal Field

    Science.gov (United States)

    Taira, T.; Nayak, A.; Brenguier, F.

    2015-12-01

    We characterize the temporal variability of ambient noise wavefield and search for velocity changes associated with activities of the geothermal energy development at the Salton Sea Geothermal Field. The noise cross-correlations (NCFs) are computed for ~6 years of continuous three-component seismic data (December 2007 through January 2014) collected at 8 sites from the CalEnergy Subnetwork (EN network) with MSNoise software (Lecocq et al., 2014, SRL). All seismic data are downloaded from the Southern California Earthquake Data Center. Velocity changes (dv/v) are obtained by measuring time delay between 5-day stacks of NCFs and the reference NCF (average over the entire 6 year period). The time history of dv/v is determined by averaging dv/v measurements over all station/channel pairs (252 combinations). Our preliminary dv/v measurement suggests a gradual increase in dv/v over the 6-year period in a frequency range of 0.5-8.0 Hz. The resultant increase rate of velocity is about 0.01%/year. We also explore the frequency-dependent velocity change at the 5 different frequency bands (0.5-2.0 Hz, 0.75-3.0 Hz, 1.0-4.0 Hz, 1.5-6.0 Hz, and 2.0-8.0 Hz) and find that the level of this long-term dv/v variability is increased with increase of frequency (i.e., the highest increase rate of ~0.15%/year at the 0.5-2.0 Hz band). This result suggests that the velocity changes were mostly occurred in a depth of ~500 m assuming that the coda parts of NCFs (~10-40 s depending on station distances) are predominantly composed of scattered surface waves, with the SoCal velocity model (Dreger and Helmberger, 1993, JGR). No clear seasonal variation of dv/v is observed in the frequency band of 0.5-8.0 Hz.

  1. Association between gap in spousal education and domestic violence in India and Bangladesh.

    Science.gov (United States)

    Rapp, Daniel; Zoch, Beate; Khan, M Mobarak H; Pollmann, Thorsten; Krämer, Alexander

    2012-06-21

    Domestic violence (DV) against women is a serious human rights abuse and well recognised global public health concern. The occurrence of DV is negatively associated with the educational level of spouses but studies dealing with educational discrepancies of spouses show contradicting results: Wives with higher education than their husbands were more likely to ever experience DV as compared to equally educated couples. The purpose of this study was to investigate the association between spousal education gap (SEG) and the prevalence and severity of DV in India and Bangladesh. Nationally representative data collected through the 2005/2006 Indian National Family Health Survey (NFHS-3) and 2007 Bangladesh Demographic and Health Survey (BDHS) were used. In total, we analysed data of 69,805 women aged 15-49 years (Bangladesh: 4,195 women, India: 65,610 women). In addition to univariate and bivariable analyses, a multinomial logistic regression model was used to quantify the association between education gap and less severe as well as severe domestic violence. Adjustment was made for age, religion, and family structure. Wives with higher education than their husbands were less likely to experience less severe (OR = 0.83, 95% CI: 0.77-0.89) and severe (OR = 0.79, 95% CI: 0.72-0.87) DV as compared to equally low-educated spouses (reference group). Equally high-educated couples revealed the lowest likelihood of experiencing DV (severe violence: OR 0.43, CI 0.39-0.48; less severe violence: OR 0.59, CI 0.55-0.63). The model's goodness of fit was low (Nagelkerke's R2 = 0.152). Our analysis revealed no increased DV among wives with a higher educational level than their husbands. Moreover, the results point towards a decrease of severe violence with an increase in education levels among spouses. However, the model did not explain a satisfying amount of DV. Therefore, further research should be done to reveal unknown determinants so that suitable interventions to reduce DV can be

  2. Influence of age on left ventricular performance during exercise in normal Japanese subject

    International Nuclear Information System (INIS)

    Konishi, Tokuji; Koyama, Takao; Aoki, Toshikazu; Makino, Katsutoshi; Yamamuro, Masashi; Nakai, Kyudayu; Nakamura, Masayuki; Nakano, Takeshi.

    1990-01-01

    To assess the effects of age on left ventricular performance, multistage supine ergometer exercise radionuclide ventriculography (RNV) was performed in 92 normal subjects. The subjects ranged in age from 24 to 86 years and were free of cardiopulmonary disease and diabetes. Age-related changes in exercise duration, left ventricular end-diastolic volume (LVEDV), left ventricular end-systolic volume (LVESV), cardiac output (CO) left ventricular ejection fraction (LVEF), left ventricular dv/dt, systolic and diastolic time indexes of dv/dt, and peak systolic pressure/left ventricular end-systolic volume (PSP/LVESV) were analyzed at rest and during the peak exercise stage. Age-related decrease in LVEDV and peak diastolic dv/dt were significant at rest. The time indexes of ECG R to peak systolic dv/dt and time of end-systole to peak diastolic dv/dt also were prolonged with age. Both maximum heart rate and exercise duration were shown to decline with age. No age-related difference was observed in LVESV, LVEF or PSP/LVESV either at rest or during exercise. However, the change of LVEF and LVESV during exercise was less in subjects aged 60 or more. These results indicate decreased left ventricular function during exercise in elderly subjects. (author)

  3. Lethal canine distemper virus outbreak in cynomolgus monkeys in Japan in 2008.

    Science.gov (United States)

    Sakai, Kouji; Nagata, Noriyo; Ami, Yasushi; Seki, Fumio; Suzaki, Yuriko; Iwata-Yoshikawa, Naoko; Suzuki, Tadaki; Fukushi, Shuetsu; Mizutani, Tetsuya; Yoshikawa, Tomoki; Otsuki, Noriyuki; Kurane, Ichiro; Komase, Katsuhiro; Yamaguchi, Ryoji; Hasegawa, Hideki; Saijo, Masayuki; Takeda, Makoto; Morikawa, Shigeru

    2013-01-01

    Canine distemper virus (CDV) has recently expanded its host range to nonhuman primates. A large CDV outbreak occurred in rhesus monkeys at a breeding farm in Guangxi Province, China, in 2006, followed by another outbreak in rhesus monkeys at an animal center in Beijing in 2008. In 2008 in Japan, a CDV outbreak also occurred in cynomolgus monkeys imported from China. In that outbreak, 46 monkeys died from severe pneumonia during a quarantine period. A CDV strain (CYN07-dV) was isolated in Vero cells expressing dog signaling lymphocyte activation molecule (SLAM). Phylogenic analysis showed that CYN07-dV was closely related to the recent CDV outbreaks in China, suggesting continuing chains of CDV infection in monkeys. In vitro, CYN07-dV uses macaca SLAM and macaca nectin4 as receptors as efficiently as dog SLAM and dog nectin4, respectively. CYN07-dV showed high virulence in experimentally infected cynomolgus monkeys and excreted progeny viruses in oral fluid and feces. These data revealed that some of the CDV strains, like CYN07-dV, have the potential to cause acute systemic infection in monkeys.

  4. Determinants of domestic violence among women attending an human immunodeficiency virus voluntary counseling and testing center in Bangalore, India.

    Science.gov (United States)

    Chandrasekaran, Varalakshmi; Krupp, Karl; George, Ruja; Madhivanan, Purnima

    2007-05-01

    Violence against women is a global phenomenon that cuts across all social and economic classes. This study was designed to measure the prevalence and correlates of domestic violence (DV) among women seeking services at a voluntary counseling and testing (VCT) center in Bangalore, India. A cross-sectional survey was conducted among women visiting an human immunodeficiency virus (HIV) VCT center in Bangalore, between September and November 2005. An interviewer-administered questionnaire was used to collect information about violence and other variables. Univariable associations with DV were made using Pearson Chi-squared test for categorical variables and Student t-test or the Mann-Whitney test for continuous variables. Forty-two percent of respondents reported DV, including physical abuse (29%), psychological abuse (69%) and sexual abuse (1%). Among the women who reported violence of any kind, 67% also reported that they were HIV seropositive. The most common reasons reported for DV included financial problems (38%), husband's alcohol use (29%) and woman's HIV status (18%). Older women (P around the world. The findings highlight the need for additional training among health care providers in VCT centers in screening for DV, detection of signs of physical abuse and provisions and referrals for women suffering from domestic partner violence.

  5. Relative accretion of /sup 99m/Tc-polyphosphate by forming and resorbing bone systems in rats: its significance in the pathologic basis of bone scanning

    International Nuclear Information System (INIS)

    Garcia, D.A.; Tow, D.E.; Kapur, K.K.; Wells, H.

    1976-01-01

    The relative roles of osteogenesis and osteolysis in the production of positive radionuclide images of skeletal lesions were investigated. The uptake of /sup 99m/Tc-polyphosphate (Tc-PP) by each process was measured in an animal model that permitted bone formation and resorption to be studied independently. Ten rats received intramuscular implants of bone-forming demineralized matrix (DM) and resorbing devitalized bone (DV). Radiographs and Tc-PP scintiscans were made each week thereafter. At 6 to 10 weeks, the implants and normal bone samples were removed, counted for /sup 99m/Tc, and examined histologically. The uptake of Tc-PP by DM implants was first detected on images made 3 weeks after implantation, and by DV implants, 1 to 2 weeks later. Serial radiography showed progressive calcification of DM and resorption of DV implants. Microscopic examinations of undecalcified sections, stained with a modified Goldner preparation, revealed vital-bone formation in the DM implants and osteoclastic resorption in the DV. Activity counts per gram of DM and DV implants were, respectively, 200 percent and 90 percent that of normal bone. Since only the bone-forming system (DM) accumulated Tc-PP at greater than normal concentrations, this study indicates that positive bone images of osteolytic lesions solely reflect compensatory osteogenic responses

  6. The Pragmatics of Domestic Violence Discourse in Uruguay

    Directory of Open Access Journals (Sweden)

    Teresa Herrera

    2017-01-01

    Full Text Available Domestic violence (DV is a form of gender-based violence and a violation of human rights. As such, it was analyzed from the perspective of feminist theory in the dissertation this article is based on, by analyzing discourse pragmatics. Which are the socially accepted DV discourses in Uruguay? Which coincidences, contradictions, and paradoxes appear when we compare these discourses and those of everyday life? Which codes and subcodes should be modified by the sectors interested in the prevention and eradication of DV? The main hypothesis is that there are different types of opposition between the public discourse of different institutional sectors and that of everyday life. Describing these oppositions and, especially, unveiling the pragmatic paradoxes will enable us to develop a different type of discourse for the prevention and eradication of DV. As I am both a researcher and an activist on the topic, my epistemological choice was the autoethnography. This article provides some final reflections, included in the dissertation, on how the feminist movement needs to succeed in persuading decision makers and the mass media, and in building solid alliances to establish an information and monitoring system; the integration of the subject into the educational system; comprehensive legislation on gender-based violence; and new ways of communicating with all sectors, so as to create a new ideology on gender relations for the suitable prevention of DV.

  7. Peer victimization and social phobia: a follow-up study among adolescents.

    Science.gov (United States)

    Ranta, Klaus; Kaltiala-Heino, Riittakerttu; Fröjd, Sari; Marttunen, Mauri

    2013-04-01

    This study examined longitudinal associations between direct and relational peer victimization (DV/RV) and self-reported social phobia (SP) among adolescents from 15 to 17 years of age, controlling for depression and family socioeconomic covariates. A total of 3,278 Finnish adolescents with a mean age of 15.5 years were surveyed at baseline (T1), and followed up 2 years afterwards (T2) their mean age being 17.6 years. In all, 2,070 adolescents were reached for the follow-up. Both types of victimization were assessed with structured questions, SP with the Social Phobia Inventory, and depression with the 13-item Beck Depression Inventory. Socioeconomic covariates were assessed with items from the Life Events Checklist. Frequency of victimization and SP were assessed at T1 and T2, and incidence and persistence from T1 to T2. Longitudinal associations between victimization and SP were examined with three logistic regression analyses with depression and socioeconomic covariates controlled for, with SP, DV, and RV in turn as the dependent endpoint (T2) variables. Among boys a bidirectional association between DV and SP was found with DV both predicting SP [Odds Ratio (OR) 2.6] and being predicted by SP (OR 3.9). Among girls RV predicted SP (OR 2.8), but not vice versa, while depression in turn predicted DV (OR 4.3). Direct victimization and SP have a bidirectional association among boys, while among girls RV increases the risk of subsequent SP.

  8. I-DECIDE: An Online Intervention Drawing on the Psychosocial Readiness Model for Women Experiencing Domestic Violence.

    Science.gov (United States)

    Tarzia, Laura; Murray, Elizabeth; Humphreys, Cathy; Glass, Nancy; Taft, Angela; Valpied, Jodie; Hegarty, Kelsey

    2016-01-01

    Domestic violence (DV) perpetrated by men against women is a pervasive global problem with significant physical and emotional consequences. Although some face-to-face interventions in health care settings have shown promise, there are barriers to disclosure to health care practitioners and women may not be ready to access or accept help, reducing uptake. Similar to the mental health field, interventions from clinical practice can be adapted to be delivered by technology. This article outlines the theoretical and conceptual development of I-DECIDE, an online healthy relationship tool and safety decision aid for women experiencing DV. The article explores the use of the Psychosocial Readiness Model (PRM) as a theoretical framework for the intervention and evaluation. This is a theoretical article drawing on current theory and literature around health care and online interventions for DV. The article argues that the Internet as a method of intervention delivery for DV might overcome many of the barriers present in health care settings. Using the PRM as a framework for an online DV intervention may help women on a pathway to safety and well-being for themselves and their children. This hypothesis will be tested in a randomized, controlled trial in 2015/2016. This article highlights the importance of using a theoretical model in intervention development and evaluation. Copyright © 2016 Jacobs Institute of Women's Health. Published by Elsevier Inc. All rights reserved.

  9. Greater commitment to the domestic violence training is required.

    Science.gov (United States)

    Leppäkoski, Tuija Helena; Flinck, Aune; Paavilainen, Eija

    2015-05-01

    Domestic violence (DV) is a major public health problem with high health and social costs. A solution to this multi-faceted problem requires that various help providers work together in an effective and optimal manner when dealing with different parties of DV. The objective of our research and development project (2008-2013) was to improve the preparedness of the social and healthcare professionals to manage DV. This article focuses on the evaluation of interprofessional education (IPE) to provide knowledge and skills for identifying and intervening in DV and to improve collaboration among social and health care professionals and other help providers at the local and regional level. The evaluation data were carried out with an internal evaluation. The evaluation data were collected from the participants orally and in the written form. The participants were satisfied with the content of the IPE programme itself and the teaching methods used. Participation in the training sessions could have been more active. Moreover, some of the people who had enrolled for the trainings could not attend all of them. IPE is a valuable way to develop intervening in DV. However, greater commitment to the training is required from not only the participants and their superiors but also from trustees.

  10. Characteristics of the digestive vacuole membrane of the alga-bearing ciliate Paramecium bursaria.

    Science.gov (United States)

    Kodama, Yuuki; Fujishima, Masahiro

    2012-07-01

    Cells of the ciliate Paramecium bursaria harbor symbiotic Chlorella spp. in their cytoplasm. To establish endosymbiosis with alga-free P. bursaria, symbiotic algae must leave the digestive vacuole (DV) to appear in the cytoplasm by budding of the DV membrane. This budding was induced not only by intact algae but also by boiled or fixed algae. However, this budding was not induced when food bacteria or India ink were ingested into the DVs. These results raise the possibility that P. bursaria can recognize sizes of the contents in the DVs. To elucidate this possibility, microbeads with various diameters were mixed with alga-free P. bursaria and traced their fate. Microbeads with 0.20μm diameter did not induce budding of the DVs. Microbeads with 0.80μm diameter produced DVs of 5-10μm diameter at 3min after mixing; then the DVs fragmented and became vacuoles of 2-5μm diameter until 3h after mixing. Each microbead with a diameter larger than 3.00μm induced budding similarly to symbiotic Chlorella. These observations reveal that induction of DV budding depends on the size of the contents in the DVs. Dynasore, a dynamin inhibitor, greatly inhibited DV budding, suggesting that dynamin might be involved in DV budding. Copyright © 2011 Elsevier GmbH. All rights reserved.

  11. Psychometric testing of inventory of beliefs and attitudes on domestic violence.

    Science.gov (United States)

    Hutchinson, Marie; Doran, Frances

    2017-06-22

    Background Domestic violence (DV) is an international public health issue associated with adverse health outcomes for adults and children. There have been widespread calls to increase nurses' capacity to respond to DV and improve undergraduate nursing education in this area. However, there are few valid, reliable and contemporary measures of nursing attitudes towards and beliefs concerning DV that are suited for use in evaluating education programmes. Aim To establish the psychometric properties of a newly developed inventory designed to measure nursing students' beliefs about and attitudes towards DV. Discussion Exploratory factor analysis identified five factors, with a Cronbach's alpha of 0.646. The few factors loading>.80 suggest that the instrument has good discriminate validity. The absence of cross-loadings indicate good convergent validity. Conclusion The inventory provides one of the first validated and reliable measures for examining undergraduate nursing students' attitudes towards and beliefs about DV. Implications for practice The instrument is suited for use by nurse educators in assessing the influence of curriculum design and teaching strategies on student beliefs and attitudes. It would also be useful in studies investigating nurses' clinical practice on domestic violence.

  12. Police Response to Children Present at Domestic Violence Incidents.

    Science.gov (United States)

    Swerin, Danielle D; Bostaph, Lisa Growette; King, Laura L; Gillespie, Lane Kirkland

    2018-01-01

    Police response to domestic violence (DV) has continued to change and expand over the past several decades. Although DV was originally considered a private matter, it now represents one of the most common calls for service received by police agencies. While police response to DV incidents has improved substantially, intervention when children are present remains an undeveloped area of research and practice. The present study examined 345 police reports from an agency in the Northwestern United States to explore police response to DV incidents when children are present. Regression analyses indicated that child presence was a statistically significant predictor of victim-directed intervention, victim-directed follow-up, and arrest although in differing directions. While child presence increased the odds of victim-directed intervention and victim-directed follow-up, it decreased the odds of arrest. Findings further indicated that the frequency of police interaction with children present at DV incidents was minimal. Based on these findings, recommendations for policy and practice are discussed.

  13. School Personnel's Bystander Action in Situations of Dating Violence, Sexual Violence, and Sexual Harassment Among High School Teens: A Qualitative Analysis.

    Science.gov (United States)

    Edwards, Katie M; Rodenhizer, Kara Anne; Eckstein, Robert P

    2017-04-01

    We examined school personnel's engagement in bystander action in situations of teen dating violence (DV), sexual violence (SV), and sexual harassment (SH). We conducted focus groups with 22 school personnel from three high schools in New Hampshire. School personnel identified their own barriers to intervening in situations of teen DV, SV, and SH (e.g., not having the time or ability to intervene). School personnel also discussed the ways in which they intervened before (e.g., talking with teens about healthy relationships), during (e.g., breaking up fights between dating partners) and after (e.g., comforting victims) instances of teen DV, SV, and SH. These data can be used to support the development of bystander training for school personnel as one component of comprehensive DV, SV, and SH prevention for teens. In addition, these data provide information that can be used to develop measures that assess school personnel bystander action barriers and behaviors in instances of teen DV, SV, and SH.

  14. Domestic violence education for UK and Ireland undergraduate dental students: a five-year perspective.

    Science.gov (United States)

    Patel, Neil; Bailey, Edmund; Mahdmina, Ayeh; Lomax, Alastair; Coulthard, Paul

    2014-08-01

    The purpose of this cross-sectional study was to ascertain whether undergraduate dental students in the United Kingdom and Ireland are receiving formal teaching on recognizing and managing domestic violence (DV) as part of their curricula. A questionnaire was sent to all dental schools in the UK and Ireland in 2007 and again in 2012, requesting information on whether the subject was taught, by which specialty it was taught, and whether schools felt it was important to include in the curriculum. In 2007, twelve of the fifteen dental schools completed and returned the questionnaire, for a response rate of 80 percent; in 2012, eleven of the sixteen dental schools responded, for a response rate of 69 percent. The main findings were that, in 2007, 50 percent of the responding schools were providing teaching about DV and the majority of this teaching was delivered by oral surgery and pediatric dentistry departments. In 2012, only 45 percent of the responding schools were teaching DV, with 60 percent of this teaching being delivered by pediatric dentists. This study's findings suggest that DV is an undertaught area in UK and Irish undergraduate dental curricula. Some schools recognized the importance of DV teaching; however, they have been unable to implement it because of a full curriculum and lack of appropriately trained staff amongst other reasons.

  15. Edge functionalised & Li-intercalated 555-777 defective bilayer graphene for the adsorption of CO{sub 2} and H{sub 2}O

    Energy Technology Data Exchange (ETDEWEB)

    Lalitha, Murugan [School of Chemical Engineering, The University of Queensland, Brisbane 4072, QLD (Australia); Department of Physics, Bharathiar University, Coimbatore 641046, Tamil Nadu (India); Lakshmipathi, Senthilkumar, E-mail: lsenthilkumar@buc.edu.in [School of Chemical Engineering, The University of Queensland, Brisbane 4072, QLD (Australia); Department of Physics, Bharathiar University, Coimbatore 641046, Tamil Nadu (India); Bhatia, Suresh K., E-mail: s.bhatia@uq.edu.au [School of Chemical Engineering, The University of Queensland, Brisbane 4072, QLD (Australia)

    2017-04-01

    Highlights: • DV defect in fluorinated graphene sheet enhances hydrophobicity. • Intercalation of Li atom decreases the separation in bilayer graphene sheets. • Bernal stacking increases hydrophobicity of the bilayer graphene sheets. - Abstract: The adsorption of CO{sub 2} and H{sub 2}O on divacanacy (DV) defected graphene cluster, and its bilayer counterpart is investigated using first-principles calculations. Both single and bilayer DV graphene cluster, are functionalised with H and F atoms. On these sheets the gas molecules are physisorbed, and the divacancy defect effectively improves the adsorption of CO{sub 2}, while fluorination enhances the hydrophobicity of the graphene cluster. Among the convex and concave curvature regions induced due to the DV defect, the adsorption of the gas molecules on the concave meniscus is more favourable. Fluorine termination induces 73% reduction in Henry law constants for H{sub 2}O, while for the CO{sub 2} molecule it increases by 8%, which indicates the DV defective sheet is a better candidate for CO{sub 2} capture compared to the STW defective sheet. Besides, both AA and AB divacant defect bilayer sheets are equally stable, wherein AA stacking results in a cavity between the sheets, while in AB stacking, the layers slide one over the other. Nevertheless, both these bilayer sheets are comparatively stabler than the monolayer. However, intercalation of lithium decreases the interlayer separation, particularly in AA stacking, which enhances the CO{sub 2} adsorption, but in the Bernal stacking enhances it hydrophobicity.

  16. A Comparative Analysis of Domestic Violence Shelter Staff Perceptions Regarding Barriers to Services in Bosnia and Herzegovina and the United States.

    Science.gov (United States)

    Grubb, Jonathan A; Muftić, Lisa R

    2017-11-01

    Service provision for domestic violence (DV) survivors has been a long-standing staple of shelters in the United States. Although shelter services provide numerous benefits for survivors, barriers tied to acquisition remain a pressing concern when combatting DV. Nevertheless, there has been minimal research exploring barriers to service acquisition on a cross-national level. As such, the current research cross-nationally examines perceptions of shelter staff regarding acquisition barriers as well as the effectiveness of local agencies to meet survivor needs and differences in populations served in the United States (specifically Texas) as well as in Bosnia and Herzegovina. Data collection stemmed from self-report surveys originally constructed in English and translated into Bosnian/Serbian/Croatian. Results underscored differences between populations served, perceptions of local agencies assisting survivors of DV, and barriers tied to cultural and financial concerns. Implications, limitations, and future directions are also discussed.

  17. At the Intersection of Private and Political Conflict Zones: Policing Domestic Violence in the Arab Community in Israel.

    Science.gov (United States)

    Erez, Edna; Ibarra, Peter R; Gur, Oren M

    2015-08-01

    This article addresses the challenges posed by state intervention in a multicultural society characterized by intense political conflict, juxtaposing the voices of batterers, victims, community members, and the officials who are involved in policing domestic violence (DV) in the Arab community in Israel. A meta-analysis of interview-based data excerpts appearing in published studies shows how the response to DV in the Arab community, though consistent with Israeli law and policy, creates a sense of paralysis for the police and frustration for the parties to the violence as well as the affected communities. The cultural, social, and political forces that underlie the dynamics, tensions, and pressures experienced by the various parties are analyzed in the context of everyday life amid concerns about the Israeli-Arab conflict. The implications for policing DV in minority communities, and for police-community relations in political conflict zones, are highlighted. © The Author(s) 2014.

  18. Child-Witnessed Domestic Violence and its Adverse Effects on Brain Development: A Call for Societal Self-Examination and Awareness

    Science.gov (United States)

    Tsavoussis, Areti; Stawicki, Stanislaw P. A.; Stoicea, Nicoleta; Papadimos, Thomas J.

    2014-01-01

    There is substantial evidence indicating that children who witness domestic violence (DV) have psychosocial maladaptation that is associated with demonstrable changes in the anatomic and physiological make up of their central nervous system. Individuals with these changes do not function well in society and present communities with serious medical, sociological, and economic dilemmas. In this focused perspective, we discuss the psychosocially induced biological alterations (midbrain, cerebral cortex, limbic system, corpus callosum, cerebellum, and the hypothalamic, pituitary, and adrenal axis) that are related to maladaptation (especially post-traumatic stress disorder) in the context of child-witnessed DV, and provide evidence for these physical alterations to the brain. Herein, we hope to stimulate the necessary political discourse to encourage legal systems around the world to make the act of DV in the presence of a child, including a first time act, a stand-alone felony. PMID:25346927

  19. Enhancing the Dental Professional’s Responsiveness Towards Domestic Violence; A Cross-Sectional Study

    Science.gov (United States)

    Kashinath, Korpathi R; Raju, Ananda S; Suresh, K V; Bharateesh, Jayanna V

    2015-01-01

    Background Dentists may be the first health care professionals to treat patients who have experienced Oro-facial trauma resulting from Domestic violence (DV). Hence, as a national health concern, it challenges the social responsibility of a dentist in bringing down its prevalence. Objective To assess the knowledge of Domestic violence among dentists of Karnataka. Materials and Methods A cross-sectional questionnaire survey was conducted among dentists of Karnataka to know their knowledge, its relation to dentistry and measures they practice to bring down the prevalence of DV victims. Results Overall knowledge about DV was very less among the dentists & out of 64% who said the dentist has a role in bringing down the prevalence, 28% reported the need for training. Conclusion Based on analysis of the data, dentists were interested and would benefit from additional education opportunities concerning recognizing, referring and managing patients who may be the victim of domestic violence in order to enhance their role. PMID:26266218

  20. Xylo-oligosaccharides and inulin affect genotoxicity and bacterial populations differently in a human colonic simulator challenged with soy protein

    DEFF Research Database (Denmark)

    Christophersen, C. T.; Petersen, Anne; Licht, Tine Rask

    2013-01-01

    High dietary intakes of some protein sources, including soy protein, can increase colonic DNA damage in animals, whereas some carbohydrates attenuate this. We investigated whether inulin and xylo-oligosaccharides (XOS) could be protective against DNA strand breaks by adding them to a human colonic...... cornstarch for 10 day followed by soy protein with 1% XOS or 1% inulin for 10 day. Inulin did not alter genotoxicity but XOS significantly reduced PV genotoxicity and increased DV genotoxicity. Inulin and XOS significantly increased butyrate concentration in the DV but not PV. Numbers of the key butyrate......-producing bacterium Faecalibacterium prausnitzii were significantly increased in the PV and DV by inulin but significantly decreased by XOS in both vessels. Other bacteria examined were also significantly impacted by the carbohydrate treatments or by the vessel (i.e., pH). There was a significant overall inverse...

  1. Comment on integrability in Dijkgraaf-Vafa {beta}-ensembles

    Energy Technology Data Exchange (ETDEWEB)

    Mironov, A., E-mail: mironov@lpi.ru [Lebedev Physics Institute (Russian Federation); ITEP, Moscow (Russian Federation); Morozov, A., E-mail: morozov@itep.ru [ITEP, Moscow (Russian Federation); Zakirova, Z., E-mail: zolya_zakirova@mail.ru [Kazan Energy State University, Kazan (Russian Federation)

    2012-05-15

    We briefly discuss the recent claims that the ordinary KP/Toda integrability, which is a characteristic property of ordinary eigenvalue matrix models, persists also for the Dijkgraaf-Vafa (DV) partition functions and for the refined topological vertex. We emphasize that in both cases what is meant is a particular representation of partition functions: a peculiar sum over all DV phases in the first case and hiding the deformation parameters in a sophisticated potential in the second case, i.e. essentially a reformulation of some questions in the new theory in the language of the old one. It is at best obscure if this treatment can be made consistent with the AGT relations and even with the quantization of the underlying integrable systems in the Nekrasov-Shatashvili limit, which seem to require a full-scale {beta}-deformation of individual DV partition functions. Thus, it is unclear if the story of integrability is indeed closed by these recent considerations.

  2. Temperature Profile of the Upper Mantle

    International Nuclear Information System (INIS)

    Anderson, O.L.

    1980-01-01

    Following the procedure outlined by Magnitsky [1971], thermal profiles of the upper mantle are computed by deriving the thermal gradient from the seismic data given as dv/sub s//drho used along with the values of (dv/sub s//dT9/sub p/ and (dv/sub s//dP)/sub T/ of selected minerals, measured at high temperature. The resulting values of dT/dZ are integrated from 380 km upward toward the surface, where the integrating constant is taken from Akagi and Akimoto's work, T=1400 0 C at 380 km. The resulting geotherms for minerals are used to derive geotherms for an eclogite mantle and a lherzolite mantle, with and without partial melting in the low-velocity zone. The geotherms are all subadiabatic, and some are virtually isothermal in the upper mantle. Some are characterized by a large thermal hump at the lithosphere boundary

  3. Victims of Domestic Violence in Shelters: Impacts on Women and Children.

    Science.gov (United States)

    Fernández-González, Liria; Calvete, Esther; Orue, Izaskun; Mauri, Alice

    2018-06-01

    The aim of this study was to examine the impact of domestic violence (DV) on women and their children. The records of women who were admitted to one of two types of shelter (an emergency shelter [n = 834] and a medium-long stay shelter [n = 84]) for victims of DV in Bizkaia (Spain) from 2006-2015 were analyzed. The results showed that up to 80% of the women had mental health problems. In about 20% of cases, a problematic mother-child relationship was identified. Inadequate parenting was present in around 35% of cases. Around 80-90% of the children had witnessed the abuse suffered by their mother, and more than half had been direct victims of some type of abuse. The findings point to actions that shelters can take to address the needs of DV victims. They also highlight the need for separate interventions targeting the needs of children, as well as mothers.

  4. "I am not [just] a rabbit who has a bunch of children!": agency in the midst of suffering at the intersections of global inequalities, gendered violence, and migration.

    Science.gov (United States)

    Parson, Nia

    2010-08-01

    This article is based on an analysis of the life history narrative of Antonia, a Peruvian immigrant in Chile, in the context of ethnographic research on Chilean women's experiences of domestic violence (DV) and the post-dictatorship state's responses to DV. Structural and socio-cultural constraints and forms of violence, including global and local economic inequalities, migration, racism, and intimate, gender-based abuses in both home and receiving countries interact in Antonia's experience to produce suffering and influence a form of gendered agency. This analysis points to the need for research and policies specifically designed to attend to the intersecting vulnerabilities migrant women who suffer DV often face, as well as their agentive acts.

  5. Korejská manhwa

    OpenAIRE

    Nováková, Petra

    2010-01-01

    Cílem této bakalářské práce je charakteristika a rozbor moderní korejské manhwy. Teoretická část se obecně věnuje historii manhwy od počátku 20. století až do současnosti, a také jejímu vymezení vůči západní komiksům a japonské manze, a také základními rozdíly mezi nimi. Dále se zmíním o korejské animaci. Praktická část je zaměřena na charakteristiku jednotlivých žánrů, dále na výskyt a úroveň erotiky v manhwě a na způsoby vyjádření emocí v manhwě kresbou nebo textem za pomoci slov zvukomaleb...

  6. Influencer marketing jako moderní nástroj komunikace prostřednictvím sociálních médií a návrh na jeho využití ve zvolené společnosti

    OpenAIRE

    Novotný, Petr

    2017-01-01

    V 21. století digitální marketing představuje nedílnou součást marketingové komunikace, kde sociální média zaujímají čím dál významnější pozici tohoto odvětví. Bakalářská práce se odráží od základů internet marketingu a následně se zabývá principy influencer marketingu u vhodných sociálních sítí k tomuto prostředku komunikace. Praktická část se zaměří na analýzu současného stavu využití sociálních médií obchodní značky MANA a její konkurence, která také poslouží jako východisko pro návrh apli...

  7. Effectiveness of "shifting boundaries" teen dating violence prevention program for subgroups of middle school students.

    Science.gov (United States)

    Taylor, Bruce G; Mumford, Elizabeth A; Stein, Nan D

    2015-02-01

    We examine whether the Shifting Boundaries (SB) intervention, a primary intervention to prevent youth dating violence and sexual harassment (DV/H), is differentially effective for girls compared with boys or for youth with a history of DV/H experiences. We randomly assigned SB to 30 public middle schools in New York City, enrolling 117 sixth and seventh grade classes to receive a classroom, building, combined, or neither intervention. The SB classroom intervention included six sessions emphasizing the laws/consequences of DV/H, establishing boundaries and safe relationships. The SB schoolwide/building intervention included the use of school-based restraining orders, greater faculty/security presence in unsafe "hot spots" mapped by students, and posters to increase DV/H awareness and reporting. Student surveys were implemented at baseline, immediately after intervention, and 6 months after intervention. At 6 months after intervention, the SB building-level intervention was associated with significant reductions in the frequency of sexual harassment (SH) perpetration and victimization; the prevalence and frequency of sexual dating violence victimization; and the frequency of total dating violence victimization and perpetration. We also had one anomalous finding that the interventions were associated with an increase in the prevalence of SH victimization. These results were consistent for girls and boys, and those with or without a history of DV/H, with the one exception for those exposed to the SB building condition who had earlier reported perpetrating SH had a significantly lower frequency of perpetrating SH at the follow-up than those without such a history. SB can provide effective universal prevention of middle school DV/H experiences, regardless of students' prior exposure histories, and for boys and girls. Copyright © 2015 Society for Adolescent Health and Medicine. Published by Elsevier Inc. All rights reserved.

  8. Domestic Violence as a Risk Factor for Attempted Suicide in Married Women.

    Science.gov (United States)

    Indu, Pankajakshan Vijayanthi; Remadevi, Sivaraman; Vidhukumar, Karunakaran; Shah Navas, Peer Mohammed; Anilkumar, Thekkethayyil Viswanathan; Subha, Nanoo

    2017-08-01

    High rates of suicide attempts and domestic violence (DV) in women of reproductive age group have been reported from South India, but the association between them was not studied. Hence, this study was undertaken to assess whether DV is a risk factor for attempted suicide in married women of reproductive age group. A hospital-based case-control study with 77 incident cases of attempted suicide in married women of the age group of 18 to 45 years and 153 controls belonging to the same age group, without history of suicide attempt, was undertaken over a period of 6 months. Univariate and multivariate analyses were done. The crude odds ratio (cOR) for DV was found to be 6.15 (95% confidence interval [95% CI] = [2.95, 12.82], p value = .0001). Other statistically significant risk factors included younger age group (below 30 years); gross family income > Rs. 5,000; higher occupational status of spouse; having poor social support; having a family history of psychiatric disorders, substance use disorders, and suicide/suicide attempt; higher impulsiveness scores; having higher scores of stressful life events over the past 12 months, and alcohol use disorder in husband. Islamic faith was found to be a significant protective factor. On logistic regression, DV was found to be an independent risk factor for attempted suicide in this study population (adjusted OR = 3.79, 95% CI = [1.35, 10.62], p value = .011). Age groups, stressful life events, impulsiveness, and alcohol use disorder in husband were the confounders adjusted for in logistic regression along with other significant risk and protective factors. Significant dose-response relationship was also observed between DV and attempted suicide. In accordance with the stress-diathesis model for suicidal behavior, DV is found to be a stressor which precipitates suicide attempt in those with diathesis like family history of psychiatric disorders. Clinical, research, and policy implications of the findings are discussed.

  9. MR Venography of Deep Veins: Changes with Uterine Fibroid Embolization

    International Nuclear Information System (INIS)

    Katsumori, Tetsuya; Kasahara, Toshiyuki; Tsuchida, Yoko; Nara, Yoshinori

    2009-01-01

    Deep veins (DVs) can be compressed by a uterus enlarged with fibroids. The purpose of this study was to assess the degree of luminal narrowing of DVs caused by a myomatous uterus, and the change in DV narrowing in women with symptomatic fibroids after embolization using time-of-flight (TOF)-magnetic resonance venography (MRV). Twenty-nine consecutive women with symptomatic uterine fibroids underwent TOF-MRV and pelvic MRI before and 4 months after embolization. Based on the TOF-MRV, we evaluated the luminal narrowing of three DVs, including the inferior vena cava, and the bilateral common and external iliac veins, and divided the findings into three grades. The scores for each DV were added for each patient (lowest, 0; highest, 6). DV scores and symptom severity (SS) scores were compared between the baseline and 4 months after embolization using the paired t-test. The relationship between DV scores and uterine volume was investigated using Pearson's test. DV scores decreased significantly, from 1.52 ± 1.70 at baseline to 0.93 ± 1.56 at 4 months after embolization (p = 0.004). The uterine volume decreased from 948 ± 647 mL at baseline to 617 ± 417 mL at 4 months after embolization (p < 0.001). DV score correlated with uterine volume (r = 0.856, p < 0.001). SS scores decreased from 54.5 ± 14.6 at baseline to 26.8 ± 15.4 at 4 months after embolization (p < 0.001). In conclusion, the degree of luminal narrowing of DVs caused by a uterus with fibroids is correlated with the uterine volume. Uterine artery embolization may induce an improvement of luminal narrowing of DVs due to a reduction of the myomatous uterus volume.

  10. Preferential streaming of the ductus venosus toward the right atrium is associated with a worse outcome despite a higher rate of invasive procedures in human fetuses with left diaphragmatic hernia.

    Science.gov (United States)

    Stressig, R; Fimmers, R; Schaible, T; Degenhardt, J; Axt-Fliedner, R; Gembruch, U; Kohl, T

    2013-12-01

    Preferential streaming of the ductus venosus (DV) toward the right atrium has been observed in fetuses with left diaphragmatic hernia (LDH). The purpose of this retrospective study was to compare survival rates to discharge between a group with preferential streaming of the DV toward the right heart and a group in which this abnormal flow pattern was not present. We retrospectively searched our patient records for fetuses with LDH in whom liver position, DV streaming and postnatal outcome information was available. 55 cases were found and divided into two groups: Group I fetuses exhibited abnormal DV streaming toward the right side of the heart; group II fetuses did not. Various prognostic and outcome parameters were compared. 62 % of group I fetuses and 88 % of group II fetuses survived to discharge (p = 0.032). Fetoscopic tracheal balloon occlusion (FETO) was performed in 66 % of group I fetuses and 23 % of group II fetuses (p = 0.003). Postnatal ECMO therapy was performed in 55 % of group I fetuses and 23 % of group II infants (p = 0.025). Moderate to severe chronic lung disease in survivors was observed in 56 % of the survivors of group I and 9 % of the survivors of group II (p = 0.002). Preferential streaming of the DV toward the right heart in human fetuses with left-sided diaphragmatic hernia was associated with a poorer postnatal outcome despite a higher rate of invasive pre- and postnatal procedures compared to fetuses without this flow abnormality. Specifically, abnormal DV streaming was found to be an independent predictor for FETO. © Georg Thieme Verlag KG Stuttgart · New York.

  11. Single-atom catalysts for CO2 electroreduction with significant activity and selectivity improvements† †Electronic supplementary information (ESI) available. See DOI: 10.1039/c6sc03911a Click here for additional data file.

    Science.gov (United States)

    Back, Seoin; Lim, Juhyung; Kim, Na-Young; Kim, Yong-Hyun

    2017-01-01

    A single-atom catalyst (SAC) has an electronic structure that is very different from its bulk counterparts, and has shown an unexpectedly high specific activity with a significant reduction in noble metal usage for CO oxidation, fuel cell and hydrogen evolution applications, although physical origins of such performance enhancements are still poorly understood. Herein, by means of density functional theory (DFT) calculations, we for the first time investigate the great potential of single atom catalysts for CO2 electroreduction applications. In particular, we study a single transition metal atom anchored on defective graphene with single or double vacancies, denoted M@sv-Gr or M@dv-Gr, where M = Ag, Au, Co, Cu, Fe, Ir, Ni, Os, Pd, Pt, Rh or Ru, as a CO2 reduction catalyst. Many SACs are indeed shown to be highly selective for the CO2 reduction reaction over a competitive H2 evolution reaction due to favorable adsorption of carboxyl (*COOH) or formate (*OCHO) over hydrogen (*H) on the catalysts. On the basis of free energy profiles, we identified several promising candidate materials for different products; Ni@dv-Gr (limiting potential U L = –0.41 V) and Pt@dv-Gr (–0.27 V) for CH3OH production, and Os@dv-Gr (–0.52 V) and Ru@dv-Gr (–0.52 V) for CH4 production. In particular, the Pt@dv-Gr catalyst shows remarkable reduction in the limiting potential for CH3OH production compared to any existing catalysts, synthesized or predicted. To understand the origin of the activity enhancement of SACs, we find that the lack of an atomic ensemble for adsorbate binding and the unique electronic structure of the single atom catalysts as well as orbital interaction play an important role, contributing to binding energies of SACs that deviate considerably from the conventional scaling relation of bulk transition metals. PMID:28451248

  12. Single-atom catalysts for CO2 electroreduction with significant activity and selectivity improvements.

    Science.gov (United States)

    Back, Seoin; Lim, Juhyung; Kim, Na-Young; Kim, Yong-Hyun; Jung, Yousung

    2017-02-01

    A single-atom catalyst (SAC) has an electronic structure that is very different from its bulk counterparts, and has shown an unexpectedly high specific activity with a significant reduction in noble metal usage for CO oxidation, fuel cell and hydrogen evolution applications, although physical origins of such performance enhancements are still poorly understood. Herein, by means of density functional theory (DFT) calculations, we for the first time investigate the great potential of single atom catalysts for CO 2 electroreduction applications. In particular, we study a single transition metal atom anchored on defective graphene with single or double vacancies, denoted M@sv-Gr or M@dv-Gr, where M = Ag, Au, Co, Cu, Fe, Ir, Ni, Os, Pd, Pt, Rh or Ru, as a CO 2 reduction catalyst. Many SACs are indeed shown to be highly selective for the CO 2 reduction reaction over a competitive H 2 evolution reaction due to favorable adsorption of carboxyl (*COOH) or formate (*OCHO) over hydrogen (*H) on the catalysts. On the basis of free energy profiles, we identified several promising candidate materials for different products; Ni@dv-Gr (limiting potential U L = -0.41 V) and Pt@dv-Gr (-0.27 V) for CH 3 OH production, and Os@dv-Gr (-0.52 V) and Ru@dv-Gr (-0.52 V) for CH 4 production. In particular, the Pt@dv-Gr catalyst shows remarkable reduction in the limiting potential for CH 3 OH production compared to any existing catalysts, synthesized or predicted. To understand the origin of the activity enhancement of SACs, we find that the lack of an atomic ensemble for adsorbate binding and the unique electronic structure of the single atom catalysts as well as orbital interaction play an important role, contributing to binding energies of SACs that deviate considerably from the conventional scaling relation of bulk transition metals.

  13. Simplifying mental math: Changing how added sugars are displayed on the nutrition facts label can improve consumer understanding.

    Science.gov (United States)

    Khandpur, Neha; Graham, Dan J; Roberto, Christina A

    2017-07-01

    Proposed variations to Nutrition Facts Labels (NFL) have included the display of added sugars (AS) content, but its impact on consumer understanding is poorly understood. To examine the degree to which different formats for displaying AS influence consumer understanding, perceptions, and purchase intentions. Randomized-controlled online experiment. A sample of 2509 U.S adults. Participants were randomized to 1 of 8 conditions and viewed 10 food or beverage images with either: (1) no label (control); (2) the current NFL (without AS); (3) the proposed NFL without AS; or the proposed NFL with AS in (4) grams, (5) grams and teaspoons, (6) grams and percent Daily Value (%DV), (7) grams with high/medium/low text, or (8) grams with high/medium/low text and %DV. ANCOVAs compared scores on quizzes that assessed the accuracy of judgments about AS, overall nutrition understanding and purchase intentions. Presenting AS in grams plus high/medium/low text with and without %DV led to the highest AS understanding scores (85% and 83% correct, respectively) compared to 70% correct when AS was not on the label or was displayed in grams only (74% correct). Displaying AS in teaspoons did not significantly improve understanding beyond grams alone. Consumers were best able to determine which of two products was healthier when AS was presented as %DV (68% correct) versus displayed in grams alone (60% correct), but %DV did not differ from high/medium/low text or teaspoons. None of the labels influenced purchase intentions relative to no label. Displaying AS on the NFL in grams with high/medium/low text, %DV, or the combination of the two, improved consumer understanding more than presenting it in grams or teaspoons. Copyright © 2017 Elsevier Ltd. All rights reserved.

  14. Genetic, Physical and Comparative Mapping of the Powdery Mildew Resistance Gene Pm21 Originating from Dasypyrum villosum

    Directory of Open Access Journals (Sweden)

    Huagang He

    2017-11-01

    Full Text Available Pm21, originating from wheat wild relative Dasypyrum villosum, confers immunity to all known races of Blumeria graminis f. sp. tritici (Bgt and has been widely utilized in wheat breeding. However, little is known on the genetic basis of the Pm21 locus. In the present study, four seedling-susceptible D. villosum lines (DvSus-1 ∼ DvSus-4 were identified from different natural populations. Based on the collinearity among genomes of Brachypodium distachyon, Oryza, and Triticeae, a set of 25 gene-derived markers were developed declaring the polymorphisms between DvRes-1 carrying Pm21 and DvSus-1. Fine genetic mapping of Pm21 was conducted by using an extremely large F2 segregation population derived from the cross DvSus-1/DvRes-1. Then Pm21 was narrowed to a 0.01-cM genetic interval defined by the markers 6VS-08.4b and 6VS-10b. Three DNA markers, including a resistance gene analog marker, were confirmed to co-segregate with Pm21. Moreover, based on the susceptible deletion line Y18-S6 induced by ethyl methanesulfonate treatment conducted on Yangmai 18, Pm21 was physically mapped into a similar interval. Comparative analysis revealed that the orthologous regions of the interval carrying Pm21 were narrowed to a 112.5 kb genomic region harboring 18 genes in Brachypodium, and a 23.2 kb region harboring two genes in rice, respectively. This study provides a high-density integrated map of the Pm21 locus, which will contribute to map-based cloning of Pm21.

  15. The Rise of Flowering Plants and Land Surface Physics: The Cretaceous and Eocene Were Different

    Science.gov (United States)

    Upchurch, G. R.; Feild, T.

    2010-12-01

    The Cretaceous and Eocene have served as the poster children of past greenhouse climates. One difference between the two time periods is that angiosperms (flowering plants) underwent a major diversification and rise to dominance during the mid-Cretaceous to Paleocene. Flowering plants differ from all other living and fossil plants in having significantly higher rates of transpiration and photosynthesis, which in modern leaves correlate with the density of venation (Dv), a feature that can be measured directly from fossils. This increase in Dv, coupled with an increase in the abundance of angiosperms, is thought to have had major impact on the climate system. This is, in part, because transpiration plays an important role in determining the ratio of sensible to latent heat flux from the land surface and in determining precipitation rate in regions such as the equatorial rainforest. Analysis of Dv in fossil leaves indicates two phases of increase in transpiration rate for angiosperms during the Cretaceous-Paleocene. The oldest known angiosperms (Aptian-early Albian) have a low Dv characteristic of extant and fossil ferns and gymnosperms. At this time angiosperms are low-stature plants of minor importance in terms of relative abundance and diversity (ferns, and maximum Dv reaches levels characteristic of many trees from the temperate zone. This first phase coincides with the first local dominance of angiosperms, the first occurrence of moderate to large angiosperm trees (up to 1 m in diameter) , and the first common occurrence of angiosperms in the Arctic. The second phase of Dv increase occurs during the Maastrichtian to Paleocene, where average Dv reaches levels characteristic of modern tropical forests and maximum Dv reaches the level found in highly productive modern vegetation. This second phase coincides with the rise to dominance of angiosperms in regional vegetation, a corresponding decline of conifers and ferns, and the modernization of hydraulic architecture

  16. Teaching Domestic Violence in the New Millennium: Intersectionality as a Framework for Social Change.

    Science.gov (United States)

    McQueeney, Krista

    2016-10-01

    This article describes an intersectional approach to teaching about domestic violence (DV), which aims to empower students as critical thinkers and agents of change by merging theory, service learning, self-reflection, and activism. Three intersectional strategies and techniques for teaching about DV are discussed: promoting difference-consciousness, complicating gender-only power frameworks, and organizing for change. The author argues that to empower future generations to end violence, educators should put intersectionality into action through their use of scholarship, teaching methods, and pedagogical authority. Finally, the benefits and challenges of intersectional pedagogy for social justice education are considered. © The Author(s) 2016.

  17. Subjective study of thermal acceptability of novel enhanced displacement ventilation system and implication of occupants' personal control

    DEFF Research Database (Denmark)

    Sun, Weimeng; Cheong, K.W.D.; Melikov, Arsen Krikor

    2012-01-01

    with DV and constant heat load at different supply air temperatures, namely 20, 22, and 24 °C and room air temperatures, 22, 24, and 26 °C. Subjective assessments were carried out with 32 tropically-acclimatized college students who were given the choice to adjust the fan speed. Subjects' thermal comfort...... of 22 and 24 °C when the fans were in operation. It was also found that the Whole Body Thermal Sensation (WBTS) reported by the subjects was correlated with the Local Thermal Sensation (LTS) at the waist, the arms, the calf and the feet when the novel DV system was employed. An expression which allows...

  18. Simplified PET measurement for evaluating histamine H1 receptors in human brains using [11C]doxepin

    International Nuclear Information System (INIS)

    Mochizuki, Hideki; Kimura, Yuichi; Ishii, Kenji; Oda, Keiichi; Sasaki, Toru; Tashiro, Manabu; Yanai, Kazuhiko; Ishiwata, Kiichi

    2004-01-01

    The aim of this study was to develop simplified positron emission tomography measurement using [ 11 C]doxepin ([ 11 C]DOX) to evaluate histamine H 1 receptors (H1Rs) in human brains. We evaluated the correlation between the distribution volume (DV) of [ 11 C]DOX, estimated quantitatively with a two-compartment model, and the [ 11 C]DOX uptake obtained at various time intervals and normalized using the metabolite-corrected plasma radioactivity. We found that the static 70- to 90-min images normalized using the plasma radioactivity at 10 min postinjection reflected the DV of [ 11 C]DOX-H1R binding

  19. Floor Heating with Displacement Ventilation: An Experimental and Numerical Analysis

    DEFF Research Database (Denmark)

    Causone, Francesco; Olesen, Bjarne W.; Corgnati, S.P.

    2010-01-01

    The effect of floor heating combined with displacement ventilation (DV) on thermal indoor environments and indoor air quality (IAQ) was studied by means of CFD. The numerical model was validated with experimental data. A typical office room was simulated, and one of the occupants was considered...... to simulate different kinds of contaminant sources, under the same boundary conditions. It was found that DV does not guarantee a better IAQ than full mixing when contaminant sources are not linked to heat sources, even when floor heating is used. Contaminants produced by powerful heat sources require high...

  20. Dowry-related domestic violence and complex posttraumatic stress disorder: a case report.

    Science.gov (United States)

    O'Connor, Manjula

    2017-08-01

    This paper draws attention to the mental health impact of coercive practice of dowry demands, associated with domestic violence (DV) in an immigrant woman. This study was based on a case report and selective literature review. This case history illustrates the serious mental health impacts of repeated emotional and physical trauma inflicted by a husband who was dissatisfied with his wife's dowry. Bio-psycho-social / cultural aspects of mental health treatments needed to be augmented with attention to safety, advocacy, and access to support networks. Cultural factors are important determinants of mental illness. Psychiatrists need to be aware of DV and dowry when treating immigrant women.