WorldWideScience

Sample records for dv stolet eskho

  1. Stoleté katastrofy

    Czech Academy of Sciences Publication Activity Database

    Cílek, Václav

    -, č. 7 (2005), s. 11-11 ISSN 0862-9587 Institutional research plan: CEZ:AV0Z30130516 Keywords : natural disaster * forrest * globalization Subject RIV: DG - Athmosphere Sciences, Meteorology http://vyhledavani.ihned.cz/109-15670400-on-stolet%E9++ AND +katastrofy+ AND +c%EDlek-M00000_d-7c

  2. A free sugars daily value (DV) identifies more "less healthy" prepackaged foods and beverages than a total sugars DV.

    Science.gov (United States)

    Bernstein, Jodi T; Labonté, Marie-Ève; Franco-Arellano, Beatriz; Schermel, Alyssa; L'Abbé, Mary R

    2018-04-01

    Regulatory changes in Canada will require food labels to have a benchmark [% Daily Value, %DV] for total sugars, based on 100 g/day, while US labels will require a %DV for added sugars, based on 50 g/day. The objective of this study was to compare two labelling policies, a total sugars DV (100 g/day) and a free sugars DV (50 g/day) on food labels. This cross-sectional analysis of the Food Label Information Program database focussed on top sources of total sugars intake in Canada (n = 6924 foods). Products were categorized as "less healthy" using two sets of criteria: a) free sugars levels exceeding the WHO guidelines (≥10% energy from free sugars); and b) exceeding healthfulness cut-offs of the Food Standards Australia New Zealand Nutrient Profiling Scoring Criterion (FSANZ-NPSC). The proportion of "less healthy" products with ≥15%DV (defined as "a lot" of sugars i.e. high in sugars, based on Health Canada's %DV labelling footnote and educational message for dietary guidance) were compared for each sugar labelling scenario. The free sugars DV showed better alignment with both methods for assessing "healthfulness" than the total sugars DV. The free sugars DV identified a greater proportion of "less healthy" foods with ≥15%DV, based on both the FSANZ-NPSC (70% vs. 45%, p chocolate bars, confectionery, and frozen desserts categories. Compared to total sugars DV labelling, using a free sugars DV identified more "less healthy" foods. Findings support the adoption of free sugars labelling. Copyright © 2018 Elsevier Inc. All rights reserved.

  3. Effective Protection Induced by a Monovalent DNA Vaccine against Dengue Virus (DV Serotype 1 and a Bivalent DNA Vaccine against DV1 and DV2 in Mice

    Directory of Open Access Journals (Sweden)

    Xiaoyan Zheng

    2017-05-01

    Full Text Available Dengue virus (DV is the causal pathogen of dengue fever, which is one of the most rapidly spread mosquito-borne disease worldwide and has become a severe public health problem. Currently, there is no specific treatment for dengue; thus, a vaccine would be an effective countermeasure to reduce the morbidity and mortality. Although, the chimeric Yellow fever dengue tetravalent vaccine has been approved in some countries, it is still necessary to develop safer, more effective, and less costly vaccines. In this study, a DNA vaccine candidate pVAX1-D1ME expressing the prME protein of DV1 was inoculated in BALB/c mice via intramuscular injection or electroporation, and the immunogenicity and protection were evaluated. Compared with traditional intramuscular injection, administration with 50 μg pVAX1-D1ME via electroporation with three immunizations induced persistent humoral and cellular immune responses and effectively protected mice against lethal DV1 challenge. In addition, immunization with a bivalent vaccine consisting of pVAX1-D1ME and pVAX1-D2ME via electroporation generated a balanced IgG response and neutralizing antibodies against DV1 and DV2 and could protect mice from lethal challenge with DV1 and DV2. This study sheds new light on developing a dengue tetravalent DNA vaccine.

  4. Effective Protection Induced by a Monovalent DNA Vaccine against Dengue Virus (DV) Serotype 1 and a Bivalent DNA Vaccine against DV1 and DV2 in Mice.

    Science.gov (United States)

    Zheng, Xiaoyan; Chen, Hui; Wang, Ran; Fan, Dongying; Feng, Kaihao; Gao, Na; An, Jing

    2017-01-01

    Dengue virus (DV) is the causal pathogen of dengue fever, which is one of the most rapidly spread mosquito-borne disease worldwide and has become a severe public health problem. Currently, there is no specific treatment for dengue; thus, a vaccine would be an effective countermeasure to reduce the morbidity and mortality. Although, the chimeric Yellow fever dengue tetravalent vaccine has been approved in some countries, it is still necessary to develop safer, more effective, and less costly vaccines. In this study, a DNA vaccine candidate pVAX1-D1ME expressing the prME protein of DV1 was inoculated in BALB/c mice via intramuscular injection or electroporation, and the immunogenicity and protection were evaluated. Compared with traditional intramuscular injection, administration with 50 μg pVAX1-D1ME via electroporation with three immunizations induced persistent humoral and cellular immune responses and effectively protected mice against lethal DV1 challenge. In addition, immunization with a bivalent vaccine consisting of pVAX1-D1ME and pVAX1-D2ME via electroporation generated a balanced IgG response and neutralizing antibodies against DV1 and DV2 and could protect mice from lethal challenge with DV1 and DV2. This study sheds new light on developing a dengue tetravalent DNA vaccine.

  5. Project Date SMART: a Dating Violence (DV) and Sexual Risk Prevention Program for Adolescent Girls with Prior DV Exposure.

    Science.gov (United States)

    Rizzo, Christie J; Joppa, Meredith; Barker, David; Collibee, Charlene; Zlotnick, Caron; Brown, Larry K

    2018-05-01

    This study assessed the initial feasibility, acceptability, and efficacy of an intervention aimed at reducing dating violence and sexual risk behavior in a sample of adolescent girls (ages 14-17) with prior exposure to physical dating violence (DV). One hundred and nine girls were randomly assigned to Date SMART (Skills to Manage Aggression in Relationships for Teens) or a Knowledge-only (KO) comparison group. Both intervention arms consisted of six, weekly 2-h sessions and one "booster" session 6 weeks later. Based on principles of cognitive behavioral therapy, the Date SMART intervention was designed to target common underlying skills deficits linked to both DV and sexual risk behavior in adolescent females: depression, self-regulation deficits, and interpersonal skills deficits. Assessments were administered at four time points (baseline, 3, 6, and 9 months). The Date SMART group was effective as reducing sexual DV involvement across the 9-month follow-up period. Both groups evidenced clinically meaningful reductions in physical, emotional, and digital DV involvement, total time in dating relationships, as well as reductions in depression. Findings indicate that delivering a DV and sexual risk prevention intervention to DV-affected adolescent girls is feasible and well-received. Furthermore, a skills-based approach that addresses the co-occurrence of DV and sexual risk behavior may be particularly useful for promoting reductions of sexual DV among high-risk adolescent girls. A future, large-scale trial with an inactive comparison condition is needed to evaluate the efficacy of Date SMART further. Clinical Trials, NCT01326195, and http://www.clinicaltrials.gov.

  6. Mezinárodní konference Slovanská lexikografie počátkem 21. století

    Czech Academy of Sciences Publication Activity Database

    Michalec, Vít; Neprašová, Renáta

    2017-01-01

    Roč. 54, 1/2 (2017), s. 70-73 ISSN 1212-5326. [Mezinárodní konference Slovanská lexikografie počátkem 21. století. Praha, 20.04.2016-22.04.2016] Institutional support: RVO:68378092 Keywords : conference * lexicography * dictionary Subject RIV: AI - Linguistics OBOR OECD: Linguistics

  7. DV or Not DV: That is the Question When Producing Video for the Internet

    Directory of Open Access Journals (Sweden)

    Gregory Gutenko

    2002-06-01

    Full Text Available Pervasive advertising and marketing efforts promote consumer market digital video (DV format camcorders as the ideal acquisition technology for Internet video production. A shared digital nature and simple interconnections between cameras and computers using IEEE1394/FireWire/i.Link® format digital cabling do suggest a natural affinity between DV and Internet production. However, experience with Web delivery reveals numerous obstacles associated with consumer-friendly camcorder design and feature sets that can severely compromise Internet streaming video quality. This paper describes the various features in consumer and industrial grade DV camcorder designs that lead to unnecessary image quality loss, and what must be done to avoid such loss. Conventional video production techniques that can lead to quality loss regardless of the camera technology used are also identified. A number of recommendations are offered that will help the videographer in an educational or production environment adapt to Internet limitations.

  8. The DV-Xα molecular-orbital calculation method

    CERN Document Server

    Ishii, Tomohiko; Ogasawara, Kazuyoshi

    2014-01-01

    This multi-author contributed volume contains chapters featuring the development of the DV-Xα method and its application to a variety of problems in Materials Science and Spectroscopy written by leaders of the respective fields. The volume contains a Foreword written by the Chairs of Japanese and Korea DV-X alpha Societies. This book is aimed at individuals working in Quantum Chemistry.

  9. Research on Improved DV-HOP Algorithm against Wormhole Attacks in WSN

    Directory of Open Access Journals (Sweden)

    Wang Xue-Wen

    2016-01-01

    Full Text Available The secure location of node is significant in the WSN (Wireless Sensor Networks of the troop frontier defence system. The wormhole attack is a big threat in the secure location. The credibility of the beacon node was used to determine the malicious nodes produced by wormhole attack in the WSN. The estimated method of multibeacon nodes was adopted to improve DV-HOP algorithm after excluding the malicious nodes. In this paper, we compared the basic DV-HOP algorithm and the improved DV-HOP algorithm in the coverage percentage and the error of network localization by simulating. The simulation results indicate that the improved DV-HOP algorithm makes the localization coverage percentage can reach 90% on a certain scale of the network, and it makes the error percentage lower when the number of beacons is different.

  10. Naphthalene degradation by bacterial consortium (DV-AL) developed from Alang-Sosiya ship breaking yard, Gujarat, India.

    Science.gov (United States)

    Patel, Vilas; Jain, Siddharth; Madamwar, Datta

    2012-03-01

    Naphthalene degrading bacterial consortium (DV-AL) was developed by enrichment culture technique from sediment collected from the Alang-Sosiya ship breaking yard, Gujarat, India. The 16S rRNA gene based molecular analyzes revealed that the bacterial consortium (DV-AL) consisted of four strains namely, Achromobacter sp. BAB239, Pseudomonas sp. DV-AL2, Enterobacter sp. BAB240 and Pseudomonas sp. BAB241. Consortium DV-AL was able to degrade 1000 ppm of naphthalene in Bushnell Haas medium (BHM) containing peptone (0.1%) as co-substrate with an initial pH of 8.0 at 37°C under shaking conditions (150 rpm) within 24h. Maximum growth rate and naphthalene degradation rate were found to be 0.0389 h(-1) and 80 mg h(-1), respectively. Consortium DV-AL was able to utilize other aromatic and aliphatic hydrocarbons such as benzene, phenol, carbazole, petroleum oil, diesel fuel, and phenanthrene and 2-methyl naphthalene as sole carbon source. Consortium DV-AL was also efficient to degrade naphthalene in the presence of other pollutants such as petroleum hydrocarbons and heavy metals. Copyright © 2011 Elsevier Ltd. All rights reserved.

  11. A Hybrid DV-Hop Algorithm Using RSSI for Localization in Large-Scale Wireless Sensor Networks.

    Science.gov (United States)

    Cheikhrouhou, Omar; M Bhatti, Ghulam; Alroobaea, Roobaea

    2018-05-08

    With the increasing realization of the Internet-of-Things (IoT) and rapid proliferation of wireless sensor networks (WSN), estimating the location of wireless sensor nodes is emerging as an important issue. Traditional ranging based localization algorithms use triangulation for estimating the physical location of only those wireless nodes that are within one-hop distance from the anchor nodes. Multi-hop localization algorithms, on the other hand, aim at localizing the wireless nodes that can physically be residing at multiple hops away from anchor nodes. These latter algorithms have attracted a growing interest from research community due to the smaller number of required anchor nodes. One such algorithm, known as DV-Hop (Distance Vector Hop), has gained popularity due to its simplicity and lower cost. However, DV-Hop suffers from reduced accuracy due to the fact that it exploits only the network topology (i.e., number of hops to anchors) rather than the distances between pairs of nodes. In this paper, we propose an enhanced DV-Hop localization algorithm that also uses the RSSI values associated with links between one-hop neighbors. Moreover, we exploit already localized nodes by promoting them to become additional anchor nodes. Our simulations have shown that the proposed algorithm significantly outperforms the original DV-Hop localization algorithm and two of its recently published variants, namely RSSI Auxiliary Ranging and the Selective 3-Anchor DV-hop algorithm. More precisely, in some scenarios, the proposed algorithm improves the localization accuracy by almost 95%, 90% and 70% as compared to the basic DV-Hop, Selective 3-Anchor, and RSSI DV-Hop algorithms, respectively.

  12. Modeling of flux, binding and substitution of urea molecules in the urea transporter dvUT.

    Science.gov (United States)

    Zhang, Hai-Tian; Wang, Zhe; Yu, Tao; Sang, Jian-Ping; Zou, Xian-Wu; Zou, Xiaoqin

    2017-09-01

    Urea transporters (UTs) are transmembrane proteins that transport urea molecules across cell membranes and play a crucial role in urea excretion and water balance. Modeling the functional characteristics of UTs helps us understand how their structures accomplish the functions at the atomic level, and facilitates future therapeutic design targeting the UTs. This study was based on the crystal structure of Desulfovibrio vulgaris urea transporter (dvUT). To model the binding behavior of urea molecules in dvUT, we constructed a cooperative binding model. To model the substitution of urea by the urea analogue N,N'-dimethylurea (DMU) in dvUT, we calculated the occupation probability of DMU along the urea pore and the ratio of the occupation probabilities of DMU at the external (S ext ) and internal (S int ) binding sites, and we established the mutual substitution rule for binding and substitution of urea and DMU. Based on these calculations and modelings, together with the use of the Monte Carlo (MC) method, we further modeled the urea flux in dvUT, equilibrium urea binding to dvUT, and the substitution of urea by DMU in the dvUT. Our modeling results are in good agreement with the existing experimental functional data. Furthermore, the modelings have discovered the microscopic process and mechanisms of those functional characteristics. The methods and the results would help our future understanding of the underlying mechanisms of the diseases associated with impaired UT functions and rational drug design for the treatment of these diseases. Copyright © 2017 Elsevier Inc. All rights reserved.

  13. Status on the heavy elements research using the DV-DFS method

    International Nuclear Information System (INIS)

    Hirata, Masaru; Bastug, T.; Sekine, Rika; Onoe, Jun; Nakamatsu, Hirohide; Mukoyama, Takeshi

    1999-03-01

    In this review report, we describe recent progress on the heavy elements research using the discrete-variational Dirac-Fock-Slater (DV-DFS) method which is being improved by Kyoto University, Shizuoka University, RIKEN and JAERI. The DV-DFS is a versatile method for interpreting spectroscopic data and predicting chemical bonding of polyatomic systems including heavy elements. This review is based on the lectures given in 74th spring meeting of chemical Society of Japan (March, 1998) and also at the workshop on the XAFS-relativistic electronic structure calculation for the actinides research which was held at Tokai Research Establishment of JAERI (November, 1998). (author)

  14. LLNL-G3Dv3: Global P wave tomography model for improved regional and teleseismic travel time prediction: LLNL-G3DV3---GLOBAL P WAVE TOMOGRAPHY

    Energy Technology Data Exchange (ETDEWEB)

    Simmons, N. A. [Lawrence Livermore National Lab. (LLNL), Livermore, CA (United States); Myers, S. C. [Lawrence Livermore National Lab. (LLNL), Livermore, CA (United States); Johannesson, G. [Lawrence Livermore National Lab. (LLNL), Livermore, CA (United States); Matzel, E. [Lawrence Livermore National Lab. (LLNL), Livermore, CA (United States)

    2012-10-06

    [1] We develop a global-scale P wave velocity model (LLNL-G3Dv3) designed to accurately predict seismic travel times at regional and teleseismic distances simultaneously. The model provides a new image of Earth's interior, but the underlying practical purpose of the model is to provide enhanced seismic event location capabilities. The LLNL-G3Dv3 model is based on ∼2.8 millionP and Pnarrivals that are re-processed using our global multiple-event locator called Bayesloc. We construct LLNL-G3Dv3 within a spherical tessellation based framework, allowing for explicit representation of undulating and discontinuous layers including the crust and transition zone layers. Using a multiscale inversion technique, regional trends as well as fine details are captured where the data allow. LLNL-G3Dv3 exhibits large-scale structures including cratons and superplumes as well numerous complex details in the upper mantle including within the transition zone. Particularly, the model reveals new details of a vast network of subducted slabs trapped within the transition beneath much of Eurasia, including beneath the Tibetan Plateau. We demonstrate the impact of Bayesloc multiple-event location on the resulting tomographic images through comparison with images produced without the benefit of multiple-event constraints (single-event locations). We find that the multiple-event locations allow for better reconciliation of the large set of direct P phases recorded at 0–97° distance and yield a smoother and more continuous image relative to the single-event locations. Travel times predicted from a 3-D model are also found to be strongly influenced by the initial locations of the input data, even when an iterative inversion/relocation technique is employed.

  15. Exploratory Climate Data Visualization and Analysis Using DV3D and UVCDAT

    Science.gov (United States)

    Maxwell, Thomas

    2012-01-01

    Earth system scientists are being inundated by an explosion of data generated by ever-increasing resolution in both global models and remote sensors. Advanced tools for accessing, analyzing, and visualizing very large and complex climate data are required to maintain rapid progress in Earth system research. To meet this need, NASA, in collaboration with the Ultra-scale Visualization Climate Data Analysis Tools (UVCOAT) consortium, is developing exploratory climate data analysis and visualization tools which provide data analysis capabilities for the Earth System Grid (ESG). This paper describes DV3D, a UV-COAT package that enables exploratory analysis of climate simulation and observation datasets. OV3D provides user-friendly interfaces for visualization and analysis of climate data at a level appropriate for scientists. It features workflow inte rfaces, interactive 40 data exploration, hyperwall and stereo visualization, automated provenance generation, and parallel task execution. DV30's integration with CDAT's climate data management system (COMS) and other climate data analysis tools provides a wide range of high performance climate data analysis operations. DV3D expands the scientists' toolbox by incorporating a suite of rich new exploratory visualization and analysis methods for addressing the complexity of climate datasets.

  16. The better growth phenotype of DvGS1-transgenic arabidopsis thaliana is attributed to the improved efficiency of nitrogen assimilation

    Directory of Open Access Journals (Sweden)

    Zhu Chenguang

    2015-01-01

    Full Text Available The overexpression of the algal glutamine synthetase (GS gene DvGS1 in Arabidopsis thaliana resulted in higher plant biomass and better growth phenotype. The purpose of this study was to recognize the biological mechanism for the growth improvement of DvGS1-transgenic Arabidopsis. A series of molecular and biochemical investigations related to nitrogen and carbon metabolism in the DvGS1-transgenic line was conducted. Analysis of nitrogen use efficiency (NUE-related gene transcription and enzymatic activity revealed that the transcriptional level and enzymatic activity of the genes encoding GS, glutamate synthase, glutamate dehydrogenase, alanine aminotransferase and aspartate aminotransferase, were significantly upregulated, especially from leaf tissues of the DvGS1-transgenic line under two nitrate conditions. The DvGS1-transgenic line showed increased total nitrogen content and decreased carbon: nitrogen ratio compared to wild-type plants. Significant reduced concentrations of free nitrate, ammonium, sucrose, glucose and starch, together with higher concentrations of total amino acids, individual amino acids (glutamate, aspartate, asparagine, methionine, soluble proteins and fructose in leaf tissues confirmed that the DvGS1-transgenic line demonstrated a higher efficiency of nitrogen assimilation, which subsequently affected carbon metabolism. These improved metabolisms of nitrogen and carbon conferred the DvGS1-transgenic Arabidopsis higher NUE, more biomass and better growth phenotype compared with the wild-type plants.

  17. Structure and transcription of the Helicoverpa armigera densovirus (HaDV2) genome and its expression strategy in LD652 cells.

    Science.gov (United States)

    Xu, Pengjun; Graham, Robert I; Wilson, Kenneth; Wu, Kongming

    2017-02-07

    Densoviruses (DVs) are highly pathogenic to their hosts. However, we previously reported a mutualistic DV (HaDV2). Very little was known about the characteristics of this virus, so herein we undertook a series of experiments to explore the molecular biology of HaDV2 further. Phylogenetic analysis showed that HaDV2 was similar to members of the genus Iteradensovirus. However, compared to current members of the genus Iteradensovirus, the sequence identity of HaDV2 is less than 44% at the nucleotide-level, and lower than 36, 28 and 19% at the amino-acid-level of VP, NS1 and NS2 proteins, respectively. Moreover, NS1 and NS2 proteins from HaDV2 were smaller than those from other iteradensoviruses due to their shorter N-terminal sequences. Two transcripts of about 2.2 kb coding for the NS proteins and the VP proteins were identified by Northern Blot and RACE analysis. Using specific anti-NS1 and anti-NS2 antibodies, Western Blot analysis revealed a 78 kDa and a 48 kDa protein, respectively. Finally, the localization of both NS1 and NS2 proteins within the cell nucleus was determined by using Green Fluorescent Protein (GFP) labelling. The genome organization, terminal hairpin structure, transcription and expression strategies as well as the mutualistic relationship with its host, suggested that HaDV2 was a novel member of the genus Iteradensovirus within the subfamily Densovirinae.

  18. Multiple-scattering and DV-Xα analyses of a Cl-passivated Ge(111) surface

    International Nuclear Information System (INIS)

    Cao, S; Tang, J-C; Shen, S-L

    2003-01-01

    The multiple-scattering cluster and DV-Xα methods have been employed to analyse the chlorine 1s near edge x-ray absorption fine structure (NEXAFS) of a Cl-passivated Ge(111) surface. Our detailed analysis demonstrates how the chlorine atoms form a perfect monochloride structure with Cl bonding to the topmost Ge atom. Our calculation reveals the interaction in the chlorine layer is multipolar electrostatic forces. Furthermore, the DV-Xα cluster calculation shows that the orbital contour of the sharp Cl-Ge resonance exhibits a global symmetry, which confirms it to be σ * -like. The above studies are found to enrich previous experimental NEXAFS investigations

  19. Development of duplex real-time PCR for the detection of WSSV and PstDV1 in cultivated shrimp.

    Science.gov (United States)

    Leal, Carlos A G; Carvalho, Alex F; Leite, Rômulo C; Figueiredo, Henrique C P

    2014-07-05

    The White spot syndrome virus (WSSV) and Penaeus stylirostris penstyldensovirus 1 (previously named Infectious hypodermal and hematopoietic necrosis virus-IHHNV) are two of the most important viral pathogens of penaeid shrimp. Different methods have been applied for diagnosis of these viruses, including Real-time PCR (qPCR) assays. A duplex qPCR method allows the simultaneous detection of two viruses in the same sample, which is more cost-effective than assaying for each virus separately. Currently, an assay for the simultaneous detection of the WSSV and the PstDV1 in shrimp is unavailable. The aim of this study was to develop and standardize a duplex qPCR assay for the simultaneous detection of the WSSV and the PstDV1 in clinical samples of diseased L. vannamei. In addition, to evaluate the performance of two qPCR master mixes with regard to the clinical sensitivity of the qPCR assay, as well as, different methods for qPCR results evaluation. The duplex qPCR assay for detecting WSSV and PstDV1 in clinical samples was successfully standardized. No difference in the amplification of the standard curves was observed between the duplex and singleplex assays. Specificities and sensitivities similar to those of the singleplex assays were obtained using the optimized duplex qPCR. The analytical sensitivities of duplex qPCR were two copies of WSSV control plasmid and 20 copies of PstDV1 control plasmid. The standardized duplex qPCR confirmed the presence of viral DNA in 28 from 43 samples tested. There was no difference for WSSV detection using the two kits and the distinct methods for qPCR results evaluation. High clinical sensitivity for PstDV1 was obtained with TaqMan Universal Master Mix associated with relative threshold evaluation. Three cases of simultaneous infection by the WSSV and the PstDV1 were identified with duplex qPCR. The standardized duplex qPCR was shown to be a robust, highly sensitive, and feasible diagnostic tool for the simultaneous detection of the

  20. 15 CFR Supplement No. 4 to Part 748 - Authorities Administering Import Certificate/Delivery Verification (IC/DV) and End-User Statement...

    Science.gov (United States)

    2010-01-01

    ... China, People's Republic of Ministry of Commerce; Department of Mechanic, Electronic and High Technology... Industry, Trade, Commerce and Tourism, Frederick House, South Frederick Street, Dublin 2 IC/DV Italy... point of entry DV United Kingdom Department of Trade and Industry Export Licensing Branch Millbank Tower...

  1. Guatemala: Ozbrojený konflikt 1960-1996 a současná situace: se zvláštním zaměřením na Máje

    OpenAIRE

    Vilímková, Olga

    2009-01-01

    Tématem disertační práce je Guatemala: ozbrojený konflikt v letech 1960 - 1996 a současná situace se zvláštním zaměřením na Máje. Příčiny ozbrojeného konfliktu druhé ploviny XX. století (a mnoha současných problémů) v Guatemale se nacházejí v hluboké minulosti země. Už v době koloniální se začaly formovat ekonomicko - sociální vztahy mezi dvěma antagonistickými vrstvami společnosti: kolonizátory a původním obyvatelstvem, které bylo porobeno, vytlačeno na okraj společnosti a využíváno jako pra...

  2. On the development of a coupled regional climate-vegetation model RCM-CLM-CN-DV and its validation in Tropical Africa

    Science.gov (United States)

    Wang, Guiling; Yu, Miao; Pal, Jeremy S.; Mei, Rui; Bonan, Gordon B.; Levis, Samuel; Thornton, Peter E.

    2016-01-01

    This paper presents a regional climate system model RCM-CLM-CN-DV and its validation over Tropical Africa. The model development involves the initial coupling between the ICTP regional climate model RegCM4.3.4 (RCM) and the Community Land Model version 4 (CLM4) including models of carbon-nitrogen dynamics (CN) and vegetation dynamics (DV), and further improvements of the models. Model improvements derive from the new parameterization from CLM4.5 that addresses the well documented overestimation of gross primary production (GPP), a refinement of stress deciduous phenology scheme in CN that addresses a spurious LAI fluctuation for drought-deciduous plants, and the incorporation of a survival rule into the DV model to prevent tropical broadleaf evergreens trees from growing in areas with a prolonged drought season. The impact of the modifications on model results is documented based on numerical experiments using various subcomponents of the model. The performance of the coupled model is then validated against observational data based on three configurations with increasing capacity: RCM-CLM with prescribed leaf area index and fractional coverage of different plant functional types (PFTs); RCM-CLM-CN with prescribed PFTs coverage but prognostic plant phenology; RCM-CLM-CN-DV in which both the plant phenology and PFTs coverage are simulated by the model. Results from these three models are compared against the FLUXNET up-scaled GPP and ET data, LAI and PFT coverages from remote sensing data including MODIS and GIMMS, University of Delaware precipitation and temperature data, and surface radiation data from MVIRI and SRB. Our results indicate that the models perform well in reproducing the physical climate and surface radiative budgets in the domain of interest. However, PFTs coverage is significantly underestimated by the model over arid and semi-arid regions of Tropical Africa, caused by an underestimation of LAI in these regions by the CN model that gets exacerbated

  3. Contaminant Attenuation and Transport Characterization of 200-DV-1 Operable Unit Sediment Samples

    Energy Technology Data Exchange (ETDEWEB)

    Truex, Michael J. [Pacific Northwest National Lab. (PNNL), Richland, WA (United States); Szecsody, James E. [Pacific Northwest National Lab. (PNNL), Richland, WA (United States); Qafoku, Nikolla [Pacific Northwest National Lab. (PNNL), Richland, WA (United States); Strickland, Christopher E. [Pacific Northwest National Lab. (PNNL), Richland, WA (United States); Moran, James J. [Pacific Northwest National Lab. (PNNL), Richland, WA (United States); Lee, Brady D. [Pacific Northwest National Lab. (PNNL), Richland, WA (United States); Snyder, Michelle M.V. [Pacific Northwest National Lab. (PNNL), Richland, WA (United States); Lawter, Amanda R. [Pacific Northwest National Lab. (PNNL), Richland, WA (United States); Resch, Charles T. [Pacific Northwest National Lab. (PNNL), Richland, WA (United States); Gartman, Brandy N. [Pacific Northwest National Lab. (PNNL), Richland, WA (United States); Zhong, Lirong [Pacific Northwest National Lab. (PNNL), Richland, WA (United States); Nims, Megan K. [Pacific Northwest National Lab. (PNNL), Richland, WA (United States); Saunders, Danielle L. [Pacific Northwest National Lab. (PNNL), Richland, WA (United States); Williams, Benjamin D. [Pacific Northwest National Lab. (PNNL), Richland, WA (United States); Horner, Jacob A. [Pacific Northwest National Lab. (PNNL), Richland, WA (United States); Leavy, Ian I. [Pacific Northwest National Lab. (PNNL), Richland, WA (United States); Baum, Steven R. [Pacific Northwest National Lab. (PNNL), Richland, WA (United States); Christiansen, Beren B. [Pacific Northwest National Lab. (PNNL), Richland, WA (United States); Clayton, Ray E. [Pacific Northwest National Lab. (PNNL), Richland, WA (United States); McElroy, Erin M. [Pacific Northwest National Lab. (PNNL), Richland, WA (United States); Appriou, Delphine [Pacific Northwest National Lab. (PNNL), Richland, WA (United States); Tyrrell, Kimberly J. [Pacific Northwest National Lab. (PNNL), Richland, WA (United States); Striluk, Miranda L. [Pacific Northwest National Lab. (PNNL), Richland, WA (United States)

    2017-05-15

    A laboratory study was conducted to quantify contaminant attenuation processes and associated contaminant transport parameters that are needed to evaluate transport of contaminants through the vadose zone to the groundwater. The laboratory study information, in conjunction with transport analyses, can be used as input to evaluate the feasibility of Monitored Natural Attenuation and other remedies for the 200-DV-1 Operable Unit at the Hanford Site.

  4. Research reports 'nuclear research' (BMFT-KBK) (1965-1975). Research reports 'data processing' (BMFT-FB DV) (1971-1975)

    International Nuclear Information System (INIS)

    1975-01-01

    The BMFT catalogue compiled by ZAED, contains a bibliography of research reports in nuclear engineering (BMFT-KN K) from 1965 to 1975 and reports on data processing (BMFT-FB DV) from 1971 to 1975. (HK) [de

  5. Hartree-fock-slater method for materials science the DV-X alpha method for design and characterization of materials

    CERN Document Server

    Adachi, H; Kawai, J

    2006-01-01

    Molecular-orbital calculations for materials design such as alloys, ceramics, and coordination compounds are now possible for experimentalists. Molecuar-orbital calculations for the interpretation of chemical effect of spectra are also possible for experimentalists. The most suitable molecular-orbital calculation method for these purpose is the DV-Xa method, which is robust in such a way that the calculation converges to a result even if the structure of the molecule or solid is impossible in the pressure and temperature ranges on earth. This book specially addresses the methods to design novel materials and to predict the spectralline shape of unknown materials using the DV-Xa molecular-orbital method, but is also useful for those who want to calculate electronic structures of materials using any kind of method.

  6. Screening for trisomy 21 based on maternal age, nuchal translucency measurement, first trimester biochemistry and quantitative and qualitative assessment of the flow in the DV - the assessment of efficacy.

    Science.gov (United States)

    Czuba, Bartosz; Zarotyński, Dariusz; Dubiel, Mariusz; Borowski, Dariusz; Węgrzyn, Piotr; Cnota, Wojciech; Reska-Nycz, Małgorzata; Mączka, Marek; Wielgoś, Mirosław; Sodowski, Krzysztof; Serafin, Dawid; Kubaty, Anna; Bręborowicz, Grzegorz H

    2017-01-01

    The aim of the study was to compare effects of addition of two methods of ductus venosus (DV) flow assessment: qualitative - the assessment of shape of the A-wave (positive or negative), and quantitative - based on the pulsatility index for veins (DVPI) to the basic screening for trisomy 21 at 11 to 13 + 6 weeks of pregnancy. The ultrasound examination was performed in 8230 fetuses in singleton pregnancies at 11- -13 + 6 wks, as a part of a routine screening for chromosomal defects. In DV A-wave was assessed and DVPI was calculated. After the scan blood sample was taken for first trimester biochemistry (BC). Risk for chromosomal defects was calculated and high-risk patients were offered an invasive test for karyotyping. Basic screening with following combination of markers: MA, NT and BC provided lowest detection rate (DR) 87.50% for FPR = 6.94%. After adding qualitative DV A-wave assessment DR increased to 88.75% for FPR = 5.65%. The best DR = 93.75% for FPR = 5.55% was achieved when quantitative DVPI was added. The application of the Receiver Operating Curves curve confirmed validity of the addition of DV flow assessment to the screening model. The highest diagnostic power of the test was achieved when DVPI was added, with the ROC AUC of 0.974. The assessment of DV flow performed at 11-13 + 6 weeks increases DR for trisomy 21 and reduces FPR. The screening model based on the quantitative DV flow analysis (DVPI) gives better results compared to the qualitative flow assessment.

  7. Analysis of Wave Reflection from Structures with Berms Through an Extensive Database and 2DV Numerical Modelling

    DEFF Research Database (Denmark)

    Zanuttigh, Barbara; van der Meer, Jentsje W.; Andersen, Thomas Lykke

    2009-01-01

    This paper analyses wave reflection from permeable structures with a berm, including reshaping cases. Data are obtained from recent wave flume experiments and from 2DV numerical simulations performed with the COBRAS-UC code. The objectives of this research were to identify the proper representation...

  8. Projected effects of vegetation feedbacks on drought characteristics with SPEI over West Africa using the RegCM-CLM-CN-DV

    Science.gov (United States)

    Jaehyeong, L.; Kim, Y.; Erfanian, A.; Wang, G.; Um, M. J.

    2017-12-01

    This study utilizes the Standardized Precipitation-Evapotranspiration Index (SPEI) to investigate the projected effect of vegetation feedbacks on drought in West Africa using the Regional Climate Model coupled to the NCAR Community Land Model with both the Carbon and Nitrogen module (CN) and Dynamic Vegetation module (DV) activated (RegCM-CLM-CN-DV). The role of vegetation feedbacks is examined based on simulations with and without dynamic vegetation. The four different future climate scenarios from CCSM, GFDL, MIROC and MPI are used as the boundary conditions of RegCM for two historical and future periods, i.e., for 1981 to 2000 and for 2081 to 2100, respectively. Using SPEI, the duration, frequency, severity and spatial extents are quantified over West Africa and analyzed for two regions of the Sahel and the Gulf of Guinea. In this study, we find that the estimated annual SPEIs clearly indicate that the projected future droughts over the Sahel are enhanced and prolonged when DV is activated. The opposite is shown over the Gulf of Guinea in general. AcknowledgementsThis work was supported by Basic Science Research Program through the National Research Foundation of Korea (NRF) funded by the Ministry of Science, ICT & Future Planning (2015R1C1A2A01054800), by the Korea Meteorological Administration R&D Program under Grant KMIPA 2015-6180 and by the Yonsei University Future-leading Research Initiative of 2015(2016-22-0061).

  9. Totally extraperitoneal (TEP) bilateral hernioplasty using the Single Site® robotic da Vinci platform (DV-SS TEP): description of the technique and preliminary results.

    Science.gov (United States)

    Cestari, A; Galli, A C; Sangalli, M N; Zanoni, M; Ferrari, M; Roviaro, G

    2017-06-01

    Laparoendoscopic single site totally extraperitoneal (TEP) hernia repair showed to be a feasible alternative to conventional laparoscopic hernia repair; nevertheless single site surgery, with the loss of instruments triangulation can be a demanding procedure. To overcome those hurdles, the Single Site® (SS) platform of the da Vinci (DV) Si robotic system enables to perform surgical procedures through a 25-mm skin incision, with a stable 3D vision and restoring an adequate triangulation of the surgical instruments. We present in details the technique and the preliminary results of DV-SS TEP, to our knowledge the first cases reported in literature. In March 2016, three consecutive male patients (mean age 46.6 years-mean BMI 25.3) with bilateral symptomatic inguinal hernia were submitted to DV-SS TEP in our institutions. Feasibility, codification of the technique, operative time and perioperative outcomes were recorded. All the procedures were completed as scheduled, with no conversion to other techniques. Mean operative time was 98.6 min, ranging between 155 and 55 min, reflecting the learning curve of the operating room team on this new procedure. No intraoperative or postoperative complications were experienced and all the patients were discharged within 24 h after surgery. Patients reported satisfactory postoperative course, with no recurrence of inguinal hernia and satisfaction in cosmetic result at 6-month follow-up. DV-SS TEP inguinal hernia repair showed to be feasible and effective surgical option for bilateral groin hernia repair. Patients' outcome was uneventful, with optimal cosmetic results. Further studies comparing this innovative technique to TEP or LESS TEP should be promoted.

  10. Genome sequence of the acid-tolerant Desulfovibrio sp. DV isolated from the sediments of a Pb-Zn mine tailings dam in the Chita region, Russia

    Directory of Open Access Journals (Sweden)

    Anastasiia Kovaliova

    2017-03-01

    Full Text Available Here we report the draft genome sequence of the acid-tolerant Desulfovibrio sp. DV isolated from the sediments of a Pb-Zn mine tailings dam in the Chita region, Russia. The draft genome has a size of 4.9 Mb and encodes multiple K+-transporters and proton-consuming decarboxylases. The phylogenetic analysis based on concatenated ribosomal proteins revealed that strain DV clusters together with the acid-tolerant Desulfovibrio sp. TomC and Desulfovibrio magneticus. The draft genome sequence and annotation have been deposited at GenBank under the accession number MLBG00000000.

  11. A Narrative about a “Resurrected Woman” in the Reception of D.V. Batov, an Old Believer of Tula

    Directory of Open Access Journals (Sweden)

    Alexander V. Pigin

    2017-12-01

    Full Text Available The article deals with one of the genres of Russian folklore, the so-called obmiraniye narratives about a human soul visiting the other world during the lethargy state. It dis- cusses the problem of perception of such texts on the example of the following case study. At the turn of the century, a famous Tula-based Old Believer and publisher D.V. Batov (1825–1910 wrote a short article “On the Reading of Brochure Phrases” (reprinted as “On the Reading of Fictitious Brochures”. In this article, he strongly criticized the nar- rative about a “resurrected woman” recorded by Archimandrite Macarius (Glukharyov of Altai in the early 1830s. In this narrative, a local Cossack’s wife sank into lethargy and was ascended to heaven where she met the Lord who heard the prayers for her and let her go back but instead ordered to bring him the soul of a different woman bearing the same name. D.V. Batov interpreted this obmiraniye narrative as sheer fiction circulated by the dominant church, alongside other fictitious stories, and causing damage to the faith. The article examines other D.V. Batov’s arguments against this text: the main one is dis- crepancy between the narrative and the Orthodox doctrine of the soul’s afterlife ordeals as represented in the Byzantine Life of Vassily Novy (10 th century. The Old Believer of Tula reads a text belonging to folk culture through the lenses of church literature and bookish topoi. Thus, the process of text verification by the bearer of religious conscious- ness consists in its juxtaposing with the tradition that the recipient sees as the only true one. The article also analyzes the actual obmiraniye narrative recorded by Archimandrite Macarius and finds its parallels in oral and written texts of the visionary genre.

  12. Three semi-direct sum Lie algebras and three discrete integrable couplings associated with the modified K dV lattice equation

    International Nuclear Information System (INIS)

    Yu Zhang; Zhang Yufeng

    2009-01-01

    Three semi-direct sum Lie algebras are constructed, which is an efficient and new way to obtain discrete integrable couplings. As its applications, three discrete integrable couplings associated with the modified K dV lattice equation are worked out. The approach can be used to produce other discrete integrable couplings of the discrete hierarchies of soliton equations.

  13. Pipe-dependent ventral processing of Easter by Snake is the defining step in Drosophila embryo DV axis formation.

    Science.gov (United States)

    Cho, Yong Suk; Stevens, Leslie M; Stein, David

    2010-06-22

    The establishment of Drosophila embryonic dorsal-ventral (DV) polarity relies on serine proteolytic activity in the perivitelline space between the embryonic membrane and the eggshell. Gastrulation Defective cleaves and activates Snake, which processes and activates Easter, which cleaves Spätzle to form the activating ligand for the Toll receptor. Ventral restriction of ligand formation depends on the Pipe sulfotransferase, which is expressed in ventral cells of the follicular epithelium surrounding the developing oocyte. Pipe modifies components of the developing eggshell to produce a ventral cue embedded in the vitelline membrane. This ventral cue is believed to promote one or more of the proteolysis steps in the perivitelline space. By examining the processing of transgenic, tagged versions of the perivitelline proteins during DV patterning, we find that the proteolysis of Easter by Snake is the first Pipe-dependent step and therefore the key ventrally restricted event in the protease cascade. We also find that Snake and Easter associate together in a complex in both wild-type and pipe mutant-derived embryos. This observation suggests a mechanism in which the sulfated target of Pipe promotes a productive interaction between Snake and Easter, perhaps by facilitating conformational changes in a complex containing the two proteins. Copyright 2010 Elsevier Ltd. All rights reserved.

  14. Toetsing van het gehalte duurzame veiligheid met Safer Transportation Network Planning : integratie van de ‘DV-gehaltemeter’ in het ontwerpprogramma ‘Safer-TNP’

    NARCIS (Netherlands)

    Hummel, T.

    2001-01-01

    Testing the sustainable-safety contents with Safer Transportation Network Planning. In the publication entitled “Developing a sustainable-safety meter (DV-meter) for measuring the sustainable-safety contents” (Van der Kooi & Dijkstra, 2000), the development of and a pilot measurement with a

  15. A safe vaccine (DV-STM-07 against Salmonella infection prevents abortion and confers protective immunity to the pregnant and new born mice.

    Directory of Open Access Journals (Sweden)

    Vidya Devi Negi

    Full Text Available Pregnancy is a transient immuno-compromised condition which has evolved to avoid the immune rejection of the fetus by the maternal immune system. The altered immune response of the pregnant female leads to increased susceptibility to invading pathogens, resulting in abortion and congenital defects of the fetus and a subnormal response to vaccination. Active vaccination during pregnancy may lead to abortion induced by heightened cell mediated immune response. In this study, we have administered the highly attenuated vaccine strain DeltapmrG-HM-D (DV-STM-07 in female mice before the onset of pregnancy and followed the immune reaction against challenge with virulent S. Typhimurium in pregnant mice. Here we demonstrate that DV-STM-07 vaccine gives protection against Salmonella in pregnant mice and also prevents Salmonella induced abortion. This protection is conferred by directing the immune response towards Th2 activation and Th1 suppression. The low Th1 response prevents abortion. The use of live attenuated vaccine just before pregnancy carries the risk of transmission to the fetus. We have shown that this vaccine is safe as the vaccine strain is quickly eliminated from the mother and is not transmitted to the fetus. This vaccine also confers immunity to the new born mice of vaccinated mothers. Since there is no evidence of the vaccine candidate reaching the new born mice, we hypothesize that it may be due to trans-colostral transfer of protective anti-Salmonella antibodies. These results suggest that our vaccine DV-STM-07 can be very useful in preventing abortion in the pregnant individuals and confer immunity to the new born. Since there are no such vaccine candidates which can be given to the new born and to the pregnant women, this vaccine holds a very bright future to combat Salmonella induced pregnancy loss.

  16. Lothar de Maizière: Stasil on praegu rohkemgi võimu kui Saksa DV ajal / Lothar de Maizière ; intervjueerinud Külli-Riin Tigasson

    Index Scriptorium Estoniae

    Maizière, Lothar de

    2009-01-01

    Intervjuu Saksa DV esimese ja ühtlasi viimase demokraatlikult valitud peaministriga Berliini müüri langemisest 20 aastat tagasi, 21. sajandi peamistest väljakutsetest. SDV ajaloo uurimisest läänesakslaste poolt, ajaloo läbitöötamise käigus sündinud vildakast pildist SDV ühiskonnast, Stasi toimikutest

  17. Single DV-DXCCII Based Voltage Controlled First Order All-pass Filter with Inverting and Non-inverting responses

    Directory of Open Access Journals (Sweden)

    B Chaturvedi

    2015-12-01

    Full Text Available In this paper, a new voltage controlled first order all-pass filter is presented. The proposed circuit employs a single differential voltage dual-X second generation current conveyor (DV-DXCCII and a grounded capacitor only. The proposed all-pass filter provides both inverting and non inverting voltage-mode outputs from the same configuration simultaneously without any matching condition. Non-ideal analysis along with sensitivity analysis is also investigated. The proposed circuit has low active and passive sensitivities. As an application the proposed all-pass filter is connected in cascade to get higher order filter. The theoretical results are validated thorough PSPICE simulations using TSMC 0.18µm CMOS process parameters.

  18. Experimental Investigation of Sulfuric Acid Condensation and Corrosion Rate in Motored Bukh DV24 Diesel Engine

    DEFF Research Database (Denmark)

    Kjemtrup, Lars; Cordtz, Rasmus Faurskov; Meyer, Martin

    2017-01-01

    The work conducted in this paper presents a novel experimental setup to study sulfuric acid cold corrosion of cylinder liners in large two-stroke marine diesel engines. The process is simulated in a motored light duty BUKH DV24 diesel engine where the charge air contain known amounts of H2SO4 and H......2O vapor. Liner corrosion is measured as iron accumulation in the lubeoil. Similarly sulfuric acid condensation is assessed by measuring the accumulation of sulfur in the lube oil. To clarify the corrosive effect of sulfuric acid the lube oil utilized for experiments is a sulfur free neutral oil...... without alkaline additives (Chevron Neutral Oil 600R). Iron and sulfur accumulation in the lube oil is analyzed withan Energy Dispersive X-Ray Fluorescence (ED-XRF) apparatus. Three test cases with different H2SO4 concentrations are run. Results reveal good agreement between sulfuric acid injection flow...

  19. Slovinské národní divadlo v Lublani

    OpenAIRE

    Semela, Ladislav

    2010-01-01

    Řešením nové scény Slovinského Národního Divadla v Lublani sleduji i motto projektu „TACE“ (Theatre Architecture in Central Europe), tedy hledání formy a typu objektu pro "Nové Divadlo 21. století“. V rámci Workshopu konaného v březnu 2009 v Lublani, vznikly různé směry řešení včetně utopistických. Konfrontuji tedy tři témata: 1/ konvenční kukátkovou koncepci pro činohru „Národního Divadla“, 2/ nekonvenční řešení „Nového Divadla pro 21. století“ a 3/ urbanistický koncept dané lokality, tzv. „...

  20. A prospective, single-arm study on the use of the da Vinci® Table Motion with the Trumpf TS7000dV operating table.

    Science.gov (United States)

    Morelli, Luca; Palmeri, Matteo; Simoncini, Tommaso; Cela, Vito; Perutelli, Alessandra; Selli, Cesare; Buccianti, Piero; Francesca, Francesco; Cecchi, Massimo; Zirafa, Cristina; Bastiani, Luca; Cuschieri, Alfred; Melfi, Franca

    2018-03-30

    The da Vinci® Table Motion (dVTM) comprises a combination of a unique operating table (Trumpf Medical™ TruSystem® 7000dV) capable of isocenter motion connected wirelessly with the da Vinci Xi® robotic platform, thereby enabling patients to be repositioned without removal of instruments and or undocking the robot. Between May 2015 to October 2015, the first human use of dVTM was carried out in this prospective, single-arm, post-market study in the EU, for which 40 patients from general surgery (GS), urology (U), or gynecology (G) were enrolled prospectively. Primary endpoints of the study were dVTM feasibility, efficacy, and safety. Surgeons from the three specialties obtained targeting success and the required table positioning in all cases. Table movement/repositioning was necessary to gain exposure of the operating field in 106/116 table moves (91.3%), change target in 2/116 table moves (1.7%), achieve hemodynamic relief in 4/116 table moves (3.5%), and improve external access for tumor removal in 4/116 table moves (3.5%). There was a significantly higher use of tilt and tilt plus Trendelenburg in GS group (GS vs. U p = 0.055 and GS vs. G p = 0.054). There were no dVTM safety-related or adverse events. The dVTM with TruSystem 7000dV operating table in wireless communication with the da Vinci Xi is a perfectly safe and effective synergistic combination, which allows repositioning of the patient whenever needed without imposing any delay in the execution of the operation. Moreover, it is helpful in avoiding extreme positions and enables the anesthesiologist to provide immediate and effective hemodynamic relief to the patient when needed.

  1. The first microbiological contamination assessment by deep-sea drilling and coring by the D/V Chikyu at the Iheya North hydrothermal field in the Mid-Okinawa Trough (IODP Expedition 331

    Directory of Open Access Journals (Sweden)

    Katsunori eYanagawa

    2013-11-01

    Full Text Available During the Integrated Ocean Drilling Program (IODP Expedition 331 at the Iheya North hydrothermal system in the Mid-Okinawa Trough by the D/V Chikyu, we conducted microbiological contamination tests of the drilling and coring operations. The contamination from the drilling mud fluids was assessed using both perfluorocarbon tracers (PFT and fluorescent microsphere beads. PFT infiltration was detected from the periphery of almost all whole round cores. By contrast, fluorescent microspheres were not detected in hydrothermally active core samples, possibly due to thermal decomposition of the microspheres under high-temperature conditions. Microbial contamination from drilling mud fluids to the core interior subsamples was further characterized by molecular-based evaluation. The microbial 16S rRNA gene phylotype compositions in the drilling mud fluids were mainly composed of sequences of Beta- and Gammaproteobacteria, and Bacteroidetes and not archaeal sequences. The phylotypes that displayed more than 97% similarity to the sequences obtained from the drilling mud fluids were defined as possible contaminants in this study and were detected as minor components of the bacterial phylotype compositions in 13 of 37 core samples. The degree of microbiological contamination was consistent with that determined by the PFT and/or microsphere assessments. This study suggests a constructive approach for evaluation and eliminating microbial contamination during riser-less drilling and coring operations by the D/V Chikyu.

  2. Listvenite logging on D/V CHIKYU: Hole BT1B, Oman Drilling Project

    Science.gov (United States)

    Kelemen, P. B.; Beinlich, A.; Morishita, T.; Greenberger, R. N.; Johnson, K. T. M.; Lafay, R.; Michibayashi, K.; Harris, M.; Phase I Science Party, T. O. D. P.

    2017-12-01

    Listvenite, quartz-carbonate altered ultramafic rock containing minor fuchsite (Cr-muscovite) forms by complete carbonation of peridotite and is thus an attractive objective for carbon mitigation studies. However, reaction controls and evolution of listvenite are still enigmatic. Here we present the first results of Phase 1 of the ICDP (International Continental Drilling Program) Oman Drilling Project and subsequent core logging using the analytical facilities on board the research vessel D/V CHIKYU. Hole BT1B contains 300 m of continuous drill core intersecting alluvium, listvenite-altered serpentinite, serpentinite, ophicarbonate and the underlying metamorphic sole of the Semail ophiolite, Oman. The drill core has been systematically investigated by visual core description, thin section petrography, X-ray fluorescence core logging, X-ray diffractometry, visible-shortwave infrared imaging spectroscopy and X-ray Computer Tomography. Our observations show that listvenite is highly variable in texture and color on the mm to m scale. Listvenite was visually categorized into 5 principal color groups: the dominant dark red (47 %), light red (19 %), orange (14 %), pale (2 %) and green (16 %). The presence of hematite/goethite results in dark reddish, red and orange hues. Light grey or pale colored listvenite lacks hematite and/or goethite veins and may represent the `true' listvenite. Green listvenite is characterized by the presence of cm-sized quartz-fuchsite intergrowths. Five zones of serpentinite, which vary in thickness between several tens of cm and 4 m, are intercalated within the massive listvenite of Hole BT1B. Gradational listvenite-serpentinite transition zones contain the ophicarbonate assemblage (magnesite + serpentine) and sometimes additional talc, representing intermediate carbonation reaction progress. Preservation of the former mesh texture and bastite after orthopyroxene in the listvenite suggest that the listvenite precursor had already been

  3. Kamillo Horn und das Melodram

    Czech Academy of Sciences Publication Activity Database

    Bajgarová, Jitka

    2010-01-01

    Roč. 12, - (2010), s. 229-237 ISSN 1212-1193. [Zdeněk Fibich, středoevropský skladatel konce 19. století. Olomouc, 19.05.2010–21.05.2010] Institutional research plan: CEZ:AV0Z90580513 Keywords : Kamillo Horn * concert melodrama Subject RIV: AL - Art, Architecture, Cultural Heritage

  4. Labyrinthus - Emendatio - Paradisus. Několik poznámek o ráji v didaktických spisech Komenského

    Czech Academy of Sciences Publication Activity Database

    Steiner, Martin

    2002-01-01

    Roč. 32, 67-68 (2002), s. 85-88 ISSN 0323-2220. [J.A. Komenský - milenarismus a eschatologie 17. století /23./. Uherský Brod, 17.10.2001-18.10.2001] Institutional research plan: CEZ:AV0Z9009908 Keywords : J.A. Comenius * paradisus Subject RIV: AA - Philosophy ; Religion

  5. X-ray Fluorescence Core Scanning of Oman Drilling Project Holes BT1B and GT3A Cores on D/V CHIKYU

    Science.gov (United States)

    Johnson, K. T. M.; Kelemen, P. B.; Michibayashi, K.; Greenberger, R. N.; Koepke, J.; Beinlich, A.; Morishita, T.; Jesus, A. P. M.; Lefay, R.

    2017-12-01

    The JEOL JSX-3600CA1 energy dispersive X-ray fluorescence core logger (XRF-CL) on the D/V Chikyu provides quantitative element concentrations of scanned cores. Scans of selected intervals are made on an x-y grid with point spacing of 5 mm. Element concentrations for Si, Al, Ti, Ca, Mg, Mn, Fe, Na, K, Cr, Ni, S and Zn are collected for each point on the grid. Accuracy of element concentrations provided by the instrument software is improved by applying empirical correction algorithms. Element concentrations were collected for 9,289 points from twenty-seven core intervals in Hole BT1B (basal thrust) and for 6,389 points from forty core intervals in Hole GT3A (sheeted dike-gabbro transition) of the Oman Drilling Project on the D/V Chikyu XRF-CL during Leg 2 of the Oman Drilling Project in August-September, 2017. The geochemical data are used for evaluating downhole compositional details associated with lithological changes, unit contacts and mineralogical variations and are particularly informative when plotted as concentration contour maps or downhole concentration diagrams. On Leg 2 additional core scans were made with X-ray Computed Tomography (X-ray CT) and infrared images from the visible-shortwave infrared imaging spectroscopy (IR) systems on board. XRF-CL, X-ray CT and IR imaging plots used together provide detailed information on rock compositions, textures and mineralogy that assist naked eye visual observations. Examples of some uses of XRF-CL geochemical maps and downhole data are shown. XRF-CL and IR scans of listvenite clearly show zones of magnesite, dolomite and the Cr-rich mica, fuchsite that are subdued in visual observation, and these scans can be used to calculate variations in proportions of these minerals in Hole BT1B cores. In Hole GT3A XRF-CL data can be used to distinguish compositional changes in different generations of sheeted dikes and gabbros and when combined with visual observations of intrusive relationships the detailed geochemical

  6. Emanuel Chalupný a Ferdinand Peroutka o J.A. Komenském

    Czech Academy of Sciences Publication Activity Database

    Beneš, Jiří

    2000-01-01

    Roč. 30, 63-64 (2000), s. 171-176 ISSN 0323-2220. [Obraz Jana Amose Komenského ve 20. století. Věda-mýtus-ideologie /22./. Uherský Brod, 07.10.1999-08.10.1999] Institutional research plan: CEZ:AV0Z9009908 Keywords : Comeniology Subject RIV: AA - Philosophy ; Religion

  7. Novostavba rodinného domu se dvěma bytovými jednotkami v Galantě v části Kolónia

    OpenAIRE

    Varjú, Marián

    2015-01-01

    Bakalářská práce „Novostavba rodinného domu se dvěma bytovými jednotkami v Galanta v části Kolónia“ je zpracována ve formě prováděcí projektové dokumentace a obsahuje všechny náležitosti dle platných předpisů. Navržený objekt leží na parcelách s číslem 5184/143, 5184/40 v Galantě v části Kolónia. Svým charakterem se jedná o samostatně stojící objekt. Rodinný dům je navržen systémem Durisol od Leier. Konstrukce střechy je rozdělena do dvou úrovní. Střecha je tvořena z pultové vaznicové konstru...

  8. Komika v díle Bohumíra Hynka Josefa Bílovského

    Czech Academy of Sciences Publication Activity Database

    Havelka, Tomáš

    2004-01-01

    Roč. 34, 71-72 (2004), s. 142-154 ISSN 0323-2220. [Morava na křižovatce duchovních proudů 16. a 17. století /24./. Uherský Brod, 15.10.2003-17.10.2003] Institutional research plan: CEZ:AV0Z9009908 Keywords : comic * Czech baroque homiletic * rhetoric Subject RIV: AA - Philosophy ; Religion

  9. THE RECENT STRUCTURE AND THE ASSUMED HISTORY OF FORMATION OF THE CRUST IN THE SOUTH-EASTERN SEGMENT OF THE NORTH ASIAN CRATON ALONG REFERENCE PROFILE 3-DV

    Directory of Open Access Journals (Sweden)

    E. Yu. Goshko

    2014-01-01

    Full Text Available The article presents results of specialized processing of the deep seismic profile along a part of Reference Profile 3-DV which crosses the Aldan-Stanovoi shield in the meridian direction and goes across its buried northern slope. The study is aimed at determining frequency-energy characteristics of the seismic wave field which are related to physical conditions of geological features of the crust. Based on analysis and interpretation of the dynamic profiles, it is possible to reveal and contour the Archean cores of consolidation of the Aldan shield and its buried continuation that is covered by sediments of the Middle Lena monocline and to input new facts in the proposed geodynamic model showing formation of the crust in the south-eastern segment of the North Asian craton.

  10. Stěžejní východiska a koncepce současné anglické náboženské pedagogiky

    Directory of Open Access Journals (Sweden)

    Karim Sidibe

    2017-08-01

    Full Text Available Tento článek si klade za cíl analyzovat didaktické koncepce výuky náboženství pěti hlavních teoretiků současné anglické náboženské pedagogiky, Harolda Loukese, Niniana Smarta, Davida Haye, Cliva Errickera a Andrewa Wrighta. Loukes a Smart položili základy současné náboženské pedagogiky v Anglii v 60. letech 20. století. Loukes využil poznatky vývojové psychologie a Smart výuku sekularizoval. Hayovo pojetí z 80. let 20. století akcentuje niternou duchovní skutečnost žáků. V současné době Erricker aplikuje postmoderní filosofická východiska na výuku a akcentuje individualitu a nezávislost žáků, zatímco Wright vychází z filosofických východisek kritického realismu a akcentuje nutnost teologické a filosofické diskuze na hodinách náboženství.

  11. Účast D. Stránské na Soupisovém výzkumu NSČ

    Czech Academy of Sciences Publication Activity Database

    Motyčková, Dana

    15[57]-16[58], - (1999), s. 99-102 ISSN 1211-8117. [Lidová kultura 20. století, její výzkum, dokumentace a prezentace. Věnováno 100. výročí narození doc. dr. Drahomíry Stránské. Rožnov pod Radhoštěm, 08.09.1999] Subject RIV: AC - Archeology, Anthropology, Ethnology

  12. K nestandardním jazykovým jevům ve staročeských textech

    Czech Academy of Sciences Publication Activity Database

    Svobodová, Andrea; Voleková, Kateřina

    2016-01-01

    Roč. 8, č. 3 (2016), s. 16-36 ISSN 1803-876X. [Jazykovědný strukturalismus na počátku 21. století. Olomouc, 24.04.2014-24.04.2014] R&D Projects: GA ČR GAP406/10/1140 Institutional support: RVO:68378092 Keywords : Old Czech * historical dialectology * non-standard language phenomena * transcription * ortography Subject RIV: AI - Linguistics OBOR OECD: Linguistics

  13. Drahomíra Stránská a studium lidové obuvi prostřednictvím dotazníkové akce Národopisné společnosti

    Czech Academy of Sciences Publication Activity Database

    Holubová, Markéta

    15[57]-16[58], - (1999), s. 95-98 ISSN 1211-8117. [Lidová kultura 20. století, její výzkum, dokumentace a prezentace. Věnováno 100. výročí narození doc. dr. Drahomíry Stránské. Rožnov pod Radhoštěm, 08.09.1999] Institutional research plan: CEZ:AV0Z9058907 Subject RIV: AC - Archeology, Anthropology, Ethnology

  14. Ještě ke slovu ještě

    Czech Academy of Sciences Publication Activity Database

    Nejedlý, Petr

    2016-01-01

    Roč. 8, č. 3 (2016), s. 38-48 ISSN 1803-876X. [Jazykovědný strukturalismus na počátku 21. století. Olomouc, 24.04.2014-24.04.2014] R&D Projects: GA ČR GAP406/10/1153 Institutional support: RVO:68378092 Keywords : Miroslav Komárek * lexical unit ještě (= still, yet) * grammatical analysis * lexicological analysis * lexical meaning Subject RIV: AI - Linguistics OBOR OECD: Linguistics

  15. Long term changes in water areas and wetlands in an intensively farmed landscape: A case study from the Czech Republic

    Directory of Open Access Journals (Sweden)

    Šantrůčková Markéta

    2017-03-01

    Full Text Available Krajina České republiky v současnosti čelí nebezpečí sucha, které je způsobeno mnoha faktory. Mezi ně patří změny krajiny a krajinného pokryvu. V článku jsou sledovány změny vodních a mokřadních ploch a délky vodních toků na podkladě starých vojenských mapování a současného stavu. Vodní a mokřadní plochy v nížinách zásadně ubyly a krajina byla vysušována s cílem zvýšit zemědělskou a lesnickou produkci. Zatímco na konci 18. století vodní a mokřadní plochy zaujímaly skoro třetinu sledovaného území Novodvorska a Žehušicka ve středních Čechách, v současnosti je to jen 3,5 %. V každé ze sledovaných period ubylo přibližně 10 % jejich rozlohy, významný úbytek těchto ploch v krajině tak nastal již v 19. století. Vodní a mokřadní plochy byly změněny převážně na ornou půdu. Délka vodních toků poklesla zejména v průběhu 19. století. Současná data ukazují nárůst jejich délky, který je ale způsoben budováním zavodňovacích a odvodňovacích kanálů, jejichž délka je také započítána do celkové délky vodních toků, byť nejsou celoročně protékány vodou.

  16. Synthesis, characterization and fluorescence performance of a waterborne polyurethane-based polymeric dye

    Energy Technology Data Exchange (ETDEWEB)

    Xianhai, Hu, E-mail: hxyh@aiai.edu.cn [CAS Key Laboratory of Soft Matter Chemistry, Department of Polymer Science and Engineering, University of Science and Technology of China, Hefei 230026 (China); School of Materials and Chemical Engineering, Building Energy Efficiency Research Institute, Anhui University of Architecture, Hefei 230022 (China); Zhang, Xingyuan, E-mail: zxym@ustc.edu.cn [CAS Key Laboratory of Soft Matter Chemistry, Department of Polymer Science and Engineering, University of Science and Technology of China, Hefei 230026 (China); Liu, Jin [School of Materials and Chemical Engineering, Building Energy Efficiency Research Institute, Anhui University of Architecture, Hefei 230022 (China); Dai, Jiabing [CAS Key Laboratory of Soft Matter Chemistry, Department of Polymer Science and Engineering, University of Science and Technology of China, Hefei 230026 (China)

    2013-10-15

    A novel anionic waterborne polyurethane-based fluorescent dye WPU-DV26 was synthesized by incorporating the molecular structure of disperse violet 26 (DV26) into the polyurethane chain. The structure of WPU-DV26 was confirmed by means of Fourier transform infrared spectroscopy and UV–vis absorption analysis. Comparing to the UV–vis spectrum of DV26, WPU-DV26 showed a hypsochromic shift from the absorption maxima of 518, 558, 609 nm to 510, 548, 586 nm, respectively. WPU-DV26 can form stable latex in water. The number average molecular weight and its distribution index, and average latex particle size for WPU-DV26 were determined to be 2.33×10{sup 4}, 1.36 and 80 nm, respectively. The improved thermal stability of WPU-DV26 can be attributed to the embedded anthraquinone unit of DV26. It was found that both the intensity and stability of the fluorescence of WPU-DV26 latex were improved significantly compared with those of DV26. -- Highlights: ► A waterborne polyurethane-based polymeric dye was synthesized. ► The fluorescence intensity of WPU-DV26 emulsion was enhanced greatly compared with that of DV26. ► The fluorescence stability of WPU-DV26 emulsion was fine not only for long term storage but also for fluorescence quencher.

  17. Activation of TLR2 and TLR6 by Dengue NS1 Protein and Its Implications in the Immunopathogenesis of Dengue Virus Infection.

    Directory of Open Access Journals (Sweden)

    Jincheng Chen

    2015-07-01

    Full Text Available Dengue virus (DV infection is the most prevalent mosquito-borne viral disease and its manifestation has been shown to be contributed in part by the host immune responses. In this study, pathogen recognition receptors, Toll-like receptor (TLR 2 and TLR6 were found to be up-regulated in DV-infected human PBMC using immunofluorescence staining, flow cytometry and Western blot analyses. Using ELISA, IL-6 and TNF-α, cytokines downstream of TLR2 and TLR6 signaling pathways were also found to be up-regulated in DV-infected PBMC. IL-6 and TNF-α production by PBMC were reduced when TLR2 and TLR6 were blocked using TLR2 and TLR6 neutralizing antibodies during DV infection. These results suggested that signaling pathways of TLR2 and TLR6 were activated during DV infection and its activation contributed to IL-6 and TNF-α production. DV NS1 protein was found to significantly increase the production of IL-6 and TNF-α when added to PBMC. The amount of IL-6 and TNF-α stimulated by DV NS1 protein was reduced when TLR2 and TLR6 were blocked, suggesting that DV NS1 protein is the viral protein responsible for the activation of TLR2 and TLR6 during DV infection. Secreted alkaline phosphatase (SEAP reporter assay was used to further confirm activation of TLR2 and TLR6 by DV NS1 protein. In addition, DV-infected and DV NS1 protein-treated TLR6-/- mice have higher survivability compared to DV-infected and DV NS1 protein-treated wild-type mice. Hence, activation of TLR6 via DV NS1 protein could potentially play an important role in the immunopathogenesis of DV infection.

  18. Perlecan Domain V induces VEGf secretion in brain endothelial cells through integrin α5β1 and ERK-dependent signaling pathways.

    Directory of Open Access Journals (Sweden)

    Douglas N Clarke

    Full Text Available Perlecan Domain V (DV promotes brain angiogenesis by inducing VEGF release from brain endothelial cells (BECs following stroke. In this study, we define the specific mechanism of DV interaction with the α(5β(1 integrin, identify the downstream signal transduction pathway, and further investigate the functional significance of resultant VEGF release. Interestingly, we found that the LG3 portion of DV, which has been suggested to possess most of DV's angio-modulatory activity outside of the brain, binds poorly to α(5β(1 and induces less BEC proliferation compared to full length DV. Additionally, we implicate DV's DGR sequence as an important element for the interaction of DV with α(5β(1. Furthermore, we investigated the importance of AKT and ERK signaling in DV-induced VEGF expression and secretion. We show that DV increases the phosphorylation of ERK, which leads to subsequent activation and stabilization of eIF4E and HIF-1α. Inhibition of ERK activity by U0126 suppressed DV-induced expression and secretion of VEGR in BECs. While DV was capable of phosphorylating AKT we show that AKT phosphorylation does not play a role in DV's induction of VEGF expression or secretion using two separate inhibitors, LY294002 and Akt IV. Lastly, we demonstrate that VEGF activity is critical for DV increases in BEC proliferation, as well as angiogenesis in a BEC-neuronal co-culture system. Collectively, our findings expand our understanding of DV's mechanism of action on BECs, and further support its potential as a novel stroke therapy.

  19. Analysis of a Mathematical Model to Investigate the Dynamics of ...

    African Journals Online (AJOL)

    ADOWIE PERE

    4. 3. 6. **. DH. DV. H. H. H. H. H. H. H. DV. V. H. H. H. H. H. H. V. H. H. DH. DV. H. V. V. H. V. VH. DV gg ggg gggg gg ggg gggg gg g λλ γτ. µγ. µ. µ. λµ γτ. µγ. µ. µ. µ. µ λλ. µ γ. ηµ β λ. Λ. +. Λ+. Λ+. Λ+. Λ. +. Λ+. Λ+. Λ. +. +. Λ. = (33) substituting. **. DH λ to. **. DV λ we have. 0. 3. **. 2. 2**. 1. = +. +. A. A. A. Dv. Dv λ λ. (34) where.

  20. Profile and programming needs of federal offenders with histories of intimate partner violence.

    Science.gov (United States)

    Stewart, Lynn A; Power, Jenelle

    2014-10-01

    This study presents data on male perpetrators of domestic violence (DV) in the Correctional Service of Canada (CSC) using two samples: (a) a snapshot of all male offenders in CSC who had been assessed for DV (n = 15,166) and (b) a cumulative sample of male offenders in CSC from 2002-2010 who had been assessed as moderate or high risk for further DV (n = 4,261) DV offenders were compared to a cohort sample of non-DV offenders (n = 4,261). Analyses were disaggregated for Aboriginal and non-Aboriginal offenders. Results indicated that 40% of the federal male population had a suspected history of DV and were therefore screened in for in-depth DV risk assessment. Of these, 45% were assessed as moderate or high risk for future DV. DV offenders had higher risk and criminogenic need ratings, more learning disabilities, more mental health problems, and more extensive criminal histories than those without DV histories. Aboriginal DV offenders had high levels of alcohol dependence, suggesting a need for substance abuse treatment as part of DV programming. Most federal offenders with DV histories would be described as belonging to the Antisocial/Generalized Aggressive typology and, therefore, adhering to the Risk-Need-Responsivity principles of the effective correctional literature, cognitive-behavioral treatment that focuses on teaching skills of self-management, and changing attitudes supporting relationship violence would be recommended. © The Author(s) 2014.

  1. Human T Lymphocytes Are Permissive for Dengue Virus Replication.

    Science.gov (United States)

    Silveira, Guilherme F; Wowk, Pryscilla F; Cataneo, Allan H D; Dos Santos, Paula F; Delgobo, Murilo; Stimamiglio, Marco A; Lo Sarzi, Maria; Thomazelli, Ana Paula F S; Conchon-Costa, Ivete; Pavanelli, Wander R; Antonelli, Lis R V; Báfica, André; Mansur, Daniel S; Dos Santos, Claudia N Duarte; Bordignon, Juliano

    2018-05-15

    Dengue virus (DV) infection can cause either a self-limiting flu-like disease or a threatening hemorrhage that may evolve to shock and death. A variety of cell types, such as dendritic cells, monocytes, and B cells, can be infected by DV. However, despite the role of T lymphocytes in the control of DV replication, there remains a paucity of information on possible DV-T cell interactions during the disease course. In the present study, we have demonstrated that primary human naive CD4 + and CD8 + T cells are permissive for DV infection. Importantly, both T cell subtypes support viral replication and secrete viable virus particles. DV infection triggers the activation of both CD4 + and CD8 + T lymphocytes, but preactivation of T cells reduces the susceptibility of T cells to DV infection. Interestingly, the cytotoxicity-inducing protein granzyme A is highly secreted by human CD4 + but not CD8 + T cells after exposure to DV in vitro Additionally, using annexin V and polycaspase assays, we have demonstrated that T lymphocytes, in contrast to monocytes, are resistant to DV-induced apoptosis. Strikingly, both CD4 + and CD8 + T cells were found to be infected with DV in acutely infected dengue patients. Together, these results show that T cells are permissive for DV infection in vitro and in vivo , suggesting that this cell population may be a viral reservoir during the acute phase of the disease. IMPORTANCE Infection by dengue virus (DV) causes a flu-like disease that can evolve to severe hemorrhaging and death. T lymphocytes are important cells that regulate antibody secretion by B cells and trigger the death of infected cells. However, little is known about the direct interaction between DV and T lymphocytes. Here, we show that T lymphocytes from healthy donors are susceptible to infection by DV, leading to cell activation. Additionally, T cells seem to be resistant to DV-induced apoptosis, suggesting a potential role as a viral reservoir in humans. Finally, we show

  2. Generation of a non-transmissive Borna disease virus vector lacking both matrix and glycoprotein genes.

    Science.gov (United States)

    Fujino, Kan; Yamamoto, Yusuke; Daito, Takuji; Makino, Akiko; Honda, Tomoyuki; Tomonaga, Keizo

    2017-09-01

    Borna disease virus (BoDV), a prototype of mammalian bornavirus, is a non-segmented, negative strand RNA virus that often causes severe neurological disorders in infected animals, including horses and sheep. Unique among animal RNA viruses, BoDV transcribes and replicates non-cytopathically in the cell nucleus, leading to establishment of long-lasting persistent infection. This striking feature of BoDV indicates its potential as an RNA virus vector system. It has previously been demonstrated by our team that recombinant BoDV (rBoDV) lacking an envelope glycoprotein (G) gene develops persistent infections in transduced cells without loss of the viral genome. In this study, a novel non-transmissive rBoDV, rBoDV ΔMG, which lacks both matrix (M) and G genes in the genome, is reported. rBoDV-ΔMG expressing green fluorescence protein (GFP), rBoDV ΔMG-GFP, was efficiently generated in Vero/MG cells stably expressing both BoDV M and G proteins. Infection with rBoDV ΔMG-GFP was persistently maintained in the parent Vero cells without propagation within cell culture. The optimal ratio of M and G for efficient viral particle production by transient transfection of M and G expression plasmids into cells persistently infected with rBoDV ΔMG-GFP was also demonstrated. These findings indicate that the rBoDV ΔMG-based BoDV vector may provide an extremely safe virus vector system and could be a novel strategy for investigating the function of M and G proteins and the host range of bornaviruses. © 2017 The Societies and John Wiley & Sons Australia, Ltd.

  3. Exposure to Spousal Violence in the Family, Attitudes and Dating Violence Perpetration Among High School Students in Port-au-Prince.

    Science.gov (United States)

    Gage, Anastasia J

    2016-09-01

    This study examined the associations of exposure to spousal violence in the family and personal and peer attitudes with dating violence (DV) perpetration among high school students in Port-au-Prince, Haiti. Participants were 342 high school students in Grades 10 to 12 who stated that they had ever been on a date. Multiple linear regression methods were used to examine correlates of the scale of DV perpetration. Findings showed that personal acceptance of DV mediated the association between exposure to wife-perpetrated and husband-perpetrated spousal violence in the family and DV perpetration for girls. Boys who were exposed to husband-perpetrated spousal violence in the family had significantly higher levels of psychological DV perpetration than those who were not. Contrary to expectations, exposure to wife-perpetrated spousal violence in the family was negatively associated with psychological and physical/sexual DV perpetration by boys, after controlling for other factors. Overall, perceived peer tolerance of DV was more strongly associated with DV perpetration than personal tolerance of DV, and was the only significant correlate of psychological DV perpetration for girls. Perceived peer attitudes also moderated the association between boys' exposure to spousal violence in the family and DV perpetration. Implications for future research and policy are discussed. © The Author(s) 2015.

  4. Dicty_cDB: Contig-U06933-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available Aedes aegypti infected with Dengue viru... 42 1.5 2 ( DV277062 ) NAAGT55TF Aedes aegypti - Fat Bodie...hrome oxid... 36 1.6 2 ( DV275464 ) NAAH730TR Aedes aegypti - Fat Bodies Normalized (... 42 1.7 2 ( DV399876...h Dengue viru... 42 1.8 2 ( DV275462 ) NAAH730TF Aedes aegypti - Fat Bodies Normalized (... 42 1.8 2 ( DV399

  5. Simplified quantification of nicotinic receptors with 2[18F]F-A-85380 PET

    International Nuclear Information System (INIS)

    Mitkovski, Sascha; Villemagne, Victor L.; Novakovic, Kathy E.; O'Keefe, Graeme; Tochon-Danguy, Henri; Mulligan, Rachel S.; Dickinson, Kerryn L.; Saunder, Tim; Gregoire, Marie-Claude; Bottlaender, Michel; Dolle, Frederic; Rowe, Christopher C.

    2005-01-01

    Introduction: Neuronal nicotinic acetylcholine receptors (nAChRs), widely distributed in the human brain, are implicated in various neurophysiological processes as well as being particularly affected in neurodegenerative conditions such as Alzheimer's disease. We sought to evaluate a minimally invasive method for quantification of nAChR distribution in the normal human brain, suitable for routine clinical application, using 2[ 18 F]F-A-85380 and positron emission tomography (PET). Methods: Ten normal volunteers (four females and six males, aged 63.40±9.22 years) underwent a dynamic 120-min PET scan after injection of 226 MBq 2[ 18 F]F-A-85380 along with arterial blood sampling. Regional binding was assessed through standardized uptake value (SUV) and distribution volumes (DV) obtained using both compartmental (DV 2CM ) and graphical analysis (DV Logan ). A simplified approach to the estimation of DV (DV simplified ), defined as the region-to-plasma ratio at apparent steady state (90-120 min post injection), was compared with the other quantification approaches. Results: DV Logan values were higher than DV 2CM . A strong correlation was observed between DV simplified , DV Logan (r=.94) and DV 2CM (r=.90) in cortical regions, with lower correlations in thalamus (r=.71 and .82, respectively). Standardized uptake value showed low correlation against DV Logan and DV 2CM . Conclusion: DV simplified determined by the ratio of tissue to metabolite-corrected plasma using a single 90- to 120-min PET acquisition appears acceptable for quantification of cortical nAChR binding with 2[ 18 F]F-A-85380 and suitable for clinical application

  6. Associations among Depressive Symptoms, Dating Violence, and Relationship Power in Urban, Adolescent Girls

    Science.gov (United States)

    Volpe, Ellen M.; Hardie, Thomas L.; Cerulli, Catherine

    2013-01-01

    Objective To explore the associations among dating violence (DV), aggression, relationship power, and depressive symptoms. Design A cross-sectional survey secondary analysis. Setting An urban, school based health center, October, 2009 through May, 2009. Participants Low income, adolescent girls (n= 155), ages 14–18. Methods Descriptive and bivariate analyses were conducted to illustrate patterns and associations among variables. Key variables included depressive symptoms, DV victimization and aggression, and relationship power. We used mediation analyses to determine the direct and indirect effects among variables. Results Both DV victimization and aggression were reported frequently. Furthermore, DV victimization had a significant direct effect on depression and an indirect effect through relationship power. Depressive symptoms and relationship power were associated with DV aggression. Although relationship power did have a significant inverse effect on depressive symptoms, it was not through DV aggression. Conclusions Complex associations remain between mental health and DV; however, relationship power partially accounts for DV victimization's effect on depressive symptoms. Depressive symptoms are associated with DV victimization and aggression; therefore, nurses should address relationship power in clinical and community interventions. PMID:22697267

  7. Transfer of the lambdadv plasmid to new bacterial hosts

    International Nuclear Information System (INIS)

    Kellenberger-Gujer, G.; Boy de la Tour, E.; Berg, D.E.

    1974-01-01

    Lambda dv, which was derived from bacteriophage lambda, replicates autonomously as a plasmid in Escherichia coli and consists of only the immunity region (imm/sup lambda/) and DNA replication genes (O, P) of the ancestral phage. Addition phages (lambda imm 21 --lambda dv) carry the lambda dv fragment inserted as a tandem duplication in their genome (sequence A imm 21 O P imm/sup lambda/ O P R) are formed as recombinants after lambda imm 21 infection of strains carrying lambda dv. Addition phages were used to transfer lambda dv to new bacterial hosts. Lambda dv transfer by excision of the lambda dv segment from the addition phage genome requires a bacterial Rec or a phage Red recombination system. Successful transfer is stimulated by uv irradiation of the addition phage before infection. Some properties of the newly transferred lambda dv plasmids are described. (U.S.)

  8. How Well Does the World Health Organization Definition of Domestic Violence Work for India?

    Science.gov (United States)

    Kalokhe, Ameeta S.; Potdar, Ratnaprabha R.; Stephenson, Rob; Dunkle, Kristin L.; Paranjape, Anuradha; del Rio, Carlos; Sahay, Seema

    2015-01-01

    Domestic violence (DV) is reported by 40% of married women in India and associated with substantial morbidity. An operational research definition is therefore needed to enhance understanding of DV epidemiology in India and inform DV interventions and measures. To arrive at a culturally-tailored definition, we aimed to better understand how definitions provided by the World Health Organization and the 2005 India Protection of Women from Domestic Violence Act match the perceptions of behaviors constituting DV among the Indian community. Between September 2012 and January 2013, 16 key informant interviews with experts in DV and family counseling and 2 gender-concordant focus groups of lay community members were conducted in Pune, India to understand community perceptions of the definition of DV, perpetrators of DV, and examples of DV encountered by married women in Pune, India. Several key themes emerged regarding behaviors and acts constituting DV including 1) the exertion of control over a woman’s reproductive decision-making, mobility, socializing with family and friends, finances, and access to food and nutrition, 2) the widespread acceptance of sexual abuse and the influences of affluence on sexual DV manifestations, 3) the shaping of physical abuse experiences by readily-available tools and the presence of witnesses, 4) psychological abuse for infertility, dowry, and girl-children, and 5) the perpetration of DV by the husband and other members of his family. Findings support the need for a culturally-tailored operational definition that expands on the WHO surveillance definition to inform the development of more effective DV intervention strategies and measures. PMID:25811374

  9. How well does the World Health Organization definition of domestic violence work for India?

    Directory of Open Access Journals (Sweden)

    Ameeta S Kalokhe

    Full Text Available Domestic violence (DV is reported by 40% of married women in India and associated with substantial morbidity. An operational research definition is therefore needed to enhance understanding of DV epidemiology in India and inform DV interventions and measures. To arrive at a culturally-tailored definition, we aimed to better understand how definitions provided by the World Health Organization and the 2005 India Protection of Women from Domestic Violence Act match the perceptions of behaviors constituting DV among the Indian community. Between September 2012 and January 2013, 16 key informant interviews with experts in DV and family counseling and 2 gender-concordant focus groups of lay community members were conducted in Pune, India to understand community perceptions of the definition of DV, perpetrators of DV, and examples of DV encountered by married women in Pune, India. Several key themes emerged regarding behaviors and acts constituting DV including 1 the exertion of control over a woman's reproductive decision-making, mobility, socializing with family and friends, finances, and access to food and nutrition, 2 the widespread acceptance of sexual abuse and the influences of affluence on sexual DV manifestations, 3 the shaping of physical abuse experiences by readily-available tools and the presence of witnesses, 4 psychological abuse for infertility, dowry, and girl-children, and 5 the perpetration of DV by the husband and other members of his family. Findings support the need for a culturally-tailored operational definition that expands on the WHO surveillance definition to inform the development of more effective DV intervention strategies and measures.

  10. How well does the World Health Organization definition of domestic violence work for India?

    Science.gov (United States)

    Kalokhe, Ameeta S; Potdar, Ratnaprabha R; Stephenson, Rob; Dunkle, Kristin L; Paranjape, Anuradha; Del Rio, Carlos; Sahay, Seema

    2015-01-01

    Domestic violence (DV) is reported by 40% of married women in India and associated with substantial morbidity. An operational research definition is therefore needed to enhance understanding of DV epidemiology in India and inform DV interventions and measures. To arrive at a culturally-tailored definition, we aimed to better understand how definitions provided by the World Health Organization and the 2005 India Protection of Women from Domestic Violence Act match the perceptions of behaviors constituting DV among the Indian community. Between September 2012 and January 2013, 16 key informant interviews with experts in DV and family counseling and 2 gender-concordant focus groups of lay community members were conducted in Pune, India to understand community perceptions of the definition of DV, perpetrators of DV, and examples of DV encountered by married women in Pune, India. Several key themes emerged regarding behaviors and acts constituting DV including 1) the exertion of control over a woman's reproductive decision-making, mobility, socializing with family and friends, finances, and access to food and nutrition, 2) the widespread acceptance of sexual abuse and the influences of affluence on sexual DV manifestations, 3) the shaping of physical abuse experiences by readily-available tools and the presence of witnesses, 4) psychological abuse for infertility, dowry, and girl-children, and 5) the perpetration of DV by the husband and other members of his family. Findings support the need for a culturally-tailored operational definition that expands on the WHO surveillance definition to inform the development of more effective DV intervention strategies and measures.

  11. The changes in Doppler indices of fetal ductus venosus and umbilical artery after amnioinfusion for women with preterm premature rupture of membranes before 26 weeks' gestation.

    Science.gov (United States)

    Hsu, Te-Yao; Hsu, Jenn-Jeih; Fu, Hung-Chun; Ou, Chia-Yu; Tsai, Chih-Chang; Cheng, Bi-Hua; Fang, Fu-Min; Kao, Hui-Fen; Yang, Chun-Yuh; Tsai, Wen Lin; Sung, Chuen Chu; Tsai, Men-Yi

    2009-09-01

    To investigate the changes in Doppler indices of the fetal ductus venosus (DV) and umbilical artery (UMA) after amnioinfusion in pregnant women with preterm premature rupture of membranes (pPROM). Pregnancies with pPROM and severe oligohydramnios cause sequelae in newborns and mothers. This cross-sectional study included a group of 25 patients with pPROM before 26 weeks' gestation. Color Doppler imaging was used to measure the impedance index and quantitative blood flow in the DV and systolic/diastolic ratio (S/D) of the UMA before and 30 minutes after the end of amnioinfusion. The following velocity parameters were measured: (1) DV peak systolic velocity; (2) DV time-averaged velocity; (3) DV maximum forward velocity during atrial contraction; (4) DV S/D; (5) DV pulsatility index (PI); (6) DV Pourcelots resistance index (RI); (7) fetal heart rate; and (8) UMA S/D. Twenty-one of the 25 patients underwent a total of 27 amnioinfusions. The mean PI and RI of the DV, and S/D of the DV and UMA decreased significantly after amnioinfusion (PI, 0.75 +/- 0.24 vs. 0.60 +/- 0.18, p = 0.009; RI, 0.60 +/- 0.15 vs. 0.50 +/- 0.13; DV S/D, 3.07 +/- 1.81 vs. 2.13 +/- 0.66, p = 0.008; UMA S/D, 3.58 +/- 0.87 vs. 2.88 +/- 0.62, p = 0.001). Amnioinfusion increases the space for the fetuses and reduces the impedance of the fetoplacental circulation. Improvements in DV and UMA flow may benefit fetuses suffering severe oligohydramnios in mid-pregnancy.

  12. Association between domestic violence and HIV serostatus among married and formerly married women in Kenya.

    Science.gov (United States)

    Onsomu, Elijah O; Abuya, Benta A; Okech, Irene N; Rosen, David L; Duren-Winfield, Vanessa; Simmons, Amber C

    2015-01-01

    The prevalence of both domestic violence (DV) and HIV among Kenyan women is known to be high, but the relationship between them is unknown. Nationally representative cross-sectional data from married and formerly married (MFM) women responding to the Kenya Demographic and Health Survey 2008/2009 were analyzed adjusting for complex survey design. Multivariable logistic regressions were used to assess the covariate-adjusted associations between HIV serostatus and any reported DV as well as four constituent DV measures: physical, emotional, sexual, and aggravated bodily harm, adjusting for covariates entered into each model using a forward stepwise selection process. Covariates of a priori interest included those representing marriage history, risky sexual behavior, substance use, perceived HIV risk, and sociodemographic characteristics. The prevalence of HIV among MFM women was 10.7% (any DV: 13.1%, no DV: 8.6%); overall prevalence of DV was 43.4%. Among all DV measures, only physical DV was associated with HIV (11.9%; adjusted odds ratio: 2.01, p <.05). Efforts by the government and women's groups to monitor and improve policies to reduce DV, such as the Sexual Offences Act of 2006, are urgently needed to curb HIV, as are policies that seek to provide DV counseling and treatment to MFM women.

  13. Domestic violence in pregnant adolescents: Characterization of the partners and prevalence of the different forms of expression

    Directory of Open Access Journals (Sweden)

    Monterrosa-Castro, Álvaro

    2017-01-01

    Full Text Available Introduction: Pregnancy in adolescents and domestic violence (DV are worldwide problems. Their prevalence is influenced by cultural factors. Objectives: To characterize pregnant adolescents and their sexual partners, and to determine the prevalence of psychological, physical and sexual DV. Methodology: Cross-sectional study of 406 Colombian pregnant teenagers. Socio-demographic data were collected, and the scales “Are you being abused?” and “Abuse Assessment Screen” were applied. The former identifies domestic violence by the partner, and the latter, DV at any moment, the last year or during pregnancy. Results: Age: 16.5 ± 1.5 years, 92.9 % were in late adolescence, average years of schooling: nine; 50 % dropped out from school when they became pregnant; 70 % depended on their parents, both before and after pregnancy. DV by the partner: 7.1 %; physical DV: 6.7 %; psychological DV: 3.7 %; sexual DV: 2.2 %. DV by partner/husband/other person: 12.4 %; physical or emotional abuse by partner/another person: 21.7 %; fear from the partner: 3.4 %. There was significant association between alcohol consumption by the partner every weekend and DV. Conclusion: Frequency of DV against pregnant adolescents is high and alcohol consumption by the partner is an important risk factor for it.

  14. Association of Domestic Violence Against Women With Sociodemographic Factors, Clinical Features, and Dissociative Symptoms in Patients Who Receive Services From Psychiatric Outpatient Units in Turkey.

    Science.gov (United States)

    Kotan, Zeynep; Kotan, Vahap Ozan; Yalvaç, Hayriye Dilek; Demir, Sibel

    2017-04-01

    Domestic violence (DV) against women is a serious problem with its negative effects on all family members and the society. Women exposed to DV not only have physical but also psychological damage. This study investigates prevalence of DV and its relations with some descriptive and clinical features in a psychiatric outpatient population in Turkey. A total of 277 female outpatients were included in the study. After a semistructured clinical interview, they were assessed by sociodemographic data form, DV questionnaire, Hamilton Depression Rating Scale (HDRS), Hamilton Anxiety Rating Scale (HARS), Dissociative Experiences Scale (DES), and Somatoform Dissociation Questionnaire (SDQ). Prevalence of exposure to DV by intimate partner is found to be 58.8% ( n = 163). The current study provided strong evidence that occupation status of the woman, education level of the partner, and family type are predictors of DV. Another predictor of DV exists where the child is battered by either parent. Prevalence of depression, conversion disorder, and other somatoform disorders are higher in women exposed to DV. These women also have higher scores from HDRS, HARS, DES, and SDQ compared with female patients who have not experienced DV ( p < .001). Number of women scoring above cutoff levels for DES and SDQ were significantly higher in women exposed to DV ( p < .001).

  15. An examination of the factors related to dating violence perpetration among young men and women and associated theoretical explanations: a review of the literature.

    Science.gov (United States)

    Dardis, Christina M; Dixon, Kristiana J; Edwards, Katie M; Turchik, Jessica A

    2015-04-01

    This article provides a review of the literature on dating violence (DV) perpetration, specifically sex similarities and differences in the correlates and predictors of DV perpetration and the utility of current theories to explain young men's and women's DV perpetration. Overall, many of the correlates and predictors of DV perpetration are similar among young men and women (e.g., witnessing interparental violence, experiencing child abuse, alcohol abuse, traditional gender roles, relationship power dynamics). However, young women's perpetration of DV is more strongly related to internalizing symptoms (e.g., depression), trait anger and hostility, and experiencing DV victimization than young men's perpetration, whereas young men's perpetration of DV is more consistently related to lower socioeconomic status and educational attainment, antisocial personality characteristics, and increased relationship length than young women's perpetration. Each theory offers insights into but does not fully account for the correlates and predictors of DV perpetration. Sociocultural theories may be useful in explaining the use of coercive control in relationships, and learning/intergenerational transmission of violence theories may be useful in explaining bidirectional couple violence. Future research should focus on integrative theories, such as in the social-ecological theory, in order to explain various forms of DV. Our understanding of young men's and young women's DV perpetration is limited by cross-sectional research designs, methodological inconsistencies, a lack of sex-specific analytic approaches, and a lack of focus on contextual factors; more multivariate and longitudinal studies are needed. Further, as DV prevention programming is often presented in mixed-sex formats, a critical understanding of sex differences and similarities in DV perpetration could ultimately refine and improve effectiveness of programming efforts aimed at reducing DV. © The Author(s) 2014.

  16. Attentional bias towards emotional facial expressions in survivors of dating violence.

    Science.gov (United States)

    Lee, Jeong-Ha; Lee, Jang-Han

    2014-01-01

    This study identified components of attentional bias (e.g. attentional vigilance, attentional avoidance and difficulty with disengagement) that are critical characteristics of survivors of dating violence (DV). Eye movements were recorded to obtain accurate and continuous information regarding attention. DV survivors with high post-traumatic stress symptoms (DV-High PTSS group; n = 20) and low post-traumatic stress symptoms (DV-Low PTSS group; n = 22) and participants who had never experienced DV (NDV group; n = 21) were shown screens displaying emotional (angry, fearful and happy) faces paired with neutral faces and negative (angry and fearful) faces paired with happy faces for 10 s. The results indicate that the DV-High PTSS group spent longer dwelling on angry faces over time compared with the DV-Low PTSS and NDV groups. This result implies that the DV-High PTSS group focused on specific trauma-related stimuli but does not provide evidence of an attentional bias towards threatening stimuli in general.

  17. Investigation of organic light-emitting diodes with novel organic electron injection layers

    Energy Technology Data Exchange (ETDEWEB)

    Lee, Sunae; Sethuraman, Kunjithapatham; An, Jongdeok; Im, Chan [Konkuk University, Seoul (Korea, Republic of); Hwang, Boseon [Jinwoong Industrial Co. Ltd., Seoul (Korea, Republic of)

    2012-03-15

    1-(diphenyl-phosphinoyl)-4-(2,2-diphenyl-vinyl)-benzene (DpDvB) and 4-(diphenyl-phosphinoyl)-4'-(2,2-diphenyl-vinyl)-biphenyl (DpDvBp) have been prepared and used as efficient electron injection layers (EILs) between aluminum cathode and tris (8-hydroxyquinoline) aluminum organic light emitting diodes (OLED). The performances of devices with different thicknesses of DpDvB and DpDvBp were investigated. Experimental results show that the turn-on voltage of the devices was decreased and the luminance of the devices was enhanced with increasing thickness of the EILs. Power efficiencies of 1.07 lm/W and 0.97 lm/W were obtained by inserting a 3-nm-thick EIL of DpDvB and a 5 nm thick EIL of DpDvBp, respectively. These efficiencies are comparable to that of the device using LiF as an EIL. The results prove that DpDvB and DpDvBp layers are also suitable for efficient EILs in OLEDs.

  18. Prevalence and associated factors of domestic violence among pregnant women attending routine antenatal care in Nepal.

    Science.gov (United States)

    Rishal, Poonam; Pun, Kunta Devi; Darj, Elisabeth; Joshi, Sunil Kumar; Bjørngaard, Johan Håkon; Swahnberg, Katarina; Schei, Berit; Lukasse, Mirjam

    2017-08-01

    The primary aim of this study was to assess the prevalence of domestic violence (DV) and its associated factors among pregnant women in Nepal. The secondary aims were to investigate disclosure of DV by women to health-care personnel and to assess whether health-care personnel had asked women about their experience of DV. This cross-sectional study included 2004 pregnant women between 12 and 28 weeks of gestation attending routine antenatal care at two hospitals in Nepal from August 2014 to November 2015. In this study, DV was defined as fear of a family member and/or an experience of physical, emotional or sexual violence. Associated risk factors were analysed using logistic regression analyses. Twenty-one per cent of the women had experienced DV; 12.5% experienced fear only, 3.6% violence only and 4.9% experienced both violence and fear. Less than 2% per cent reported physical violence during pregnancy. This study found that just 17.7% had ever been asked by health-care personnel about DV, and of the women who had reported DV, only 9.5% had disclosed their experience to health-care personnel. Women of young age and low socio-economic status were more likely to have experienced DV. Women who reported having their own income and the autonomy to use it were at significantly lower risk of DV compared to women with no income. A substantial proportion of women reported having experienced DV. Victims had rarely disclosed their experience of DV to health-care personnel. This study underlines the importance of integrating systematic assessment of DV in antenatal care.

  19. The increase in domestic violence in Brazil from 2009-2014.

    Science.gov (United States)

    Rodrigues, Nádia Cristina Pinheiro; O'Dwyer, Gisele; Andrade, Mônica Kramer de Noronha; Flynn, Matthew Brian; Monteiro, Denise Leite Maia; Lino, Valéria Teresa Saraiva

    2017-09-01

    In recent decades, the rise violent phenomena in Brazil has reached epidemic proportions. However, the prevalence of domestic violence (DV) across different states in the country is not well established. The objective of this study was to describe the distribution of DV across Brazilian states from 2009 to 2014. An ecological study based on spatial analysis techniques was performed using Brazilian states as geographical units of analysis. A multilevel Poisson model was used to explain the risk of DV in Brazil according to age, sex, period (fixed effects), the Human Developing Index, and the victim's residence state (random effects). The overall average rate of DV almost tripled from 2009-2010 to 2013-2014. The rate of DV in Brazil in the 2013-2014 period was 3.52 times greater than the 2009-2010 period. The risk of DV in men was 74% lower than in women. The increase of DV against women during period under study occurred mainly in the Southeast, South, and Midwest. DV was more frequent in adolescence and adulthood. DV is gradually increasing in recent years in Brazil. More legislation and government programs are needed to combat the growth of violence in society.

  20. Dicty_cDB: Contig-U16376-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available egypti infected with Dengue viru... 50 2e-09 2 ( DV283960 ) NAAG514TR Aedes aegypti - Fat Bodies Normalized ...(... 50 2e-09 2 ( DV283959 ) NAAG514TF Aedes aegypti - Fat Bodies Normalized (...... 2e-09 2 ( DV288110 ) NAAHX47TR Aedes aegypti - Fat Bodies Normalized (... 50 2e-...7TF Aedes aegypti - Fat Bodies Normalized (... 50 2e-09 2 ( DV408036 ) NADX707TF Aedes aegypti infected with... 50 2e-09 2 ( DV247339 ) A2FMT46TV Aedes aegypti full length cDNA library,... 50 2e-09 2 ( DV288109 ) NAAHX4

  1. Dicty_cDB: SHI783 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 34, mRNA sequence. 42 5.0 1 DV288069 |DV288069.1 NAAHW80TF Aedes aegypti - Fat Bodie...583TR Aedes aegypti - Fat Bodies Normalized (NAFFB2) Aedes aegypti cDNA clone NAAG583, mRNA sequence. 42 5.0... 1 DV284076 |DV284076.1 NAAG583TF Aedes aegypti - Fat Bodies Normalized (NAFFB2) ...Aedes aegypti cDNA clone NAAG583, mRNA sequence. 42 5.0 1 DV276964 |DV276964.1 NAAFQ66TR Aedes aegypti - Fat Bodie...AAFQ66TF Aedes aegypti - Fat Bodies Normalized (NAFFB2) Aedes aegypti cDNA clone NAAFQ66, mRNA sequence. 42

  2. Dicty_cDB: Contig-U10208-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 0.97 2 ( DV285001 ) NAAIC55TF Aedes aegypti - Fat Bodies Normalized (... 32 1.0 3 ( CR318626 ) Zebrafish DNA...F T37 testes subtractive Aedes aegypti... 32 1.3 3 ( DV286020 ) NAAI485TF Aedes aegypti - Fat Bodie...ti cDNA ... 32 1.4 3 ( DV276168 ) NAAHD62TF Aedes aegypti - Fat Bodies Normalized... (... 32 1.4 3 ( DV290027 ) NAAHO86TF Aedes aegypti - Fat Bodies Normalized (... 32 1.4 3 ( DV434601 ) NADCW...8 ) NADA239TF Aedes aegypti infected with Dengue viru... 32 1.6 3 ( DV283216 ) NAAGJ68TF Aedes aegypti - Fat Bodie

  3. Fixing broken bones and broken homes: domestic violence as a patient safety issue.

    Science.gov (United States)

    Cohn, Felicia; Rudman, William J

    2004-11-01

    Domestic violence (DV) is a significant problem in terms of both patient harm and cost. To better address this problem, the diagnosis and treatment of DV are considered within the emerging model of patient safety and medical error reduction. The case of a female patient who presents in the clinical setting following an incident of DV shows how medical errors can be analyzed as they are in medical cases not involving DV, such as when a person with abdominal pain is sent away from the emergency department with instructions to take an acid reducer and later suffers a burst appendix. A number of factors inhibit the correct diagnosis and treatment of DV victims seeking additional treatment. Physicians often fail to screen for DV, misidentify symptoms, or deny the possibility of underlying DV, and patients often hide the symptoms and refuse to admit the problem. However, human factor errors related to knowledge, cultural norms, and individual biases; organizational factors, including lack of training and reimbursement; and technology factors related to information accessibility appear to play significant roles. Failure to diagnose or adequately address DV can be interpreted as medical errors. Addressing DV requires a systemic response, which might begin with integrating education and training about DV into the clinical setting, ensuring the use of existing screening tools, and providing adequate and appropriate reimbursement levels.

  4. Dual function of the nuclear export signal of the Borna disease virus nucleoprotein in nuclear export activity and binding to viral phosphoprotein.

    Science.gov (United States)

    Yanai, Mako; Sakai, Madoka; Makino, Akiko; Tomonaga, Keizo

    2017-07-11

    Borna disease virus (BoDV), which has a negative-sense, single-stranded RNA genome, causes persistent infection in the cell nucleus. The nuclear export signal (NES) of the viral nucleoprotein (N) consisting of leucine at positions 128 and 131 and isoleucine at positions 133 and 136 overlaps with one of two predicted binding sites for the viral phosphoprotein (P). A previous study demonstrated that higher expression of BoDV-P inhibits nuclear export of N; however, the function of N NES in the interaction with P remains unclear. We examined the subcellular localization, viral polymerase activity, and P-binding ability of BoDV-N NES mutants. We also characterized a recombinant BoDV (rBoDV) harboring an NES mutation of N. BoDV-N with four alanine-substitutions in the leucine and isoleucine residues of the NES impaired its cytoplasmic localization and abolished polymerase activity and P-binding ability. Although an alanine-substitution at position 131 markedly enhanced viral polymerase activity as determined by a minigenome assay, rBoDV harboring this mutation showed expression of viral RNAs and proteins relative to that of wild-type rBoDV. Our results demonstrate that BoDV-N NES has a dual function in BoDV replication, i.e., nuclear export of N and an interaction with P, affecting viral polymerase activity in the nucleus.

  5. Domestic violence against women in India: A systematic review of a decade of quantitative studies.

    Science.gov (United States)

    Kalokhe, Ameeta; Del Rio, Carlos; Dunkle, Kristin; Stephenson, Rob; Metheny, Nicholas; Paranjape, Anuradha; Sahay, Seema

    2017-04-01

    Domestic violence (DV) is prevalent among women in India and has been associated with poor mental and physical health. We performed a systematic review of 137 quantitative studies published in the prior decade that directly evaluated the DV experiences of Indian women to summarise the breadth of recent work and identify gaps in the literature. Among studies surveying at least two forms of abuse, a median 41% of women reported experiencing DV during their lifetime and 30% in the past year. We noted substantial inter-study variance in DV prevalence estimates, attributable in part to different study populations and settings, but also to a lack of standardisation, validation, and cultural adaptation of DV survey instruments. There was paucity of studies evaluating the DV experiences of women over age 50, residing in live-in relationships, same-sex relationships, tribal villages, and of women from the northern regions of India. Additionally, our review highlighted a gap in research evaluating the impact of DV on physical health. We conclude with a research agenda calling for additional qualitative and longitudinal quantitative studies to explore the DV correlates proposed by this quantitative literature to inform the development of a culturally tailored DV scale and prevention strategies.

  6. The relationship between temperament, gender, and childhood dysfunctional voiding.

    Science.gov (United States)

    Colaco, Marc; Dobkin, Roseanne D; Sterling, Matthew; Schneider, Dona; Barone, Joseph

    2013-08-01

    Dysfunctional voiding (DV) is an extremely common pediatric complaint. The goal of this study was to examine the relationship between DV and childhood temperament. Information about the voiding behaviors and temperaments of 50 children was examined using a case-control model. Caregivers were asked to fill out the Children's Behavior Questionnaire in order to rate their child on the dimensions of surgency, negative affect, and effortful control. The relationship between DV and these dimensions was then evaluated. Males with DV were found to have lower effortful control than males with normal voiding habits. Females with DV did not demonstrate a difference in effortful control, but did demonstrate a higher rate of surgency. The results suggest that temperament does have an association with DV. These findings are in line with temperamental associations with other externalizing trouble behaviors and may inform potential treatment strategies for DV.

  7. Using Social Media to Explore the Consequences of Domestic Violence on Mental Health.

    Science.gov (United States)

    Liu, Mingming; Xue, Jia; Zhao, Nan; Wang, Xuefei; Jiao, Dongdong; Zhu, Tingshao

    2018-02-01

    A great deal of research has focused on the negative consequences of domestic violence (DV) on mental health. However, current studies cannot provide direct and reliable evidence on the impacts of DV on mental health in a short term as it is not feasible to measure mental health shortly before and after an unpredictable event like DV. This study aims to explore the short-term outcomes of DV on individuals' mental health. We collected a sample of 232 victims (77% female) and 232 nonvictims (gender and location matched with 232 victims) on Sina Weibo. In both the victim and nonvictim groups, we measured their mental health status during the 4 weeks before the first DV incident and during the 4 weeks after the DV incident. We used our proposed Online Ecological Recognition (OER) system, which is based on several predictive models to identify individuals' mental health statuses. Mental health statuses were measured based on individuals' Weibo profiles and messages, which included "Depression," "Suicide Probability," and "Satisfaction With Life." The results showed that mental health in the victim group was impacted by DV while individuals in the nonvictim group were not. Furthermore, the victim group demonstrated an increase in depression symptoms, higher suicide risks, and decreased life satisfaction after their DV experience. In addition, the effect of DV on individuals' mental health could appear in the conditions of child abuse, intimate partner violence, and exposure to DV. These findings inform that DV significantly impacts individuals' mental health over the short term, as in 4 weeks. Our proposed new data collection and analyses approach, OER, has implications for employing "big data" from social networks to identify individuals' mental health.

  8. Dicty_cDB: Contig-U16342-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available .. 44 3.7 1 ( DV275889 ) NAAHC82TF Aedes aegypti - Fat Bodies Normalized (... 44 3.7 1 ( DV275869 ) NAAHC82TR Aedes aegypti - Fat Bod...ies Normalized (... 44 3.7 1 ( DV274316 ) NAAH317TR Aedes aegypti - Fat Bodie...s Normalized (... 44 3.7 1 ( DV274315 ) NAAH317TF Aedes aegypti - Fat Bodies Normalized

  9. Incidence and Outcomes of Dating Violence Victimization Among High School Youth: The Role of Gender and Sexual Orientation.

    Science.gov (United States)

    Edwards, Katie M

    2018-05-01

    The purpose of this study was to examine rates of dating violence (DV) victimization and DV victimization outcomes as a function of sex and sexual orientation. Participants were 25,122 high school students who participated in the 2013 New Hampshire Youth Risk Behavior Survey study. Heterosexual youth, especially heterosexual male youth, were less likely to report experiencing physical and sexual DV victimization than lesbian, gay, bisexual, and questioning (LGBQ) girls and boys. Among LGBQ girls and boys, there was little variability in rates of DV victimization with the exception of questioning boys being significantly more likely to experience physical and sexual DV victimization than several other LGBQ sub-groups. Furthermore, LGBQ DV victims reported worse outcomes than heterosexual DV victims on measures of depression, binge drinking, and poor academic performance. At the sub-group level, bisexual and questioning female victims were most at risk for depression; bisexual and questioning male victims were most at risk for binge drinking; bisexual male victims were most at risk for poor academic performance. The findings underscore the importance of better understanding variability in DV incidence and outcomes within the LGBQ population and using this information to inform clinical intervention and prevention efforts.

  10. Ectoparasitic hematophagous dipters: potential reservoirs of dengue virus?

    Science.gov (United States)

    Setién, Álvaro Aguilar; Baltazar, Anahí García; Leyva, Ignacio Olave; Rojas, Mónica Salas; Koldenkova, Vadim Pérez; García, Mariem Pérez-Peña; Ceballos, Nidia Aréchiga; Romero, Guillermo Gálvez; Villegas, Edgar Olivier López; Malacara, Juan Bibiano Morales; Marín, Cenia Almazán

    2017-01-01

    Recently, the presence of antibodies and dengue virus (DV) RNA in neotropical wild mammals, including Desmodus rotundus, was reported. In a previous study, DV was also found in a high percentage (39.6%) of ectoparasitic hematophagous dipters specifics of these hematophagous bats. In order to verify the susceptibility of these ectoparasites to DV, in this work experimental infections with VD2 of organs explants of Strebla wiedemanni and of Melophagus ovinus were performed using C6/36 cells as control. Viral titers (UFP/mL) were determined at 0, 48 and 96 hrs pi. Infected organs were observed by electron microscopy and under the confocal microscopy indirect immunofluorescence (IIF) using specific conjugates against DV. The infected organs of both species of ectoparasites replicated DV at titers similar to those obtained with the C6/36 cell line (≥10 6 UFP/mL). Electron microscopy and IIF showed DV replication in the digestive tract, tracheoles, reproductive organs of males but not in females, and milk glands (MG) of both species. In the fatty bodies of the MG of M. ovinus, zones with a high affinity for the DV were observed. In this work the susceptibility of S. wiedemanni and M. ovinus to DV was demonstrated and consequently the probable role of this ectoparasites as wild reservoirs of DV. Copyright: © 2017 SecretarÍa de Salud.

  11. In-Situ Sampling and Characterization of Naturally Occurring Marine Methane Hydrate Using the D/V JOIDES Resolution

    Energy Technology Data Exchange (ETDEWEB)

    Frank R. Rack

    2006-09-20

    Cooperative Agreement DE-FC26-01NT41329 between Joint Oceanographic Institutions and DOE-NETL was divided into two phases based on successive proposals and negotiated statements of work pertaining to activities to sample and characterize methane hydrates on ODP Leg 204 (Phase 1) and on IODP Expedition 311 (Phase 2). The Phase 1 Final Report was submitted to DOE-NETL in April 2004. This report is the Phase 2 Final Report to DOE-NETL. The primary objectives of Phase 2 were to sample and characterize methane hydrates using the systems and capabilities of the D/V JOIDES Resolution during IODP Expedition 311, to enable scientists the opportunity to establish the mass and distribution of naturally occurring gas and gas hydrate at all relevant spatial and temporal scales, and to contribute to the DOE methane hydrate research and development effort. The goal of the work was to provide expanded measurement capabilities on the JOIDES Resolution for a dedicated hydrate cruise to the Cascadia continental margin off Vancouver Island, British Columbia, Canada (IODP Expedition 311) so that hydrate deposits in this region would be well characterized and technology development continued for hydrate research. IODP Expedition 311 shipboard activities on the JOIDES Resolution began on August 28 and were concluded on October 28, 2005. The statement of work for this project included three primary tasks: (1) research management oversight, provided by JOI; (2) mobilization, deployment and demobilization of pressure coring and core logging systems, through a subcontract with Geotek Ltd.; and, (3) mobilization, deployment and demobilization of a refrigerated container van that will be used for degassing of the Pressure Core Sampler and density logging of these pressure cores, through a subcontract with the Texas A&M Research Foundation (TAMRF). Additional small tasks that arose during the course of the research were included under these three primary tasks in consultation with the DOE

  12. Perlecan Domain V Induces VEGf Secretion in Brain Endothelial Cells through Integrin α5β1 and ERK-Dependent Signaling Pathways

    Science.gov (United States)

    Clarke, Douglas N.; Al Ahmad, Abraham; Lee, Boyeon; Parham, Christi; Auckland, Lisa; Fertala, Andrezj; Kahle, Michael; Shaw, Courtney S.; Roberts, Jill; Bix, Gregory J.

    2012-01-01

    Perlecan Domain V (DV) promotes brain angiogenesis by inducing VEGF release from brain endothelial cells (BECs) following stroke. In this study, we define the specific mechanism of DV interaction with the α5β1 integrin, identify the downstream signal transduction pathway, and further investigate the functional significance of resultant VEGF release. Interestingly, we found that the LG3 portion of DV, which has been suggested to possess most of DV’s angio-modulatory activity outside of the brain, binds poorly to α5β1 and induces less BEC proliferation compared to full length DV. Additionally, we implicate DV’s DGR sequence as an important element for the interaction of DV with α5β1. Furthermore, we investigated the importance of AKT and ERK signaling in DV-induced VEGF expression and secretion. We show that DV increases the phosphorylation of ERK, which leads to subsequent activation and stabilization of eIF4E and HIF-1α. Inhibition of ERK activity by U0126 suppressed DV-induced expression and secretion of VEGR in BECs. While DV was capable of phosphorylating AKT we show that AKT phosphorylation does not play a role in DV’s induction of VEGF expression or secretion using two separate inhibitors, LY294002 and Akt IV. Lastly, we demonstrate that VEGF activity is critical for DV increases in BEC proliferation, as well as angiogenesis in a BEC-neuronal co-culture system. Collectively, our findings expand our understanding of DV’s mechanism of action on BECs, and further support its potential as a novel stroke therapy. PMID:23028886

  13. A method to identify early ventricular dysfunction using resting gated blood pool scans (GBPS) in patients with coronary artery disease (CAD)

    International Nuclear Information System (INIS)

    Schwarzberg, R.J.; Seldin, D.W.; Johnson, L.L.; Alderson, P.O.

    1984-01-01

    To determine the sensitivity of regional 1st and 2nd time derivative (1DV, 2DV) images to assess ventricular function (VF) in CAD, the resting GBPS of 8 normal patients (pts) and 20 pts with CAD who had coronary angiography and contrast ventriculography (CV) were analyzed. The 1DV and 2DV of the systolic time-activity curve were determined for each left ventricular pixel in the GBPS. These values were displayed as functional images that were reviewed by three readers to determine the presence of regional abnormalities. No regional abnormalities were seen in the conventional GBPS or 1DV or 2DV images of the 8 normal pts. Regional GBPS and DV image abnormalities were seen in all 10 pts with CAD and abnormal wall motion by CV. The DV image abnormalities were in the distribution of 18/22 coronary arteries (CA) with ≥50% stenoses; 2 of these regions showed normal wall motion by CV and conventional GBPS. DV images were abnormal in 2/8 CAs without significant stenoses. In addition, regional DV image abnormalities were present in 9 of 10 pts with CAD who had normal wall motion and global ejection fraction by both CV and resting GBPS. These 10 pts showed regional abnormalities in the distribution of 13/15 CAs with significant stenoses and 2/15 CAs without such stenoses. The results suggest that time derivative functional images derived from resting GBPS provide a more sensitive means for detecting regional left ventricular dysfunction than several other current methods, especially in pts with mild CAD

  14. Knowledge of Primary Care Physicians Regarding Domestic Violence.

    African Journals Online (AJOL)

    Knowledge of Primary Care Physicians Regarding Domestic Violence. ... prevalence of DV, and 4 main aspects relevant to DV, namely deprivation, psychological, ... and instructions about DV from scientific formal sources as medical schools, ...

  15. Physical domestic violence exposure is highly associated with suicidal attempts in both women and men. Results from the national public health survey in Sweden.

    Science.gov (United States)

    Dufort, Mariana; Stenbacka, Marlene; Gumpert, Clara Hellner

    2015-06-01

    Studies on a national level concerning domestic violence (DV) among both men and women are few. DV and its relation to other social and health outcomes within the framework of the Swedish Public Health Survey have remained unexplored. To compare women and men regarding their social situation and health status in relation to self-reported exposure to physical DV as measured in the Swedish National Public Health Survey. This study used cross-sectional data from the Swedish Public Health Survey, years 2004-09 with a total sample of 50 350 respondents, of which 205 women and 93 men reported DV exposure. Logistic regression analyses stratified by sex with physical DV exposure as the outcome measure were conducted, and the multivariate models were fitted using the likelihood ratio test. Being foreign-born [women odds ratio (OR) = 1.52, men OR = 1.92] and lack of social support (women OR = 2.81, men OR = 1.92) were associated with DV exposure among both sexes. Higher psychological distress (women OR = 2.81, men OR = 1.92) and hazardous drinking (women OR = 1.61, men OR = 2.33) were also associated with DV exposure. Among women, financial problems were associated with DV exposure (OR = 1.83), whereas among men, sum of medicines used and higher odds of DV were associated (OR = 1.17). Further, suicidal attempts were associated with DV exposure among both women (OR = 5.59) and men (OR = 8.34). In this national survey, prevalence rates of violence exposure were lower than in other studies, but despite this, both women and men exposed to physical DV reported increased odds of having attempted suicide. © The Author 2014. Published by Oxford University Press on behalf of the European Public Health Association.

  16. Granitoids of the Dry Valleys area, southern Victoria Land : geochemistry and evolution along the early Paleozoic Antarctic Craton margin

    International Nuclear Information System (INIS)

    Allibone, A.H.; Cox, S.C.; Smillie, R.W.

    1993-01-01

    Field relationships and geochemistry indicate granitoid plutons of the Dry Valleys area comprise at least three petrogenetically distinct suites. The older Dry Valleys 1a (DV1a) suite, comprising the Bonney, Catspaw, Denton, Cavendish, and Wheeler Plutons and hornblende-biotite orthogneisses, and Dry Valleys 1b (DV1b) suite, comprising the Hedley, Valhalla, St Johns, Dun, Calkin, and Suess Plutons, biotite granitoid dikes and biotite orthogneisses, were emplaced before prominent swarms of Vanda mafic and felsic dikes. Both the DV1a and DV1b suites are time transgressive, with older intrusions in each suite being emplaced during the later stages of deformation of the Koettlitz Group. Younger granitoids that postdate the majority of the Vanda dikes include: the Dry Valleys 2 (DV2) suite, comprising the Pearse and Nibelungen Plutons plus several smaller, unnamed plugs; and the Harker, Swinford, Orestes, and Brownworth Plutons with identical field relationships and enclaves but distinct chemistries. Chemical characteristics and limited Rb-Sr isotopic dating indicate plutonism before c. 500 Ma was dominated by the Cordilleran I-type DV1a suite, inferred to have developed during melting above a west-dipping subduction zone along the Antarctic Craton margin. The chemical characteristics of the DV1b suite indicate large-scale melting of a quartzo-feldspathic protolith lacking residual plagioclase, but containing refractory garnet. Potential DV1b suite source rocks include metamorphosed immature sediments, possibly underplated along the subduction zone associated with DV1a magmatism, or older granitoid orthogneisses. Major DV1b plutonism at 490 Ma marks the end of subduction-related plutonism in southern Victoria Land. Younger DV2 alkali-calcic, Caledonian I-type plutonism is inferred to have formed in response to uplift and extension between 480 and 455 Ma. Lack of DV2 suite correlatives and Vanda mafic and felsic dikes in northern Victoria Land suggests significantly

  17. An ethnographic-feminist study of Jordanian women's experiences of domestic violence and process of resolution.

    Science.gov (United States)

    Safadi, Reema; Swigart, Valerie; Hamdan-Mansour, Ayman M; Banimustafa, Radwan; Constantino, Rose E

    2013-01-01

    We interviewed 12 Jordanian women who had experienced domestic violence (DV) and were receiving assistance at the Jordanian Women's Union (JWU). Our aim was to explore the history and factors supporting attainment of freedom from DV. Narratives revealed themes of DV toward girls; forced marriage; physical, psychological, or sexual abuse before and during marriage; and escalation and enduring DV. Escaping from DV required family and JWU support. In the context of a strongly patriarchal, religious society, we observed a process of resolution by shifting cultural values and themes of empowerment, with an undercurrent of suffering blamed on inequalities in the legal process.

  18. Quantifying K, U and Th contents of marine sediments using shipboard natural gamma radiation spectra measured on DV JOIDES Resolution

    Science.gov (United States)

    De Vleeschouwer, David; Dunlea, Ann G.; Auer, Gerald; Anderson, Chloe H.; Brumsack, Hans; de Loach, Aaron; Gurnis, Michael C.; Huh, Youngsook; Ishiwa, Takeshige; Jang, Kwangchul; Kominz, Michelle A.; März, Christian; Schnetger, Bernhard; Murray, Richard W.; Pälike, Heiko; Expedition 356 shipboard scientists, IODP

    2017-04-01

    During International Ocean Discovery Program (IODP) expeditions, shipboard-generated data provide the first insights into the cored sequences. The natural gamma radiation (NGR) of the recovered material, for example, is routinely measured on the ocean drilling research vessel DV JOIDES Resolution. At present, only total NGR counts are readily available as shipboard data, although full NGR spectra (counts as a function of gamma-ray energy level) are produced and archived. These spectra contain unexploited information, as one can estimate the sedimentary contents of potassium (K), thorium (Th), and uranium (U) from the characteristic gamma-ray energies of isotopes in the 40K, 232Th, and 238U radioactive decay series. Dunlea et al. [2013] quantified K, Th and U contents in sediment from the South Pacific Gyre by integrating counts over specific energy levels of the NGR spectrum. However, the algorithm used in their study is unavailable to the wider scientific community due to commercial proprietary reasons. Here, we present a new MATLAB algorithm for the quantification of NGR spectra that is transparent and accessible to future NGR users. We demonstrate the algorithm's performance by comparing its results to shore-based inductively coupled plasma-mass spectrometry (ICP-MS), inductively coupled plasma-emission spectrometry (ICP-ES), and quantitative wavelength-dispersive X-ray fluorescence (XRF) analyses. Samples for these comparisons come from eleven sites (U1341, U1343, U1366-U1369, U1414, U1428-U1430, U1463) cored in two oceans during five expeditions. In short, our algorithm rapidly produces detailed high-quality information on sediment properties during IODP expeditions at no extra cost. Dunlea, A. G., R. W. Murray, R. N. Harris, M. A. Vasiliev, H. Evans, A. J. Spivack, and S. D'Hondt (2013), Assessment and use of NGR instrumentation on the JOIDES Resolution to quantify U, Th, and K concentrations in marine sediment, Scientific Drilling, 15, 57-63.

  19. Medical students' clinical performance of dealing with patients in the context of domestic violence.

    Science.gov (United States)

    Kong, Hyun-Hee; Im, Sunju; Seo, Ji-Hyun; Kim, Do-Kyong; Roh, HyeRin

    2018-03-01

    The aim of this study was to inquire about the clinical performance and determine the performance pattern of medical students in standardized patient (SP) based examinations of domestic violence (DV). The clinical performance sores in DV station with SP of third-year (n=111, in 2014) and 4th-year (n=143, in 2016) medical students of five universities in the Busan-Gyeongnam Clinical Skills Examination Consortium were subjected in this study. The scenarios and checklists of DV cases were developed by the case development committee of the consortium. The students' performance was compared with other stations encountered in SP. The items of the checklists were categorized to determine the performance pattern of students investigating DV into six domains: disclosure strategy (D), DV related history taking (H), checking the perpetrator's psychosocial state (P), checking the victim's condition (V), negotiating and persuading the interviewee (N), and providing information about DV (I). Medical students showed poorer performance in DV stations than in the other stations with SP in the same examination. Most students did confirm the perpetrator and commented on confidentiality but ignored the perpetrator's state and patient's physical and psychological condition. The students performed well in the domains of D, H, and I but performed poorly in domains P, V, and N. Medical students showed poor clinical performance in the DV station. They performed an 'event oriented interview' rather than 'patient centered' communication. An integrated educational program of DV should be set to improve students' clinical performance.

  20. Correlates of domestic violence experience among recently-married women residing in slums in Pune, India.

    Science.gov (United States)

    Kalokhe, Ameeta S; Iyer, Sandhya R; Kolhe, Ambika R; Dhayarkar, Sampada; Paranjape, Anuradha; Del Rio, Carlos; Stephenson, Rob; Sahay, Seema

    2018-01-01

    The high risk of experiencing domestic violence (DV) among married women in India who reside in slum communities underscores the need for effective, evidence-based, and culturally-tailored primary prevention. To inform such DV primary prevention strategies for this population, we herein aimed to identify correlates of DV experience in early marriage. Utilizing a cross-sectional design, potential correlates of DV experience were explored among a geographically-clustered random sample of 100 recently-married women residing in slums in Pune, India. In multivariable regression, DV experience was associated with less educational attainment by the participant's spouse (standardized β = -0.281, p = 0.004), less satisfaction of the spouse's family with the maanpaan (wedding-related gifts provided by the bride's family) they received at the time of marriage (standardized β = -0.298, p<0.001), poorer conflict negotiation skills (standardized β = -0.308, p<0.001), and greater acknowledgement of DV occurrence in family and friends (standardized β = 0.436, p<0.001). These correlates suggest strategies that could be incorporated into future DV primary prevention interventions for this vulnerable population (i.e. promoting completion of formal education of boys alongside girls, mitigating causes of familial dowry harassment, improving conflict negotiation skills, and challenging norms surrounding DV).

  1. RGMDV: An approach to requirements gathering and the management of data virtualization projects

    Science.gov (United States)

    Mousa, Ayad Hameed; Shiratuddin, Norshuhada; Bakar, Muhamad Shahbani Abu

    2015-12-01

    Data virtualization (DV) refers to a set of data stores that enable users to query, access, and manipulate data in a unified, abstracted, and encapsulated manner regardless of data location. Apart from reducing data movement, this system provides a unified, abstracted, real-time, and encapsulated view of information for query purposes. Through its provision of live, virtual data in a timely manner, the DV technique can overcome the obstacles faced by organizations and companies as a result of using other data integration techniques. The systematic planning for the period that precedes DV deployment enables organizations to avoid many challenges related to manageability, usability, data quality, and performance. DV requirements are among the most significant and challenging aspects of a DV project. In this study, an approach has been developed to gather and manage the requirements of a DV design model as an initial step in developing such projects. Expert methods are reviewed to validate and evaluate the proposed approach in terms of usability and related components; the results of this review demonstrate that the applied approaches benefit DV development projects.

  2. Dicty_cDB: Contig-U15589-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available DV288387 ) NAAHZ89TF Aedes aegypti - Fat Bodies Normalized (... 111 7e-31 3 ( DW611127 ) CLJ261-B09.y1d-s S...251 Rhizopus oryzae Company Rhizopus oryz... 84 2e-29 3 ( DV279302 ) NAAF564TF Aedes aegypti - Fat Bodies No...2 ( DV281619 ) NAAGT04TF Aedes aegypti - Fat Bodies Normalized (... 74 2e-27 4 ( ...404141 ) 293792124 Nasonia vitripennis Female Pupae Nasoni... 105 3e-27 2 ( DV288878 ) NAAHH95TF Aedes aegypti - Fat Bodie...-25 7 ( DV279303 ) NAAF564TR Aedes aegypti - Fat Bodies Normalized (... 119 5e-25 2 ( GE353884 ) 289177336 N

  3. Decrease in domestic violence during pregnancy: a study from Turkey.

    Science.gov (United States)

    Bagcioglu, Erman; Vural, Mehmet; Karababa, Ibrahim Fatih; Aksin, Mahmut; Selek, Salih

    2014-01-01

    Our aim is to evaluate the prevalence of domestic violence (DV) among pregnant women and find out whether several factors were associated with DV or not. A total of 317 pregnant women applied at Sanliurfa Obstetrics Hospital and Harran University obstetrics and gynecology department outpatient clinic were interviewed using the modified form of Abuse Assessment Screen questionnaire. Several clinical and sociodemographic data were also obtained from the participants. Mean pregnancy number per woman (gravida) was 3.62 ± 0.13. 47.3% of women had experienced DV before pregnancy. However, the rate of DV exposure significantly decreased to 10.3% during pregnancy (p violence. Pregnancy appears to decrease DV in Sanliurfa.

  4. Beliefs and Recommendations Regarding Child Custody and Visitation in Cases Involving Domestic Violence: A Comparison of Professionals in Different Roles.

    Science.gov (United States)

    Saunders, Daniel G; Faller, Kathleen C; Tolman, Richard M

    2016-05-01

    Research is lacking on differing perspectives regarding custody cases involving domestic violence (DV). In a survey of judges, legal aid attorneys, private attorneys, DV program workers, and child custody evaluators (n = 1,187), judges, private attorneys, and evaluators were more likely to believe that mothers make false DV allegations and alienate their children. In response to a vignette, evaluators and private attorneys were most likely to recommend joint custody and least likely to recommend sole custody to the survivor. Legal aid attorneys and DV workers were similar on many variables. Gender, DV knowledge, and knowing victims explained many group differences. © The Author(s) 2015.

  5. Isotopic character of Cambro-Ordovician plutonism, southern Victoria Land

    International Nuclear Information System (INIS)

    Cox, S.C.; Parkinson, D.L.; Allibone, A.H.; Cooper, A.F.

    2000-01-01

    Previous mapping of granitoid rocks in the Dry Valleys area of southern Victoria Land, Antarctica, identified the calc-alkaline (DV1a), adakitic (DV1b), and monzonitic (DV2) suites. A fourth older suite comprising alkaline gabbro, syenite, and A-type granite occurs in the Mt Dromedary area c. 80 km to the south. U-Pb zircon dating of Bonney Pluton, the largest calc-alkaline DV1a intrusion, indicates emplacement of this regional-scale body at 505 +/- 2 Ma. Pb-loss and inherited zircon were common to Bonney Pluton analyses of this study. U-Pb dating of monazite from Valhalla Pluton, a principal DV1b suite adakitic intrusion, indicates emplacement at 488 +/- 2 Ma. The Bonney Pluton age constrains the peak of calc-alkaline plutonism at 505 Ma and the Valhalla Pluton age records the major pulse of adakitic plutonism that is inferred to mark the final stages of subduction c. 490 Ma along this section of the East Antarctic margin. Nd and Sr isotope data for the calc-alkaline DV1a suite and adakitic DV1b suite define distinct ranges for each suite, supporting their subdivision on the basis of field relationships, petrography, and whole-rock geochemistry. Calc-alkaline DV1a suite granite magmas have eNd(T) = -4.2 to -6.1 and Sri = 0.7071-0.7079, whereas the adakitic DV1b suite rocks have a wider range of eNd(T) = -1.9 to -7.2 and Sri = 0.7065-0.7097. The isotopic data suggest a significant mantle component and subordinate crustal component in the source region of both suites. Time-dependent variations in the isotopic ratios of DV1a and DV1b suites imply a progressive increase in the proportion of more radiogenic material in the source region of the granitoid rocks, either mantle- or crust-derived material. Larger adakitic DV1b plutons are more 'evolved' than equivalent, smaller plutons of the same DV1b suite. Vanda Dikes and monzonitic DV2 suite intrusions are characterised by particularly low Sri = 0.7044-0.7067 and near-constant eNd(T) = -4.8 to -5.3, which indicate a

  6. Domestic violence as a threat to maternal and child well-being in an urban migrant community in Peru

    Directory of Open Access Journals (Sweden)

    Brieanne K. Kohrt

    Full Text Available OBJECTIVE: To examine the impact that domestic violence (DV has on hindering the success of urban migrants in Peru and any association with maternal depression, impaired parenting, social capital, and child development. METHODS: This was a cross-sectional study consisting of structured interviews with 97 mothers and their school-aged children in El Porvenir, a predominantly migrant area of the city of Trujillo, Peru. Data collection occurred in February-June 2011. Proven tools previously validated for use in Spanish were used to assess the following variables: maternal depression, social capital, domestic violence, parenting behaviors, child socioemotional development, and child cognitive development. Correlational, multiple regression, tests of interaction, and indirect/mediator models were used for analysis. RESULTS: Sixty-five percent of women reported currently experiencing DV. DV strongly predicted depression (P < 0.001. Women who reported DV were less likely to be employed (P < 0.05, had lower cognitive social capital (P < 0.01, engaged in fewer caregiving activities (P < 0.05, had less maternal energy (P < 0.05, and were less warm (P < 0.05. DV was associated with internalizing behaviors in children (P < 0.01, with impaired parenting partially mediating this relationship. CONCLUSIONS: DV compromises women's mental health and parenting ability. High rates of DV among urban migrants affect the whole community by hindering employment potential and reducing trust among community members. Interventions targeting DV-related variables (e.g., substance abuse and limited job opportunities for men could reduce the deleterious effects of DV on urban migrant communities across Latin America.

  7. Breast-feeding counselling mitigates the negative association of domestic violence on exclusive breast-feeding duration in rural Bangladesh. The MINIMat randomized trial.

    Science.gov (United States)

    Frith, Amy L; Ziaei, Shirin; Naved, Ruchira Tabassum; Khan, Ashraful Islam; Kabir, Iqbal; Ekström, Eva-Charlotte

    2017-10-01

    To determine if exclusive breast-feeding counselling modifies the association of experience of any lifetime or specific forms of domestic violence (DV) on duration of exclusive breast-feeding (EBF). In the MINIMat trial pregnant women were randomized to receive either usual health messages (UHM) or usual health messages with breast-feeding counselling (BFC) in eight visits. During pregnancy (30 weeks), lifetime experience of any or specific forms of DV was measured. Infant feeding practice information was collected from 0 to 6 months at 15 d intervals. Matlab, Bangladesh. Pregnant and postpartum women (n 3186) and their infants. Among women in the UHM group, those who had experienced any lifetime DV exclusively breast-fed for a shorter duration than women who did not experience any lifetime DV (P=0·02). There was no difference, however, in duration of EBF among women in the BFC group based on their experience of any lifetime DV exposure (P=0·48). Using Cox regression analysis, there was an interaction of exposure to any lifetime DV, sexual violence and controlling behaviour, and counselling group with duration of breast-feeding at or before 6 months (P-interaction≤0·08). Among the UHM group, experience of any lifetime DV, sexual violence or controlling behaviour was associated with fewer days of EBF (Pgroup, experience of DV was not associated with duration of EBF. The experience of DV compromises EBF and the support of breast-feeding counselling programmes could assist this vulnerable group towards better infant feeding practices.

  8. Prevalence and Risk Factors of Domestic Violence Against Women Attending a Primary Care Center in Riyadh, Saudi Arabia.

    Science.gov (United States)

    Barnawi, Fatima Hamza

    2015-05-27

    Domestic violence (DV) against women can negatively affect the physical, mental, sexual, and reproductive health of the women as well as the well-being of their children. The objective was to estimate among Saudi women the prevalence of different types of DV, to identify its associated risk factors, and to determine the immediate victims' reactions to such violence. A cross-sectional study was carried between March and July, 2011. Self-administrated questionnaire was administered to ever-married Saudi women attending Al-Wazarat primary health care center, in Riyadh, Saudi Arabia. Out of the 720 women studied, 144 (20%) reported exposure to DV over the last year. The most common DV types were emotional (69%), social (34%), economic (26%), physical (20%), and sexual violence (10%). In multivariate logistic regression analysis, the following characteristics were independently associated with DV: younger women age, longer duration of marriage, higher women education, lower husband education, working husbands, military occupation, fewer children, husbands with multiple wives, smoking husbands, aggressive husbands, presence of chronic disease in women or husbands, and non-sufficient family income. The most common impacts of DV on women were medical or behavioral problems (72%) and psychiatric problems (58%). The most common reactions to DV were seeking separation (56%) and doing nothing (41%). More than 90% of children of abused women suffered psychological or behavioral problems. In conclusion, DV against Saudi women is considerable and the response is generally passive. Promoting a culture non-tolerant to DV and providing accessible, effective, and trustful social services to abused women are critically needed. © The Author(s) 2015.

  9. Does the health status of intimate partner violence victims warrant pharmacies as portals for public health promotion?

    Science.gov (United States)

    Cerulli, Catherine; Cerulli, Jennifer; Santos, Elizabeth J; Lu, Najii; He, Hua; Kaukeinen, Kimberly; White, Anne Marie; Tu, Xin

    To explore whether the health status of intimate partner violence (IPV) victims warrants pharmacies to be portals for public health promotion. Specific objectives included (1) identifying prevalence of IPV including domestic violence (DV) and sexual assault (SA) in a community sample, (2) describing characteristics and correlates of DV/SA between participants who reported and did not report DV/SA, and (3) exploring whether DV/SA status is related to mental health medication use. Cross sectional. Upstate New York during 2006. English- and Spanish-speaking respondents younger than 65 years of age answering four questions to assess DV/SA. Secondary analysis of a countywide random telephone survey, the 2006 Monroe County Adult Health Survey, which collects prevalence data on health behaviors and health status indicators. To determine whether those reporting DV/SA are at increased odds for mental health medication use, controlling for other sociodemographic- and health-related variables. The survey response rate was 30.3%, with 1,881 respondents meeting inclusion criteria. Those reporting DV/SA were almost twice as likely to use mental health medications. However, when controlling for other variables, only poor mental and physical health were significant in increasing the odds of mental health medication use. The analyses reported here suggest that DV/SA victims in a community sample use mental health medications. When controlling for other variables, survey respondents reported worse physical and mental health. If pharmacies are suitable portals for DV/SA outreach, curricula would need to provide the knowledge and skills needed to take an active role in this public health promotion.

  10. Primary health care physicians’ approach toward domestic violence in Tehran, Iran

    Science.gov (United States)

    Rasoulian, Maryam; Shirazi, Mina; Nojomi, Marzieh

    2014-01-01

    Background: Primary health care physicians (PHCPs) are the first in the clinic to detect and help victims of intimate partner violence (IPV). Therefore, their attitude and practice toward domestic violence (DV) are important to manage this problem. The aim of current study was to compare the behavior and attitude of PHCPs about DV versus other health risk factors in Tehran, Iran. Methods: A convenience sample of 220 PHCPs was evaluated. The study was carried out in April 2012. Two self-administered questionnaires were used to identify physicians’ beliefs and behaviors on screening and intervention of DV and other health risk factors. All analyses were performed using SPSS version 18.0 (SPSS, Inc. Chicago, IL). Results: One hundred and ninety eight questionnaires were analyzed. PHCPs’ mean age was 39.06 (±7.5) years. Participants were just reported 10% screening of regular patients for DV compared with 29% to 48% for other health risk factors. Mean age of PHCPs was not associated with their approach toward the DV. Compared to male physicians, females spared more time for DV victims. Major of physicians (96%) believed that DV is not a private problem and is something that needs to be addressed cautiously. Conclusion: The results of this study indicated that DV screening occurs less than that of other health risk factors. Attitude of majority of PHCPs was positive for addressing this problem PMID:25695006

  11. Attitudes towards domestic violence in Lebanon: a qualitative study of primary care practitioners

    Science.gov (United States)

    Usta, Jinan; Feder, Gene; Antoun, Jumana

    2014-01-01

    Background Domestic violence (DV) is highly prevalent in the developing and developed world. Healthcare systems internationally are still not adequately addressing the needs of patients experiencing violence. Aim To explore physicians’ attitudes about responding to DV, their perception of the physician’s role, and the factors that influence their response. Design and setting Qualitative study using individual interviews among primary care practitioners working in Lebanon. Method Primary care clinicians practising for >5 years and with >100 patient consultations a week were interviewed. Physicians were asked about their practice when encountering women disclosing abuse, their opinion about the engagement of the health services with DV, their potential role, and the anticipated reaction of patients and society to this extended role. Results Physicians felt that they were well positioned to play a pivotal role in addressing DV; yet they had concerns related to personal safety, worry about losing patients, and opposing the norms of a largely conservative society. Several physicians justified DV or blamed the survivor rather than the perpetrator for triggering the violent behaviour. Moreover, religion was perceived as sanctioning DV. Conclusion Perceived cultural norms and religious beliefs seem to be major barriers to physicians responding to DV in Lebanon, and possibly in the Arab world more generally. Financial concerns also need to be addressed to encourage physicians to address DV. PMID:24868068

  12. Dentists awareness and action towards domestic violence patients

    Science.gov (United States)

    AlAlyani, Wafa S.; Alshouibi, Ehab N.

    2017-01-01

    Objectives: To identify the potential factors that would predict a dentist’s awareness of domestic violence (DV), as well as the factors that influence the probability of dentists to take the required action. Also, to list the common barriers that dentists face when managing DV victims. Methods: In this cross-sectional study, a self-administered, structured questionnaire was sent randomly to dentists practicing in Jeddah, Saudi Arabia. The online survey link was emailed with a cover message that illustrated the study context. Responses were accepted from January 2016 until the end of February 2016. The Statistical Package for the Social Sciences version 22 was used for data analysis. Descriptive statistics, bivariate and multivariate analysis carried out to identify significant variables at p<0.05 level of significance. Results: A sample size of 151 responses were recruited. The result of multivariate models indicated that the odds of dentists’ awareness and taking actions towards DV victims were influenced by their education, clinical experience, gender, practicing sector, and qualification. Lack of training in identifying DV and embarrassment to bring up DV with patients were the most common barriers for the respondents when treating DV victims. Conclusion: Continuing education with regards to DV was found to be the most relevant predictor. More educational courses in this regard would empower dentists to support DV victims. PMID:28042635

  13. Dentists awareness and action towards domestic violence patients. A cross-sectional study among dentists in Western Saudi Arabia.

    Science.gov (United States)

    AlAlyani, Wafa S; Alshouibi, Ehab N

    2017-01-01

    To identify the potential factors that would predict a dentist's awareness of domestic violence (DV), as well as the factors that influence the probability of dentists to take the required action. Also, to list the common barriers that dentists face when managing DV victims. Methods: In this cross-sectional study, a self-administered, structured questionnaire was sent randomly to dentists practicing in Jeddah, Saudi Arabia. The online survey link was emailed with a cover message that illustrated the study context. Responses were accepted from January 2016 until the end of February 2016. The Statistical Package for the Social Sciences version 22 was used for data analysis. Descriptive statistics, bivariate and multivariate analysis carried out to identify significant variables at p less than 0.05 level of significance.  Results: A sample size of 151 responses were recruited. The result of multivariate models indicated that the odds of dentists' awareness and taking actions towards DV victims were influenced by their education, clinical experience, gender, practicing sector, and qualification. Lack of training in identifying DV and embarrassment to bring up DV with patients were the most common barriers for the respondents when treating DV victims. Conclusion: Continuing education with regards to DV was found to be the most relevant predictor. More educational courses in this regard would empower dentists to support DV victims.

  14. Dentists awareness and action towards domestic violence patients. A cross-sectional study among dentists in Western Saudi Arabia

    Directory of Open Access Journals (Sweden)

    Wafa S. AlAlyani

    2017-01-01

    Full Text Available Objectives: To identify the potential factors that would predict a dentist’s awareness of domestic violence (DV, as well as the factors that influence the probability of dentists to take the required action. Also, to list the common barriers that dentists face when managing DV victims. Methods: In this cross-sectional study, a self-administered, structured questionnaire was sent randomly to dentists practicing in Jeddah, Saudi Arabia. The online survey link was emailed with a cover message that illustrated the study context. Responses were accepted from January 2016 until the end of February 2016. The Statistical Package for the Social Sciences version 22 was used for data analysis. Descriptive statistics, bivariate and multivariate analysis carried out to identify significant variables at p<0.05 level of significance. Results: A sample size of 151 responses were recruited. The result of multivariate models indicated that the odds of dentists’ awareness and taking actions towards DV victims were influenced by their education, clinical experience, gender, practicing sector, and qualification. Lack of training in identifying DV and embarrassment to bring up DV with patients were the most common barriers for the respondents when treating DV victims. Conclusion: Continuing education with regards to DV was found to be the most relevant predictor. More educational courses in this regard would empower dentists to support DV victims.

  15. Attitudes towards domestic violence in Lebanon: a qualitative study of primary care practitioners.

    Science.gov (United States)

    Usta, Jinan; Feder, Gene; Antoun, Jumana

    2014-06-01

    Domestic violence (DV) is highly prevalent in the developing and developed world. Healthcare systems internationally are still not adequately addressing the needs of patients experiencing violence. To explore physicians' attitudes about responding to DV, their perception of the physician's role, and the factors that influence their response. Qualitative study using individual interviews among primary care practitioners working in Lebanon. Primary care clinicians practising for >5 years and with >100 patient consultations a week were interviewed. Physicians were asked about their practice when encountering women disclosing abuse, their opinion about the engagement of the health services with DV, their potential role, and the anticipated reaction of patients and society to this extended role. Physicians felt that they were well positioned to play a pivotal role in addressing DV; yet they had concerns related to personal safety, worry about losing patients, and opposing the norms of a largely conservative society. Several physicians justified DV or blamed the survivor rather than the perpetrator for triggering the violent behaviour. Moreover, religion was perceived as sanctioning DV. Perceived cultural norms and religious beliefs seem to be major barriers to physicians responding to DV in Lebanon, and possibly in the Arab world more generally. Financial concerns also need to be addressed to encourage physicians to address DV. © British Journal of General Practice 2014.

  16. Correlates of domestic violence perpetration reporting among recently-married men residing in slums in Pune, India.

    Science.gov (United States)

    Kalokhe, Ameeta S; Iyer, Sandhya R; Gadhe, Keshav; Katendra, Tuman; Paranjape, Anuradha; Del Rio, Carlos; Stephenson, Rob; Sahay, Seema

    2018-01-01

    Domestic violence (DV) is prevalent in low-income and slum-dwelling communities in India. To date, the focus of DV prevention in resource-poor settings has largely been with women. We herein aim to identify correlates of DV perpetration to help inform future primary prevention efforts that focus on behavioral change in men. Utilizing a cross-sectional design, potential correlates of DV perpetration were explored among a geographically-clustered random sample of 100 recently-married men residing in slums in Pune, India. In multivariable regression, DV perpetration was associated with less time spent alone in the relationship post-marriage (standardized β = -0.230, p<0.01), not attaining the "husband ideal" (standardized β = -0.201, p<0.05), poor resilience (standardized β = -0.304, p < .01), having limited definitions of behaviors constituting DV (standardized β = -0.217, p<0.05), and reporting greater jealousy if the participant's spouse were to talk to men outside the family (standardized β = 0.272, p<0.01). The identified correlates should inform components of future DV primary prevention interventions that target men as potential perpetrators or the couple as a unit.

  17. Dicty_cDB: Contig-U11844-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 2 ( DV237992 ) A2FLE69TO Aedes aegypti full length cDNA library,... 32 9.1 2 ( DV284078 ) NAAG584TF Aedes aegypti - Fat Bodie...s Normalized (... 32 9.2 2 ( DV273445 ) NAAFZ58TR Aedes aegypti - Fat Bodie

  18. Dicty_cDB: Contig-U05163-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available nondirectional cD... 48 0.48 1 ( DV283772 ) NAAG406TR Aedes aegypti - Fat Bodies Normalized (... 48 0.48 1 ...( DV283771 ) NAAG406TF Aedes aegypti - Fat Bodies Normalized (... 48 0.48 1 ( DV189293 ) BCT040_A07_BCT040_3

  19. On the inverse transform of Laplace transforms that contain (products of) the parabolic cylinder function

    NARCIS (Netherlands)

    Veestraeten, D.

    2015-01-01

    The Laplace transforms of the transition probability density and distribution functions for the Ornstein-Uhlenbeck process contain the product of two parabolic cylinder functions, namely Dv(x)Dv(y) and Dv(x)Dv−1(y), respectively. The inverse transforms of these products have as yet not been

  20. Sexual Safety Planning as an HIV Prevention Strategy for Survivors of Domestic Violence.

    Science.gov (United States)

    Foster, Jill; Núñez, Ana; Spencer, Susan; Wolf, Judith; Robertson-James, Candace

    2016-06-01

    Victims of domestic violence (DV) are not only subject to physical and emotional abuse but may also be at increased risk for less recognized dangers from infection with human immunodeficiency virus (HIV) and other sexually transmitted pathogens. Because of the close link between DV and sexual risk, women need to be educated about the consequences of acquiring a life-threatening sexually transmitted infection, risk reduction measures, and how to access appropriate HIV services for diagnosis and treatment. It is therefore critical for DV workers to receive sufficient training about the link between DV and HIV risk so that sexual safety planning can be incorporated into activities with their clients in the same way as physical safety plans. In this article, we discuss how the Many Hands Working Together project provides interactive training for workers in DV and DV-affiliated agencies to increase their knowledge about HIV and teach sexual safety planning skills to achieve HIV risk reduction.

  1. The TIM and TAM families of phosphatidylserine receptors mediate dengue virus entry.

    Science.gov (United States)

    Meertens, Laurent; Carnec, Xavier; Lecoin, Manuel Perera; Ramdasi, Rasika; Guivel-Benhassine, Florence; Lew, Erin; Lemke, Greg; Schwartz, Olivier; Amara, Ali

    2012-10-18

    Dengue viruses (DVs) are responsible for the most medically relevant arboviral diseases. However, the molecular interactions mediating DV entry are poorly understood. We determined that TIM and TAM proteins, two receptor families that mediate the phosphatidylserine (PtdSer)-dependent phagocytic removal of apoptotic cells, serve as DV entry factors. Cells poorly susceptible to DV are robustly infected after ectopic expression of TIM or TAM receptors. Conversely, DV infection of susceptible cells is inhibited by anti-TIM or anti-TAM antibodies or knockdown of TIM and TAM expression. TIM receptors facilitate DV entry by directly interacting with virion-associated PtdSer. TAM-mediated infection relies on indirect DV recognition, in which the TAM ligand Gas6 acts as a bridging molecule by binding to PtdSer within the virion. This dual mode of virus recognition by TIM and TAM receptors reveals how DVs usurp the apoptotic cell clearance pathway for infectious entry. Copyright © 2012 Elsevier Inc. All rights reserved.

  2. Conspicuous by its absence: Domestic violence intervention in ...

    African Journals Online (AJOL)

    Domestic violence (DV) is common globally. In South Africa, emergency care providers (ECPs) lack a clear policy framework and the necessary training to identify DV and intervene when it is encountered. We investigate the knowledge, attitudes and beliefs of ECPs towards DV, and identify factors affecting early ...

  3. Addressing domestic violence in primary care: what the physician needs to know

    Science.gov (United States)

    Usta, Jinan; Taleb, Rim

    2014-01-01

    Domestic violence (DV) is quite prevalent and negatively impacts the health and mental wellbeing of those affected. Victims of DV are frequent users of health service, yet they are infrequently recognized. Physicians tend to treat the presenting complaints without addressing the root cause of the problem. Lack of knowledge on adequately managing cases of DV and on appropriate ways to help survivors is commonly presented as a barrier. This article presents the magnitude of the problem of DV in the Arab world, highlights the role of the primary care physician in addressing this problem, and provides practical steps that can guide the clinician in the Arab world in giving a comprehensive and culturally sensitive service to the survivors of DV. PMID:24647277

  4. [Electroencephalographic characteristics of the deja vu phenomenon].

    Science.gov (United States)

    Vlasov, P N; Cherviakov, A V; Gnezdinsiĭ, V V

    2013-01-01

    Déjà vu (DV, from French "already seen") is an aberration of psychic activity associated with transitory erroneous perception of novel circumstances, objects, or people as already known. An aim of the study was to investigate EEG characteristics of DV in patients with epilepsy. We studied 166 people (63.2% women, mean age 25.17±9.19 years). The DV phenomenon was studied in patients (27 people) and in a control group (139 healthy people). Patients were interviewed for DV characteristics and underwent a long (12-16 h) ambulatory EEG-monitoring study. In EEG, DV episodes in patients began with polyspike activity in the right temporal lobe and, in some cases, ended with the slow-wave theta-delta activity in the right hemisphere.

  5. A Meta-Analysis of Risk and Protective Factors for Dating Violence Victimization: The Role of Family and Peer Interpersonal Context.

    Science.gov (United States)

    Hébert, Martine; Daspe, Marie-Ève; Lapierre, Andréanne; Godbout, Natacha; Blais, Martin; Fernet, Mylène; Lavoie, Francine

    2017-01-01

    Dating violence (DV) is a widespread social issue that has numerous deleterious repercussions on youths' health. Family and peer risk factors for DV have been widely studied, but with inconsistent methodologies, which complicates global comprehension of the phenomenon. Protective factors, although understudied, constitutes a promising line of research for prevention. To date, there is no comprehensive quantitative review attempting to summarize knowledge on both family and peer factors that increase or decrease the risk for adolescents and emerging adults DV victimization. The current meta-analysis draws on 87 studies with a total sample of 278,712 adolescents and young adults to examine effect sizes of the association between various family and peer correlates of DV victimization. Results suggest small, significant effect sizes for all the family (various forms of child maltreatment, parental support, and parental monitoring) and peer factors (peer victimization, sexual harassment, affiliation with deviant peers, and supportive/prosocial peers) in the prediction of DV. With few exceptions, forms of DV (psychological, physical, and sexual), gender, and age did not moderate the strength of these associations. In addition, no difference was found between the magnitude of family and peer factors' effect sizes, suggesting that these determinants are equally important in predicting DV. The current results provide future directions for examining relations between risk and protective factors for DV and indicate that both peers and family should be part of the development of efficient prevention options.

  6. A Cross-Cultural Comparative Study of Undergraduate Health Care Professional Students’ Knowledge, Definitions, Education, and Training Experience of Domestic Violence in Northern Ireland and Jordan

    Directory of Open Access Journals (Sweden)

    Nahla Mansour Al-Ali

    2012-11-01

    Full Text Available The purpose of this study was to examine the cross-cultural differences in the knowledge, definitions, and current training and educational experiences of domestic violence (DV among third-year undergraduate nursing, dental, and medical students from two distinct universities in Northern Ireland and Jordan. A convenience sample of 774 undergraduate students was recruited. Analysis was based on gender, culture, and educational speciality, as seen through the integrated lens of a social ecological and feminist theory model. The results showed that a substantial percentage of all participants had never received any education or training on DV in their undergraduate programs. The majority of participants had good knowledge about DV, and half of the participants believed that DV is “common” in their respective countries. Significant gender and cultural differences in the definition of DV were also revealed, with Northern Irish students and female students in both cultures more likely to regard a range of behaviors as a form of DV. The research findings suggest several potential directions for change, emphasizing the importance of establishing a systematic evidence-based multidisciplinary and interagency approach to teaching and learning for student health care professionals on the topic of DV in their undergraduate programs.

  7. Domestic violence: prevalence in pregnant women and associations with physical and psychological health.

    Science.gov (United States)

    Bacchus, Loraine; Mezey, Gillian; Bewley, Susan

    2004-03-15

    To examine the prevalence of domestic violence (DV) and its associations with obstetric complications and psychological health in women on antenatal and postnatal wards. A cross-sectional survey conducted in an inner-London teaching hospital. Two hundred English-speaking women aged 16 and over, were interviewed between July 2001 and April 2002. The Abuse Assessment Screen was used to assess for experiences of DV. Depression was assessed using the Edinburgh Postnatal Depression Scale (EPDS). The analysis of predictors of obstetric complications grouped together those known to be associated with DV. 23.5% of women had lifetime experience of DV, 3% during the current pregnancy. Women with a history of DV were significantly more likely to be single, separated or in non-cohabiting relationship and to have smoked in the year prior to and/or during pregnancy. Higher EPDS scores were significantly associated with DV, single, separated or non-cohabiting status, and obstetric complications. Both a history of DV and increased EPDS scores were significantly associated with obstetric complications after controlling for other known risk factors. Domestic violence is regarded as an important risk marker for the development of obstetric complications and depressive symptomatology. This finding of itself justifies training and education of maternity health professionals to raise awareness.

  8. Inhibitory effect of glutathione on oxidative liver injury induced by dengue virus serotype 2 infections in mice.

    Directory of Open Access Journals (Sweden)

    Juan Wang

    Full Text Available The pathogenesis of dengue virus (DV infection has not been completely defined and change of redox status mediated by depletion of glutathione (GSH in host cell is a common result of viral infection. Our previous study has demonstrated that DV serotype 2 (DV2 infection alters host intracellular GSH levels, and exogenous GSH inhibits viral production by modulating the activity of NF-κB in HepG2 cells. GSH is the most powerful intracellular antioxidant and involved in viral infections. Thus, this study was to investigate whether DV2 infection can induce alteration in redox balance and effect of GSH on the disease in HepG2 xenografts SCID mice. Our results revealed that mice infected with DV2 showed alterations in oxidative stress by increasing the level of malondialdehyde (MDA, an end product of lipid peroxidation, and GSSG/GSH ratio. DV2-infected mice also showed a decrease in the activity of catalase (CAT and total superoxide dismutase (T-SOD in the serum and/or observed organs, especially the liver. Moreover, DV2 infection resulted in elevated serum levels of the cytokines tumor necrosis factor-α and interlukin-6 and obvious histopathological changes in the liver. The administration of exogenous GSH significantly reversed all of the aforementioned pathological changes and prevented significant liver damage. Furthermore, in vitro treatment of HepG2 cells with antioxidants such as GSH inhibited viral entry as well as the production of reactive oxygen species in HepG2 cells. These results suggest that GSH prevents DV2-induced oxidative stress and liver injury in mice by inhibiting proinflammatory cytokine production, and GSH and may be a promising therapeutic agent for prevention of oxidative liver damage during DV infection.

  9. 76 FR 38997 - Approval and Promulgation of Implementation Plans; State of Oregon; Regional Haze State...

    Science.gov (United States)

    2011-07-05

    ... dollars/dv cost effectiveness threshold of $10 million/dv based on what it considered the most relevant... such as a dollars/dv cost effectiveness threshold but rather on the full range of relevant factors. In... could also meet ODEQ's cost-effectiveness threshold, even if used for only a few years as in the case...

  10. The relationship between women's mental health and domestic violence in semirural areas: a study in Turkey.

    Science.gov (United States)

    Savas, Nazan; Agridag, Gulseren

    2011-05-01

    The authors examine the relationship between emotional disorders and domestic violence (DV) in 395 women of different ethnicities in Turkey. PRIME MD (Primary Care Evaluation of Mental Disorders) was used for diagnosis. This is a cross-sectional and epidemiological research. showed that the prevalence of emotional disorders, anxiety, and somatoform disorders was 22.8%, 24.8%, and 16.9%, respectively. The mean DV score was 2.98±1.32 over 10.00. DV scores were higher when women did not want to get married or did not have their family's blessing for marriage. Observed scores were also high for civil marriage cases, or when women had a job, had low income, or were afraid of their husbands (P<.05). The number of comorbid diagnoses increased with increase in DV scores (P<.001). Mean DV scores were higher for women diagnosed with major depression, partial remission or recurrence of major depression, panic disorder, and common anxiety (P<.05). The authors recommend that if physicians suspect any emotional disorders in women in primary care, they should evaluate for DV.

  11. Exploring domestic violence and social distress in Australian-Indian migrants through community theater.

    Science.gov (United States)

    O'Connor, Manjula; Colucci, Erminia

    2016-02-01

    In many parts of the world, young adult women have higher levels of common mental disorders than men. The exacerbation of domestic violence (DV) by migration is a salient social determinant of poor mental health. Ecological models describe factors contributing to DV as operating at individual, family, cultural, and societal levels. We explored the interplay among these factors in an Indian community living in Melbourne, Australia, in a qualitative participatory action research study using a modified Forum Theater approach. We here present findings on connections between migration, societal factors, and social/family/cultural factors in DV. The study captured the voices of women living in the community as they describe how DV contributes to their emotional difficulties. Improved understanding of the sociocultural dynamics of DV and the associated social distress in this migrant Indian community can be used to guide the development of culturally sensitive prevention and response programs to assist migrant women from the Indian subcontinent who present with psychopathology and suicidal behaviors associated with DV. © The Author(s) 2015.

  12. Multi-Rocket Thought Experiment

    Science.gov (United States)

    Smarandache, Florentin

    2014-03-01

    We consider n>=2 identical rockets: R1 ,R2 , ..., Rn. Each of them moving at constant different velocities respectively v1 ,v2 , ..., vn on parallel directions in the same sense. In each rocket there is a light clock, the observer on earth also has a light clock. All n + 1 light clocks are identical and synchronized. The proper time Δt' in each rocket is the same. (1) If we consider the observer on earth and the first rocket R1, then the non-proper time Δt of the observer on earth is dilated with the factor D(v1) : or Δt = Δt' D(v1) (1) But if we consider the observer on earth and the second rocket R2 , then the non-proper time Δt of the observer on earth is dilated with a different factor D(v2) : or Δt = Δt' D(v2) And so on. Therefore simultaneously Δt is dilated with different factors D(v1) , D(v2), ..., D(vn) , which is a multiple contradiction.

  13. Descompensación distal postoperatoria (D.D.P. en curvas lenke 1a tratadas con tornillos pediculares: una revisión de 63 casos Descompensação distal pós-operatória (DDP em curvaturas lenke 1a tratadas com parafusos pediculares: análise de 63 casos Postoperative distal decompensation (PDD in lenke 1a curvatures treated with pedicular screws: analysis of 63 cases

    Directory of Open Access Journals (Sweden)

    Norberto Ventura

    2012-06-01

    Full Text Available OBJETIVO: Identificar los factores de riesgo de descompensación distal postoperatoria (D.D.P. y definir una estrategia quirúrgica segura en curvas tipo Lenke 1A tratadas con tornillos pediculares. MÉTODO: Estudio radiológico retrospectivo de 63 pacientes con escoliosis Lenke 1A, con un seguimiento mínimo de un año. Se evaluó, edad, sexo, grados Cobb, signo de Risser, relación de la vértebra distal instrumentada (V.D.I. con la vértebra distal de la curva (V.D., vértebra estable (V.E. y con la vértebra, cuya distancia a la línea central vertical al sacro (L.V.S. era superior a 10 mm "distancia vertebral" (D.V.. RESULTADOS: 8 casos (12,7% desarrollaron D.D.P. El signo de Risser fue 0 en 2 pacientes (25% y I en 2 pacientes (25%. Relación de V.D.I. con V.D.: 4 pacientes (50% mismo nivel (V.D. +0, 4 pacientes (50% un nivel caudal (V.D. (+1; relación V.D.I. con V.E.: 5 pacientes (62,5% 2 niveles cefálicos (V.E -2, 3 pacientes (37,5% 1 nivel cefálico (V. E.-1; relación V.D.I. con D.V.: 5 pacientes (62,5% un nivel cefálico D.V. (-1, 3 pacientes mismo nivel (D.V.+ 0. CONCLUSIONES: Riesgo de descompensación distal postoperatoria: V.D.I. mismo nivel V.D. (V.D. + 0, 2 niveles cefálicos V.E. (V.E.-2, 1 nivel cefálico D.V. (D.V. -1. Estrategia quirúrgica curvas Lenke 1A: V.D.I: 1/2 niveles caudales a V.D. (V.D. +1/+2, un nivel cefálico a V.E. (V.E -1, mismo nivel D.V. (D.V. +0.OBJETIVO: Identificar os fatores de risco de descompensação distal pós-operatória (DDP e definir estratégia cirúrgica de segurança em curvaturas de Lenke 1A, tratadas com parafusos pediculares. MÉTODO: Estudo radiológico retrospectivo de 63 pacientes com escoliose Lenke 1A, com acompanhamento mínimo de um ano. Os parâmetros avaliados foram idade, sexo, graus do ângulo de Cobb, sinal de Risser, relação da vértebra distal instrumentada (VDI com a vértebra distal da curvatura (VD, com a vértebra estável (VE e com a vértebra cuja distância da linha

  14. Out with the Old

    Science.gov (United States)

    Rydeen, James E.; Stofferahn, Terry; Lange, Jim

    2010-01-01

    Displacement ventilation (DV) units use the natural buoyancy of warm air to improve ventilation and comfort. Although relatively new to the United States, DV has been used in Scandinavian countries since the 1970s. Two types of DV can be used in a classroom: (1) Conventional displacement ventilation (CDV) units which are situated on an interior…

  15. Sea Star Wasting Disease 2 Years On: What We know, What We Don't Yet Know, and What We are Doing Now to Understand the Disease

    Science.gov (United States)

    Hewson, I.

    2016-02-01

    Sea star wasting disease has affected over 20 species of asterozoa in waters from central Alaska to Baja California, causing extensive mortality and disappearance entirely from some areas. Combined viral, bacterial, eukaryotic microbial, and histological investigations identified the core nano- and micro-biome of sea stars, and elucidated that the Sea Star Associated Densovirus (SSaDV) was the most likely candidate microorganism involved in disease etiology. Direct challenge experiments using tissue homogenates from symptomatic animals injected into asymptomatic individuals revealed that the disease is caused by a virus-sized entity. However, there remains much to be learned about the disease, especially how disease symptoms are generated by SSaDV, how the virus is transmitted between infected and uninfected animals, and why SSaDV may cause disease recently. We performed inoculation trials on SSaDV-naïve sea stars collected from a geographically distant population away from disease-affected areas, and observed viral, bacterial, archaeal, and host transcriptomic responses over time. We also performed surveys of SSaDV in juveniles and larval plankton, as well as the environmental distribution and stability of SSaDV in key regions where SSWD has all but wiped out adults. Our results suggest that SSaDV must move around either on particles or by direct contact between animals, since decay rates exceed reasonable transmission times based on sea star abundance. Global surveys of sea star-associated viruses also elucidate that SSaDV may have been present in populations of sea stars from Hong Kong around the same time of the 2013-2015 epidemic.

  16. Modeling Plan-Related Clinical Complications Using Machine Learning Tools in a Multiplan IMRT Framework

    International Nuclear Information System (INIS)

    Zhang, Hao H.; D'Souza, Warren D.; Shi Leyuan; Meyer, Robert R.

    2009-01-01

    Purpose: To predict organ-at-risk (OAR) complications as a function of dose-volume (DV) constraint settings without explicit plan computation in a multiplan intensity-modulated radiotherapy (IMRT) framework. Methods and Materials: Several plans were generated by varying the DV constraints (input features) on the OARs (multiplan framework), and the DV levels achieved by the OARs in the plans (plan properties) were modeled as a function of the imposed DV constraint settings. OAR complications were then predicted for each of the plans by using the imposed DV constraints alone (features) or in combination with modeled DV levels (plan properties) as input to machine learning (ML) algorithms. These ML approaches were used to model two OAR complications after head-and-neck and prostate IMRT: xerostomia, and Grade 2 rectal bleeding. Two-fold cross-validation was used for model verification and mean errors are reported. Results: Errors for modeling the achieved DV values as a function of constraint settings were 0-6%. In the head-and-neck case, the mean absolute prediction error of the saliva flow rate normalized to the pretreatment saliva flow rate was 0.42% with a 95% confidence interval of (0.41-0.43%). In the prostate case, an average prediction accuracy of 97.04% with a 95% confidence interval of (96.67-97.41%) was achieved for Grade 2 rectal bleeding complications. Conclusions: ML can be used for predicting OAR complications during treatment planning allowing for alternative DV constraint settings to be assessed within the planning framework.

  17. The Relationship Between Maternal Domestic Violence and Infant and Toddlers' Emotional Regulation: Highlighting the Need for Preventive Services.

    Science.gov (United States)

    Geyer, Chelsea; Ogbonnaya, Ijeoma Nwabuzor

    2017-11-01

    In an effort to further understand the impact of domestic violence (DV) on infant and toddlers' development, this research utilized data from the second cohort of National Survey of Child and Adolescent Well-Being (NSCAW II) to examine the relationship between maternal DV and infant and toddlers' emotional regulation, and determine whether mothers' receipt of DV services mediated this relationship. The sample was limited to children aged 0 to 3 years and included (a) infants less than 1 year old ( n = 603), (b) infants 1 to less than 2 years old ( n = 310), and (c) toddlers 2 to 3 years old ( n = 268). Infant/toddlers' emotional regulation was measured using mothers' response on the How My Infant/Toddler/Child Usually Acts questionnaire. In addition, data were collected to assess whether (a) active DV was present during the time of the Child Protective Services (CPS) investigation and (b) mothers received DV services during the past year. Study research questions were examined using a series of multiple regression analyses. Mediation was tested based on Baron and Kenny's recommended model for establishing mediation. The mediational model was not found to be significant; however, a positive relationship existed between maternal DV and emotional regulation among infants aged less than 1 year old (β = 1.61, p = .039). There were no statistically significant relationships between DV and emotional regulation in the other age groups. These findings highlight the need to provide CPS-involved families victimized by DV with services that focus on preventing poor infant emotional regulation.

  18. Double Jeopardy: Insurance, Animal Harm, and Domestic Violence.

    Science.gov (United States)

    Signal, Tania; Taylor, Nik; Burke, Karena J; Brownlow, Luke

    2018-05-01

    Although the role of companion animals within the dynamic of domestic violence (DV) is increasingly recognized, the overlap of animal harm and insurance discrimination for victims/survivors of DV has not been considered. Prompted by a case study presented in a National Link Coalition LINK-Letter, this research note examines "Pet Insurance" policies available in Australia and whether nonaccidental injury caused by an intimate partner would be covered. We discuss the implications of exclusion criteria for victims/survivors of DV, shelters providing places for animals within a DV dynamic, and, more broadly, for cross- or mandatory-reporting (of animal harm) initiatives.

  19. The Equation Δ u + ∇φ· ∇u = 8πc(1-heu) on a Riemann Surface

    International Nuclear Information System (INIS)

    Wang Meng

    2009-12-01

    Let M be a compact Riemann surface, h(x) a positive smooth function on M, and φ(x) a smooth function on M which satisfies that ∫ M e φ dV g = 1. In this paper, we consider the functional J(u) = 2 1 ∫ M |∇u| 2 e φ dV g +8πc ∫ M ue φ dV g -8πclog ∫ M he u+φ dV g . We give a sufficient condition under which J achieves its minimum for c ≤ inf xelement ofM Φ(x). (author)

  20. Decadal trends in the diurnal variation of galactic cosmic rays observed using neutron monitor data

    Energy Technology Data Exchange (ETDEWEB)

    Thomas, Simon [Reading Univ. (United Kingdom). Dept. of Meteorology; Univ. College London, Dorking (United Kingdom). Mullard Space Science Lab.; Owens, Mathew; Lockwood, Mike [Reading Univ. (United Kingdom). Dept. of Meteorology; Owen, Chris [Univ. College London, Dorking (United Kingdom). Mullard Space Science Lab.

    2017-10-01

    The diurnal variation (DV) in galactic cosmic ray (GCR) flux is a widely observed phenomenon in neutron monitor data. The background variation considered primarily in this study is due to the balance between the convection of energetic particles away from the Sun and the inward diffusion of energetic particles along magnetic field lines. However, there are also times of enhanced DV following geomagnetic disturbances caused by coronal mass ejections or corotating interaction regions. In this study we investigate changes in the DV over four solar cycles using ground-based neutron monitors at different magnetic latitudes and longitudes at Earth. We divide all of the hourly neutron monitor data into magnetic polarity cycles to investigate cycle-to-cycle variations in the phase and amplitude of the DV. The results show, in general, a similarity between each of the A<0 cycles and A>0 cycles, but with a phase change between the two. To investigate this further, we split the neutron monitor data by solar magnetic polarity between times when the dominant polarity was either directed outward (positive) or inward (negative) at the northern solar pole. We find that the maxima and minima of the DV changes by, typically, 1-2 h between the two polarity states for all non-polar neutron monitors. This difference between cycles becomes even larger in amplitude and phase with the removal of periods with enhanced DV caused by solar wind transients. The time difference between polarity cycles is found to vary in a 22-year cycle for both the maximum and minimum times of the DV. The times of the maximum and minimum in the DV do not always vary in the same manner between A>0 and A<0 polarity cycles, suggesting a slight change in the anisotropy vector of GCRs arriving at Earth between polarity cycles. Polar neutron monitors show differences in phase between polarity cycles which have asymptotic directions at mid-to-high latitudes. All neutron monitors show changes in the amplitude of the

  1. The Development and Validation of the Indian Family Violence and Control Scale.

    Science.gov (United States)

    Kalokhe, Ameeta S; Stephenson, Rob; Kelley, Mary E; Dunkle, Kristin L; Paranjape, Anuradha; Solas, Vikram; Karve, Latika; del Rio, Carlos; Sahay, Seema

    2016-01-01

    The high prevalence of domestic violence (DV) among married women in India and associated negative health repercussions highlight the need for effective prevention strategies and tools to measure the efficacy of such interventions. Literature supporting differing manifestations of DV by culture underscores the need for a culturally-tailored scale to more effectively measure DV in the Indian context. We therefore aimed to develop and validate such a tool, the Indian Family Violence and Control Scale (IFVCS), through a mixed-methods study. The psychometric development of IFVCS is herein discussed. After field pre-testing and expert review, a 63-item questionnaire was administered to a random sample of 630 married women from May-July 2013 in Pune, India. The item response theory approach for binary data to explore the IFVCS structure suggested that IFVCS is reliable, with the majority of items having high (>0.5) and significant factor loadings. Concurrent validity, assessed by comparing responses to IFVCS with the validated, abridged Conflict Tactics Scale-2, was high (r = 0.899, p<0.001) as was the construct validity, demonstrated by its significant association with several established DV correlates. Therefore, initial assessment of the IFVCS psychometric properties suggests that it is an effective tool for measuring DV among married women in India and speaks to its capacity for enhancing understanding of DV epidemiology and for evaluating the effectiveness of future DV interventions.

  2. Dimensionality-varied deep convolutional neural network for spectral-spatial classification of hyperspectral data

    Science.gov (United States)

    Qu, Haicheng; Liang, Xuejian; Liang, Shichao; Liu, Wanjun

    2018-01-01

    Many methods of hyperspectral image classification have been proposed recently, and the convolutional neural network (CNN) achieves outstanding performance. However, spectral-spatial classification of CNN requires an excessively large model, tremendous computations, and complex network, and CNN is generally unable to use the noisy bands caused by water-vapor absorption. A dimensionality-varied CNN (DV-CNN) is proposed to address these issues. There are four stages in DV-CNN and the dimensionalities of spectral-spatial feature maps vary with the stages. DV-CNN can reduce the computation and simplify the structure of the network. All feature maps are processed by more kernels in higher stages to extract more precise features. DV-CNN also improves the classification accuracy and enhances the robustness to water-vapor absorption bands. The experiments are performed on data sets of Indian Pines and Pavia University scene. The classification performance of DV-CNN is compared with state-of-the-art methods, which contain the variations of CNN, traditional, and other deep learning methods. The experiment of performance analysis about DV-CNN itself is also carried out. The experimental results demonstrate that DV-CNN outperforms state-of-the-art methods for spectral-spatial classification and it is also robust to water-vapor absorption bands. Moreover, reasonable parameters selection is effective to improve classification accuracy.

  3. Matched trauma: The role of parents' and children's shared history of childhood domestic violence exposure in parents' report of children's trauma-related symptomatology.

    Science.gov (United States)

    Cohodes, Emily; Hagan, Melissa; Narayan, Angela; Lieberman, Alicia

    2016-01-01

    Parents' childhood experiences of trauma may influence their reports of their children's behavior, and this may be particularly true when children are also traumatized. The present study proposed and tested a matched trauma hypothesis, positing that compared to parents without a childhood history of witnessing domestic violence (DV), parents with a childhood history of witnessing DV may report their children's trauma-related symptomatology differently following children's exposure to DV. Of 137 included parents (M age = 32 years; 93% mothers), 81 reported witnessing childhood DV (matched group), whereas 56 reported no childhood DV exposure (nonmatched comparison group). All parents reported on their 3- to 6-year-old children's dissociation and posttraumatic stress symptoms following children's DV exposure. An analysis of covariance controlling for parental life stress, dissociation symptoms, and other childhood traumatic events revealed that parents who witnessed childhood DV reported significantly fewer child dissociation symptoms than comparison parents. No difference was found for parents' reports of children's posttraumatic stress symptoms. Exploratory analyses on a subsample of children with teacher reports of child dissociation symptoms (n = 75) revealed that the strength of the association between parent and teacher reports of dissociation symptoms was moderated by matched versus nonmatched group membership. Findings suggest the importance of considering a parent's history of trauma when using parents as informants for children's trauma symptoms.

  4. The Role and Education of Dental Care Professionals in Identifying Domestic Violence: Report of an Audience Participation Exercise and Round Table Discussion

    Science.gov (United States)

    Lea, Susan J.; Quinn, Barry; Reynolds, Patricia A.

    2017-01-01

    Domestic violence (DV) is a major public problem affecting 30% of women over 16. Three quarters of victims have violence to the head and neck, and therefore the role of the dentist is paramount in DV identification. Only one-third of dental schools in the UK include DV in their curricula and there is a need to introduce effective education for the…

  5. Three-dimensional reconstruction volume: a novel method for volume measurement in kidney cancer.

    Science.gov (United States)

    Durso, Timothy A; Carnell, Jonathan; Turk, Thomas T; Gupta, Gopal N

    2014-06-01

    The role of volumetric estimation is becoming increasingly important in the staging, management, and prognostication of benign and cancerous conditions of the kidney. We evaluated the use of three-dimensional reconstruction volume (3DV) in determining renal parenchymal volumes (RPV) and renal tumor volumes (RTV). We compared 3DV with the currently available methods of volume assessment and determined its interuser reliability. RPV and RTV were assessed in 28 patients who underwent robot-assisted laparoscopic partial nephrectomy for kidney cancer. Patients with a preoperative creatinine level of kidney pre- and postsurgery overestimated 3D reconstruction volumes by 15% to 102% and 12% to 101%, respectively. In addition, volumes obtained from 3DV displayed high interuser reliability regardless of experience. 3DV provides a highly reliable way of assessing kidney volumes. Given that 3DV takes into account visible anatomy, the differences observed using previously published methods can be attributed to the failure of geometry to accurately approximate kidney or tumor shape. 3DV provides a more accurate, reproducible, and clinically useful tool for urologists looking to improve patient care using analysis related to volume.

  6. A Gas-Kinetic Scheme for Turbulent Flow

    Science.gov (United States)

    2014-09-19

    is dΞ = dv1dv2dv3 dξ and: ψ = [ 1 v1 v2 v3 1 2 ( ui 2 + ξ2 )]T . (2) The numerical fluxes F related to a unit interface length normal to direction n... Rockets , 44(6):1232–1240. [Mandal and Deshpande, 1994] Mandal, J. and Desh- pande, S. (1994). Kinetic flux vector splitting for Euler equations. Comput

  7. Association between gap in spousal education and domestic violence in India and Bangladesh.

    Science.gov (United States)

    Rapp, Daniel; Zoch, Beate; Khan, M Mobarak H; Pollmann, Thorsten; Krämer, Alexander

    2012-06-21

    Domestic violence (DV) against women is a serious human rights abuse and well recognised global public health concern. The occurrence of DV is negatively associated with the educational level of spouses but studies dealing with educational discrepancies of spouses show contradicting results: Wives with higher education than their husbands were more likely to ever experience DV as compared to equally educated couples. The purpose of this study was to investigate the association between spousal education gap (SEG) and the prevalence and severity of DV in India and Bangladesh. Nationally representative data collected through the 2005/2006 Indian National Family Health Survey (NFHS-3) and 2007 Bangladesh Demographic and Health Survey (BDHS) were used. In total, we analysed data of 69,805 women aged 15-49 years (Bangladesh: 4,195 women, India: 65,610 women). In addition to univariate and bivariable analyses, a multinomial logistic regression model was used to quantify the association between education gap and less severe as well as severe domestic violence. Adjustment was made for age, religion, and family structure. Wives with higher education than their husbands were less likely to experience less severe (OR = 0.83, 95% CI: 0.77-0.89) and severe (OR = 0.79, 95% CI: 0.72-0.87) DV as compared to equally low-educated spouses (reference group). Equally high-educated couples revealed the lowest likelihood of experiencing DV (severe violence: OR 0.43, CI 0.39-0.48; less severe violence: OR 0.59, CI 0.55-0.63). The model's goodness of fit was low (Nagelkerke's R2 = 0.152). Our analysis revealed no increased DV among wives with a higher educational level than their husbands. Moreover, the results point towards a decrease of severe violence with an increase in education levels among spouses. However, the model did not explain a satisfying amount of DV. Therefore, further research should be done to reveal unknown determinants so that suitable interventions to reduce DV can be

  8. The Development and Validation of the Indian Family Violence and Control Scale.

    Directory of Open Access Journals (Sweden)

    Ameeta S Kalokhe

    Full Text Available The high prevalence of domestic violence (DV among married women in India and associated negative health repercussions highlight the need for effective prevention strategies and tools to measure the efficacy of such interventions. Literature supporting differing manifestations of DV by culture underscores the need for a culturally-tailored scale to more effectively measure DV in the Indian context. We therefore aimed to develop and validate such a tool, the Indian Family Violence and Control Scale (IFVCS, through a mixed-methods study. The psychometric development of IFVCS is herein discussed. After field pre-testing and expert review, a 63-item questionnaire was administered to a random sample of 630 married women from May-July 2013 in Pune, India. The item response theory approach for binary data to explore the IFVCS structure suggested that IFVCS is reliable, with the majority of items having high (>0.5 and significant factor loadings. Concurrent validity, assessed by comparing responses to IFVCS with the validated, abridged Conflict Tactics Scale-2, was high (r = 0.899, p<0.001 as was the construct validity, demonstrated by its significant association with several established DV correlates. Therefore, initial assessment of the IFVCS psychometric properties suggests that it is an effective tool for measuring DV among married women in India and speaks to its capacity for enhancing understanding of DV epidemiology and for evaluating the effectiveness of future DV interventions.

  9. Initial digital vasculitis in a large multicenter cohort of childhood-onset systemic lupus erythematosus

    Directory of Open Access Journals (Sweden)

    Ana Paula Sakamoto

    Full Text Available Abstract Objectives: To assess clinical digital vasculitis (DV as an initial manifestation of childhood-onset systemic lupus erythematosus (cSLE within a large population. Methods: Multicenter cross-sectional study including 852 cSLE patients (ACR criteria followed in ten Pediatric Rheumatology centers in São Paulo State, Brazil. Results: DV was observed in 25/852 (3% cSLE patients. Periungual hemorrhage was diagnosed in 12 (48%, periungual infarction in 7 (28%, tip finger ulceration in 4 (16%, painful nodules in 1 (4% and gangrene in 1 (4%. A poor outcome, with digital resorption, occurred in 5 (20%. Comparison of patients with and without DV revealed higher frequency of malar rash (80% vs. 53%, p = 0.008, discoid rash (16% vs. 4%, p = 0.017, photosensitivity (76% vs. 45%, p = 0.002 and other cutaneous vasculitides (80% vs. 19%, p 0.05. SLEDAI-2K median, DV descriptor excluded, was significantly lower in patients with DV compared to those without this manifestation [10 (0-28 vs. 14 (0-58, p = 0.004]. Visceral vasculitis or death were not observed in this cSLE cohort. The frequency of cyclophosphamide use (0% vs. 18%, p = 0.014 was significantly lower in the DV group. Conclusion: Our large multicenter study identified clinical DV as one of the rare initial manifestation of active cSLE associated with a mild multisystemic disease, in spite of digital resorption in some of these patients.

  10. Performance of Healthcare Providers Regarding Iranian Women Experiencing Physical Domestic Violence in Isfahan.

    Science.gov (United States)

    Yousefnia, Nasim; Nekuei, Nafisehsadat; Farajzadegan, Ziba; Yadegarfar, Ghasem

    2018-01-01

    Domestic violence (DV) can threaten women's health. Healthcare providers (HCPs) may be the first to come into contact with a victim of DV. Their appropriate performance regarding a DV victim can decrease its complications. The aim of the present study was to investigate HCPs' performance regarding women experiencing DV in emergency and maternity wards of hospitals in Isfahan, Iran. The present descriptive, cross-sectional study was conducted among 300 HCPs working in emergency and maternity wards in hospitals in Isfahan. The participants were selected using quota random sampling from February to May 2016. A researcher-made questionnaire containing the five items of HCPs performance regarding DV (assessment, intervention, documentation, reference, and follow-up) was used to collect data. The reliability and validity of the questionnaire were confirmed, and the collected data were analyzed using SPSS software. Cronbach's alpha was used to assess the reliability of the questionnaires. To present a general description of the data (variables, mean, and standard deviation), the table of frequencies was designed. The performance of the participants regarding DV in the assessment (mean = 64.22), intervention (mean = 68.55), and reference stages (mean = 68.32) were average. However, in the documentation (mean = 72.55) and follow-up stages (mean = 23.10), their performance was good and weak respectively (criterion from 100). Based on the results, because of defects in providing services for women experiencing DV, a practical indigenous guideline should be provided to treat and support these women.

  11. Police Response to Children Present at Domestic Violence Incidents.

    Science.gov (United States)

    Swerin, Danielle D; Bostaph, Lisa Growette; King, Laura L; Gillespie, Lane Kirkland

    2018-01-01

    Police response to domestic violence (DV) has continued to change and expand over the past several decades. Although DV was originally considered a private matter, it now represents one of the most common calls for service received by police agencies. While police response to DV incidents has improved substantially, intervention when children are present remains an undeveloped area of research and practice. The present study examined 345 police reports from an agency in the Northwestern United States to explore police response to DV incidents when children are present. Regression analyses indicated that child presence was a statistically significant predictor of victim-directed intervention, victim-directed follow-up, and arrest although in differing directions. While child presence increased the odds of victim-directed intervention and victim-directed follow-up, it decreased the odds of arrest. Findings further indicated that the frequency of police interaction with children present at DV incidents was minimal. Based on these findings, recommendations for policy and practice are discussed.

  12. School Personnel's Bystander Action in Situations of Dating Violence, Sexual Violence, and Sexual Harassment Among High School Teens: A Qualitative Analysis.

    Science.gov (United States)

    Edwards, Katie M; Rodenhizer, Kara Anne; Eckstein, Robert P

    2017-04-01

    We examined school personnel's engagement in bystander action in situations of teen dating violence (DV), sexual violence (SV), and sexual harassment (SH). We conducted focus groups with 22 school personnel from three high schools in New Hampshire. School personnel identified their own barriers to intervening in situations of teen DV, SV, and SH (e.g., not having the time or ability to intervene). School personnel also discussed the ways in which they intervened before (e.g., talking with teens about healthy relationships), during (e.g., breaking up fights between dating partners) and after (e.g., comforting victims) instances of teen DV, SV, and SH. These data can be used to support the development of bystander training for school personnel as one component of comprehensive DV, SV, and SH prevention for teens. In addition, these data provide information that can be used to develop measures that assess school personnel bystander action barriers and behaviors in instances of teen DV, SV, and SH.

  13. Monitoring daily and sub-daily variations in crustal strain with seismic arrays

    Science.gov (United States)

    Mao, S.; Campillo, M.; van der Hilst, R. D.; Brenguier, F.; Hillers, G.

    2017-12-01

    We demonstrate that we can monitor deformation of the shallow crust (with hourly temporal resolution) directly with seismic waves, by measuring relative seismic wave speed changes (dv/v) due to relatively known periodical forcing (tides and changes in atmospheric temperature) at Piton de la Fournaise Volcano (PdF), La Réunion. We use ambient seismic noise recorded (for one month) at VolcArray, an experiment with three arrays of 49 vertical-component geophones deployed on a 7x7 grid of approximately 80 m spacing. Through noise-based coda wave interferometry we infer for each array the average relative changes in propagation speed of seismic waves (dv/v) as a function of time, which relate to temporal changes in medium properties within 100m depth. The variations in dv/v ( 0.05%) on time-scales longer than a day are best explained by effects of precipitation on pore pressure. In contrast, the (weaker) daily and sub-daily fluctuations of dv/v ( 0.01%) are likely to be caused by tidal and thermal effects. We verify that the inferred variations of dv/v are unrelated to spatiotemporal changes of noise wavefields. We further compare the power spectrum of dv/v with spectra of simulated tide-induced volumetric strain, temperature records, very broadband (VBB) seismograms, and borehole tilt records. In all five types of data, dominant peaks are found at around diurnal, semi-diurnal, and ter-diurnal frequencies. A comparison of phase and spectra of the data suggests that the tidal and thermal effects on dv/v are of similar magnitude but vary with frequency. Theoretical modeling of tide- and temperature-induced strain in different frequency bands agrees with the relative magnitude of the two effects on dv/v from passive monitoring.

  14. Comparison of domestic violence against women in urban versus rural areas of southeast Nigeria

    Science.gov (United States)

    Ajah, Leonard Ogbonna; Iyoke, Chukwuemeka Anthony; Nkwo, Peter Onubiwe; Nwakoby, Boniface; Ezeonu, Paul

    2014-01-01

    Background The perception and prevalence of domestic violence (DV) in rural areas is poorly understood; the result is that most efforts at eradicating this harmful practice are concentrated in urban areas. The objective of the study was to compare the burden and perception of DV among women living in rural and urban Igbo communities of southeast Nigeria. Methods This was a comparative, cross-sectional study of women residing in rural and urban communities in Enugu, Nigeria, who had gathered for an annual religious meeting from August 1–7, 2011. Data analysis involved descriptive and inferential statistics and was conducted with the Statistical Package for Social Sciences, software version 17.0, at a 95% level of confidence. Results A total of 836 women who met the eligibility criteria participated in the survey. Of these, 376 were from Okpanku, a rural community, while 460 were from Ogui Nike, an urban community. The prevalence of DV among rural women was significantly higher than that among urban women (97% versus 81%, P<0.001). In particular, the prevalence of physical violence was significantly higher among rural women than among urban women (37.2% versus 23.5%; P=0.05). In contrast, rural and urban women did not differ significantly in the proportions that had experienced psychological or sexual violence. The proportion of women who believed that DV was excusable was significantly higher among rural dwellers than among urban dwellers (58.5% versus 29.6%; P=0.03). Conclusion The burden of DV against women may be higher in rural communities than in urban communities in southeast Nigeria. More rural women perceived DV as excusable; this finding suggests that factors that sustain DV could be strong in rural areas. A comprehensive program to curb DV in this area may need to significantly involve the rural areas. PMID:25336992

  15. The association of domestic violence and social resources with functioning in an adult trauma-affected sample living in Kurdistan, Northern Iraq

    Science.gov (United States)

    Kane, Jeremy C.; Hall, Brian J.; Bolton, Paul; Murray, Laura K.; Ahmed, Ahmed Mohammed Amin; Bass, Judith K.

    2016-01-01

    Ability to function in tasks and activities is an important aspect of daily living. There are factors that increase the risk for impaired functioning, such as experiences of domestic violence (DV) and other trauma types, and factors that provide a buffer to existing risks and allow the individual to continue and build functioning, such as access to social resources. This cross-sectional study investigated the direct effects of DV and access to social resources (perceived social support, social integration, and frequency of social contact), as well as their potential interactive effects, on daily functioning among 894 male and female trauma survivors who attended primary care clinics in Kurdistan, Iraq in 2009 and 2010. Experiencing DV was not associated with functioning for males (p=.15) or females (p=.60), suggesting that in the context of a trauma-affected sample, the experience of DV may not significantly increase the risk for functional impairment. Greater amounts of social integration were associated with less functional impairment among males (p<.01) and females (p<.05); social integration was associated with less functional impairment among males only (p<.01); and frequency of social contact was associated with less functional impairment among females only (p<.05), indicating that the association between social resource type and functioning differed by gender. Standardized beta coefficients indicated that social resources had a stronger effect on functioning among men compared to women. Among males who experienced DV, social integration was the only social resource associated with less functional impairment (p<.01); among male trauma survivors who did not experience DV, social support was the only resource associated with less functional impairment (p<.01). Further investigation into the association of social resources with functioning and how these differ by gender and DV exposure is warranted to inform intervention strategies for survivors of DV and other

  16. Efficient Hybrid Watermarking Scheme for Security and Transmission Bit Rate Enhancement of 3D Color-Plus-Depth Video Communication

    Science.gov (United States)

    El-Shafai, W.; El-Rabaie, S.; El-Halawany, M.; Abd El-Samie, F. E.

    2018-03-01

    Three-Dimensional Video-plus-Depth (3DV + D) comprises diverse video streams captured by different cameras around an object. Therefore, there is a great need to fulfill efficient compression to transmit and store the 3DV + D content in compressed form to attain future resource bounds whilst preserving a decisive reception quality. Also, the security of the transmitted 3DV + D is a critical issue for protecting its copyright content. This paper proposes an efficient hybrid watermarking scheme for securing the 3DV + D transmission, which is the homomorphic transform based Singular Value Decomposition (SVD) in Discrete Wavelet Transform (DWT) domain. The objective of the proposed watermarking scheme is to increase the immunity of the watermarked 3DV + D to attacks and achieve adequate perceptual quality. Moreover, the proposed watermarking scheme reduces the transmission-bandwidth requirements for transmitting the color-plus-depth 3DV over limited-bandwidth wireless networks through embedding the depth frames into the color frames of the transmitted 3DV + D. Thus, it saves the transmission bit rate and subsequently it enhances the channel bandwidth-efficiency. The performance of the proposed watermarking scheme is compared with those of the state-of-the-art hybrid watermarking schemes. The comparisons depend on both the subjective visual results and the objective results; the Peak Signal-to-Noise Ratio (PSNR) of the watermarked frames and the Normalized Correlation (NC) of the extracted watermark frames. Extensive simulation results on standard 3DV + D sequences have been conducted in the presence of attacks. The obtained results confirm that the proposed hybrid watermarking scheme is robust in the presence of attacks. It achieves not only very good perceptual quality with appreciated PSNR values and saving in the transmission bit rate, but also high correlation coefficient values in the presence of attacks compared to the existing hybrid watermarking schemes.

  17. Kinetic isotope effect studies on aspartate aminotransferase: Evidence for a concerted 1,3 prototropic shift mechanism for the cytoplasmic isozyme and L-aspartate and dichotomy in mechanism

    International Nuclear Information System (INIS)

    Julin, D.A.; Kirsch, J.F.

    1989-01-01

    The C alpha primary hydrogen kinetic isotope effects (C alpha-KIEs) for the reaction of the cytoplasmic isozyme of aspartate aminotransferase (cAATase) with [alpha-2H]-L-aspartate are small and only slightly affected by deuterium oxide solvent (DV = 1.43 +/- 0.03 and DV/KAsp = 1.36 +/- 0.04 in H 2 O; DV = 1.44 +/- 0.01 and DV/KAsp = 1.61 +/- 0.06 in D 2 O). The D 2 O solvent KIEs (SKIEs) are somewhat larger and are essentially independent of deuterium at C alpha (D 2 OV = 2.21 +/- 0.07 and D 2 OV/KAsp = 1.70 +/- 0.03 with [α-1H]-L-aspartate; D 2 OV = 2.34 +/- 0.12 and D 2 OV/KAsp = 1.82 +/- 0.06 with [α-2H]-L- aspartate). The C alpha-KIEs on V and on V/KAsp are independent of pH from pH 5.0 to pH 10.0. These results support a rate-determining concerted 1,3 prototropic shift mechanism by the multiple KIE criteria. The large C alpha-KIEs for the reaction of mitochondrial AATase (mAATase) with L-glutamate (DV = 1.88 +/- 0.13 and DV/KGlu = 3.80 +/- 0.43 in H 2 O; DV = 1.57 +/- 0.05 and DV/KGlu = 4.21 +/- 0.19 in D 2 O) coupled with the relatively small SKIEs (D 2 OV = 1.58 +/- 0.04 and D 2 OV/KGlu = 1.25 +/- 0.05 with [α-1H]-L-glutamate; D 2 OV = 1.46 +/- 0.06 and D 2 OV/KGlu = 1.16 +/- 0.05 with [alpha-2H]-L-glutamate) are most consistent with a two-step mechanism for the 1,3 prototropic shift for this isozyme-substrate pair

  18. Autophagic machinery activated by dengue virus enhances virus replication

    International Nuclear Information System (INIS)

    Lee, Y.-R.; Lei, H.-Y.; Liu, M.-T.; Wang, J.-R.; Chen, S.-H.; Jiang-Shieh, Y.-F.; Lin, Y.-S.; Yeh, T.-M.; Liu, C.-C.; Liu, H.-S.

    2008-01-01

    Autophagy is a cellular response against stresses which include the infection of viruses and bacteria. We unravel that Dengue virus-2 (DV2) can trigger autophagic process in various infected cell lines demonstrated by GFP-LC3 dot formation and increased LC3-II formation. Autophagosome formation was also observed under the transmission electron microscope. DV2-induced autophagy further enhances the titers of extracellular and intracellular viruses indicating that autophagy can promote viral replication in the infected cells. Moreover, our data show that ATG5 protein is required to execute DV2-induced autophagy. All together, we are the first to demonstrate that DV can activate autophagic machinery that is favorable for viral replication

  19. DIAGNOSTIC VALUE OF THE DEJA VU PHENOMENON IN THE CLINICAL PICTURE OF GLIAL BRAIN TUMORS

    Directory of Open Access Journals (Sweden)

    Pavel Nikolaevich Vlasov

    2009-01-01

    This investigation was undertaken to study the implication of the DV phenomenon in the clinical picture of glial brain tumors (GBT. One hundred and sixty-one subjects (mean age 29,2±6,4 years; males 47%, including 129 healthy individuals and 32 patients with GBT, were examined. In the clinical picture of GBT with seizures, DV is a common symptom that is encountered in the involvement of predominantly the right temporal lobe and accompanied by generalized convulsive attacks and olfactory hallucinations. DV in GBT occurs more than once daily; its duration is a few (as many as 5 minutes; DV is characterized by a negative emotional tinge and attended by fear

  20. Comparison of injection pain caused by the DentalVibe Injection System versus a traditional syringe for inferior alveolar nerve block anaesthesia in paediatric patients.

    Science.gov (United States)

    Elbay, M; Şermet Elbay, Ü; Yıldırım, S; Uğurluel, C; Kaya, C; Baydemir, C

    2015-06-01

    To compare paediatric patients' pain during needle insertion and injection in inferior alveoler nerve block (IANB) anaesthesia injected by either a traditional syringe (TS) or the DentalVibe Injection Comfort System (DV). the study was a randomised controlled crossover clinical trial, comprised of 60 children aged 6-12 requiring an operative procedure with IANB anaesthesia on their mandibular molars bilaterally. One of the molar teeth was treated with TS and the contralateral tooth was treated with DV. On each visit, subjective and objective pain was evaluated using the Wond-Baker Faces Pain Rating Scale (PRS) and the Face, Legg, Cry, Consolability Scale (FLACC Scale). Patients were asked which anaesthesia technique they preferred. Data were analysed using Wilcoxon signed rank, Spearman correlation, and Mann-Whitney U tests. There were no statistically significant differences for pain evalution during needle insertion and injection of each injection system. However, a negative correlation was found on the FLACC between age and pain scores during injection after using DV. Paediatric patients experienced similar pain during IANB anaesthesia administered with TS and DV. With increased age, pain values reduced during anaesthetic agent injection with DV according to FLACC. The traditional procedure was preferred to DV in paediatric patients.

  1. Assessing Domestic Violence Shelter Workers Views and Practices Pertaining to HIV Prevention Services for Women Residing in Domestic Violence Shelters.

    Science.gov (United States)

    Cavanaugh, Courtenay E; Harvey, Jenna; Alexander, Kamila A; Saraczewski, Samantha; Campbell, Jacquelyn C

    2018-06-01

    There is a need for studies to assess domestic violence (DV) shelter workers views about brief HIV prevention interventions for shelter residents to improve these workers' provision of HIV prevention interventions to shelter residents. This mixed methods study assessed DV shelter workers' views about the following: (a) the need for and appropriateness of HIV prevention services within DV shelters, (b) the utility (i.e., acceptability, systems support, understanding, and feasibility) of an HIV Risk Assessment and Safety Plan (HIV RASP) for women in DV shelters, and (c) suggested changes to or concerns about using the HIV RASP. Workers from DV shelters located in the 10 states in the United States with the highest rates of HIV reviewed the HIV RASP and answered survey questions about it including the Usage Rating Profile-Intervention (URP-I) Questionnaire and two open-ended questions. Although workers felt it was appropriate to provide HIV prevention interventions within DV shelters, only 23% reported that HIV prevention interventions had ever been implemented at their shelter and only 42% had provided residents with educational brochures about HIV prevention. Workers generally agreed that the HIV RASP was acceptable, understandable, and feasible. They somewhat disagreed about their ability to implement the tool independently. Findings suggest that little progress has been made in engaging DV shelter workers in HIV prevention efforts for residents during the past decade and reveal ways to improve the HIV RASP and overcome barriers to implementing it. The study findings may be used to help reduce gaps between the science and practice of HIV prevention for abused women.

  2. Performance of healthcare providers regarding iranian women experiencing physical domestic violence in Isfahan

    Directory of Open Access Journals (Sweden)

    Nasim Yousefnia

    2018-01-01

    Full Text Available Background: Domestic violence (DV can threaten women's health. Healthcare providers (HCPs may be the first to come into contact with a victim of DV. Their appropriate performance regarding a DV victim can decrease its complications. The aim of the present study was to investigate HCPs' performance regarding women experiencing DV in emergency and maternity wards of hospitals in Isfahan, Iran. Materials and Methods: The present descriptive, cross-sectional study was conducted among 300 HCPs working in emergency and maternity wards in hospitals in Isfahan. The participants were selected using quota random sampling from February to May 2016. A researcher-made questionnaire containing the five items of HCPs performance regarding DV (assessment, intervention, documentation, reference, and follow-up was used to collect data. The reliability and validity of the questionnaire were confirmed, and the collected data were analyzed using SPSS software. Cronbach's alpha was used to assess the reliability of the questionnaires. To present a general description of the data (variables, mean, and standard deviation, the table of frequencies was designed. Results: The performance of the participants regarding DV in the assessment (mean = 64.22, intervention (mean = 68.55, and reference stages (mean = 68.32 were average. However, in the documentation (mean = 72.55 and follow-up stages (mean = 23.10, their performance was good and weak respectively (criterion from 100. Conclusions: Based on the results, because of defects in providing services for women experiencing DV, a practical indigenous guideline should be provided to treat and support these women.

  3. Evolution and Analysis of Cultural and Cognitive Factors Related With Domestic Violence Against Women.

    Science.gov (United States)

    Alves, Maria João Vidal; Manita, Celina; Caldas, Inês Morais; Fernández-Martinez, Elena; Gomes da Silva, Angélica; Magalhães, Teresa

    2016-05-02

    Despite the occurrence of encouraging political and social changes in the past few years, many beliefs about women's role in intimate relationships persist, influencing their response to domestic violence (DV). This study aims to analyze the influence of recent policies against DV in Portugal, concerning particularly intimate partner violence against women and their perceptions about the victimization process. Two samples of women (n = 126 each) reporting an aggressive act allegedly perpetrated by the current or former male partner were interviewed with a hiatus of 5 years (before and after some most relevant policy updates). Results suggest a positive influence of the recent policies against DV. Many significant and encouraging changes were found in the more recent women sample (S2) relatively to the first sample (S1) regarding their information, awareness, perceptions, and attitudes toward DV. They seem to show less tolerance and endurance to DV, placing responsibility on the offender, as well as seem more empowered to report. In S2, there was a decrease in the acceptance of violent behaviors as normal and of reasons to explain violence; the fears, shame, and helplessness about DV; the elapsed time between the beginning of the abuse and its report; and the prevalence of more severe types of physical abuse. In S2, there was an increase on the acknowledgment of DV as a crime, the number of reports in cases without cohabitation, the report of psychological abuses, and the feeling of safety and assurance while reporting. © The Author(s) 2016.

  4. Proceedings of the Workshop on Mobility and Control in Challenging Environments

    Science.gov (United States)

    2007-09-20

    gyros, odometry, articulation sensing etc. Kalman Filter Predict specific force that would be observed at the cg. Compare to the support polygon Can...forces are observable. Rigid Terrain Model: Extended Kalman -Bucy Filtering for Tire Force Estimation • Sensors – x and y accelerations, yaw rate...Layer D-V V-D V-D D-V Right Down Left D-V Right V-D Strain Gauge Antenna A/D Converter • Discretizes Bridge output to 1 of 7 levels

  5. Knowledge of primary care nurses regarding domestic violence ...

    African Journals Online (AJOL)

    Knowledge of primary care nurses regarding domestic violence. ... It included also knowledge about prevalence of DV, and four main aspects relevant to DV, namely deprivation, psychological, ... schools, training courses and conferences.

  6. Incidence of Domestic Violence Against Pregnant Females After the Great East Japan Earthquake in Miyagi Prefecture: The Japan Environment and Children's Study.

    Science.gov (United States)

    Sakurai, Kasumi; Nishigori, Hidekazu; Nishigori, Toshie; Mizuno, Satoshi; Obara, Taku; Iwama, Noriyuki; Watanabe, Zen; Ishikuro, Mami; Tatsuta, Nozomi; Nishijima, Ichiko; Sugawara, Junichi; Fujiwara, Ikuma; Arima, Takahiro; Kuriyama, Shinichi; Metoki, Hirohito; Takahashi, Fumiaki; Nakai, Kunihiko; Yaegashi, Nobuo

    2017-04-01

    This study aimed to clarify the correlation between the 2011 Great East Japan Earthquake and domestic violence (DV) against pregnant females after the disaster in Miyagi Prefecture, an area damaged by the earthquake and tsunami. We analyzed 7600 pregnant females from June to December 2011. The incidence of physical and mental DV and the proportions in the inland, north coastal, and south coastal areas of Miyagi Prefecture and nationwide were calculated, and a chi-square test was conducted for comparison. The risk factors for DV were estimated with multivariate logistic regression analyses on a prefecture-wide basis. The incidence levels for physical DV were found to be 5.9% in the north coastal area, which was significantly higher than in the inland area (1.3%, P=0.0007) and nationwide (1.5%, P<0.0001). There were no significant differences in the incidence of mental DV between the 3 areas in Miyagi Prefecture (inland 15.2%, north coast 15.7%, and south coast 18.8%) or nationwide (13.8%). Experiencing disease or injury in someone close and changes in the family structure were significantly associated with mental DV in Miyagi Prefecture. Continuous monitoring and support for pregnant females may be necessary to address this issue in disaster-affected areas. (Disaster Med Public Health Preparedness. 2017;11:216-226).

  7. Associations between women's perceptions of domestic violence and contraceptive use in seven countries in West and Central Africa.

    Science.gov (United States)

    Olorunsaiye, Comfort Z; Brunner Huber, Larissa; Laditka, Sarah B; Kulkarni, Shanti; Boyd, A Suzanne

    2017-10-01

    This study examined associations of women's attitudes toward domestic violence (DV) and contraceptive use in West and Central Africa. We used data from the Multiple Indicator Cluster Surveys for women in seven countries in West and Central Africa (2009-2011, n=80,055). We measured contraceptive use as none, traditional, or modern contraceptives. DV approval was measured as no, low, or high tolerance of wife beating. Multinomial logistic regression estimated odds of using traditional or modern methods versus none, adjusting for age, education, wealth, residence, parity, marital structure, spousal age-difference, and religion. Many women had no or low DV tolerance (41%, 44%, respectively); most used no contraception (81%). In adjusted results, women with low DV tolerance had lower odds of using traditional contraceptive methods (odds ratio, OR=0.87; 95% confidence interval, CI: 0.78-0.98) or modern methods (OR=0.86; 95% CI: 0.78-0.95) compared to women with no tolerance. Women with high DV tolerance had 28% lower odds of traditional contraceptive use (95% CI: 0.60-0.90), and 38% lower odds of modern contraceptive use (95% CI: 0.59-0.88) compared to women with no tolerance. The high prevalence of DV approval may threaten the success of programs aimed at improving women's reproductive health, including contraceptive use. Copyright © 2017 Elsevier B.V. All rights reserved.

  8. The Association of Domestic Violence and Social Resources With Functioning in an Adult Trauma-Affected Sample Living in Kurdistan, Northern Iraq.

    Science.gov (United States)

    Kane, Jeremy C; Hall, Brian J; Bolton, Paul; Murray, Laura K; Mohammed Amin Ahmed, Ahmed; Bass, Judith K

    2016-03-27

    Domestic violence (DV) and other experienced trauma types increase the risk for impaired functioning. Access to social resources may provide a buffer to existing risks and allow individuals to continue and build functioning. This cross-sectional study investigated the direct effects of DV and access to social resources (perceived social support, social integration, and frequency of social contact), as well as their potential interactive effects, on daily functioning among 894 male and female trauma survivors who attended primary care clinics in Kurdistan, Iraq in 2009 and 2010. Experiencing DV was not associated with functioning for males (p=.15) or females (p=.60), suggesting that in the context of a trauma-affected sample, the experience of DV may not significantly increase the risk for functional impairment. Greater amounts of social integration were associated with less functional impairment among males (p<.01) and females (p<.05); social integration was associated with less functional impairment among males only (p<.01); and frequency of social contact was associated with less functional impairment among females only (p<.05), indicating that the association between social resource type and functioning differed by gender. Social resources had a stronger effect on functioning among men compared to women. Among males who experienced DV, social integration was the only social resource associated with less functional impairment (p<.01); among male trauma survivors who did not experience DV, social support was the only resource associated with less functional impairment (p<.01). Further investigation into these associations is warranted to inform intervention strategies for survivors of DV and other traumas in post-conflict settings. © The Author(s) 2016.

  9. Drought increases cowpea (Vigna unguiculata [L.] Walp.) susceptibility to cowpea severe mosaic virus (CPSMV) at early stage of infection.

    Science.gov (United States)

    Silva, Rodolpho G G; Vasconcelos, Ilka M; Martins, Thiago F; Varela, Anna L N; Souza, Pedro F N; Lobo, Ana K M; Silva, Fredy D A; Silveira, Joaquim A G; Oliveira, Jose T A

    2016-12-01

    The physiological and biochemical responses of a drought tolerant, virus-susceptible cowpea genotype exposed to drought stress (D), infected by Cowpea severe mosaic virus (CPSMV) (V), and to these two combined stresses (DV), at 2 and 6 days post viral inoculation (DPI), were evaluated. Gas exchange parameters (net photosynthesis, transpiration rate, stomatal conductance, and internal CO 2 partial pressure) were reduced in D and DV at 2 and 6 DPI compared to control plants (C). Photosynthesis was reduced by stomatal and biochemical limitations. Water use efficiency increased at 2 DPI in D, DV, and V, but at 6 DPI only in D and DV compared to C. Photochemical parameters (effective quantum efficiency of photosystem II and electron transport rate) decreased in D and DV compared to C, especially at 6 DPI. The potential quantum efficiency of photosystem II did not change, indicating reversible photoinhibition of photosystem II. In DV, catalase decreased at 2 and 6 DPI, ascorbate peroxidase increased at 2 DPI, but decreased at 6 DPI. Hydrogen peroxide increased at 2 and 6 DPI. Peroxidase increased at 6 DPI and chitinase at 2 and 6 DPI. β-1,3-glucanase decreased in DV at 6 DPI compared to V. Drought increased cowpea susceptibility to CPSMV at 2 DPI, as verified by RT-PCR. However, at 6 DPI, the cowpea plants overcome this effect. Likewise, CPSMV increased the negative effects of drought at 2 DPI, but not at 6 DPI. It was concluded that the responses to combined stresses are not additive and cannot be extrapolated from the study of individual stresses. Copyright © 2016 Elsevier Masson SAS. All rights reserved.

  10. Comparative mapping of powdery mildew resistance gene Pm21 and functional characterization of resistance-related genes in wheat.

    Science.gov (United States)

    He, Huagang; Zhu, Shanying; Jiang, Zhengning; Ji, Yaoyong; Wang, Feng; Zhao, Renhui; Bie, Tongde

    2016-04-01

    The powdery mildew resistance gene Pm21 was physically and comparatively mapped by newly developed markers. Seven candidate genes were verified to be required for Pm21 -mediated resistance to wheat powdery mildew. Pm21, a gene derived from wheat wild relative Dasypyrum villosum, has been transferred into common wheat and widely utilized in wheat resistance breeding for powdery mildew. Previously, Pm21 has been located to the bin FL0.45-0.58 of 6VS by using deletion stocks. However, its fine mapping is still a hard work. In the present study, 30 gene-derived 6VS-specific markers were obtained based on the collinearity among genomes of Brachypodium distachyon, Oryza and Triticeae, and then physically and comparatively mapped in the bin FL0.45-0.58 and its nearby chromosome region. According to the maps, the bin FL0.45-0.58 carrying Pm21 was closely flanked by the markers 6VS-03 and 6VS-23, which further narrowed the orthologous regions to 1.06 Mb in Brachypodium and 1.38 Mb in rice, respectively. Among the conserved genes shared by Brachypodium and rice, four serine/threonine protein kinase genes (DvMPK1, DvMLPK, DvUPK and DvPSYR1), one protein phosphatase gene (DvPP2C) and two transcription factor genes (DvGATA and DvWHY) were confirmed to be required for Pm21-mediated resistance to wheat powdery mildew by barley stripe mosaic virus-induced gene silencing (BSMV-VIGS) and transcriptional pattern analyses. In summary, this study gives new insights into the genetic basis of the Pm21 locus and the disease resistance pathways mediated by Pm21.

  11. Polydeoxyribonucleotides and nitric oxide release from guinea-pig hearts during ischaemia and reperfusion.

    Science.gov (United States)

    Masini, E.; Lupini, M.; Mugnai, L.; Raspanti, S.; Mannaioni, P. F.

    1995-01-01

    1. Two polydeoxyribonucleotides, produced by the controlled hydrolysis of DNA of mammalian lung (defibrotide and its lower molecular weight fraction, P.O. 085 DV), were studied for their ability to modify the release of nitrite and the coronary flow in perfusates collected from isolated, normally perfused hearts of guinea-pigs and from hearts subjected to regional ischaemia and reperfusion. 2. In guinea-pig normally perfused hearts, both defibrotide (DFT) and its fraction, P.O. 085 DV, increase the amount of nitrite appearing in perfusates in a concentration-dependent fashion. At the highest concentration studied (10(-6) M), P.O. 085 DV was more effective than DFT. A concomitant increase in the coronary flow was observed. 3. The increase in nitrite in perfusates and the increase in coronary flow induced by both DFT and P.O. 085 DV were significantly reduced by NG-monomethyl-L-arginine (L-NMMA, 10(-4) M), an inhibitor of nitric oxide synthase (NOS). 4. The endothelium-dependent vasodilator, acetylcholine (ACh), enhances the formation of nitrite and the coronary flow. Both the increase in coronary flow and in the formation of nitrite were significantly reduced by L-NMMA (10(-4) M). 5. In guinea-pig hearts subjected to ischaemia and reperfusion, the effect of both compounds in increasing the amount of nitrite in perfusates was more evident and more pronounced with P.O. 085 DV. 6. Reperfusion-induced arrhythmias were significantly reduced by both compounds to the extent of complete protection afforded by compound P.O. 085 DV. 7. The cardioprotective and antiarrhythmic effects of DFT and P.O. 085 DV are discussed. PMID:7582482

  12. Canine distemper virus isolated from a monkey efficiently replicates on Vero cells expressing non-human primate SLAM receptors but not human SLAM receptor.

    Science.gov (United States)

    Feng, Na; Liu, Yuxiu; Wang, Jianzhong; Xu, Weiwei; Li, Tiansong; Wang, Tiecheng; Wang, Lei; Yu, Yicong; Wang, Hualei; Zhao, Yongkun; Yang, Songtao; Gao, Yuwei; Hu, Guixue; Xia, Xianzhu

    2016-08-02

    In 2008, an outbreak of canine distemper virus (CDV) infection in monkeys was reported in China. We isolated CDV strain (subsequently named Monkey-BJ01-DV) from lung tissue obtained from a rhesus monkey that died in this outbreak. We evaluated the ability of this virus on Vero cells expressing SLAM receptors from dog, monkey and human origin, and analyzed the H gene of Monkey-BJ01-DV with other strains. The Monkey-BJ01-DV isolate replicated to the highest titer on Vero cells expressing dog-origin SLAM (10(5.2±0.2) TCID50/ml) and monkey-origin SLAM (10(5.4±0.1) TCID50/ml), but achieved markedly lower titers on human-origin SLAM cells (10(3.3±0.3) TCID50/ml). Phylogenetic analysis of the full-length H gene showed that Monkey-BJ01-DV was highly related to other CDV strains obtained during recent CDV epidemics among species of the Canidae family in China, and these Monkey strains CDV (Monkey-BJ01-DV, CYN07-dV, Monkey-KM-01) possessed a number of amino acid specific substitutions (E276V, Q392R, D435Y and I542F) compared to the H protein of CDV epidemic in other animals at the same period. Our results suggested that the monkey origin-CDV-H protein could possess specific substitutions to adapt to the new host. Monkey-BJ01-DV can efficiently use monkey- and dog-origin SLAM to infect and replicate in host cells, but further adaptation may be required for efficient replication in host cells expressing the human SLAM receptor.

  13. Normalization in quantitative [18F]FDG PET imaging: the 'body surface area' may be a volume

    International Nuclear Information System (INIS)

    Laffon, Eric; Suarez, Kleydis; Berthoumieu, Yannick; Ducassou, Dominique; Marthan, Roger

    2006-01-01

    Non-invasive methods for quantifying [ 18 F]FDG uptake in tumours often require normalization to either body weight or body surface area (BSA), as a surrogate for [ 18 F]FDG distribution volume (DV). Whereas three dimensions are involved in DV and weight (assuming that weight is proportional to volume), only two dimensions are obviously involved in BSA. However, a fractal geometry interpretation, related to an allometric scaling, suggests that the so-called 'body surface area' may stand for DV. (note)

  14. Domestic violence on pregnant women in Abuja, Nigeria.

    Science.gov (United States)

    Efetie, E R; Salami, H A

    2007-05-01

    Violence against women is a human rights violation, which is increasingly becoming a serious public health issue. When it occurs in pregnant women, victims are recognised to be at higher risk of complications of pregnancy. A cross-sectional questionnaire survey was carried out over a 3-month period from May to July 2005 to document the prevalence, knowledge and perception of domestic violence (DV) on pregnant women attending the antenatal clinic of the National Hospital, Abuja, Nigeria. The mean age of the respondents was 31.5 +/- 4.25 years, with a range of 20 - 42 years. Most (85.2%) had attained tertiary education. While most (92.9%) were aware of DV in pregnancy, 125 women (37.4%) had experienced DV. Psychological abuse ranked highest with 66.4%, while physical and sexual abuse accounted for 23.4% and 10.2% of the group. Of this group, 21.2% required medical treatment as a result of DV, and all were aware of possible pregnancy complications, such as abortion, premature labour and depression. Most (81.9%) of the respondents felt DV was illegal. A majority (29.7%) kept their DV secret with a few numbers reporting to family, doctors, clergy or close friends. With higher educational status, the experience of DV was greater, although this was not statistically significant (p > 0.05). Similarly with increasing parity, although this tended to reverse after parity of 3. The prevalence of DV found in Abuja, the centrally located capital city of Nigeria is higher than that from the study in Zaria, northern Nigeria (28%). This is cause for concern, and points to a rising trend in the northern region of the country although the centres are different. Similarly, the husband/spouse was the most common offender; responsible here for 74.2% of cases. This may give justification to recent calls for paternal educational classes for spouses. Increasing public awareness remains the key, through education and public enlightenment campaigns, with more emphasis on the identified

  15. Non-canonical dorsoventral patterning in the moth midge Clogmia albipunctata

    Directory of Open Access Journals (Sweden)

    Karl R. Wotton

    2017-11-01

    Full Text Available Abstract Background Bone morphogenetic proteins (BMPs are of central importance for dorsal–ventral (DV axis specification. They are core components of a signalling cascade that includes the BMP ligand decapentaplegic (DPP and its antagonist short gastrulation (SOG in Drosophila melanogaster. These components are very ancient, with orthologs involved in DV patterning in both protostomes and deuterostomes. Despite such strong conservation, recent comparative work in insects has revealed interesting differences in the way the patterning function of the DV system is achieved in different species. Results In this paper, we characterise the expression patterns of the principal components of the BMP DV patterning system, as well as its signalling outputs and downstream targets, in the non-cyclorrhaphan moth midge Clogmia albipunctata (Diptera: Psychodidae. We previously reported ventral expression patterns of dpp in the pole regions of C. albipunctata blastoderm embryos. Strikingly, we also find ventral sog and posteriorly restricted tkv expression, as well as expanded polar activity of pMad. We use our results from gene knock-down by embryonic RNA interference to propose a mechanism of polar morphogen shuttling in C. albipunctata. We compare these results to available data from other species and discuss scenarios for the evolution of DV signalling in the holometabolan insects. Conclusions A comparison of gene expression patterns across hemipteran and holometabolan insects reveals that expression of upstream signalling factors in the DV system is very variable, while signalling output is highly conserved. This has two major implications: first, as long as ligand shuttling and other upstream regulatory mechanisms lead to an appropriately localised activation of BMP signalling at the dorsal midline, it is of less importance exactly where the upstream components of the DV system are expressed. This, in turn, explains why the early-acting components of

  16. Maternal and child health nurse screening and care for mothers experiencing domestic violence (MOVE): a cluster randomised trial.

    Science.gov (United States)

    Taft, Angela J; Hooker, Leesa; Humphreys, Cathy; Hegarty, Kelsey; Walter, Ruby; Adams, Catina; Agius, Paul; Small, Rhonda

    2015-06-25

    Mothers are at risk of domestic violence (DV) and its harmful consequences postpartum. There is no evidence to date for sustainability of DV screening in primary care settings. We aimed to test whether a theory-informed, maternal and child health (MCH) nurse-designed model increased and sustained DV screening, disclosure, safety planning and referrals compared with usual care. Cluster randomised controlled trial of 12 month MCH DV screening and care intervention with 24 month follow-up. The study was set in community-based MCH nurse teams (91 centres, 163 nurses) in north-west Melbourne, Australia. Eight eligible teams were recruited. Team randomisation occurred at a public meeting using opaque envelopes. Teams were unable to be blinded. The intervention was informed by Normalisation Process Theory, the nurse-designed good practice model incorporated nurse mentors, strengthened relationships with DV services, nurse safety, a self-completion maternal health screening checklist at three or four month consultations and DV clinical guidelines. Usual care involved government mandated face-to-face DV screening at four weeks postpartum and follow-up as required. Primary outcomes were MCH team screening, disclosure, safety planning and referral rates from routine government data and a postal survey sent to 10,472 women with babies ≤ 12 months in study areas. Secondary outcomes included DV prevalence (Composite Abuse Scale, CAS) and harm measures (postal survey). No significant differences were found in routine screening at four months (IG 2,330/6,381 consultations (36.5 %) versus CG 1,792/7,638 consultations (23.5 %), RR = 1.56 CI 0.96-2.52) but data from maternal health checklists (n = 2,771) at three month IG consultations showed average screening rates of 63.1 %. Two years post-intervention, IG safety planning rates had increased from three (RR 2.95, CI 1.11-7.82) to four times those of CG (RR 4.22 CI 1.64-10.9). Referrals remained low in both intervention groups (IGs

  17. Perpetration of gross human rights violations in South Africa ...

    African Journals Online (AJOL)

    ... rights violations, purposeful injury, accidental injury and domestic violence. ... Socio-demographic profiles of perpetrators of HRV and DV in South Africa differ. ... is possible that some HRV and DV perpetrators were themselves once victims.

  18. Rozvod v 21. století

    OpenAIRE

    Tučková, Markéta

    2013-01-01

    This bachelor thesis deals with divorce and the history of divorce situation till the beginning of the 21st century. It describes the essential divorce problem areas, lists both negative and positive divorce consequences, specific effects of divorce on children, historical evolvement of legal regulations of divorce and their present-day form and current development trends in the Czech Republic. Empirical part of the thesis analyses opinion shifts on family and divorce in Czech population betw...

  19. Dicty_cDB: Contig-U07003-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available aegypti infected with Brugia Mal... 50 0.090 1 ( DV278108 ) NAAF224TF Aedes aegypti - Fat Bodies Normalized ...(... 50 0.090 1 ( DV276715 ) NAAHF49TR Aedes aegypti - Fat Bodies Normalized (...

  20. Domestic Violence in the Canadian Workplace: Are Coworkers Aware?

    Directory of Open Access Journals (Sweden)

    Jennifer C.D. MacGregor

    2016-09-01

    Conclusion: Our findings have implications for a coordinated workplace response to DV. Further research is urgently needed to examine how best to address DV in the workplace and improve outcomes for victims, perpetrators, and their coworkers.

  1. Temporal Variability in Seismic Velocity at the Salton Sea Geothermal Field

    Science.gov (United States)

    Taira, T.; Nayak, A.; Brenguier, F.

    2015-12-01

    We characterize the temporal variability of ambient noise wavefield and search for velocity changes associated with activities of the geothermal energy development at the Salton Sea Geothermal Field. The noise cross-correlations (NCFs) are computed for ~6 years of continuous three-component seismic data (December 2007 through January 2014) collected at 8 sites from the CalEnergy Subnetwork (EN network) with MSNoise software (Lecocq et al., 2014, SRL). All seismic data are downloaded from the Southern California Earthquake Data Center. Velocity changes (dv/v) are obtained by measuring time delay between 5-day stacks of NCFs and the reference NCF (average over the entire 6 year period). The time history of dv/v is determined by averaging dv/v measurements over all station/channel pairs (252 combinations). Our preliminary dv/v measurement suggests a gradual increase in dv/v over the 6-year period in a frequency range of 0.5-8.0 Hz. The resultant increase rate of velocity is about 0.01%/year. We also explore the frequency-dependent velocity change at the 5 different frequency bands (0.5-2.0 Hz, 0.75-3.0 Hz, 1.0-4.0 Hz, 1.5-6.0 Hz, and 2.0-8.0 Hz) and find that the level of this long-term dv/v variability is increased with increase of frequency (i.e., the highest increase rate of ~0.15%/year at the 0.5-2.0 Hz band). This result suggests that the velocity changes were mostly occurred in a depth of ~500 m assuming that the coda parts of NCFs (~10-40 s depending on station distances) are predominantly composed of scattered surface waves, with the SoCal velocity model (Dreger and Helmberger, 1993, JGR). No clear seasonal variation of dv/v is observed in the frequency band of 0.5-8.0 Hz.

  2. The impact of domestic violence exposure on South Asian children in the United States: Perspectives of domestic violence agency staff.

    Science.gov (United States)

    Ragavan, Maya I; Fikre, Tsion; Millner, Uma; Bair-Merritt, Megan

    2018-02-01

    The South Asian community is the fastest growing ethnic group in the United States, and past research suggests that South Asian domestic violence (DV) survivors may require culturally-specific resources. Similarly, South Asian children in the US exposed to DV may have unique responses and needs, but this has not been explored to date. The objective of this study was to examine the specific needs of South Asian children exposed to DV from the vantage point of staff from South Asian DV agencies across the United States. Thirty interviews were conducted, with data coded and consolidated into larger themes using thematic analysis. Participants described several factors important to understanding the impact of DV on South Asian children including the role of the extended family, identifying with two cultures, fear about what the South Asian community will think, gender differences, and the importance of projecting an image of perfection. Participants also discussed development of culturally-tailored resources. This study suggests the importance of framing South Asian children's experiences within the context of interweaving South Asian and American cultural values, with careful attention paid to how potential culture clashes between parents and children may impact the way children process trauma. Further work should triangulate these themes with children, parents, and extended family, as well as collaborate with South Asian DV agencies to design child-focused programs. Copyright © 2017 Elsevier Ltd. All rights reserved.

  3. Geometric and electronic structures of mono- and di-vacancies in phosphorene.

    Science.gov (United States)

    Hu, Ting; Dong, Jinming

    2015-02-13

    The geometric structures, stabilities and diffusions of the monovacancy (MV) and divacancy (DV) in two-dimensional phosphorene, as well as their influences on their vibrational and electronic properties have been studied by first-principles calculations. Two possible MVs and 14 possible DVs have been found in phosphorene, in which the MV-(5|9) with a pair of pentagon-nonagon is the ground state of MVs, and the DV-(5|8|5) with a pentagon-octagon-pentagon structure is the most stable DV. All 14 DVs could be divided into four basic types based upon their topological structures and transform between different configurations via bond rotations. The diffusion of MV-(5|9) is found to exhibit an anisotropic character, preferring to migrate along the zigzag direction in the same half-layer. The introduction of MV and DV in phosphorene influences its vibrational properties, inducing the localized defect modes, which could be used to distinguish different vacancy structures. The MVs and DVs also have a significant influence on the electronic properties of phosphorene. It is found that the phosphorene with MV-(5|9) is a ferromagnetic semiconductor with the magnetic moment of 1.0 μB and a band gap of about 0.211 eV, while the DV induces a direct-indirect band gap transition. Our calculation results on the MV and DV in phosphorene are important for the promising application of the phosphorene in the nanoelectronics.

  4. Dengue and dengue haemorrhagic fever: Indian perspective

    Indian Academy of Sciences (India)

    PRAKASH KUMAR

    ). They are transmitted mainly by the Aedes aegypti mosquito and also by Aedes albopictus. Biologically, DV are highly adapted to the mosquito and are maintained by vertical transmission. DV produces from a subclinical infection to a mild ...

  5. Psychometric testing of inventory of beliefs and attitudes on domestic violence.

    Science.gov (United States)

    Hutchinson, Marie; Doran, Frances

    2017-06-22

    Background Domestic violence (DV) is an international public health issue associated with adverse health outcomes for adults and children. There have been widespread calls to increase nurses' capacity to respond to DV and improve undergraduate nursing education in this area. However, there are few valid, reliable and contemporary measures of nursing attitudes towards and beliefs concerning DV that are suited for use in evaluating education programmes. Aim To establish the psychometric properties of a newly developed inventory designed to measure nursing students' beliefs about and attitudes towards DV. Discussion Exploratory factor analysis identified five factors, with a Cronbach's alpha of 0.646. The few factors loading>.80 suggest that the instrument has good discriminate validity. The absence of cross-loadings indicate good convergent validity. Conclusion The inventory provides one of the first validated and reliable measures for examining undergraduate nursing students' attitudes towards and beliefs about DV. Implications for practice The instrument is suited for use by nurse educators in assessing the influence of curriculum design and teaching strategies on student beliefs and attitudes. It would also be useful in studies investigating nurses' clinical practice on domestic violence.

  6. Lethal canine distemper virus outbreak in cynomolgus monkeys in Japan in 2008.

    Science.gov (United States)

    Sakai, Kouji; Nagata, Noriyo; Ami, Yasushi; Seki, Fumio; Suzaki, Yuriko; Iwata-Yoshikawa, Naoko; Suzuki, Tadaki; Fukushi, Shuetsu; Mizutani, Tetsuya; Yoshikawa, Tomoki; Otsuki, Noriyuki; Kurane, Ichiro; Komase, Katsuhiro; Yamaguchi, Ryoji; Hasegawa, Hideki; Saijo, Masayuki; Takeda, Makoto; Morikawa, Shigeru

    2013-01-01

    Canine distemper virus (CDV) has recently expanded its host range to nonhuman primates. A large CDV outbreak occurred in rhesus monkeys at a breeding farm in Guangxi Province, China, in 2006, followed by another outbreak in rhesus monkeys at an animal center in Beijing in 2008. In 2008 in Japan, a CDV outbreak also occurred in cynomolgus monkeys imported from China. In that outbreak, 46 monkeys died from severe pneumonia during a quarantine period. A CDV strain (CYN07-dV) was isolated in Vero cells expressing dog signaling lymphocyte activation molecule (SLAM). Phylogenic analysis showed that CYN07-dV was closely related to the recent CDV outbreaks in China, suggesting continuing chains of CDV infection in monkeys. In vitro, CYN07-dV uses macaca SLAM and macaca nectin4 as receptors as efficiently as dog SLAM and dog nectin4, respectively. CYN07-dV showed high virulence in experimentally infected cynomolgus monkeys and excreted progeny viruses in oral fluid and feces. These data revealed that some of the CDV strains, like CYN07-dV, have the potential to cause acute systemic infection in monkeys.

  7. Theoretical study of relativistic effects in the electronic structure and chemical bonding of UF6

    International Nuclear Information System (INIS)

    Onoe, Jun; Takeuchi, Kazuo; Sekine, Rika; Nakamatsu, Hirohide; Mukoyama, Takeshi; Adachi, Hirohiko.

    1992-01-01

    We have performed the relativistic molecular orbital calculation for the ground state of UF 6 , using the discrete-variational Dirac-Slater method (DV-DS), in order to elucidate the relativistic effects in the electronic structure and chemical bonding. Compared with the electronic structure calculated by the non-relativistic Hartree-Fock-Slater (DV-X α )MO method, not only the direct relativistic effects (spin-orbit splitting etc), but also the indirect effect due to the change in screening core potential charge are shown to be important in the MO level structure. From the U-F bond overlap population analysis, we found that the U-F bond formation can be explained only by the DV-DS, not by the DV-X α . The calculated electronic structure in valence energy region (-20-OeV) and excitation energies in UV region are in agreement with experiments. (author)

  8. Static Aeroelastic Effects on High Performance Aircraft

    Science.gov (United States)

    1987-06-01

    davis la rffrence 9. L’avion est instrurnent6, en plus des capteurs classiques des param~tres de n~ca- nique du vol. de plusleurs centaines de jauges de...crites §2.3.5, et lensemble dv l’analyse, pernet- tent le calcul des r~ponues des jauges en fonction dv X soit ar ( X) , lv procesnus de d~rivation...travissonique. Rema rque La smine technique d’identification par rtponne dv jauges s’applique (plus simple- ment) sur len essais en soufflerie, pour la

  9. Decidual vasculopathy in preeclampsia: Lesion characteristics relate to disease severity and perinatal outcome

    NARCIS (Netherlands)

    Stevens, D.U.; Al-Nasiry, S.; Bulten, J.; Spaanderman, M.E.A.

    2013-01-01

    OBJECTIVE: In a proportion of patients with preeclampsia, unremodeled spiral arteries develop additional pathological changes, termed decidual vasculopathy (DV), or acute atherosis. DV has been correlated to adverse clinical outcome and increased placental pathology. However, it was unclear whether

  10. to view fulltext PDF

    Indian Academy of Sciences (India)

    cases the cross-correlation signal takes advantage of the different probes ..... correlation analysis are found to be quite competitive with other cosmological probes .... survey, it is possible to achieve the fiducial value δDV/DV = 2.0% from the ...

  11. Development of a Dating Violence Assessment Tool for Late Adolescence Across Three Countries : The Violence in Adolescents' Dating Relationships Inventory (VADRI)

    NARCIS (Netherlands)

    Aizpitarte, Alazne; Alonso-Arbiol, Itziar; Van de Vijver, Fons J. R.; Perdomo, Maria Cristina; Andres Galvez-Sobral, J.; Garcia-Lopez, Eric

    2017-01-01

    Accurate assessment of dating violence (DV) is crucial for evaluation and intervention planning. However, extant self-report measurement tools of DV do not adequately consider age-, generation-, and culture-specific issues, which are essential for its accurate conceptualization. To address these

  12. The Rise of Flowering Plants and Land Surface Physics: The Cretaceous and Eocene Were Different

    Science.gov (United States)

    Upchurch, G. R.; Feild, T.

    2010-12-01

    The Cretaceous and Eocene have served as the poster children of past greenhouse climates. One difference between the two time periods is that angiosperms (flowering plants) underwent a major diversification and rise to dominance during the mid-Cretaceous to Paleocene. Flowering plants differ from all other living and fossil plants in having significantly higher rates of transpiration and photosynthesis, which in modern leaves correlate with the density of venation (Dv), a feature that can be measured directly from fossils. This increase in Dv, coupled with an increase in the abundance of angiosperms, is thought to have had major impact on the climate system. This is, in part, because transpiration plays an important role in determining the ratio of sensible to latent heat flux from the land surface and in determining precipitation rate in regions such as the equatorial rainforest. Analysis of Dv in fossil leaves indicates two phases of increase in transpiration rate for angiosperms during the Cretaceous-Paleocene. The oldest known angiosperms (Aptian-early Albian) have a low Dv characteristic of extant and fossil ferns and gymnosperms. At this time angiosperms are low-stature plants of minor importance in terms of relative abundance and diversity (ferns, and maximum Dv reaches levels characteristic of many trees from the temperate zone. This first phase coincides with the first local dominance of angiosperms, the first occurrence of moderate to large angiosperm trees (up to 1 m in diameter) , and the first common occurrence of angiosperms in the Arctic. The second phase of Dv increase occurs during the Maastrichtian to Paleocene, where average Dv reaches levels characteristic of modern tropical forests and maximum Dv reaches the level found in highly productive modern vegetation. This second phase coincides with the rise to dominance of angiosperms in regional vegetation, a corresponding decline of conifers and ferns, and the modernization of hydraulic architecture

  13. Comparison of domestic violence against women in urban versus rural areas of southeast Nigeria

    Directory of Open Access Journals (Sweden)

    Ajah LO

    2014-10-01

    Full Text Available Leonard Ogbonna Ajah,1,2 Chukwuemeka Anthony Iyoke,1 Peter Onubiwe Nkwo,1 Boniface Nwakoby,3 Paul Ezeonu2 1Department of Obstetrics and Gynaecology, University of Nigeria Teaching Hospital, Enugu, Nigeria; 2Department of Obstetrics and Gynaecology, Federal Teaching Hospital, Abakaliki, Ebonyi State, Nigeria; 3Department of Community Medicine, University of Nigeria Teaching Hospital, Ituku-Ozalla, Enugu, Nigeria Background: The perception and prevalence of domestic violence (DV in rural areas is poorly understood; the result is that most efforts at eradicating this harmful practice are concentrated in urban areas. The objective of the study was to compare the burden and perception of DV among women living in rural and urban Igbo communities of southeast Nigeria. Methods: This was a comparative, cross-sectional study of women residing in rural and urban communities in Enugu, Nigeria, who had gathered for an annual religious meeting from August 1–7, 2011. Data analysis involved descriptive and inferential statistics and was conducted with the Statistical Package for Social Sciences, software version 17.0, at a 95% level of confidence. Results: A total of 836 women who met the eligibility criteria participated in the survey. Of these, 376 were from Okpanku, a rural community, while 460 were from Ogui Nike, an urban community. The prevalence of DV among rural women was significantly higher than that among urban women (97% versus 81%, P<0.001. In particular, the prevalence of physical violence was significantly higher among rural women than among urban women (37.2% versus 23.5%; P=0.05. In contrast, rural and urban women did not differ significantly in the proportions that had experienced psychological or sexual violence. The proportion of women who believed that DV was excusable was significantly higher among rural dwellers than among urban dwellers (58.5% versus 29.6%; P=0.03. Conclusion: The burden of DV against women may be higher in rural

  14. Dicty_cDB: Contig-U05658-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available ted with Brugia Mala... 44 2.4 1 ( DV286265 ) NAAI621TR Aedes aegypti - Fat Bodie...s Normalized (... 44 2.4 1 ( DV286264 ) NAAI621TF Aedes aegypti - Fat Bodies Normalized (... 44 2.4 1 ( CP00

  15. Experience of domestic violence and acceptance of intimate partner violence among out-of-school adolescent girls in Iwaya Community, Lagos State.

    Science.gov (United States)

    Kunnuji, Michael O N

    2015-02-01

    Gender-based domestic violence (DV) comes at great costs to the victims and society at large. Yet, many women hold the view that intimate partner violence (IPV) against women is appropriate behavior. This study aimed at exploring the nexus of experience of different forms of DV and acceptance of IPV as appropriate behavior. Using data from a survey of 480 out-of-school adolescent girls, the researcher shows that psychological abuse is a significant predictor of approval of DV resulting from the wife's failure to make food available for her husband with victims of abuse approving of violence against women. Conversely, victims of sexual abuse, more than nonvictims, disapproved of wife beating resulting from the wife going out without informing the husband. The implications of the findings are discussed and the study recommends deconstructing women's negative beliefs upon which DV rests. © The Author(s) 2014.

  16. Air quality Performance of Ductless Personalized Ventilation in Conjunction with Displacement Ventilation: Impact of Walking Person

    DEFF Research Database (Denmark)

    Bolashikov, Zhecho Dimitrov; Lu, Pengfei; Melikov, Arsen Krikor

    2015-01-01

    The present experiment evaluates the impact of air disturbances from a walking person on inhaled air by ductless personalized ventilation (DPV) with displacement ventilation (DV), when a seated occupant is the source of pollution: bio-effluents and exhaled air. The measurements took place in a full...... and the DV supply. Pollution from feet and exhaled air by one manikin was simulated with tracer gases. Room temperature of 26 °C and 90 L/s DV supply flow rate were kept constant. Measurements under numerous combinations of DPV operation modes and supply flow rates were performed. Tracer gas concentrations...

  17. Domestic Violence Counseling in Rural Northern China: Gender, Social Harmony, and Human Rights.

    Science.gov (United States)

    Xie, Lijia; Eyre, Stephen L; Barker, Judith

    2018-03-01

    Domestic violence (DV) affects over a third of Chinese women in a relationship. Focusing on ethnographic data from six staff members and six DV survivors at a rural, state-affiliated women's center in China in 2010, this article relies on Henrietta Moore's notion of the poststructuralist gendered subject to examine how the staff draw on discourses about gender and social harmony in persuading women to stay in their marriages, rather than on human rights discourses that emphasize survivor safety. It shows that DV survivors are frequently sent back to dangerous homes where their health is placed at risk.

  18. Greater commitment to the domestic violence training is required.

    Science.gov (United States)

    Leppäkoski, Tuija Helena; Flinck, Aune; Paavilainen, Eija

    2015-05-01

    Domestic violence (DV) is a major public health problem with high health and social costs. A solution to this multi-faceted problem requires that various help providers work together in an effective and optimal manner when dealing with different parties of DV. The objective of our research and development project (2008-2013) was to improve the preparedness of the social and healthcare professionals to manage DV. This article focuses on the evaluation of interprofessional education (IPE) to provide knowledge and skills for identifying and intervening in DV and to improve collaboration among social and health care professionals and other help providers at the local and regional level. The evaluation data were carried out with an internal evaluation. The evaluation data were collected from the participants orally and in the written form. The participants were satisfied with the content of the IPE programme itself and the teaching methods used. Participation in the training sessions could have been more active. Moreover, some of the people who had enrolled for the trainings could not attend all of them. IPE is a valuable way to develop intervening in DV. However, greater commitment to the training is required from not only the participants and their superiors but also from trustees.

  19. Relative accretion of /sup 99m/Tc-polyphosphate by forming and resorbing bone systems in rats: its significance in the pathologic basis of bone scanning

    International Nuclear Information System (INIS)

    Garcia, D.A.; Tow, D.E.; Kapur, K.K.; Wells, H.

    1976-01-01

    The relative roles of osteogenesis and osteolysis in the production of positive radionuclide images of skeletal lesions were investigated. The uptake of /sup 99m/Tc-polyphosphate (Tc-PP) by each process was measured in an animal model that permitted bone formation and resorption to be studied independently. Ten rats received intramuscular implants of bone-forming demineralized matrix (DM) and resorbing devitalized bone (DV). Radiographs and Tc-PP scintiscans were made each week thereafter. At 6 to 10 weeks, the implants and normal bone samples were removed, counted for /sup 99m/Tc, and examined histologically. The uptake of Tc-PP by DM implants was first detected on images made 3 weeks after implantation, and by DV implants, 1 to 2 weeks later. Serial radiography showed progressive calcification of DM and resorption of DV implants. Microscopic examinations of undecalcified sections, stained with a modified Goldner preparation, revealed vital-bone formation in the DM implants and osteoclastic resorption in the DV. Activity counts per gram of DM and DV implants were, respectively, 200 percent and 90 percent that of normal bone. Since only the bone-forming system (DM) accumulated Tc-PP at greater than normal concentrations, this study indicates that positive bone images of osteolytic lesions solely reflect compensatory osteogenic responses

  20. Influence of age on left ventricular performance during exercise in normal Japanese subject

    International Nuclear Information System (INIS)

    Konishi, Tokuji; Koyama, Takao; Aoki, Toshikazu; Makino, Katsutoshi; Yamamuro, Masashi; Nakai, Kyudayu; Nakamura, Masayuki; Nakano, Takeshi.

    1990-01-01

    To assess the effects of age on left ventricular performance, multistage supine ergometer exercise radionuclide ventriculography (RNV) was performed in 92 normal subjects. The subjects ranged in age from 24 to 86 years and were free of cardiopulmonary disease and diabetes. Age-related changes in exercise duration, left ventricular end-diastolic volume (LVEDV), left ventricular end-systolic volume (LVESV), cardiac output (CO) left ventricular ejection fraction (LVEF), left ventricular dv/dt, systolic and diastolic time indexes of dv/dt, and peak systolic pressure/left ventricular end-systolic volume (PSP/LVESV) were analyzed at rest and during the peak exercise stage. Age-related decrease in LVEDV and peak diastolic dv/dt were significant at rest. The time indexes of ECG R to peak systolic dv/dt and time of end-systole to peak diastolic dv/dt also were prolonged with age. Both maximum heart rate and exercise duration were shown to decline with age. No age-related difference was observed in LVESV, LVEF or PSP/LVESV either at rest or during exercise. However, the change of LVEF and LVESV during exercise was less in subjects aged 60 or more. These results indicate decreased left ventricular function during exercise in elderly subjects. (author)

  1. Determinants of domestic violence among women attending an human immunodeficiency virus voluntary counseling and testing center in Bangalore, India.

    Science.gov (United States)

    Chandrasekaran, Varalakshmi; Krupp, Karl; George, Ruja; Madhivanan, Purnima

    2007-05-01

    Violence against women is a global phenomenon that cuts across all social and economic classes. This study was designed to measure the prevalence and correlates of domestic violence (DV) among women seeking services at a voluntary counseling and testing (VCT) center in Bangalore, India. A cross-sectional survey was conducted among women visiting an human immunodeficiency virus (HIV) VCT center in Bangalore, between September and November 2005. An interviewer-administered questionnaire was used to collect information about violence and other variables. Univariable associations with DV were made using Pearson Chi-squared test for categorical variables and Student t-test or the Mann-Whitney test for continuous variables. Forty-two percent of respondents reported DV, including physical abuse (29%), psychological abuse (69%) and sexual abuse (1%). Among the women who reported violence of any kind, 67% also reported that they were HIV seropositive. The most common reasons reported for DV included financial problems (38%), husband's alcohol use (29%) and woman's HIV status (18%). Older women (P around the world. The findings highlight the need for additional training among health care providers in VCT centers in screening for DV, detection of signs of physical abuse and provisions and referrals for women suffering from domestic partner violence.

  2. Psychometric properties of a Dutch version of the Maslach Burnout Inventory General Survey (UBOS) in individuals with work-related problems

    NARCIS (Netherlands)

    Roelofs, J.; Verbraak, M.J.P.M.; Keijsers, G.P.J.; Bruin, M.B.N. de; Schmidt, A.J.M.

    2005-01-01

    Psychometric properties of the Dutch version of the Maslach Burnout Inventory General Survey, the MBI-DV, were examined in individuals with and without clinical burnout. The factor structure, the utility of the MBI-DV as a screening instrument in addition to a clinical interview for diagnosing

  3. Filtration Effects Due to Bioassay Cage Design and Screen Type

    Science.gov (United States)

    2010-01-01

    Optical Nonimaging Light- Scattering Instruments (ASTM, 2003). Droplet sizing data included volume median diam (DV50), and the 10% and 90% diam (DV10 and...optical nonimaging light-scattering instru- ments. In: Annual book of ASTM standards. West Conshohocken, PA: American Society for Testing and Materials

  4. Dicty_cDB: Contig-U16576-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 5.7 1 ( ES399554 ) MUT06-K17.y1d-s SHGC-MUT Mytilus californianus cD... 46 5.7 1 ( DV865787 ) CRP5519 Creep...ing bentgrass EST Agrostis stolonife... 46 5.7 1 ( DV860530 ) CRP262 Creeping ben

  5. Dicty_cDB: Contig-U16574-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available ( ES399554 ) MUT06-K17.y1d-s SHGC-MUT Mytilus californianus cD... 46 4.9 1 ( DV865787 ) CRP5519 Creeping ben...tgrass EST Agrostis stolonife... 46 4.9 1 ( DV860530 ) CRP262 Creeping bentgrass EST Agrostis stolonifer...

  6. Sexual and dating violence among adolescents and young adults in Chile: a review of findings from a survey of university students.

    Science.gov (United States)

    Lehrer, Jocelyn A; Lehrer, Evelyn L; Koss, Mary P

    2013-01-01

    This paper synthesises and discusses results from the 2005 Survey of Student Well-Being, a closed-ended questionnaire administered to students attending general education courses at a major public university in Santiago (n = 484 women, 466 men). The survey included questions on sexual violence (SV) and dating violence (DV), public health problems that have received little attention in Chile and other Latin-American countries. This paper highlights key findings from a series of papers based on these data, noting lessons learned in the Chilean context that may be useful for other Latin-American countries. Important gaps in the international literature on SV and DV are also discussed. A central finding is the high prevalence of SV and DV in this sample of university students, warranting further public health attention to these problems. Potentially, the findings will contribute to changes in awareness, policy and practice along similar lines to efforts that transformed the US landscape regarding SV and DV on college campuses in the 1980s.

  7. Association between domestic violence and miscarriage: a population-based cross-sectional study among women of childbearing ages, Sivas, Turkey.

    Science.gov (United States)

    Nur, Naim

    2014-01-01

    Violence against women is a global issue, with ramifications for the reproductive health of women. The current study examined the relation of domestic violence (DV) to miscarriage among women who were victimized during their last pregnancy. The study was conducted in Sivas city center, in Turkey. Associations between self-reported DV and miscarriage were analyzed using multiple regression modeling. Physical and/or sexual DV during the last pregnancy was reported by 10.0% and 6.2% of women, respectively. Women who experienced physical violence were 2.5 times as likely (Odds Ratio (OR) = 2.47, 95% confidence interval [CI]: 1.37-4.84, p = .003) to have experienced a miscarriage than women who did not report physical violence. These findings suggest that victims who experience physical violence during the last pregnancy may be more likely to experience miscarriage. Preventing DV, especially physical violence, may, therefore, be beneficial for avoiding adverse pregnancy outcomes.

  8. The Development of Point Doppler Velocimeter Data Acquisition and Processing Software

    Science.gov (United States)

    Cavone, Angelo A.

    2008-01-01

    In order to develop efficient and quiet aircraft and validate Computational Fluid Dynamic predications, aerodynamic researchers require flow parameter measurements to characterize flow fields about wind tunnel models and jet flows. A one-component Point Doppler Velocimeter (pDv), a non-intrusive, laser-based instrument, was constructed using a design/develop/test/validate/deploy approach. A primary component of the instrument is software required for system control/management and data collection/reduction. This software along with evaluation algorithms, advanced pDv from a laboratory curiosity to a production level instrument. Simultaneous pDv and pitot probe velocity measurements obtained at the centerline of a flow exiting a two-inch jet, matched within 0.4%. Flow turbulence spectra obtained with pDv and a hot-wire detected the primary and secondary harmonics with equal dynamic range produced by the fan driving the flow. Novel,hardware and software methods were developed, tested and incorporated into the system to eliminate and/or minimize error sources and improve system reliability.

  9. Understanding the hesitancy to disclose teen dating violence: Correlates of self-efficacy to deal with teen dating violence

    Directory of Open Access Journals (Sweden)

    Hébert Martine

    2014-01-01

    Full Text Available Dating violence (DV is now recognized as an important public health issue. Prevention and intervention programs are being implemented in school contexts. Such initiatives aim to raise awareness among potential victims and offenders as well as among peer bystanders and offer adequate interventions following disclosure. Yet, a major challenge remains as teenagers may not disclose their victimization or may not feel self-efficient to deal with DV if they witness such violence. As such, teen DV remains largely hidden. A representative sample of 8194 students (age 14-18 in the province of Quebec, Canada was used to explore teenagers’ self-efficacy to reach out for help or to help others in a situation of DV victimization and perpetration. Analyses are conducted to identify possible correlates of self-efficacy in terms of socio-demographic variable (sex, age and a history of child sexual abuse and dating victimization. Implications for preven­tion and support strategies are discussed.

  10. Do Three-dimensional Visualization and Three-dimensional Printing Improve Hepatic Segment Anatomy Teaching? A Randomized Controlled Study.

    Science.gov (United States)

    Kong, Xiangxue; Nie, Lanying; Zhang, Huijian; Wang, Zhanglin; Ye, Qiang; Tang, Lei; Li, Jianyi; Huang, Wenhua

    2016-01-01

    Hepatic segment anatomy is difficult for medical students to learn. Three-dimensional visualization (3DV) is a useful tool in anatomy teaching, but current models do not capture haptic qualities. However, three-dimensional printing (3DP) can produce highly accurate complex physical models. Therefore, in this study we aimed to develop a novel 3DP hepatic segment model and compare the teaching effectiveness of a 3DV model, a 3DP model, and a traditional anatomical atlas. A healthy candidate (female, 50-years old) was recruited and scanned with computed tomography. After three-dimensional (3D) reconstruction, the computed 3D images of the hepatic structures were obtained. The parenchyma model was divided into 8 hepatic segments to produce the 3DV hepatic segment model. The computed 3DP model was designed by removing the surrounding parenchyma and leaving the segmental partitions. Then, 6 experts evaluated the 3DV and 3DP models using a 5-point Likert scale. A randomized controlled trial was conducted to evaluate the educational effectiveness of these models compared with that of the traditional anatomical atlas. The 3DP model successfully displayed the hepatic segment structures with partitions. All experts agreed or strongly agreed that the 3D models provided good realism for anatomical instruction, with no significant differences between the 3DV and 3DP models in each index (p > 0.05). Additionally, the teaching effects show that the 3DV and 3DP models were significantly better than traditional anatomical atlas in the first and second examinations (p < 0.05). Between the first and second examinations, only the traditional method group had significant declines (p < 0.05). A novel 3DP hepatic segment model was successfully developed. Both the 3DV and 3DP models could improve anatomy teaching significantly. Copyright © 2015 Association of Program Directors in Surgery. Published by Elsevier Inc. All rights reserved.

  11. If You Want to Convict a Domestic Violence Batterer, List Multiple Charges in the Police Report

    Directory of Open Access Journals (Sweden)

    Eric L. Nelson

    2014-01-01

    Full Text Available Problem: Even though reforms in the past 40 years mandated police response to domestic violence (DV crime, and in many states also mandated arrest, never-the-less baseline rates of DV prosecution remain low. Background: The nature of prosecution is reviewed, noting that nearly all criminal cases are resolved through plea bargaining in state and federal cases. Thus, the nature of plea bargaining is examined from a perspective of negotiable currency. Past research demonstrates that if multiple crimes are described and listed in the first responding police officer’s written report, there is a substantially greater odds that the suspect will be prosecuted and found guilty. Those extra charges can be dropped by prosecutors in exchange for a plea of guilt. Purpose: This empirical study examines a discretionary best practices crime investigation method that can be operationalized by first responding police officers, in situ, to determine whether its use leads to a significant increase in rates of prosecution and criminal conviction for DV crime. The methodology is the choice to thoroughly investigate each DV crime to uncover concurrent and also past-but-still-chargeable crimes. This optional work is time-consuming because children, neighbors, the 911 caller, and others must be contacted and interviewed. Method: Randomly selected police reports (n = 366 were found to contain 22 combinations of crime codes listed as violations, for DV and other concurrent crimes. The reports were evaluated on a number of prosecutorial outcomes. Frequency statistics were calculated, and logistic regression was used to confirm key relationships. Results: Only one third of all submitted reports listed more than one crime. For those investigations that did lead to prosecution, 97% resolved through plea bargaining. Most single charge misdemeanor DV police reports were found to be “dead upon arrival” at the prosecutor’s office, with only 29% resulting in any type of

  12. Sex, Attribution, and Severity Influence Intervention Decisions of Informal Helpers in Domestic Violence

    Science.gov (United States)

    Chabot, Heather Frasier; Tracy, Tracy L.; Manning, Christine A.; Poisson, Chelsea A.

    2009-01-01

    Most domestic violence (DV) researchers examine professional intervention (e.g., police and nurses), but informal helpers (e.g., friends and bystanders) are critical. The authors measure undergraduates' intervention likelihood, type of involvement (i.e., contact with abuser), and the influence of attribution decisions in DV situations where the…

  13. Modelling offshore sand wave evolution

    NARCIS (Netherlands)

    Nemeth, Attila; Hulscher, Suzanne J.M.H.; van Damme, Rudolf M.J.

    2007-01-01

    We present a two-dimensional vertical (2DV) flow and morphological numerical model describing the behaviour of offshore sand waves. The model contains the 2DV shallow water equations, with a free water surface and a general bed load formula. The water movement is coupled to the sediment transport

  14. Genetic, Physical and Comparative Mapping of the Powdery Mildew Resistance Gene Pm21 Originating from Dasypyrum villosum

    Directory of Open Access Journals (Sweden)

    Huagang He

    2017-11-01

    Full Text Available Pm21, originating from wheat wild relative Dasypyrum villosum, confers immunity to all known races of Blumeria graminis f. sp. tritici (Bgt and has been widely utilized in wheat breeding. However, little is known on the genetic basis of the Pm21 locus. In the present study, four seedling-susceptible D. villosum lines (DvSus-1 ∼ DvSus-4 were identified from different natural populations. Based on the collinearity among genomes of Brachypodium distachyon, Oryza, and Triticeae, a set of 25 gene-derived markers were developed declaring the polymorphisms between DvRes-1 carrying Pm21 and DvSus-1. Fine genetic mapping of Pm21 was conducted by using an extremely large F2 segregation population derived from the cross DvSus-1/DvRes-1. Then Pm21 was narrowed to a 0.01-cM genetic interval defined by the markers 6VS-08.4b and 6VS-10b. Three DNA markers, including a resistance gene analog marker, were confirmed to co-segregate with Pm21. Moreover, based on the susceptible deletion line Y18-S6 induced by ethyl methanesulfonate treatment conducted on Yangmai 18, Pm21 was physically mapped into a similar interval. Comparative analysis revealed that the orthologous regions of the interval carrying Pm21 were narrowed to a 112.5 kb genomic region harboring 18 genes in Brachypodium, and a 23.2 kb region harboring two genes in rice, respectively. This study provides a high-density integrated map of the Pm21 locus, which will contribute to map-based cloning of Pm21.

  15. The Whitham deformation of the Dijkgraaf-Vafa Theory

    International Nuclear Information System (INIS)

    Aoyama, Shogo; Masuda, Takahiro

    2004-01-01

    We discuss the Whitham deformation of the effective superpotential in the Dijkgraaf-Vafa (DV) theory. It amounts to discussing the Whitham deformation of an underlying (hyper)elliptic curve. Taking the elliptic case for simplicity we derive the Whitham equation for the period, which governs fowings of branch points on the Riemann surface. By studying the hodograph solution to the Whitham equation it is shown that the effective superpotential in the DV theory is realized by many different meromorphic differentials. Depending on which meromorphic differential to take, the effective superpotential undergoes different deformations. This aspect of the DV theory is discussed in detail by taking the N = 1* theory. (author)

  16. Changed and changing gender and family roles and domestic violence in African refugee background communities post-settlement in Perth, Australia.

    Science.gov (United States)

    Fisher, Colleen

    2013-07-01

    In this study, domestic violence (DV) in five African refugee background communities post-settlement in Perth, Australia, is investigated-specifically, the interrelationship between experiences of DV, and changed and changing gender and family roles and responsibilities. The participatory qualitative design utilized in-depth interviews with 54 members of the Somalian, Sierra Leonean, Ethiopian, Liberian and Sudanese Communities, and focus groups with 24 professionals who support them. Three key dimensions of this interrelationship are discussed: "male loss of the breadwinner role and status," "financial independence," and "mismatch between formal response and expectations." The importance of understanding experiences of DV within the context of cultural transition is highlighted here.

  17. Preliminary construction of a service provider--informed domestic violence research agenda.

    Science.gov (United States)

    Murray, Christine E; Welch, Metoka L

    2010-12-01

    This article presents the results of a statewide survey of domestic violence (DV) service providers that focused on the needs, background characteristics, and opinions of service providers related to research. The survey included an examination of service providers' motivation for working in the field, research background and training, and perceptions of research as well as the topics they believe are important for researchers to study, the resources they consult to learn about DV, and their suggestions to help researchers learn more about the nature of their work. The results are integrated into a preliminary agenda for future DV research that accounts for the needs and insight of service providers.

  18. Non-invasive assessment of distribution volume ratios and binding potential: tissue heterogeneity and interindividually averaged time-activity curves

    Energy Technology Data Exchange (ETDEWEB)

    Reimold, M.; Mueller-Schauenburg, W.; Dohmen, B.M.; Bares, R. [Department of Nuclear Medicine, University of Tuebingen, Otfried-Mueller-Strasse 14, 72076, Tuebingen (Germany); Becker, G.A. [Nuclear Medicine, University of Leipzig, Leipzig (Germany); Reischl, G. [Radiopharmacy, University of Tuebingen, Tuebingen (Germany)

    2004-04-01

    Due to the stochastic nature of radioactive decay, any measurement of radioactivity concentration requires spatial averaging. In pharmacokinetic analysis of time-activity curves (TAC), such averaging over heterogeneous tissues may introduce a systematic error (heterogeneity error) but may also improve the accuracy and precision of parameter estimation. In addition to spatial averaging (inevitable due to limited scanner resolution and intended in ROI analysis), interindividual averaging may theoretically be beneficial, too. The aim of this study was to investigate the effect of such averaging on the binding potential (BP) calculated with Logan's non-invasive graphical analysis and the ''simplified reference tissue method'' (SRTM) proposed by Lammertsma and Hume, on the basis of simulated and measured positron emission tomography data [{sup 11}C]d-threo-methylphenidate (dMP) and [{sup 11}C]raclopride (RAC) PET. dMP was not quantified with SRTM since the low k {sub 2} (washout rate constant from the first tissue compartment) introduced a high noise sensitivity. Even for considerably different shapes of TAC (dMP PET in parkinsonian patients and healthy controls, [{sup 11}C]raclopride in patients with and without haloperidol medication) and a high variance in the rate constants (e.g. simulated standard deviation of K {sub 1}=25%), the BP obtained from average TAC was close to the mean BP (<5%). However, unfavourably distributed parameters, especially a correlated large variance in two or more parameters, may lead to larger errors. In Monte Carlo simulations, interindividual averaging before quantification reduced the variance from the SRTM (beyond a critical signal to noise ratio) and the bias in Logan's method. Interindividual averaging may further increase accuracy when there is an error term in the reference tissue assumption E=DV {sub 2}-DV ' (DV {sub 2} = distribution volume of the first tissue compartment, DV &apos

  19. Domestic Violence Assessments in the Child Advocacy Center

    Science.gov (United States)

    Thackeray, Jonathan D.; Scribano, Philip V.; Rhoda, Dale

    2010-01-01

    Objective: This study was designed to identify the frequency, methods, and practices of universal assessments for domestic violence (DV) within child advocacy centers (CACs) and determine which factors are associated with CACs that conduct universal DV assessments. Methods: The study design was a cross-sectional, web-based survey distributed to…

  20. Addressing domestic violence in primary care: what the physician ...

    African Journals Online (AJOL)

    Domestic violence (DV) is quite prevalent and negatively impacts the health and mental wellbeing of those affected. Victims of DV are frequent users of health service, yet they are infrequently recognized. Physicians tend to treat the presenting complaints without addressing the root cause of the problem. Lack of knowledge ...

  1. Dicty_cDB: SHH135 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available and phloem from mature trees Picea glauca cDNA clone GenomeQuebec_Id:GQ00610_L03 5', mRNA sequence. 44 1e-0...RNA, partial cds. 1265 0.0 1 DV977319 |DV977319.1 GQ00610.B3.1_L03 GQ006: Cambium

  2. Performance of Ductless Personalized Ventilation in Conjunction with Displacement Ventilation: Impact of Workstations Layout and Partitions

    DEFF Research Database (Denmark)

    Halvonova, Barbara; Melikov, Arsen Krikor

    2010-01-01

    cleaner for some of the layouts studied. The use of DPV in conjunction with DV substantially decreased the temperature of the inhaled air and increased the body cooling in comparison with use of DV alone, i.e., DPV also had potential for improving occupants' perceived air quality and thermal comfort....

  3. How Useful Are Indices of Personality Pathology when Assessing Domestic Violence Perpetrators?

    Science.gov (United States)

    Gibbons, Peter; Collins, Marjorie; Reid, Corinne

    2011-01-01

    There has been considerable debate about profiling personality pathology when assessing and treating male perpetrators of domestic violence (DV). This study used the Millon Clinical Multiaxial Inventory (MCMI-III) to explore the severity and diversity of male perpetrator personality pathology and response bias in a group of DV perpetrators being…

  4. Prenatal Diagnosis of Persistent Right Umbilical Vein Using Three-dimensional Sonography with Power Doppler

    Directory of Open Access Journals (Sweden)

    Pei-Yin Yang

    2007-03-01

    Conclusion: PRUV is a common vascular anomaly that is easy to be overlooked. Reconstruction of the portal system in the affected fetuses using 3D ultrasound facilitated the identification of the DV. If the DV is present, and other anomalies are excluded, the fetus with PRUV has a good outcome.

  5. I-DECIDE: An Online Intervention Drawing on the Psychosocial Readiness Model for Women Experiencing Domestic Violence.

    Science.gov (United States)

    Tarzia, Laura; Murray, Elizabeth; Humphreys, Cathy; Glass, Nancy; Taft, Angela; Valpied, Jodie; Hegarty, Kelsey

    2016-01-01

    Domestic violence (DV) perpetrated by men against women is a pervasive global problem with significant physical and emotional consequences. Although some face-to-face interventions in health care settings have shown promise, there are barriers to disclosure to health care practitioners and women may not be ready to access or accept help, reducing uptake. Similar to the mental health field, interventions from clinical practice can be adapted to be delivered by technology. This article outlines the theoretical and conceptual development of I-DECIDE, an online healthy relationship tool and safety decision aid for women experiencing DV. The article explores the use of the Psychosocial Readiness Model (PRM) as a theoretical framework for the intervention and evaluation. This is a theoretical article drawing on current theory and literature around health care and online interventions for DV. The article argues that the Internet as a method of intervention delivery for DV might overcome many of the barriers present in health care settings. Using the PRM as a framework for an online DV intervention may help women on a pathway to safety and well-being for themselves and their children. This hypothesis will be tested in a randomized, controlled trial in 2015/2016. This article highlights the importance of using a theoretical model in intervention development and evaluation. Copyright © 2016 Jacobs Institute of Women's Health. Published by Elsevier Inc. All rights reserved.

  6. The Pragmatics of Domestic Violence Discourse in Uruguay

    Directory of Open Access Journals (Sweden)

    Teresa Herrera

    2017-01-01

    Full Text Available Domestic violence (DV is a form of gender-based violence and a violation of human rights. As such, it was analyzed from the perspective of feminist theory in the dissertation this article is based on, by analyzing discourse pragmatics. Which are the socially accepted DV discourses in Uruguay? Which coincidences, contradictions, and paradoxes appear when we compare these discourses and those of everyday life? Which codes and subcodes should be modified by the sectors interested in the prevention and eradication of DV? The main hypothesis is that there are different types of opposition between the public discourse of different institutional sectors and that of everyday life. Describing these oppositions and, especially, unveiling the pragmatic paradoxes will enable us to develop a different type of discourse for the prevention and eradication of DV. As I am both a researcher and an activist on the topic, my epistemological choice was the autoethnography. This article provides some final reflections, included in the dissertation, on how the feminist movement needs to succeed in persuading decision makers and the mass media, and in building solid alliances to establish an information and monitoring system; the integration of the subject into the educational system; comprehensive legislation on gender-based violence; and new ways of communicating with all sectors, so as to create a new ideology on gender relations for the suitable prevention of DV.

  7. Characteristics of the digestive vacuole membrane of the alga-bearing ciliate Paramecium bursaria.

    Science.gov (United States)

    Kodama, Yuuki; Fujishima, Masahiro

    2012-07-01

    Cells of the ciliate Paramecium bursaria harbor symbiotic Chlorella spp. in their cytoplasm. To establish endosymbiosis with alga-free P. bursaria, symbiotic algae must leave the digestive vacuole (DV) to appear in the cytoplasm by budding of the DV membrane. This budding was induced not only by intact algae but also by boiled or fixed algae. However, this budding was not induced when food bacteria or India ink were ingested into the DVs. These results raise the possibility that P. bursaria can recognize sizes of the contents in the DVs. To elucidate this possibility, microbeads with various diameters were mixed with alga-free P. bursaria and traced their fate. Microbeads with 0.20μm diameter did not induce budding of the DVs. Microbeads with 0.80μm diameter produced DVs of 5-10μm diameter at 3min after mixing; then the DVs fragmented and became vacuoles of 2-5μm diameter until 3h after mixing. Each microbead with a diameter larger than 3.00μm induced budding similarly to symbiotic Chlorella. These observations reveal that induction of DV budding depends on the size of the contents in the DVs. Dynasore, a dynamin inhibitor, greatly inhibited DV budding, suggesting that dynamin might be involved in DV budding. Copyright © 2011 Elsevier GmbH. All rights reserved.

  8. Domestic violence education for UK and Ireland undergraduate dental students: a five-year perspective.

    Science.gov (United States)

    Patel, Neil; Bailey, Edmund; Mahdmina, Ayeh; Lomax, Alastair; Coulthard, Paul

    2014-08-01

    The purpose of this cross-sectional study was to ascertain whether undergraduate dental students in the United Kingdom and Ireland are receiving formal teaching on recognizing and managing domestic violence (DV) as part of their curricula. A questionnaire was sent to all dental schools in the UK and Ireland in 2007 and again in 2012, requesting information on whether the subject was taught, by which specialty it was taught, and whether schools felt it was important to include in the curriculum. In 2007, twelve of the fifteen dental schools completed and returned the questionnaire, for a response rate of 80 percent; in 2012, eleven of the sixteen dental schools responded, for a response rate of 69 percent. The main findings were that, in 2007, 50 percent of the responding schools were providing teaching about DV and the majority of this teaching was delivered by oral surgery and pediatric dentistry departments. In 2012, only 45 percent of the responding schools were teaching DV, with 60 percent of this teaching being delivered by pediatric dentists. This study's findings suggest that DV is an undertaught area in UK and Irish undergraduate dental curricula. Some schools recognized the importance of DV teaching; however, they have been unable to implement it because of a full curriculum and lack of appropriately trained staff amongst other reasons.

  9. Cloning and expression analysis of a blue copperbinding protein ...

    African Journals Online (AJOL)

    Adifferentially expressed fragment EST145 was isolated by suppression subtractive hybridization (SSH) method. Using EST145 as the probe, a blue copper-binding protein gene designated as DvBCB was screened from Dasypyrum villosum cDNA Library. The DvBCB gene was 845 bp in length with an open reading frame ...

  10. Degree of Exposure to Domestic Violence, Psychopathology, and Functional Impairment in Children and Adolescents

    Science.gov (United States)

    Fernandez, Eduard Bayarri; Ezpeleta, Lourdes; Granero, Roser; de la Osa, Nuria; Domenech, Josep Maria

    2011-01-01

    There are discrepancies about whether children who witness and suffer domestic violence (DV) have similar outcomes in terms of psychopathology. This work examines the relationship between different types of exposure to DV and child psychopathology and functional impairment. One hundred and forty-four Spanish children aged from 4 to 17 years and…

  11. Composing with New Technology: Teacher Reflections on Learning Digital Video

    Science.gov (United States)

    Bruce, David L.; Chiu, Ming Ming

    2015-01-01

    This study explores teachers' reflections on their learning to compose with new technologies in the context of teacher education and/or teacher professional development. English language arts (ELA) teachers (n = 240) in 15 courses learned to use digital video (DV), completed at least one DV group project, and responded to open-ended survey…

  12. Effectiveness of "shifting boundaries" teen dating violence prevention program for subgroups of middle school students.

    Science.gov (United States)

    Taylor, Bruce G; Mumford, Elizabeth A; Stein, Nan D

    2015-02-01

    We examine whether the Shifting Boundaries (SB) intervention, a primary intervention to prevent youth dating violence and sexual harassment (DV/H), is differentially effective for girls compared with boys or for youth with a history of DV/H experiences. We randomly assigned SB to 30 public middle schools in New York City, enrolling 117 sixth and seventh grade classes to receive a classroom, building, combined, or neither intervention. The SB classroom intervention included six sessions emphasizing the laws/consequences of DV/H, establishing boundaries and safe relationships. The SB schoolwide/building intervention included the use of school-based restraining orders, greater faculty/security presence in unsafe "hot spots" mapped by students, and posters to increase DV/H awareness and reporting. Student surveys were implemented at baseline, immediately after intervention, and 6 months after intervention. At 6 months after intervention, the SB building-level intervention was associated with significant reductions in the frequency of sexual harassment (SH) perpetration and victimization; the prevalence and frequency of sexual dating violence victimization; and the frequency of total dating violence victimization and perpetration. We also had one anomalous finding that the interventions were associated with an increase in the prevalence of SH victimization. These results were consistent for girls and boys, and those with or without a history of DV/H, with the one exception for those exposed to the SB building condition who had earlier reported perpetrating SH had a significantly lower frequency of perpetrating SH at the follow-up than those without such a history. SB can provide effective universal prevention of middle school DV/H experiences, regardless of students' prior exposure histories, and for boys and girls. Copyright © 2015 Society for Adolescent Health and Medicine. Published by Elsevier Inc. All rights reserved.

  13. Preferential streaming of the ductus venosus toward the right atrium is associated with a worse outcome despite a higher rate of invasive procedures in human fetuses with left diaphragmatic hernia.

    Science.gov (United States)

    Stressig, R; Fimmers, R; Schaible, T; Degenhardt, J; Axt-Fliedner, R; Gembruch, U; Kohl, T

    2013-12-01

    Preferential streaming of the ductus venosus (DV) toward the right atrium has been observed in fetuses with left diaphragmatic hernia (LDH). The purpose of this retrospective study was to compare survival rates to discharge between a group with preferential streaming of the DV toward the right heart and a group in which this abnormal flow pattern was not present. We retrospectively searched our patient records for fetuses with LDH in whom liver position, DV streaming and postnatal outcome information was available. 55 cases were found and divided into two groups: Group I fetuses exhibited abnormal DV streaming toward the right side of the heart; group II fetuses did not. Various prognostic and outcome parameters were compared. 62 % of group I fetuses and 88 % of group II fetuses survived to discharge (p = 0.032). Fetoscopic tracheal balloon occlusion (FETO) was performed in 66 % of group I fetuses and 23 % of group II fetuses (p = 0.003). Postnatal ECMO therapy was performed in 55 % of group I fetuses and 23 % of group II infants (p = 0.025). Moderate to severe chronic lung disease in survivors was observed in 56 % of the survivors of group I and 9 % of the survivors of group II (p = 0.002). Preferential streaming of the DV toward the right heart in human fetuses with left-sided diaphragmatic hernia was associated with a poorer postnatal outcome despite a higher rate of invasive pre- and postnatal procedures compared to fetuses without this flow abnormality. Specifically, abnormal DV streaming was found to be an independent predictor for FETO. © Georg Thieme Verlag KG Stuttgart · New York.

  14. Single-atom catalysts for CO2 electroreduction with significant activity and selectivity improvements.

    Science.gov (United States)

    Back, Seoin; Lim, Juhyung; Kim, Na-Young; Kim, Yong-Hyun; Jung, Yousung

    2017-02-01

    A single-atom catalyst (SAC) has an electronic structure that is very different from its bulk counterparts, and has shown an unexpectedly high specific activity with a significant reduction in noble metal usage for CO oxidation, fuel cell and hydrogen evolution applications, although physical origins of such performance enhancements are still poorly understood. Herein, by means of density functional theory (DFT) calculations, we for the first time investigate the great potential of single atom catalysts for CO 2 electroreduction applications. In particular, we study a single transition metal atom anchored on defective graphene with single or double vacancies, denoted M@sv-Gr or M@dv-Gr, where M = Ag, Au, Co, Cu, Fe, Ir, Ni, Os, Pd, Pt, Rh or Ru, as a CO 2 reduction catalyst. Many SACs are indeed shown to be highly selective for the CO 2 reduction reaction over a competitive H 2 evolution reaction due to favorable adsorption of carboxyl (*COOH) or formate (*OCHO) over hydrogen (*H) on the catalysts. On the basis of free energy profiles, we identified several promising candidate materials for different products; Ni@dv-Gr (limiting potential U L = -0.41 V) and Pt@dv-Gr (-0.27 V) for CH 3 OH production, and Os@dv-Gr (-0.52 V) and Ru@dv-Gr (-0.52 V) for CH 4 production. In particular, the Pt@dv-Gr catalyst shows remarkable reduction in the limiting potential for CH 3 OH production compared to any existing catalysts, synthesized or predicted. To understand the origin of the activity enhancement of SACs, we find that the lack of an atomic ensemble for adsorbate binding and the unique electronic structure of the single atom catalysts as well as orbital interaction play an important role, contributing to binding energies of SACs that deviate considerably from the conventional scaling relation of bulk transition metals.

  15. Simplifying mental math: Changing how added sugars are displayed on the nutrition facts label can improve consumer understanding.

    Science.gov (United States)

    Khandpur, Neha; Graham, Dan J; Roberto, Christina A

    2017-07-01

    Proposed variations to Nutrition Facts Labels (NFL) have included the display of added sugars (AS) content, but its impact on consumer understanding is poorly understood. To examine the degree to which different formats for displaying AS influence consumer understanding, perceptions, and purchase intentions. Randomized-controlled online experiment. A sample of 2509 U.S adults. Participants were randomized to 1 of 8 conditions and viewed 10 food or beverage images with either: (1) no label (control); (2) the current NFL (without AS); (3) the proposed NFL without AS; or the proposed NFL with AS in (4) grams, (5) grams and teaspoons, (6) grams and percent Daily Value (%DV), (7) grams with high/medium/low text, or (8) grams with high/medium/low text and %DV. ANCOVAs compared scores on quizzes that assessed the accuracy of judgments about AS, overall nutrition understanding and purchase intentions. Presenting AS in grams plus high/medium/low text with and without %DV led to the highest AS understanding scores (85% and 83% correct, respectively) compared to 70% correct when AS was not on the label or was displayed in grams only (74% correct). Displaying AS in teaspoons did not significantly improve understanding beyond grams alone. Consumers were best able to determine which of two products was healthier when AS was presented as %DV (68% correct) versus displayed in grams alone (60% correct), but %DV did not differ from high/medium/low text or teaspoons. None of the labels influenced purchase intentions relative to no label. Displaying AS on the NFL in grams with high/medium/low text, %DV, or the combination of the two, improved consumer understanding more than presenting it in grams or teaspoons. Copyright © 2017 Elsevier Ltd. All rights reserved.

  16. MR Venography of Deep Veins: Changes with Uterine Fibroid Embolization

    International Nuclear Information System (INIS)

    Katsumori, Tetsuya; Kasahara, Toshiyuki; Tsuchida, Yoko; Nara, Yoshinori

    2009-01-01

    Deep veins (DVs) can be compressed by a uterus enlarged with fibroids. The purpose of this study was to assess the degree of luminal narrowing of DVs caused by a myomatous uterus, and the change in DV narrowing in women with symptomatic fibroids after embolization using time-of-flight (TOF)-magnetic resonance venography (MRV). Twenty-nine consecutive women with symptomatic uterine fibroids underwent TOF-MRV and pelvic MRI before and 4 months after embolization. Based on the TOF-MRV, we evaluated the luminal narrowing of three DVs, including the inferior vena cava, and the bilateral common and external iliac veins, and divided the findings into three grades. The scores for each DV were added for each patient (lowest, 0; highest, 6). DV scores and symptom severity (SS) scores were compared between the baseline and 4 months after embolization using the paired t-test. The relationship between DV scores and uterine volume was investigated using Pearson's test. DV scores decreased significantly, from 1.52 ± 1.70 at baseline to 0.93 ± 1.56 at 4 months after embolization (p = 0.004). The uterine volume decreased from 948 ± 647 mL at baseline to 617 ± 417 mL at 4 months after embolization (p < 0.001). DV score correlated with uterine volume (r = 0.856, p < 0.001). SS scores decreased from 54.5 ± 14.6 at baseline to 26.8 ± 15.4 at 4 months after embolization (p < 0.001). In conclusion, the degree of luminal narrowing of DVs caused by a uterus with fibroids is correlated with the uterine volume. Uterine artery embolization may induce an improvement of luminal narrowing of DVs due to a reduction of the myomatous uterus volume.

  17. Lived Experiences of Diversity Visa Lottery Immigrants in the United States

    Science.gov (United States)

    Hailu, Tekleab Elos; Mendoza, Bernadette M.; Lahman, Maria K. E.; Richard, Veronica M.

    2012-01-01

    Every year approximately 50,000 people immigrate to the United States through the avenue referred to as the Diversity Visa (DV) Lottery. In this article, the authors present a literature review of immigration to the U.S. through the DV Lottery, reflect on their own immigration histories, and utilize phenomenology to investigate and describe…

  18. AcEST: BP912241 [AcEST

    Lifescience Database Archive (English)

    Full Text Available 8RVJ8|Q8RVJ8_POPCA Putative photosystem I reaction centre su... 96 2e-18 tr|Q01DV3|Q01DV3_OSTTA PsaE undef...ined product (IC) OS=Ostreococc... 96 2e-18 tr|B7FME3|B7FME3_MEDTR Putative unchara

  19. The Cognitive Symptom Checklist-Work in cancer patients is related with work functioning, fatigue and depressive symptoms : a validation study

    NARCIS (Netherlands)

    Dorland, H. F.; Abma, F. I.; Roelen, C. A. M.; Smink, A.; Feuerstein, M.; Amick, B. C.; Ranchor, A. V.; Bultmann, U.

    The study objectives are to translate the 21-item Cognitive Symptom Checklist-Work (CSC-W21) to Dutch (CSC-W DV) and to validate the CSC-W DV in working cancer patients. The CSC-W21 was cross-culturally translated and adapted to a Dutch version. In this 19-item version, the dichotomous response

  20. Children's experiences of domestic violence and abuse: Siblings' accounts of relational coping.

    Science.gov (United States)

    Callaghan, Jane E M; Alexander, Joanne H; Sixsmith, Judith; Fellin, Lisa C

    2016-10-01

    This article explores how children see their relationships, particularly their sibling relationships, in families affected by domestic violence (DV) and how relationality emerges in their accounts as a resource to build an agentic sense of self. The 'voice' of children is largely absent from the DV literature, which typically portrays them as passive, damaged and relationally incompetent. Children's own understandings of their relational worlds are often overlooked, and consequently, existing models of children's social interactions give inadequate accounts of their meaning-making-in-context. Drawn from a larger study of children's experiences of DV and abuse, this article uses two case studies of sibling relationships to explore young people's use of relational resources, for coping with violence in the home. The article explores how relationality and coping intertwine in young people's accounts and disrupts the taken-for-granted assumption that children's 'premature caring' or 'parentification' is (only) pathological in children's responses to DV. This has implications for understanding young people's experiences in the present and supporting their capacity for relationship building in the future. © The Author(s) 2015.

  1. A Gender Comparison of Motivations for Physical Dating Violence Among College Students.

    Science.gov (United States)

    Elmquist, JoAnna; Wolford-Clevenger, Caitlin; Zapor, Heather; Febres, Jeniimarie; Shorey, Ryan C; Hamel, John; Stuart, Gregory L

    2016-01-01

    There are limited empirical investigations that directly compare men and women's motivations, or reasons, for perpetrating physical dating violence (DV). In an attempt to further understand whether men and women have similar or different motives for physical DV, the purpose of the current study was to conduct a gender comparison of motives in a sample of male (n = 163) and female (n = 319) college students. Motivations for physical DV were classified according to seven broad categories proposed by Langhinrichsen-Rohling and colleagues: (a) power/control, (b) self-defense, (c) expression of negative emotion (e.g., anger), (d) communication difficulties, (e) retaliation, (f) jealousy, and (g) other (e.g., because it was sexually arousing, the influence of alcohol, the influence of drugs). The prevalence of physical violence perpetration in the overall sample was 29.4%. Results indicated that communication difficulties and self-defense were among the most frequently endorsed motive categories for both male and female perpetrated DV. In addition, results demonstrated gender similarity in all of the examined motive categories. Research and clinical implications are discussed. © The Author(s) 2014.

  2. "I am not [just] a rabbit who has a bunch of children!": agency in the midst of suffering at the intersections of global inequalities, gendered violence, and migration.

    Science.gov (United States)

    Parson, Nia

    2010-08-01

    This article is based on an analysis of the life history narrative of Antonia, a Peruvian immigrant in Chile, in the context of ethnographic research on Chilean women's experiences of domestic violence (DV) and the post-dictatorship state's responses to DV. Structural and socio-cultural constraints and forms of violence, including global and local economic inequalities, migration, racism, and intimate, gender-based abuses in both home and receiving countries interact in Antonia's experience to produce suffering and influence a form of gendered agency. This analysis points to the need for research and policies specifically designed to attend to the intersecting vulnerabilities migrant women who suffer DV often face, as well as their agentive acts.

  3. Attitudes and Beliefs About Domestic Violence: Results of a Public Opinion Survey. I. Definitions of Domestic Violence, Criminal Domestic Violence, and Prevalence

    Science.gov (United States)

    Carlson, Bonnie E.; Worden, Alissa Pollitz

    2005-01-01

    This study reports analyses and findings from a public opinion survey designed to explore beliefs about domestic violence (DV) -- what it is, when it is against the law, and how prevalent it is. The project interviewed 1,200 residents from six New York communities. The analyses reveal substantial first hand and second hand experience with DV and…

  4. Dicty_cDB: Contig-U04691-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 63 ) GQ02748.B3_E01 GQ099: Mixed spruce tissues Picea ... 50 0.11 1 ( DV989931 ) GQ0223.B7_H01 GQ022: ROOT XYLEM - mature trees... Pi... 50 0.11 1 ( DV989830 ) GQ0222.B7_A17 GQ022: ROOT XYLEM - mature trees Pi... 50 0.1

  5. Applying the PR and PP Methodology for a qualitative assessment of a misuse scenario in a notional Generation IV Example Sodium Fast Reactor. Assessing design variations

    Energy Technology Data Exchange (ETDEWEB)

    Cojazzi, G.G.M.; Renda, G. [European Commission, Joint Research Centre, Institute for the Protection and Security of the Citizen, TP 210, Via E. Fermi 2749, I-21027, Ispra - Va (Italy); Hassberger, J. [Lawrence Livermore National Laboratory (United States)

    2009-06-15

    The Generation IV International Forum (GIF) Proliferation Resistance and Physical Protection (PR and PP) Working Group has developed a methodology for the PR and PP evaluation of advanced nuclear energy systems. The methodology is organised as a progressive approach applying alternative methods at different levels of thoroughness as more design information becomes available and research improves the depth of technical knowledge. The GIF Proliferation Resistance and Physical Protection (PR and PP) Working Group developed a notional sodium cooled fast neutron nuclear reactor, named the Example Sodium Fast Reactor (ESFR), for use in developing and testing the methodology. The ESFR is a hypothetical nuclear energy system consisting of four sodium-cooled fast reactors of medium size, co-located with an on-site dry fuel storage facility and a Fuel Cycle Facility with pyrochemical processing of the spent fuel and re-fabrication of new ESFR fuel elements. The baseline design is an actinide burner, with LWR spent fuel elements as feed material processed on the site. In the years 2007 and 2008 the GIF PR and PP Working Group performed a case study designed to both test the methodology and demonstrate how it can provide useful feedback to designers even during pre-conceptual design. The Study analysed the response of the entire ESFR system to different proliferation and theft strategies. Three proliferation threats were considered: Concealed diversion, Concealed Misuse and Abrogation. An overt theft threat was also studied. One of the objectives of the case study is to confirm the capability of the methodology to capture PR and PP differences among varied design configurations. To this aim Design Variations (DV) have been also defined corresponding respectively to a) a small variation of the baseline design (DV0), b) a deep burner configuration (DV1), c) a self sufficient core (DV2), and c) a breeder configuration (DV3). This paper builds on the approach followed for the

  6. Peer victimization and social phobia: a follow-up study among adolescents.

    Science.gov (United States)

    Ranta, Klaus; Kaltiala-Heino, Riittakerttu; Fröjd, Sari; Marttunen, Mauri

    2013-04-01

    This study examined longitudinal associations between direct and relational peer victimization (DV/RV) and self-reported social phobia (SP) among adolescents from 15 to 17 years of age, controlling for depression and family socioeconomic covariates. A total of 3,278 Finnish adolescents with a mean age of 15.5 years were surveyed at baseline (T1), and followed up 2 years afterwards (T2) their mean age being 17.6 years. In all, 2,070 adolescents were reached for the follow-up. Both types of victimization were assessed with structured questions, SP with the Social Phobia Inventory, and depression with the 13-item Beck Depression Inventory. Socioeconomic covariates were assessed with items from the Life Events Checklist. Frequency of victimization and SP were assessed at T1 and T2, and incidence and persistence from T1 to T2. Longitudinal associations between victimization and SP were examined with three logistic regression analyses with depression and socioeconomic covariates controlled for, with SP, DV, and RV in turn as the dependent endpoint (T2) variables. Among boys a bidirectional association between DV and SP was found with DV both predicting SP [Odds Ratio (OR) 2.6] and being predicted by SP (OR 3.9). Among girls RV predicted SP (OR 2.8), but not vice versa, while depression in turn predicted DV (OR 4.3). Direct victimization and SP have a bidirectional association among boys, while among girls RV increases the risk of subsequent SP.

  7. Edge functionalised & Li-intercalated 555-777 defective bilayer graphene for the adsorption of CO{sub 2} and H{sub 2}O

    Energy Technology Data Exchange (ETDEWEB)

    Lalitha, Murugan [School of Chemical Engineering, The University of Queensland, Brisbane 4072, QLD (Australia); Department of Physics, Bharathiar University, Coimbatore 641046, Tamil Nadu (India); Lakshmipathi, Senthilkumar, E-mail: lsenthilkumar@buc.edu.in [School of Chemical Engineering, The University of Queensland, Brisbane 4072, QLD (Australia); Department of Physics, Bharathiar University, Coimbatore 641046, Tamil Nadu (India); Bhatia, Suresh K., E-mail: s.bhatia@uq.edu.au [School of Chemical Engineering, The University of Queensland, Brisbane 4072, QLD (Australia)

    2017-04-01

    Highlights: • DV defect in fluorinated graphene sheet enhances hydrophobicity. • Intercalation of Li atom decreases the separation in bilayer graphene sheets. • Bernal stacking increases hydrophobicity of the bilayer graphene sheets. - Abstract: The adsorption of CO{sub 2} and H{sub 2}O on divacanacy (DV) defected graphene cluster, and its bilayer counterpart is investigated using first-principles calculations. Both single and bilayer DV graphene cluster, are functionalised with H and F atoms. On these sheets the gas molecules are physisorbed, and the divacancy defect effectively improves the adsorption of CO{sub 2}, while fluorination enhances the hydrophobicity of the graphene cluster. Among the convex and concave curvature regions induced due to the DV defect, the adsorption of the gas molecules on the concave meniscus is more favourable. Fluorine termination induces 73% reduction in Henry law constants for H{sub 2}O, while for the CO{sub 2} molecule it increases by 8%, which indicates the DV defective sheet is a better candidate for CO{sub 2} capture compared to the STW defective sheet. Besides, both AA and AB divacant defect bilayer sheets are equally stable, wherein AA stacking results in a cavity between the sheets, while in AB stacking, the layers slide one over the other. Nevertheless, both these bilayer sheets are comparatively stabler than the monolayer. However, intercalation of lithium decreases the interlayer separation, particularly in AA stacking, which enhances the CO{sub 2} adsorption, but in the Bernal stacking enhances it hydrophobicity.

  8. Developing a western Siberia reference site for tropospheric water vapour isotopologue observations obtained by different techniques (in situ and remote sensing

    Directory of Open Access Journals (Sweden)

    K. Gribanov

    2014-06-01

    water cycle, affected by changes in air mass origin, non-convective and convective processes and continental recycling. Novel remote sensing and in situ measuring techniques have recently offered opportunities for monitoring atmospheric water vapour isotopic composition. Recently developed infrared laser spectrometers allow for continuous in situ measurements of surface water vapour δDv and δ18Ov. So far, very few intercomparisons of measurements conducted using different techniques have been achieved at a given location, due to difficulties intrinsic to the comparison of integrated with local measurements. Nudged simulations conducted with high-resolution isotopically enabled general circulation models (GCMs provide a consistent framework for comparison with the different types of observations. Here, we compare simulations conducted with the ECHAM5-wiso model with two types of water vapour isotopic data obtained during summer 2012 at the forest site of Kourovka, western Siberia: hourly ground-based FTIR total atmospheric columnar δDv amounts, and in situ hourly Picarro δDv measurements. There is an excellent correlation between observed and predicted δDv at surface while the comparison between water column values derived from the model compares well with FTIR estimates.

  9. Floor heating and cooling combined with displacement ventilation: Possibilities and limitations

    Energy Technology Data Exchange (ETDEWEB)

    Causone, Francesco; Corgnati, Stefano P. [TEBE Research Group, Department of Energetics, Politecnico di Torino, Corso Duca degli Abruzzi 24, 10129 Torino (Italy); Baldin, Fabio [Department of Applied Physics, University of Padova, via Venezia 1, 35131 Padova (Italy); Olesen, Bjarne W. [ICIEE, Department of Civil Engineering, Technical University of Denmark, Nils Koppels Alle Building 402, 2800 Kgs. Lyngby (Denmark)

    2010-12-15

    Design guidelines envisage that floor heating can be used together with displacement ventilation (DV), provided that the supply air is not overly heated before it can reach heat and contaminant sources. If this is not controlled a mixing flow pattern could occur in the room. The use of floor cooling with DV is also considered possible, although draught risk at ankle level and vertical air temperature differences must be controlled carefully, because they could increase. Few studies on these topics were found in the literature. An indoor environmental chamber was set up to obtain measurements aimed at analysing the possibilities and limitations of combining floor heating/cooling with DV. Air temperature profiles, air velocity profiles, surface temperatures and ventilation effectiveness were measured under different environmental conditions that may occur in practice. These values were compared to equivalent temperature measurements obtained using a thermal manikin. The measurements show that floor heating can be used with DV, obtaining high ventilation effectiveness values. A correlation between the floor heating capacity and the air temperature profile in the room was found. Measurements showed that floor cooling does not increase draught risk at ankle level, although it does increase vertical air temperature differences. (author)

  10. Maternal control of the Drosophila dorsal–ventral body axis

    Science.gov (United States)

    Stein, David S.; Stevens, Leslie M.

    2016-01-01

    The pathway that generates the dorsal–ventral (DV) axis of the Drosophila embryo has been the subject of intense investigation over the previous three decades. The initial asymmetric signal originates during oogenesis by the movement of the oocyte nucleus to an anterior corner of the oocyte, which establishes DV polarity within the follicle through signaling between Gurken, the Drosophila Transforming Growth Factor (TGF)-α homologue secreted from the oocyte, and the Drosophila Epidermal Growth Factor Receptor (EGFR) that is expressed by the follicular epithelium cells that envelop the oocyte. Follicle cells that are not exposed to Gurken follow a ventral fate and express Pipe, a sulfotransferase that enzymatically modifies components of the inner vitelline membrane layer of the eggshell, thereby transferring DV spatial information from the follicle to the egg. These ventrally sulfated eggshell proteins comprise a localized cue that directs the ventrally restricted formation of the active Spätzle ligand within the perivitelline space between the eggshell and the embryonic membrane. Spätzle activates Toll, a transmembrane receptor in the embryonic membrane. Transmission of the Toll signal into the embryo leads to the formation of a ventral-to-dorsal gradient of the transcription factor Dorsal within the nuclei of the syncytial blastoderm stage embryo. Dorsal controls the spatially specific expression of a large constellation of zygotic target genes, the Dorsal gene regulatory network, along the embryonic DV circumference. This article reviews classic studies and integrates them with the details of more recent work that has advanced our understanding of the complex pathway that establishes Drosophila embryo DV polarity. PMID:25124754

  11. Growth and physiological responses to cadmium stress of two populations of Dittrichia viscosa (L.) Greuter

    Energy Technology Data Exchange (ETDEWEB)

    Fernández, R.; Bertrand, A. [Departamento de Biología de Organismos y Sistemas, Universidad de Oviedo, Catedrático Rodrigo Uría s/n, 33071 Oviedo (Spain); Instituto Universitario de Biotecnología de Asturias (Spain); Reis, R.; Mourato, M.P.; Martins, L.L. [Departamento de Química Agrícola e Ambiental, Universidade Técnica de Lisboa, Tapada da Ajuda 1349-017, Lisboa (Portugal); González, A., E-mail: aidag@uniovi.es [Departamento de Biología de Organismos y Sistemas, Universidad de Oviedo, Catedrático Rodrigo Uría s/n, 33071 Oviedo (Spain); Instituto Universitario de Biotecnología de Asturias (Spain)

    2013-01-15

    Highlights: ► Cd tolerance and accumulation are constitutive traits in D. viscosa. ► The physiological mechanisms involved in Cd stress differed between clones. ► The metallicolous clone was more Cd tolerant than the non-metallicolous one. ► Antioxidant enzymes had important roles in each clone, especially peroxidases. -- Abstract: Two clones of Dittrichia viscosa (L.) Greuter from contrasting populations, DV-A (metallicolous) and DV-W (non-metallicolous), were studied to compare Cd accumulation and tolerance. After 10 days of hydroponic culture with 0, 5, 10, and 15 mg Cd L{sup −1}, metal accumulation and plant growth were measured as well as other stress markers such as decrease in the content of photosynthetic pigments, lipid peroxidation, phenols, H{sub 2}O{sub 2}, and free proline. We also analyzed the activity of the antioxidant enzymes guaiacol and ascorbate peroxidases, catalase, superoxide dismutase, and glutathione reductase as well as their isoform patterns. Our results confirmed a high Cd tolerance and accumulation in both clones of D. viscosa, which suggests that these traits are constitutive in this species. However, when the Cd concentration in solution exceeded 10 mg Cd L{sup −1}, DV-A was more tolerant than DV-W. The physiological mechanisms involved in Cd tolerance also differed between them, although phenols and guaiacol peroxidase played an important role in both clones. The effective Cd detoxification of DV-A consisted mainly in a promoted ascorbate peroxidase activity and better efficiency of catalase and glutathione reductase enzymes.

  12. Effects of weather conditions on emergency ambulance calls for acute coronary syndromes

    Science.gov (United States)

    Vencloviene, Jone; Babarskiene, Ruta; Dobozinskas, Paulius; Siurkaite, Viktorija

    2015-08-01

    The aim of this study was to evaluate the relationship between weather conditions and daily emergency ambulance calls for acute coronary syndromes (ACS). The study included data on 3631 patients who called the ambulance for chest pain and were admitted to the department of cardiology as patients with ACS. We investigated the effect of daily air temperature ( T), barometric pressure (BP), relative humidity, and wind speed (WS) to detect the risk areas for low and high daily volume (DV) of emergency calls. We used the classification and regression tree method as well as cluster analysis. The clusters were created by applying the k-means cluster algorithm using the standardized daily weather variables. The analysis was performed separately during cold (October-April) and warm (May-September) seasons. During the cold period, the greatest DV was observed on days of low T during the 3-day sequence, on cold and windy days, and on days of low BP and high WS during the 3-day sequence; low DV was associated with high BP and decreased WS on the previous day. During June-September, a lower DV was associated with low BP, windless days, and high BP and low WS during the 3-day sequence. During the warm period, the greatest DV was associated with increased BP and changing WS during the 3-day sequence. These results suggest that daily T, BP, and WS on the day of the ambulance call and on the two previous days may be prognostic variables for the risk of ACS.

  13. Optimally Repeatable Kinetic Model Variant for Myocardial Blood Flow Measurements with 82Rb PET

    Directory of Open Access Journals (Sweden)

    Adrian F. Ocneanu

    2017-01-01

    Full Text Available Purpose. Myocardial blood flow (MBF quantification with Rb82 positron emission tomography (PET is gaining clinical adoption, but improvements in precision are desired. This study aims to identify analysis variants producing the most repeatable MBF measures. Methods. 12 volunteers underwent same-day test-retest rest and dipyridamole stress imaging with dynamic Rb82 PET, from which MBF was quantified using 1-tissue-compartment kinetic model variants: (1 blood-pool versus uptake region sampled input function (Blood/Uptake-ROI, (2 dual spillover correction (SOC-On/Off, (3 right blood correction (RBC-On/Off, (4 arterial blood transit delay (Delay-On/Off, and (5 distribution volume (DV constraint (Global/Regional-DV. Repeatability of MBF, stress/rest myocardial flow reserve (MFR, and stress/rest MBF difference (ΔMBF was assessed using nonparametric reproducibility coefficients (RPCnp = 1.45 × interquartile range. Results. MBF using SOC-On, RVBC-Off, Blood-ROI, Global-DV, and Delay-Off was most repeatable for combined rest and stress: RPCnp = 0.21 mL/min/g (15.8%. Corresponding MFR and ΔMBF RPCnp were 0.42 (20.2% and 0.24 mL/min/g (23.5%. MBF repeatability improved with SOC-On at stress (p<0.001 and tended to improve with RBC-Off at both rest and stress (p<0.08. DV and ROI did not significantly influence repeatability. The Delay-On model was overdetermined and did not reliably converge. Conclusion. MBF and MFR test-retest repeatability were the best with dual spillover correction, left atrium blood input function, and global DV.

  14. Comparative analysis of short - term functional outcomes and quality of life in a prospective series of brachytherapy and Da Vinci robotic prostatectomy

    International Nuclear Information System (INIS)

    Garcia-Sanchez, Cristina; Roman Martin, Ana A.; Conde-Sanchez, J. Manuel; Congregado-Ruiz, C. Belen; Osman-Garcia, Ignacio; Medina-Lopez, Rafael A.

    2017-01-01

    Introduction: There is a growing interest in achieving higher survival rates with the lowest morbidity in localized prostate cancer (PC) treatment. Consequently, minimally invasive techniques such as low-dose rate brachytherapy (BT) and robotic-assisted prostatectomy (RALP) have been developed and improved. Comparative analysis of functional outcomes and quality of life in a prospective series of 51BT and 42Da Vinci prostatectomies DV. Materials and Methods: Comparative analysis of functional outcomes and quality of life in a prospective series of 93 patients with low-risk localized PC diagnosed in 2011. 51 patients underwent low-dose rate BT and the other 42 patients RALP. IIEF to assess erectile function, ICIQ to evaluate continence and SF36 test to quality of life wee employed. Results: ICIQ at the first revision shows significant differences which favour the BT group, 79% present with continence or mild incontinence, whereas in the DV group 45% show these positive results. Differences disappear after 6 months, with 45 patients (89%) presenting with continence or mild incontinence in the BT group vs. 30 (71%) in the DV group. 65% of patients are potent in the first revision following BT and 39% following DV. Such differences are not significant and cannot be observed after 6 months. No significant differences were found in the comparative analysis of quality of life. Conclusions: ICIQ after surgery shows significant differences in favour of BT, which disappear after 6 months. Both procedures have a serious impact on erectile function, being even greater in the DV group. Differences between groups disappear after 6 months. (author)

  15. Comparative analysis of short - term functional outcomes and quality of life in a prospective series of brachytherapy and Da Vinci robotic prostatectomy

    Energy Technology Data Exchange (ETDEWEB)

    Garcia-Sanchez, Cristina; Roman Martin, Ana A.; Conde-Sanchez, J. Manuel; Congregado-Ruiz, C. Belen; Osman-Garcia, Ignacio; Medina-Lopez, Rafael A. [Virgen del Rocio Universitary Hospital, Seville (Spain)

    2017-03-15

    Introduction: There is a growing interest in achieving higher survival rates with the lowest morbidity in localized prostate cancer (PC) treatment. Consequently, minimally invasive techniques such as low-dose rate brachytherapy (BT) and robotic-assisted prostatectomy (RALP) have been developed and improved. Comparative analysis of functional outcomes and quality of life in a prospective series of 51BT and 42Da Vinci prostatectomies DV. Materials and Methods: Comparative analysis of functional outcomes and quality of life in a prospective series of 93 patients with low-risk localized PC diagnosed in 2011. 51 patients underwent low-dose rate BT and the other 42 patients RALP. IIEF to assess erectile function, ICIQ to evaluate continence and SF36 test to quality of life wee employed. Results: ICIQ at the first revision shows significant differences which favour the BT group, 79% present with continence or mild incontinence, whereas in the DV group 45% show these positive results. Differences disappear after 6 months, with 45 patients (89%) presenting with continence or mild incontinence in the BT group vs. 30 (71%) in the DV group. 65% of patients are potent in the first revision following BT and 39% following DV. Such differences are not significant and cannot be observed after 6 months. No significant differences were found in the comparative analysis of quality of life. Conclusions: ICIQ after surgery shows significant differences in favour of BT, which disappear after 6 months. Both procedures have a serious impact on erectile function, being even greater in the DV group. Differences between groups disappear after 6 months. (author)

  16. A One-Dimensional, Noniterative Trajectory Model (With a C++ Implementation)

    Science.gov (United States)

    2014-03-01

    maF = (6) 2 2 1 AvC m a Dρ−=⇒ (7) Next, the definitions of speed and acceleration can be used to find acceleration as a function of speed and...position: dt dxv ≡ (8) and dt dx dx dv dt dva =≡ (9) dx dvva =⇒ (10) Combining equations 7 and 10, AvC mdx dv Dρ2 1 −= (11) Next

  17. Characterization of a genome-specific Gypsy-like retrotransposon ...

    Indian Academy of Sciences (India)

    Aegilops ventricosa. As 106. DvDvMvMv. Ae. uniaristata. As136. M. Ae. tauschii. 38. D. T. durum - D. villosum amphipoild. Th1w, Th2w, Th3w, Th1,Th3. ABV. T. aestivum (CS) - D. villorum additional lines. Add. *. 1V-7V. ABDV. *. Add. indicates wheat - D. villosum addition lines. Journal of Genetics, Vol. 92, No. 1, April 2013.

  18. 78 FR 69849 - Issuance of an Experimental Use Permit

    Science.gov (United States)

    2013-11-21

    ... http://www.regulations.gov or at the Office of Pesticide Programs Regulatory Public Docket (OPP Docket... Dv49 double stranded RNA (dsRNA) suppression cassette in combination with Bacillus thuringiensis (Bt....105, Cry2Ab2, Vip3Aa20, Dv49 dsRNA, Cry3Bb1, Cry34Ab1, Cry35Ab1, eCry3.1Ab, respectively) are to be...

  19. Domestic Violence as a Risk Factor for Attempted Suicide in Married Women.

    Science.gov (United States)

    Indu, Pankajakshan Vijayanthi; Remadevi, Sivaraman; Vidhukumar, Karunakaran; Shah Navas, Peer Mohammed; Anilkumar, Thekkethayyil Viswanathan; Subha, Nanoo

    2017-08-01

    High rates of suicide attempts and domestic violence (DV) in women of reproductive age group have been reported from South India, but the association between them was not studied. Hence, this study was undertaken to assess whether DV is a risk factor for attempted suicide in married women of reproductive age group. A hospital-based case-control study with 77 incident cases of attempted suicide in married women of the age group of 18 to 45 years and 153 controls belonging to the same age group, without history of suicide attempt, was undertaken over a period of 6 months. Univariate and multivariate analyses were done. The crude odds ratio (cOR) for DV was found to be 6.15 (95% confidence interval [95% CI] = [2.95, 12.82], p value = .0001). Other statistically significant risk factors included younger age group (below 30 years); gross family income > Rs. 5,000; higher occupational status of spouse; having poor social support; having a family history of psychiatric disorders, substance use disorders, and suicide/suicide attempt; higher impulsiveness scores; having higher scores of stressful life events over the past 12 months, and alcohol use disorder in husband. Islamic faith was found to be a significant protective factor. On logistic regression, DV was found to be an independent risk factor for attempted suicide in this study population (adjusted OR = 3.79, 95% CI = [1.35, 10.62], p value = .011). Age groups, stressful life events, impulsiveness, and alcohol use disorder in husband were the confounders adjusted for in logistic regression along with other significant risk and protective factors. Significant dose-response relationship was also observed between DV and attempted suicide. In accordance with the stress-diathesis model for suicidal behavior, DV is found to be a stressor which precipitates suicide attempt in those with diathesis like family history of psychiatric disorders. Clinical, research, and policy implications of the findings are discussed.

  20. Dose-volume histograms based on serial intravascular ultrasound: a calculation model for radioactive stents

    International Nuclear Information System (INIS)

    Kirisits, Christian; Wexberg, Paul; Gottsauner-Wolf, Michael; Pokrajac, Boris; Ortmann, Elisabeth; Aiginger, Hannes; Glogar, Dietmar; Poetter, Richard

    2001-01-01

    Background and purpose: Radioactive stents are under investigation for reduction of coronary restenosis. However, the actual dose delivered to specific parts of the coronary artery wall based on the individual vessel anatomy has not been determined so far. Dose-volume histograms (DVHs) permit an estimation of the actual dose absorbed by the target volume. We present a method to calculate DVHs based on intravascular ultrasound (IVUS) measurements to determine the dose distribution within the vessel wall. Materials and methods: Ten patients were studied by intravascular ultrasound after radioactive stenting (BX Stent, P-32, 15-mm length) to obtain tomographic cross-sections of the treated segments. We developed a computer algorithm using the actual dose distribution of the stent to calculate differential and cumulative DVHs. The minimal target dose, the mean target dose, the minimal doses delivered to 10 and 90% of the adventitia (DV10, DV90), and the percentage of volume receiving a reference dose at 0.5 mm from the stent surface cumulated over 28 days were derived from the DVH plots. Results were expressed as mean±SD. Results: The mean activity of the stents was 438±140 kBq at implantation. The mean reference dose was 111±35 Gy, whereas the calculated mean target dose within the adventitia along the stent was 68±20 Gy. On average, DV90 and DV10 were 33±9 Gy and 117±41 Gy, respectively. Expanding the target volume to include 2.5-mm-long segments at the proximal and distal ends of the stent, the calculated mean target dose decreased to 55±17 Gy, and DV 90 and DV 10 were 6.4±2.4 Gy and 107±36 Gy, respectively. Conclusions: The assessment of DVHs seems in principle to be a valuable tool for both prospective and retrospective analysis of dose-distribution of radioactive stents. It may provide the basis to adapt treatment planning in coronary brachytherapy to the common standards of radiotherapy

  1. Single-atom catalysts for CO2 electroreduction with significant activity and selectivity improvements† †Electronic supplementary information (ESI) available. See DOI: 10.1039/c6sc03911a Click here for additional data file.

    Science.gov (United States)

    Back, Seoin; Lim, Juhyung; Kim, Na-Young; Kim, Yong-Hyun

    2017-01-01

    A single-atom catalyst (SAC) has an electronic structure that is very different from its bulk counterparts, and has shown an unexpectedly high specific activity with a significant reduction in noble metal usage for CO oxidation, fuel cell and hydrogen evolution applications, although physical origins of such performance enhancements are still poorly understood. Herein, by means of density functional theory (DFT) calculations, we for the first time investigate the great potential of single atom catalysts for CO2 electroreduction applications. In particular, we study a single transition metal atom anchored on defective graphene with single or double vacancies, denoted M@sv-Gr or M@dv-Gr, where M = Ag, Au, Co, Cu, Fe, Ir, Ni, Os, Pd, Pt, Rh or Ru, as a CO2 reduction catalyst. Many SACs are indeed shown to be highly selective for the CO2 reduction reaction over a competitive H2 evolution reaction due to favorable adsorption of carboxyl (*COOH) or formate (*OCHO) over hydrogen (*H) on the catalysts. On the basis of free energy profiles, we identified several promising candidate materials for different products; Ni@dv-Gr (limiting potential U L = –0.41 V) and Pt@dv-Gr (–0.27 V) for CH3OH production, and Os@dv-Gr (–0.52 V) and Ru@dv-Gr (–0.52 V) for CH4 production. In particular, the Pt@dv-Gr catalyst shows remarkable reduction in the limiting potential for CH3OH production compared to any existing catalysts, synthesized or predicted. To understand the origin of the activity enhancement of SACs, we find that the lack of an atomic ensemble for adsorbate binding and the unique electronic structure of the single atom catalysts as well as orbital interaction play an important role, contributing to binding energies of SACs that deviate considerably from the conventional scaling relation of bulk transition metals. PMID:28451248

  2. ASSOCIATION OF DRUSEN VOLUME WITH CHOROIDAL PARAMETERS IN NONNEOVASCULAR AGE-RELATED MACULAR DEGENERATION.

    Science.gov (United States)

    Balasubramanian, Siva; Lei, Jianqin; Nittala, Muneeswar G; Velaga, Swetha B; Haines, Jonathan; Pericak-Vance, Margaret A; Stambolian, Dwight; Sadda, SriniVas R

    2017-10-01

    The choroid is thought to be relevant to the pathogenesis of nonneovascular age-related macular degeneration, but its role has not yet been fully defined. In this study, we evaluate the relationship between the extent of macular drusen and specific choroidal parameters, including thickness and intensity. Spectral domain optical coherence tomography images were collected from two distinct, independent cohorts with nonneovascular age-related macular degeneration: Amish (53 eyes of 34 subjects) and non-Amish (40 eyes from 26 subjects). All spectral domain optical coherence tomography scans were obtained using the Cirrus HD-OCT with a 512 × 128 macular cube (6 × 6 mm) protocol. The Cirrus advanced retinal pigment epithelium analysis tool was used to automatically compute drusen volume within 3 mm (DV3) and 5 mm (DV5) circles centered on the fovea. The inner and outer borders of the choroid were manually segmented, and the mean choroidal thickness and choroidal intensity (i.e., brightness) were calculated. The choroidal intensity was normalized against the vitreous and nerve fiber layer reflectivity. The correlation between DV and these choroidal parameters was assessed using Pearson and linear regression analysis. A significant positive correlation was observed between normalized choroidal intensity and DV5 in the Amish (r = 0.42, P = 0.002) and non-Amish (r = 0.33, P = 0.03) cohorts. Also, DV3 showed a significant positive correlation with normalized choroidal intensity in both the groups (Amish: r = 0.30, P = 0.02; non-Amish: r = 0.32, P = 0.04). Choroidal thickness was negatively correlated with normalized choroidal intensity in both Amish (r = -0.71, P = 0.001) and non-Amish (r = -0.43, P = 0.01) groups. Normalized choroidal intensity was the most significant constant predictor of DV in both the Amish and non-Amish groups. Choroidal intensity, but not choroidal thickness, seems to be associated with drusen volume in Amish and non-Amish populations. These

  3. Characterization of the mode of action of a potent dengue virus capsid inhibitor.

    Science.gov (United States)

    Scaturro, Pietro; Trist, Iuni Margaret Laura; Paul, David; Kumar, Anil; Acosta, Eliana G; Byrd, Chelsea M; Jordan, Robert; Brancale, Andrea; Bartenschlager, Ralf

    2014-10-01

    Dengue viruses (DV) represent a significant global health burden, with up to 400 million infections every year and around 500,000 infected individuals developing life-threatening disease. In spite of attempts to develop vaccine candidates and antiviral drugs, there is a lack of approved therapeutics for the treatment of DV infection. We have previously reported the identification of ST-148, a small-molecule inhibitor exhibiting broad and potent antiviral activity against DV in vitro and in vivo (C. M. Byrd et al., Antimicrob. Agents Chemother. 57:15-25, 2013, doi:10 .1128/AAC.01429-12). In the present study, we investigated the mode of action of this promising compound by using a combination of biochemical, virological, and imaging-based techniques. We confirmed that ST-148 targets the capsid protein and obtained evidence of bimodal antiviral activity affecting both assembly/release and entry of infectious DV particles. Importantly, by using a robust bioluminescence resonance energy transfer-based assay, we observed an ST-148-dependent increase of capsid self-interaction. These results were corroborated by molecular modeling studies that also revealed a plausible model for compound binding to capsid protein and inhibition by a distinct resistance mutation. These results suggest that ST-148-enhanced capsid protein self-interaction perturbs assembly and disassembly of DV nucleocapsids, probably by inducing structural rigidity. Thus, as previously reported for other enveloped viruses, stabilization of capsid protein structure is an attractive therapeutic concept that also is applicable to flaviviruses. Dengue viruses are arthropod-borne viruses representing a significant global health burden. They infect up to 400 million people and are endemic to subtropical and tropical areas of the world. Currently, there are neither vaccines nor approved therapeutics for the prophylaxis or treatment of DV infections, respectively. This study reports the characterization of the

  4. Estudo do sonograma do ducto venoso em fetos com centralização hemodinâmica: avaliação de repercussões perinatais Study of ductus venosus in fetuses with brain sparing reflex: evaluation of perinatal outcomes

    Directory of Open Access Journals (Sweden)

    Paulo Roberto Nassar de Carvalho

    2006-04-01

    Full Text Available OBJETIVO: avaliar a associação da relação sístole ventricular/atrial (S/A do ducto venoso (DV com resultados perinatais em fetos prematuros com centralização de fluxo à dopplervelocimetria. MÉTODOS: o estudo foi delineado como um estudo observacional, transversal, com os dados colhidos de forma prospectiva. A relação S/A do DV foi estudada em 41 fetos centralizados com idade gestacional (IG entre 25 e 33ª semana completa, no período de novembro de 2002 a julho de 2005. Os recém-nascidos foram acompanhados até o 28º dia pós-parto na UTI da Clínica Perinatal Laranjeiras, buscando-se complicações neonatais. A população de estudo foi dividida em dois grupos a partir do resultado do DV. Foram incluídos no grupo normal os fetos com relação S/A menor ou igual a 3,6 e no grupo alterado aqueles com valores de S/A maiores que 3,6. A comparação entre os grupos foi realizada com os testes estatísticos de Mann-Whitney, chi2 e exato de Fisher. Todos os resultados foram considerados estatisticamente significativos se p3,6. Não houve diferença significativa entre os grupos quanto à IG ao nascimento e Apgar PURPOSE: to evaluate the relationship between S/A ratio in ductus venosus (DV and perinatal outcomes in fetuses with brain sparing reflex. METHODS: the study was designed as an observational, sectional study with prospectively collected data. Forty-one fetuses with brain sparing reflex and gestational age between 25 and 33 weeks were studied between November 2002 and July 2005. The newborns were observed during the neonatal period in the intensive care unit of "Clínica Perinatal Laranjeiras" in order to find adverse outcomes. The study population was divided into two groups according to DV assessment. In the normal group all the fetuses with S/A ratio values of 3.6 or less were included, and in the abnormal group the fetuses with values of S/A ratio greater than 3.6. The statistical analysis was performed by the Mann-Whitney U

  5. Human Deception Detection from Whole Body Motion Analysis

    Science.gov (United States)

    2015-12-01

    associated with incentivized deception, an initial reward /punishment protocol was designed to apply a level of stakes/significance to the checkpoint...questionnaire asking them about their emotions and deception strategy . Once completed, the participants removed all the markers and changed into their... Sony MiniDV Handycam® Camcorder, Model # DCR-HC38. All camera footage were saved to MiniDV tape and then transferred to a PC for processing. Once

  6. Simulating and Testing a DC-DC Half-Bridge SLR Converter

    Science.gov (United States)

    2013-06-01

    future pulse power demands with ship power, a large bank of capacitors or similar rapid discharge source is required. If capacitors are charged...Single Pulsed Avalanche Energy (j) I" Avalanche Current (i) E,, Repetilive Avalanche Energy (i) dv/dt Peak Diode Recovery dv/dt ® Po Total Power...SLR), battery charging, DC-DC, pulse power, power electronics, SLR converter 15. NUMBER OF PAGES 119 16. PRICE CODE 17. SECURITY CLASSIFICATION

  7. Development of Milestone Schedules for Selected Logistics Support Directorate Programs. Appendix A. Part 2. Task Summaries.

    Science.gov (United States)

    1987-09-15

    LOGISTIC SUPPORT (ILS) COST ESTIMATE SCODE NUMBER: NONE -ESPONSIBILITY: ROY & ILS ’,!,RATION: 22.00 WORK DAYS A-221 * .9 ..- 9 * PAGE: .LSMTEST SCHEDULE: CE...0/ TIPO SCHEDULE: DV CONDUCT A PERFORMANCE DEMONSTRATION PRIOR TO TECHNICAL TEST CODE NUMBER: NONE (TT) I AND USER TEST (UT) I. RESPONSIBILITY...RESPONSIBILITY: BELVOIR LAB DURATION: 20.00 WORK DAYS ENG DE I SCHEDULE: DV ENGINEERING DESIGN INITIATED. CODE NUMBER: NONE RESPONSIBILITY: BELVOIR LAB

  8. Kunsten at dvæle i dialogen

    DEFF Research Database (Denmark)

    Stelter, Reinhard

    en drøm, nemlig at føre dialoger, som beriger begge parter – vel vidende, at dialogholderen, fx coachen, har et særligt ansvar for dialogens fremgang. Bogen henvender sig til alle, der ønsker at styrke deres evner som samskabende dialogpartner – uanset om man er coach, mentor, leder, kollega......I denne bog forholder Reinhard Stelter sig til de kritiske stemmer, som har rejst sig i forhold til coaching. Denne kritik anses for berettiget, især når man placerer coaching som middel til optimering af den enkeltes præstationsræs og som simpelt motivationsinstrument. Præstationssubjektet har...... nået sine grænser og skal mødes med omsorg og forståelse. Forfatterens ambition er at inddrage tredje generations coaching i en søgen efter en bæredygtig, frugtbar og åben dialogform, som kan bruges I mange livskontekster. Dialogpartneren frigøres ved at inviteres til at finde sit etiske ståsted...

  9. Superiority of Equivalent Uniform Dose (EUD)-Based Optimization for Breast and Chest Wall

    International Nuclear Information System (INIS)

    Mihailidis, Dimitris N.; Plants, Brian; Farinash, Lloyd; Harmon, Michael; Whaley, Lewis; Raja, Prem; Tomara, Pelagia

    2010-01-01

    We investigate whether IMRT optimization based on generalized equivalent uniform dose (gEUD) objectives for organs at risk (OAR) results in superior dosimetric outcomes when compared with multiple dose-volume (DV)-based objectives plans for patients with intact breast and postmastectomy chest wall (CW) cancer. Four separate IMRT plans were prepared for each of the breast and CW cases (10 patients). The first three plans used our standard in-house, physician-selected, DV objectives (phys-plan); gEUD-based objectives for the OARs (gEUD-plan); and multiple, 'very stringent,' DV objectives for each OAR and PTV (DV-plan), respectively. The fourth plan was only beam-fluence optimized (FO-plan), without segmentation, which used the same objectives as in the DV-plan. The latter plan was to be used as an 'optimum' benchmark without the effects of the segmentation for deliverability. Dosimetric quantities, such as V 20Gy for the ipsilateral lung and mean dose (D mean ) for heart, contralateral breast, and contralateral lung were used to evaluate the results. For all patients in this study, we have seen that the gEUD-based plans allow greater sparing of the OARs while maintaining equivalent target coverage. The average ipsilateral lung V 20Gy reduced from 22 ± 4.4% for the FO-plan to 18 ± 3% for the gEUD-plan. All other dosimetric quantities shifted towards lower doses for the gEUD-plan. gEUD-based optimization can be used to search for plans of different DVHs with the same gEUDs. The use of gEUD allows selective optimization and reduction of the dose for each OAR and results in a truly individualized treatment plan.

  10. Acute Systemic Infection with Dengue Virus Leads to Vascular Leakage and Death through Tumor Necrosis Factor-α and Tie2/Angiopoietin Signaling in Mice Lacking Type I and II Interferon Receptors.

    Science.gov (United States)

    Phanthanawiboon, Supranee; Limkittikul, Kriengsak; Sakai, Yusuke; Takakura, Nobuyuki; Saijo, Masayuki; Kurosu, Takeshi

    2016-01-01

    Severe dengue is caused by host responses to viral infection, but the pathogenesis remains unknown. This is, in part, due to the lack of suitable animal models. Here, we report a non-mouse-adapted low-passage DENV-3 clinical isolate, DV3P12/08, derived from recently infected patients. DV3P12/08 caused a lethal systemic infection in type I and II IFN receptor KO mice (IFN-α/β/γR KO mice), which have the C57/BL6 background. Infection with DV3P12/08 induced a cytokine storm, resulting in severe vascular leakage (mainly in the liver, kidney and intestine) and organ damage, leading to extensive hemorrhage and rapid death. DV3P12/08 infection triggered the release of large amounts of TNF-α, IL-6, and MCP-1. Treatment with a neutralizing anti-TNF-α antibody (Ab) extended survival and reduced liver damage without affecting virus production. Anti-IL-6 neutralizing Ab partly prolonged mouse survival. The anti-TNF-α Ab suppressed IL-6, MCP-1, and IFN-γ levels, suggesting that the severe response to infection was triggered by TNF-α. High levels of TNF-α mRNA were expressed in the liver and kidneys, but not in the small intestine, of infected mice. Conversely, high levels of IL-6 mRNA were expressed in the intestine. Importantly, treatment with Angiopoietin-1, which is known to stabilize blood vessels, prolonged the survival of DV3P12/08-infected mice. Taken together, the results suggest that an increased level of TNF-α together with concomitant upregulation of Tie2/Angiopoietin signaling have critical roles in severe dengue infection.

  11. Response of water vapour D-excess to land-atmosphere interactions in a semi-arid environment

    KAUST Repository

    Parkes, Stephen

    2016-06-30

    The stable isotopic composition of water vapour provides information about moisture sources and processes difficult to obtain with traditional measurement techniques. Recently, it has been proposed that the D-excess of water vapour can provide a diagnostic tracer of continental moisture recycling. However, D-excess exhibits a diurnal cycle that has been observed across a variety of ecosystems and may be influenced by a range of processes beyond regional-scale moisture recycling, including local evaporation (ET) fluxes. There is a lack of measurements of D-excess in evaporation (ET) fluxes, which has made it difficult to assess how ET fluxes modify the Dexcess in water vapour (dv). With this in mind, we employed a chamber-based approach to directly measure D-excess in ET (dET) fluxes. We show that ET fluxes imposed a negative forcing on the ambient vapour and could not explain the higher daytime dv values. The low dET observed here was sourced from a soil water pool that had undergone an extended drying period, leading to low D-excess in the soil moisture pool. A strong correlation between daytime dv and locally measured relative humidity was consistent with an oceanic moisture source, suggesting that remote hydrological processes were the major contributor to daytime dv variability. During the early evening, ET fluxes into a shallow nocturnal inversion layer caused a lowering of dv values near the surface. In addition, transient mixing of vapour with a higher D-excess from above the nocturnal inversion modified these values, causing large variability during the night. These results indicate dET can generally be expected to show

  12. Kepler Data Validation Time Series File: Description of File Format and Content

    Science.gov (United States)

    Mullally, Susan E.

    2016-01-01

    The Kepler space mission searches its time series data for periodic, transit-like signatures. The ephemerides of these events, called Threshold Crossing Events (TCEs), are reported in the TCE tables at the NASA Exoplanet Archive (NExScI). Those TCEs are then further evaluated to create planet candidates and populate the Kepler Objects of Interest (KOI) table, also hosted at the Exoplanet Archive. The search, evaluation and export of TCEs is performed by two pipeline modules, TPS (Transit Planet Search) and DV (Data Validation). TPS searches for the strongest, believable signal and then sends that information to DV to fit a transit model, compute various statistics, and remove the transit events so that the light curve can be searched for other TCEs. More on how this search is done and on the creation of the TCE table can be found in Tenenbaum et al. (2012), Seader et al. (2015), Jenkins (2002). For each star with at least one TCE, the pipeline exports a file that contains the light curves used by TPS and DV to find and evaluate the TCE(s). This document describes the content of these DV time series files, and this introduction provides a bit of context for how the data in these files are used by the pipeline.

  13. Co-occupant's exposure to exhaled pollutants with two types of personalized ventilation strategies under mixing and displacement ventilation systems.

    Science.gov (United States)

    Li, X; Niu, J; Gao, N

    2013-04-01

    Personalized ventilation (PV) system in conjunction with total ventilation system can provide cleaner inhaled air for the user. Concerns still exist about whether the normally protecting PV device, on the other hand, facilitates the dispersion of infectious agents generated by its user. In this article, two types of PV systems with upward supplied fresh air, namely a chair-based PV and one kind of desk-mounted PV systems, when combined with mixing ventilation (MV) and displacement ventilation (DV) systems, are investigated using simulation method with regard to their impacts on co-occupant's exposure to the exhaled droplet nuclei generated by the infected PV user. Simulation results of tracer gas and particles with aerodynamic diameter of 1, 5, and 10 μm from exhaled air show that, when only the infected person uses a PV, the different PV air supplying directions present very different impacts on the co-occupant's intake under DV, while no apparent differences can be observed under MV. The findings demonstrate that better inhaled air quality can always be achieved under DV when the adopted PV system can deliver conditioned fresh air in the same direction with the mainly upward airflow patterns of DV. © 2012 John Wiley & Sons A/S. Published by Blackwell Publishing Ltd.

  14. B-mode and Doppler ultrasonography of adrenal glands of healthy dogs

    Directory of Open Access Journals (Sweden)

    S. Fernandez

    2016-08-01

    Full Text Available ABSTRACT The aim of this study was to determine the vascular indices of adrenal blood flow in healthy dogs (systolic velocity - SV; diastolic velocity - DV; resistance index - RI. Eighteen dogs (thirty six adrenal were studied. Physical examination, biochemical profile and dexamethasone suppression test were performed to determine general health status. Echotexture, size, contours and margins, and overall shape of the adrenal gland (right and left were assessed via ultrasound. By spectral Doppler of the phrenic-abdominal artery, the SV, DV, and RI were acquired. Animals did not show alterations in clinical and laboratory examination and suppression of cortisol. Normal homogeneous and echotexture, regular contours and margins and normal shape and size were verified via B mode. Spectral Doppler of the phrenic-abdominal artery showed monophasic-patterned waves and low vascular resistance and systolic peak evident with means values: left adrenal - SV = 31.34cm/s, DV = 9.54cm/s and RI = 0.69; and right adrenal - SV = 27.83cm/s, DV = 7.71cm/s and RI = 0.68. Doppler evaluation of adrenal was easily implemented and may provide base line data in the study, allowing for the use of this technique as a diagnostic tool for diseases of the dog's adrenal.

  15. Understanding How Domestic Violence Support Services Promote Survivor Well-being: A Conceptual Model.

    Science.gov (United States)

    Sullivan, Cris M

    2018-01-01

    Domestic violence (DV) victim service programs have been increasingly expected by legislators and funders to demonstrate that they are making a significant difference in the lives of those using their services. Alongside this expectation, they are being asked to describe the Theory of Change guiding how they believe their practices lead to positive results for survivors and their children. Having a widely accepted conceptual model is not just potentially useful to funders and policy makers as they help shape policy and practice -- it can also help programs continually reflect upon and improve their work. This paper describes the iterative and collaborative process undertaken to generate a conceptual model describing how DV victim services are expected to improve survivors' lives. The Social and Emotional Well-Being Framework guiding the model is an ideal structure to use to describe the goals and practices of DV programs because this framework: (1) accurately represents DV programs' goal of helping survivors and their children thrive; and (2) recognizes the importance of community, social, and societal context in influencing individuals' social and emotional well-being. The model was designed to guide practice and to generate new questions for research and evaluation that address individual, community, and systems factors that promote or hinder survivor safety and well-being.

  16. Assessing and Enhancing Health Care Providers’ Response to Domestic Violence

    Directory of Open Access Journals (Sweden)

    Tuija Leppäkoski

    2014-01-01

    Full Text Available This study aimed to examine possible changes from 2008 to 2012 in the skills of health care staff in identifying and intervening in domestic violence (DV. A longitudinal descriptive study design with volunteer samples (baseline; n=68, follow-up; n=100 was used to acquire information regarding the present state and needs of the staff in practices related to DV. The results of the baseline survey were used as a basis for planning two interventions: staff training and drafting practical guidelines. Information was collected by questionnaires from nurses, physicians, and social workers and supplemented by responses from the interviews. The data were analysed using both quantitative and qualitative methods. A chi-square test was used to test the statistical significance of the data sets. In addition, participants’ quotes are used to describe specific phenomena or issues. The comparison showed that overall a small positive change had taken place between the study periods. However, the participants were aware of their own shortcomings in identifying and intervening in DV. Changes happen slowly, and administrative support is needed to sustain such changes. Therefore, this paper offers recommendations to improve health care providers’ response to DV. Moreover, there is a great need for evaluating the training programme used.

  17. Study of Nitrate Stress in Desulfovibrio vulgaris Hildenborough Using iTRAQ Proteomics

    Energy Technology Data Exchange (ETDEWEB)

    Redding, A.M.; Mukhopadhyay, A.; Joyner, D.; Hazen, T.C.; Keasling, J.D.

    2006-10-12

    The response of Desulfovibrio vulgaris Hildenborough (DvH),a sulphate-reducing bacterium, to nitrate stress was examined usingquantitative proteomic analysis. DvH was stressed with 105 m M sodiumnitrate(NaNO3), a level that caused a 50 percent inhibition in growth.The protein profile of stressed cells was compared with that of cellsgrown in the absence of nitrate using the iTRAQ peptide labellingstrategy and tandem liquid chromatography separation coupled with massspectrometry (quadrupoletime-of-flight) detection. A total of 737 uniqueproteins were identified by two or more peptides, representing 22 percentof the total DvH proteome and spanning every functional category. Theresults indicate that this was a mild stress, as proteins involved incentral metabolism and the sulphate reduction pathway were unperturbed.Proteins involved in the nitrate reduction pathway increased. Increasesseen in transport systems for proline, glycine^ betaineandglutamateindicate that the NaNO3 exposure led to both salt stress and nitratestress.Up-regulation observed in oxidative stress response proteins (Rbr,RbO, etc.) and a large number of ABC transport systems as well as in iron^ sulphur -cluster-containing proteins, however, appear to be specific tonitrate exposure. Finally, a number of hypothetical proteins were amongthe most significant changers, indicating that there may be unknownmechanisms initiated upon nitrate stress in DvH.

  18. Edge functionalised & Li-intercalated 555-777 defective bilayer graphene for the adsorption of CO2 and H2O

    Science.gov (United States)

    Lalitha, Murugan; Lakshmipathi, Senthilkumar; Bhatia, Suresh K.

    2017-04-01

    The adsorption of CO2 and H2O on divacanacy (DV) defected graphene cluster, and its bilayer counterpart is investigated using first-principles calculations. Both single and bilayer DV graphene cluster, are functionalised with H and F atoms. On these sheets the gas molecules are physisorbed, and the divacancy defect effectively improves the adsorption of CO2, while fluorination enhances the hydrophobicity of the graphene cluster. Among the convex and concave curvature regions induced due to the DV defect, the adsorption of the gas molecules on the concave meniscus is more favourable. Fluorine termination induces 73% reduction in Henry law constants for H2O, while for the CO2 molecule it increases by 8%, which indicates the DV defective sheet is a better candidate for CO2 capture compared to the STW defective sheet. Besides, both AA and AB divacant defect bilayer sheets are equally stable, wherein AA stacking results in a cavity between the sheets, while in AB stacking, the layers slide one over the other. Nevertheless, both these bilayer sheets are comparatively stabler than the monolayer. However, intercalation of lithium decreases the interlayer separation, particularly in AA stacking, which enhances the CO2 adsorption, but in the Bernal stacking enhances it hydrophobicity.

  19. Xylo-oligosaccharides and inulin affect genotoxicity and bacterial populations differently in a human colonic simulator challenged with soy protein

    DEFF Research Database (Denmark)

    Christophersen, C. T.; Petersen, Anne; Licht, Tine Rask

    2013-01-01

    High dietary intakes of some protein sources, including soy protein, can increase colonic DNA damage in animals, whereas some carbohydrates attenuate this. We investigated whether inulin and xylo-oligosaccharides (XOS) could be protective against DNA strand breaks by adding them to a human colonic...... cornstarch for 10 day followed by soy protein with 1% XOS or 1% inulin for 10 day. Inulin did not alter genotoxicity but XOS significantly reduced PV genotoxicity and increased DV genotoxicity. Inulin and XOS significantly increased butyrate concentration in the DV but not PV. Numbers of the key butyrate......-producing bacterium Faecalibacterium prausnitzii were significantly increased in the PV and DV by inulin but significantly decreased by XOS in both vessels. Other bacteria examined were also significantly impacted by the carbohydrate treatments or by the vessel (i.e., pH). There was a significant overall inverse...

  20. The Role of Social Support on the Relationship between Gender and Career Progression in STEM Academia

    Science.gov (United States)

    2015-03-26

    sciences. According to the article, gender stereotyping was still an issue for women in STEM while treatment in other fields improved. The authors...Minimum Maximum Sum Mean Std. Deviation Gender DV (1= Male ) .00 1.00 50.00 .7692 .42460 Google Scholar Articles 0 192 2658 42.87 38.863 Years...Predictors: (Constant), Gender DV (1= Male ) Dependent Variable: Rank Results of analysis supported the hypothesis that gender is a predictor of the

  1. Wireless Sensor Network Localization Research

    OpenAIRE

    Liang Xin

    2014-01-01

    DV-Hop algorithm is one of the important range-free localization algorithms. It performs better in isotropic density senor networks, however, it brings larger location errors in random distributed networks. According to the localization principle of the DV-Hop algorithm, this paper improves the estimation of average single hop distance by using the Least Equal Square Error, and revises the estimated distance between the unknown node and the anchor node with compensation coefficient considerin...

  2. Management a leadership ve 20. století

    OpenAIRE

    Šafránková, Noemi

    2009-01-01

    The bachelor thesis describes the development of most famous theories of management and leadership in 20th century that had and still do have great influence over our managerial and organisational thinking. The focus of this paper is to describe and critically evaluate the contribution of these theoretical disciplines from a human factor's perception of organisation. The first part of the thesis is focused on "big theoretical concepts" of "taylorism", Fayol's concept of managerial functions a...

  3. The detection of hemorrhagic proteins in snake venoms using monoclonal antibodies against Virginia opossum (Didelphis virginiana) serum.

    Science.gov (United States)

    Sánchez, E E; García, C; Pérez, J C; De La Zerda, S J

    1998-10-01

    Most snakes and a few warm-blooded animals have a resistance to snake venoms because of naturally occurring antihemorrhagins found in their sera. The antihemorrhagins in serum of Virginia opossum (Didelphis virginiana) neutralize hemorrhagic activity by binding to hemorrhagins in snake venoms. The binding characteristic of antihemorrhagins in D. virginiana serum was used to develop a five-step western blot. The detection of hemorrhagic proteins were measured indirectly with antihemorrhagins in Virginia opossum serum and with DV-2LD#2, a monoclonal antibody specific for Virginia opossum antihemorrhagins. Snake venoms were separated by native-PAGE, transferred to a Millipore Immobilon-P membrane and then incubated with crude Virginia opossum serum. The hemorrhagins in snake venom bind to antihemorrhagins in Virginia opossum serum which react with DV-2LD#2 a monoclonal antibody that is specific for Virginia opossum antihemorrhagins. DV-2LD#2 monoclonal antibody inhibits antihemorrhagic activity in Virginia opossum serum when mixed in equal amounts. The inhibition of antihemorrhagins by DV-2LD#2 monoclonal antibody suggests specificity. DV-2LD#2 monoclonal antibody does not recognize antihemorrhagins in gray woodrat (Neotoma micropus) serum. The five-step western blot reveals two well-defined bands which represent hemorrhagins found in Western diamondback rattlesnake (Crotalus atrox) venom. Venoms from 15 different snake species were examined to determine the usefulness of the five-step western blot. Other hemorrhagic venoms (Great Basin rattlesnake (C. viridis lutosus), Prairie rattlesnake (C. viridis viridis), Tancitaran dusky rattlesnake (C. pusillus), Northern Mojave rattlesnake (C. scutulatus scutulatus type B) and Northern Pacific rattlesnake (C. v. oreganus)) had one single band in the five-step western blot. DV-2LD#2 did not bind to the non-hemorrhagic venoms and reacted with 50% of the hemorrhagic venoms used in this study. The monoclonal antibody, CAH

  4. Interventions for domestic violence among pregnant women in low- and middle-income countries: a systematic review protocol.

    Science.gov (United States)

    Sapkota, Diksha; Baird, Kathleen; Saito, Amornrat; Anderson, Debra

    2017-12-12

    Violence during pregnancy is a global problem, associated with serious health risks for both the mother and baby. Evaluation of interventions targeted for reducing or controlling domestic violence (DV) is still in its infancy, and the majority of findings are primarily from high-income countries (HICs). Therefore, there is an urgent need for generating evidence of DV interventions among pregnant women in low- and middle-income countries (LMICs). Preferred Reporting Items for Systematic Reviews and Meta-Analyses (PRISMA) guidelines will be employed to structure the review. A comprehensive search will be carried out via electronic databases including MEDLINE, CINAHL, Scopus, Embase, Web of Science, PsycINFO, and The Cochrane library. Gray literature will also be scrutinized for potential articles. An optimal search strategy has been developed following consultations with subject-matter experts and librarians. This search strategy will be adapted to the different databases. Experimental studies evaluating DV interventions among pregnant women from LMICs will be included in the review. The review will only include literature written in English. Two reviewers will independently screen and assess studies for inclusion in the review. A third author will resolve any discrepancies between the reviewers. Risk of bias will be assessed based on the Cochrane risk of bias assessment tool, and overall quality of the evidence will be judged using Grading of Recommendations, Assessment, Development, and Evaluation (GRADE) criteria. Findings will be presented with the narrative synthesis, and if applicable, they will be further quantified using random-effects meta-analysis. Effect size, risk ratio for dichotomous variables, and standardized mean differences for continuous variables will be calculated for each outcome using Review Manager 5.3. Systematic reviews to evaluate the efficacy of interventions to address DV within the perinatal context have been limited. Hence, no one

  5. TomoTherapy MLC verification using exit detector data

    Energy Technology Data Exchange (ETDEWEB)

    Chen Quan; Westerly, David; Fang Zhenyu; Sheng, Ke; Chen Yu [TomoTherapy Inc., 1240 Deming Way, Madison, Wisconsin 53717 (United States); Department of Radiation Oncology, University of Colorado School of Medicine, Aurora, Colorado 80045 (United States); Xinghua Cancer Hospital, Xinghua, Jiangsu 225700 (China); Department of Radiation Oncology, University of California-Los Angeles, Los Angeles, California 90095 (United States); TomoTherapy Inc., 1240 Deming Way, Madison, Wisconsin 53717 (United States)

    2012-01-15

    Purpose: Treatment delivery verification (DV) is important in the field of intensity modulated radiation therapy (IMRT). While IMRT and image guided radiation therapy (IGRT), allow us to create more conformal plans and enables the use of tighter margins, an erroneously executed plan can have detrimental effects on the treatment outcome. The purpose of this study is to develop a DV technique to verify TomoTherapy's multileaf collimator (MLC) using the onboard mega-voltage CT detectors. Methods: The proposed DV method uses temporal changes in the MVCT detector signal to predict actual leaf open times delivered on the treatment machine. Penumbra and scattered radiation effects may produce confounding results when determining leaf open times from the raw detector data. To reduce the impact of the effects, an iterative, Richardson-Lucy (R-L) deconvolution algorithm is applied. Optical sensors installed on each MLC leaf are used to verify the accuracy of the DV technique. The robustness of the DV technique is examined by introducing different attenuation materials in the beam. Additionally, the DV technique has been used to investigate several clinical plans which failed to pass delivery quality assurance (DQA) and was successful in identifying MLC timing discrepancies as the root cause. Results: The leaf open time extracted from the exit detector showed good agreement with the optical sensors under a variety of conditions. Detector-measured leaf open times agreed with optical sensor data to within 0.2 ms, and 99% of the results agreed within 8.5 ms. These results changed little when attenuation was added in the beam. For the clinical plans failing DQA, the dose calculated from reconstructed leaf open times played an instrumental role in discovering the root-cause of the problem. Throughout the retrospective study, it is found that the reconstructed dose always agrees with measured doses to within 1%. Conclusions: The exit detectors in the TomoTherapy treatment

  6. TomoTherapy MLC verification using exit detector data

    International Nuclear Information System (INIS)

    Chen Quan; Westerly, David; Fang Zhenyu; Sheng, Ke; Chen Yu

    2012-01-01

    Purpose: Treatment delivery verification (DV) is important in the field of intensity modulated radiation therapy (IMRT). While IMRT and image guided radiation therapy (IGRT), allow us to create more conformal plans and enables the use of tighter margins, an erroneously executed plan can have detrimental effects on the treatment outcome. The purpose of this study is to develop a DV technique to verify TomoTherapy's multileaf collimator (MLC) using the onboard mega-voltage CT detectors. Methods: The proposed DV method uses temporal changes in the MVCT detector signal to predict actual leaf open times delivered on the treatment machine. Penumbra and scattered radiation effects may produce confounding results when determining leaf open times from the raw detector data. To reduce the impact of the effects, an iterative, Richardson-Lucy (R-L) deconvolution algorithm is applied. Optical sensors installed on each MLC leaf are used to verify the accuracy of the DV technique. The robustness of the DV technique is examined by introducing different attenuation materials in the beam. Additionally, the DV technique has been used to investigate several clinical plans which failed to pass delivery quality assurance (DQA) and was successful in identifying MLC timing discrepancies as the root cause. Results: The leaf open time extracted from the exit detector showed good agreement with the optical sensors under a variety of conditions. Detector-measured leaf open times agreed with optical sensor data to within 0.2 ms, and 99% of the results agreed within 8.5 ms. These results changed little when attenuation was added in the beam. For the clinical plans failing DQA, the dose calculated from reconstructed leaf open times played an instrumental role in discovering the root-cause of the problem. Throughout the retrospective study, it is found that the reconstructed dose always agrees with measured doses to within 1%. Conclusions: The exit detectors in the TomoTherapy treatment systems

  7. Geluidsexpositie bij Gebruik van Otoplastieken met Communicatie (Sound Exposure Level of F-16 Crew Chiefs Using Custom Molded Communications Earplugs)

    Science.gov (United States)

    2008-10-01

    346 35 39 77 lnfo-DenV@tno nl Datum oktober 2008 Auteur (s) dr. ir. MM..I. Houben J.A. Verhave Rubricering rapport Ongerubriceerd Vastgesteld... Auteur (s) dr. ir. M.M.J. Houben J.A. Verhave Rubricering rapport Ongerubriceerd TNO-rapport | TNO-DV 2008 A395 4/19 Summary Sound exposure level...ontwikkeld om de geluidsexpositie van CEPs te bepalen (TNO-project 032.13072, rapport TNO-DV 2008 A054) [1], In theorie kan het totale

  8. The Prospects of SAS Interferometry for Detection and Classification (SAS Interferometrie voor Detectie en Classificatie)

    Science.gov (United States)

    2008-10-01

    DV2008A176 Opdrachtnummer Datum October 2008 Auteur (s) dr. R. van Vossen B.A.J. Quesson dr.ir. J.C. Sabel Rubricering rapport Ongerubriceerd TH9...TNO report | TNO-DV 2008 A176 4/44 Summary This report presents an overview of the theory and implementation of interferometric SAS processing at TNO... theory in software has been tested on two types of data, simulated and measured. Chapter 3 presents results obtained with simulated data; Chapter 4

  9. EEG characteristics of déjà vu phenomenon

    OpenAIRE

    Chervyakov, Alexander V.; Gnezditskii, Victor V.; Vlasov, Pavel N.; Kalmykova, Galina V.

    2013-01-01

    Introduction. Déjà vu (DV, from French “already seen”) is an aberration of psychic activity associated with transitory erroneous perception of novel circumstances, objects, or people as already known. Aim. Investigation of clinical and diagnostic significance of derealization episodes in epilepsy. Materials and methods. The study involved 166 individuals (mean age 25.2 ± 9.2 yrs; 63.2% women). DV episodes were characterized and compared in groups of healthy volunteers (n = 139) and epilepsy...

  10. A Comparative Analysis of Domestic Violence Shelter Staff Perceptions Regarding Barriers to Services in Bosnia and Herzegovina and the United States.

    Science.gov (United States)

    Grubb, Jonathan A; Muftić, Lisa R

    2017-11-01

    Service provision for domestic violence (DV) survivors has been a long-standing staple of shelters in the United States. Although shelter services provide numerous benefits for survivors, barriers tied to acquisition remain a pressing concern when combatting DV. Nevertheless, there has been minimal research exploring barriers to service acquisition on a cross-national level. As such, the current research cross-nationally examines perceptions of shelter staff regarding acquisition barriers as well as the effectiveness of local agencies to meet survivor needs and differences in populations served in the United States (specifically Texas) as well as in Bosnia and Herzegovina. Data collection stemmed from self-report surveys originally constructed in English and translated into Bosnian/Serbian/Croatian. Results underscored differences between populations served, perceptions of local agencies assisting survivors of DV, and barriers tied to cultural and financial concerns. Implications, limitations, and future directions are also discussed.

  11. At the Intersection of Private and Political Conflict Zones: Policing Domestic Violence in the Arab Community in Israel.

    Science.gov (United States)

    Erez, Edna; Ibarra, Peter R; Gur, Oren M

    2015-08-01

    This article addresses the challenges posed by state intervention in a multicultural society characterized by intense political conflict, juxtaposing the voices of batterers, victims, community members, and the officials who are involved in policing domestic violence (DV) in the Arab community in Israel. A meta-analysis of interview-based data excerpts appearing in published studies shows how the response to DV in the Arab community, though consistent with Israeli law and policy, creates a sense of paralysis for the police and frustration for the parties to the violence as well as the affected communities. The cultural, social, and political forces that underlie the dynamics, tensions, and pressures experienced by the various parties are analyzed in the context of everyday life amid concerns about the Israeli-Arab conflict. The implications for policing DV in minority communities, and for police-community relations in political conflict zones, are highlighted. © The Author(s) 2014.

  12. Child-Witnessed Domestic Violence and its Adverse Effects on Brain Development: A Call for Societal Self-Examination and Awareness

    Science.gov (United States)

    Tsavoussis, Areti; Stawicki, Stanislaw P. A.; Stoicea, Nicoleta; Papadimos, Thomas J.

    2014-01-01

    There is substantial evidence indicating that children who witness domestic violence (DV) have psychosocial maladaptation that is associated with demonstrable changes in the anatomic and physiological make up of their central nervous system. Individuals with these changes do not function well in society and present communities with serious medical, sociological, and economic dilemmas. In this focused perspective, we discuss the psychosocially induced biological alterations (midbrain, cerebral cortex, limbic system, corpus callosum, cerebellum, and the hypothalamic, pituitary, and adrenal axis) that are related to maladaptation (especially post-traumatic stress disorder) in the context of child-witnessed DV, and provide evidence for these physical alterations to the brain. Herein, we hope to stimulate the necessary political discourse to encourage legal systems around the world to make the act of DV in the presence of a child, including a first time act, a stand-alone felony. PMID:25346927

  13. Temperature Profile of the Upper Mantle

    International Nuclear Information System (INIS)

    Anderson, O.L.

    1980-01-01

    Following the procedure outlined by Magnitsky [1971], thermal profiles of the upper mantle are computed by deriving the thermal gradient from the seismic data given as dv/sub s//drho used along with the values of (dv/sub s//dT9/sub p/ and (dv/sub s//dP)/sub T/ of selected minerals, measured at high temperature. The resulting values of dT/dZ are integrated from 380 km upward toward the surface, where the integrating constant is taken from Akagi and Akimoto's work, T=1400 0 C at 380 km. The resulting geotherms for minerals are used to derive geotherms for an eclogite mantle and a lherzolite mantle, with and without partial melting in the low-velocity zone. The geotherms are all subadiabatic, and some are virtually isothermal in the upper mantle. Some are characterized by a large thermal hump at the lithosphere boundary

  14. Factors associated with domestic violence: a cross-sectional survey among women in Jeddah, Saudi Arabia.

    Science.gov (United States)

    Fageeh, Wafa M K

    2014-02-14

    This study aims to identify the factors associated with domestic violence (DV) among women in Jeddah. Cross-sectional survey. Outpatient departments of three tertiary hospitals in Jeddah. Convenience sample of women, aged 15-70 years, at the outpatient and inpatient clinics. Between 15 December 2011 and 30 May 2012, a psychologist and a professional health assistant explained the purpose of the research to participants, who were then asked to fill a 50-item questionnaire. The questionnaire was created based on questions from three questionnaires: the NorVold Domestic Abuse Questionnaire, the Pregnancy Risk Assessment Monitoring System and the Kansas Marital Satisfaction Scale. The questionnaire was used to assess the association between DV and family status, male partner attitudes, age, educational attainment, employment, financial and socioeconomic status. A total of 2301 women participated in the survey (81% response rate). The mean±SD age of the participants was 34.4±10.9 years. The lifetime prevalence of DV was 34%. Abused women had more children than non-abused women (p=0.001), and their spouses were significantly older than those of non-abused women (p<0.0001). Financially dependent women and those with a high educational status were significantly more likely to report abuse (p=0.003 and p<0.001, respectively). Abused women were also likely to report that their spouse was a smoker (p<0.0001) and had completed at least primary or secondary education (p<0.0001). A significantly lower proportion of abused women reported that their male partners were alcohol users (p=0.001). The results of logistic regression showed that women who were financially dependent had about 1.5-fold odds of being physically abused by a spouse. Many factors are associated with DV against women, thereby highlighting the need to design effective DV prevention programmes.

  15. Characterization and Validation of Transiting Planets in the TESS SPOC Pipeline

    Science.gov (United States)

    Twicken, Joseph D.; Caldwell, Douglas A.; Davies, Misty; Jenkins, Jon Michael; Li, Jie; Morris, Robert L.; Rose, Mark; Smith, Jeffrey C.; Tenenbaum, Peter; Ting, Eric; Wohler, Bill

    2018-06-01

    Light curves for Transiting Exoplanet Survey Satellite (TESS) target stars will be extracted and searched for transiting planet signatures in the Science Processing Operations Center (SPOC) Science Pipeline at NASA Ames Research Center. Targets for which the transiting planet detection threshold is exceeded will be processed in the Data Validation (DV) component of the Pipeline. The primary functions of DV are to (1) characterize planets identified in the transiting planet search, (2) search for additional transiting planet signatures in light curves after modeled transit signatures have been removed, and (3) perform a comprehensive suite of diagnostic tests to aid in discrimination between true transiting planets and false positive detections. DV data products include extensive reports by target, one-page summaries by planet candidate, and tabulated transit model fit and diagnostic test results. DV products may be employed by humans and automated systems to vet planet candidates identified in the Pipeline. TESS will launch in 2018 and survey the full sky for transiting exoplanets over a period of two years. The SPOC pipeline was ported from the Kepler Science Operations Center (SOC) codebase and extended for TESS after the mission was selected for flight in the NASA Astrophysics Explorer program. We describe the Data Validation component of the SPOC Pipeline. The diagnostic tests exploit the flux (i.e., light curve) and pixel time series associated with each target to support the determination of the origin of each purported transiting planet signature. We also highlight the differences between the DV components for Kepler and TESS. Candidate planet detections and data products will be delivered to the Mikulski Archive for Space Telescopes (MAST); the MAST URL is archive.stsci.edu/tess. Funding for the TESS Mission has been provided by the NASA Science Mission Directorate.

  16. Overview of FTV (free-viewpoint television)

    Science.gov (United States)

    Tanimoto, Masayuki

    2010-07-01

    We have developed a new type of television named FTV (Free-viewpoint TV). FTV is the ultimate 3DTV that enables us to view a 3D scene by freely changing our viewpoints. We proposed the concept of FTV and constructed the world's first real-time system including the complete chain of operation from image capture to display. FTV is based on the rayspace method that represents one ray in real space with one point in the ray-space. We have developed ray capture, processing and display technologies for FTV. FTV can be carried out today in real time on a single PC or on a mobile player. We also realized FTV with free listening-point audio. The international standardization of FTV has been conducted in MPEG. The first phase of FTV was MVC (Multi-view Video Coding) and the second phase is 3DV (3D Video). MVC was completed in May 2009. The Blu-ray 3D specification has adopted MVC for compression. 3DV is a standard that targets serving a variety of 3D displays. The view generation function of FTV is used to decouple capture and display in 3DV. FDU (FTV Data Unit) is proposed as a data format for 3DV. FTU can compensate errors of the synthesized views caused by depth error.

  17. EFFECT OF DIFFERENT CRYOPROTECTIVE AGENTS ON SKIM MILK AND DIMITROPOULUS EXTENDER FOR STALLION SEMEN CRYOPRESERVATION

    Directory of Open Access Journals (Sweden)

    R.I. Arifiantini

    2014-10-01

    Full Text Available s to assess different CPAs on stallion semen cryopreservation. Skim milk (SM and Dimitropoulos(DV were the extenders used in this study; each was added by glycerol (Gly, combination of ethyleneglycol-glycerol (EG+Gly or dimethilformamide (DMF. Each semen sample was evaluated and dividedequally into six tubes; semen in the three tubes was diluted 1:1 with (SM, while in the remaining tubesthe semen was diluted 1:1 by DV. After being diluted, all tubes were centrifuged at 1006xg for 10minutes. The supernatan discarded, the pellet was rediluted by SM trehalosa or DV trehalose, and addedby G, EG+Gly, or DMF to reach the final sperm concentration of 200x106/ml. The extended semen wasindividually packed in 0.3 ml minitube, equilibrated at 4oC for 2 hours, frozen in liquid nitrogen vaporfor 10 minutes, and then was stored in liquid nitrogen container at -196 oC. After 24 hours, the semenwas thawed at 37 oC for 30 second. There were no significantly different (p>0.05 on the percentages ofmotile and viable sperm in SMT (21.7% and 43.4%, respectively compared with those extended withDV T extender (26.9% and 50.8%, respectively. DMF demonstrated better results as CPA compared tothe others; and DVTDMF combination had the best protection during cryopreservation in this study.

  18. A new molecular logic for BMP-mediated dorsoventral patterning in the leech Helobdella.

    Science.gov (United States)

    Kuo, Dian-Han; Weisblat, David A

    2011-08-09

    Bone morphogenetic protein (BMP) signaling is broadly implicated in dorsoventral (DV) patterning of bilaterally symmetric animals [1-3], and its role in axial patterning apparently predates the birth of Bilateria [4-7]. In fly and vertebrate embryos, BMPs and their antagonists (primarily Sog/chordin) diffuse and interact to generate signaling gradients that pattern fields of cells [8-10]. Work in other species reveals diversity in essential facets of this ancient patterning process, however. Here, we report that BMP signaling patterns the DV axis of segmental ectoderm in the leech Helobdella, a clitellate annelid (superphylum Lophotrochozoa) featuring stereotyped developmental cell lineages, but the detailed mechanisms of DV patterning in Helobdella differ markedly from fly and vertebrates. In Helobdella, BMP2/4s are expressed broadly, rather than in dorsal territory, whereas a dorsally expressed BMP5-8 specifies dorsal fate by short-range signaling. A BMP antagonist, gremlin, is upregulated by BMP5-8 in dorsolateral, rather than ventral territory, and yet the BMP-antagonizing activity of gremlin is required for normal ventral cell fates. Gremlin promotes ventral fates without disrupting dorsal fates by selectively inhibiting BMP2/4s, not BMP5-8. Thus, DV patterning in the development of the leech revealed unexpected evolutionary plasticity of the conserved BMP patterning system, presumably reflecting its adaptation to different modes of embryogenesis. Copyright © 2011 Elsevier Ltd. All rights reserved.

  19. The Impact on Informal Supporters of Domestic Violence Survivors: A Systematic Literature Review.

    Science.gov (United States)

    Gregory, Alison Clare; Williamson, Emma; Feder, Gene

    2017-12-01

    Domestic violence (DV) is experienced by 1 in 4 women in the United Kingdom during their lifetime, and most survivors will seek informal support from the people around them, even if they choose not to access help from professionals. Support from these relatives, friends, neighbors, and colleagues can provide a buffer against effects on the survivor's physical health, mental health, and quality of life, and has been shown to be protective against future abuse. There has been an absence of research studying members of survivors' networks and, in particular, investigating how the impact of DV might diffuse to affect them. A systematic literature review of reported research (either in peer-reviewed journals or in gray literature) was undertaken to explore the impacts of DV on survivor networks. Of the articles found, 24 had data relating to the topic area, though no study addressed the question directly. Framework analysis and meta-ethnography generated the following themes: physical health impacts, negative impacts on psychological well-being, direct impacts from the perpetrator, and beneficial impacts on psychological well-being. The studies in this review indicated that informal supporters may be experiencing substantial impact, including vicarious trauma and the risk of physical harm. Currently, there is little support available which is directly aimed at informal supporters of DV survivors, thus these findings have practical and policy implications, in order to acknowledge and meet their needs.

  20. Elevated Dengue Virus Nonstructural Protein 1 Serum Levels and Altered Toll-Like Receptor 4 Expression, Nitric Oxide, and Tumor Necrosis Factor Alpha Production in Dengue Hemorrhagic Fever Patients

    Directory of Open Access Journals (Sweden)

    Denise Maciel Carvalho

    2014-01-01

    Full Text Available Background. During dengue virus (DV infection, monocytes produce tumor necrosis factor alpha (TNF-α and nitric oxide (NO which might be critical to immunopathogenesis. Since intensity of DV replication may determine clinical outcomes, it is important to know the effects of viral nonstructural protein 1 (NS1 on innate immune parameters of infected patients. The present study investigates the relationships between dengue virus nonstructural protein 1 (NS1 serum levels and innate immune response (TLR4 expression and TNF-α/NO production of DV infected patients presenting different clinical outcomes. Methodology/Principal Findings. We evaluated NO, NS1 serum levels (ELISA, TNF-α production by peripheral blood mononuclear cells (PBMCs, and TLR4 expression on CD14+ cells from 37 dengue patients and 20 healthy controls. Early in infection, increased expression of TLR4 in monocytes of patients with dengue fever (DF was detected compared to patients with dengue hemorrhagic fever (DHF. Moreover, PBMCs of DHF patients showed higher NS1 and lower NO serum levels during the acute febrile phase and a reduced response to TLR4 stimulation by LPS (with a reduced TNF-α production when compared to DF patients. Conclusions/Significance. During DV infection in humans, some innate immune parameters change, depending on the NS1 serum levels, and phase and severity of the disease which may contribute to development of different clinical outcomes.

  1. ESLAV/ECLAM/LAVA/EVERI recommendations for the roles, responsibilities and training of the laboratory animal veterinarian and the designated veterinarian under Directive 2010/63/EU

    DEFF Research Database (Denmark)

    Poirier, G M; Bergmann, C; Denais-Lalieve, D G

    2015-01-01

    on the role of the DV. The role and responsibilities of the DV include the development, implementation and continuing review of an adequate programme for veterinary care at establishments breeding and/or using animals for scientific purposes. The programme should be tailored to the needs of the establishment...... professional development on the basis of a gap analysis. A tiered approach to further training in laboratory animal veterinary medicine and science offers career development pathways that are mutually beneficial to LAVs and establishments....

  2. Déjà vu phenomenon-related EEG pattern. Case report

    OpenAIRE

    Vlasov, P.N.; Chervyakov, A.V.; Gnezditskii, V.V.

    2013-01-01

    Background D?j? vu (DV, from French d?j? vu ? ?already seen?) is an aberration of psychic activity associated with transitory erroneous perception of novel circumstances, objects, or people as already known. Objective This study aimed to record the EEG pattern of d?j? vu. Methods The subjects participated in a survey concerning d?j? vu characteristics and underwent ambulatory EEG monitoring (12?16?h). Results In patients with epilepsy, DV episodes began with polyspike activity in the right te...

  3. Korejská manhwa

    OpenAIRE

    Nováková, Petra

    2010-01-01

    Cílem této bakalářské práce je charakteristika a rozbor moderní korejské manhwy. Teoretická část se obecně věnuje historii manhwy od počátku 20. století až do současnosti, a také jejímu vymezení vůči západní komiksům a japonské manze, a také základními rozdíly mezi nimi. Dále se zmíním o korejské animaci. Praktická část je zaměřena na charakteristiku jednotlivých žánrů, dále na výskyt a úroveň erotiky v manhwě a na způsoby vyjádření emocí v manhwě kresbou nebo textem za pomoci slov zvukomaleb...

  4. Influencer marketing jako moderní nástroj komunikace prostřednictvím sociálních médií a návrh na jeho využití ve zvolené společnosti

    OpenAIRE

    Novotný, Petr

    2017-01-01

    V 21. století digitální marketing představuje nedílnou součást marketingové komunikace, kde sociální média zaujímají čím dál významnější pozici tohoto odvětví. Bakalářská práce se odráží od základů internet marketingu a následně se zabývá principy influencer marketingu u vhodných sociálních sítí k tomuto prostředku komunikace. Praktická část se zaměří na analýzu současného stavu využití sociálních médií obchodní značky MANA a její konkurence, která také poslouží jako východisko pro návrh apli...

  5. Search for long-lived supersymmetry particles by signature of a high track-multiplicity displaced vertex using the LHC-ATLAS Experiment

    CERN Document Server

    AUTHOR|(INSPIRE)INSPIRE-00360876

    Long-lived supersymmetry (SUSY) particles decaying within the tracking volume of the LHC-ATLAS Experiment can be reconstructed as a displaced vertex (DV). The search strategy involves attempting to reassemble the decay point of the long-lived particles (LLPs) by fitting vertices from the trajectories arising from the charged decay products. A search, looking for a signature of a massive high track-multiplicity DV has been conducted using data collected during 2012 by the LHC-ATLAS Experiment at $\\sqrt{s}~=~8$ TeV, equaling to an integrated luminosity of 20.3 fb$^{-1}$. A signature of a massive displaced vertex is especially powerful due to the lack of any heavy long-lived standard model particles. Thereby, giving an analysis that is nearly background free. This dissertation describes the new, much more generic, "$DV+\\text{jets}$" channel. In this channel events with high momentum jets and at least one displaced vertex are considered. Eliminating the requirement of an associated $\\mu$ generated, to date of w...

  6. Comparison of indoor air distribution and thermal environment for different combinations of radiant heating systems with mechanical ventilation systems

    DEFF Research Database (Denmark)

    Wu, Xiaozhou; Fang, Lei; Olesen, Bjarne W.

    2018-01-01

    A hybrid system with a radiant heating system and a mechanical ventilation system, which is regarded as an advanced heating, ventilation and air-conditioning (HVAC) system, has been applied in many modern buildings worldwide. To date, almost no studies focused on comparative analysis of the indoor...... air distribution and the thermal environment for all combinations of radiant heating systems with mechanical ventilation systems. Therefore, in this article, the indoor air distribution and the thermal environment were comparatively analyzed in a room with floor heating (FH) or ceiling heating (CH......) and mixing ventilation (MV) or displacement ventilation (DV) when the supply air temperature ranged from 15.0°C to 19.0°C. The results showed that the temperature effectiveness values were 1.05–1.16 and 0.95–1.02 for MV+ FH and MV+ CH, respectively, and they were 0.78–0.91 and 0.51–0.67 for DV + FH and DV...

  7. Enhancing the Dental Professional’s Responsiveness Towards Domestic Violence; A Cross-Sectional Study

    Science.gov (United States)

    Kashinath, Korpathi R; Raju, Ananda S; Suresh, K V; Bharateesh, Jayanna V

    2015-01-01

    Background Dentists may be the first health care professionals to treat patients who have experienced Oro-facial trauma resulting from Domestic violence (DV). Hence, as a national health concern, it challenges the social responsibility of a dentist in bringing down its prevalence. Objective To assess the knowledge of Domestic violence among dentists of Karnataka. Materials and Methods A cross-sectional questionnaire survey was conducted among dentists of Karnataka to know their knowledge, its relation to dentistry and measures they practice to bring down the prevalence of DV victims. Results Overall knowledge about DV was very less among the dentists & out of 64% who said the dentist has a role in bringing down the prevalence, 28% reported the need for training. Conclusion Based on analysis of the data, dentists were interested and would benefit from additional education opportunities concerning recognizing, referring and managing patients who may be the victim of domestic violence in order to enhance their role. PMID:26266218

  8. Dyadic Dynamics in Young Couples Reporting Dating Violence: An Actor-Partner Interdependence Model.

    Science.gov (United States)

    Paradis, Alison; Hébert, Martine; Fernet, Mylène

    2017-01-01

    This study uses a combination of observational methods and dyadic data analysis to understand how boyfriends' and girlfriends' perpetration of dating violence (DV) may shape their own and their partners' problem-solving communication behaviors. A sample of 39 young heterosexual couples aged between 15 and 20 years (mean age = 17.8 years) completed a set of questionnaires and were observed during a 45-min dyadic interaction, which was coded using the Interactional Dimension Coding System (IDCS). Results suggest that neither boyfriends' nor girlfriends' own perpetration of DV was related to their display of positive and negative communication behaviors. However, estimates revealed significant partner effects, suggesting that negative communication behaviors displayed by girls and boys and positive communication behavior displayed by girls were associated to their partner's DV but not to their own. Such results confirm the need to shift our focus from an individual perspective to examining dyadic influences and processes involved in the couple system and the bidirectionality of violent relationships. © The Author(s) 2015.

  9. Victims of Domestic Violence in Shelters: Impacts on Women and Children.

    Science.gov (United States)

    Fernández-González, Liria; Calvete, Esther; Orue, Izaskun; Mauri, Alice

    2018-06-01

    The aim of this study was to examine the impact of domestic violence (DV) on women and their children. The records of women who were admitted to one of two types of shelter (an emergency shelter [n = 834] and a medium-long stay shelter [n = 84]) for victims of DV in Bizkaia (Spain) from 2006-2015 were analyzed. The results showed that up to 80% of the women had mental health problems. In about 20% of cases, a problematic mother-child relationship was identified. Inadequate parenting was present in around 35% of cases. Around 80-90% of the children had witnessed the abuse suffered by their mother, and more than half had been direct victims of some type of abuse. The findings point to actions that shelters can take to address the needs of DV victims. They also highlight the need for separate interventions targeting the needs of children, as well as mothers.

  10. Comment on integrability in Dijkgraaf-Vafa {beta}-ensembles

    Energy Technology Data Exchange (ETDEWEB)

    Mironov, A., E-mail: mironov@lpi.ru [Lebedev Physics Institute (Russian Federation); ITEP, Moscow (Russian Federation); Morozov, A., E-mail: morozov@itep.ru [ITEP, Moscow (Russian Federation); Zakirova, Z., E-mail: zolya_zakirova@mail.ru [Kazan Energy State University, Kazan (Russian Federation)

    2012-05-15

    We briefly discuss the recent claims that the ordinary KP/Toda integrability, which is a characteristic property of ordinary eigenvalue matrix models, persists also for the Dijkgraaf-Vafa (DV) partition functions and for the refined topological vertex. We emphasize that in both cases what is meant is a particular representation of partition functions: a peculiar sum over all DV phases in the first case and hiding the deformation parameters in a sophisticated potential in the second case, i.e. essentially a reformulation of some questions in the new theory in the language of the old one. It is at best obscure if this treatment can be made consistent with the AGT relations and even with the quantization of the underlying integrable systems in the Nekrasov-Shatashvili limit, which seem to require a full-scale {beta}-deformation of individual DV partition functions. Thus, it is unclear if the story of integrability is indeed closed by these recent considerations.

  11. Learning Reverse Engineering and Simulation with Design Visualization

    Science.gov (United States)

    Hemsworth, Paul J.

    2018-01-01

    The Design Visualization (DV) group supports work at the Kennedy Space Center by utilizing metrology data with Computer-Aided Design (CAD) models and simulations to provide accurate visual representations that aid in decision-making. The capability to measure and simulate objects in real time helps to predict and avoid potential problems before they become expensive in addition to facilitating the planning of operations. I had the opportunity to work on existing and new models and simulations in support of DV and NASA’s Exploration Ground Systems (EGS).

  12. La educación inclusiva del alumnado con discapacidad visual en la Comunidad Valenciana: análisis y perspectivas

    OpenAIRE

    Herrero Ortín, Teresa María

    2015-01-01

    El propósito de este estudio fue examinar el proceso de la educación inclusiva del alumnado con discapacidad visual (DV) escolarizado en centros ordinarios, públicos y concertados, de la Comunidad Valenciana desde la perspectiva de los implicados (profesorado, familias y alumnado con y sin DV). Concretamente, se exploraron sus percepciones y actitudes, prácticas, satisfacción con los servicios, y la participación y aceptación del alumnado por sus compañeros. En el estudio participaron de form...

  13. Sea Basing Logistiek

    Science.gov (United States)

    2007-11-01

    athankelijkheden, de hoeveelheid situatie? Auteur (s) ir. P.L.H. Cleophas drs. M.H.M. Delmee PROGRAMMA PROJECT drs. S. Hoesmans drs. P.G.M. van Scheepstal drs...hiertussen een aanvullende belangrijke schakel. In theorie worden binnen de CLAS en CZSK verschillende methoden voor het plannen van een operatie gehanteerd...J.H.A.Blokker MCM drs P.G.M. van Scheepstal Afdelingshoofd Auteur 72/72 TNO-rapport I TNO-DV 2007 A452 TNO-rapport I TNO-DV 2007 A452 Bijlage A 11/4 A Fysiek

  14. Xylo-Oligosaccharides and Inulin Affect Genotoxicity and Bacterial Populations Differently in a Human Colonic Simulator Challenged with Soy Protein

    Science.gov (United States)

    Christophersen, Claus T.; Petersen, Anne; Licht, Tine R.; Conlon, Michael A.

    2013-01-01

    High dietary intakes of some protein sources, including soy protein, can increase colonic DNA damage in animals, whereas some carbohydrates attenuate this. We investigated whether inulin and xylo-oligosaccharides (XOS) could be protective against DNA strand breaks by adding them to a human colonic simulator consisting of a proximal vessel (PV) (pH 5.5) and a distal vessel (DV) (pH 6.8) inoculated with human faeces and media containing soy protein. Genotoxicity of the liquid phase and microbial population changes in the vessels were measured. Soy protein (3%) was fermented with 1% low amylose cornstarch for 10 day followed by soy protein with 1% XOS or 1% inulin for 10 day. Inulin did not alter genotoxicity but XOS significantly reduced PV genotoxicity and increased DV genotoxicity. Inulin and XOS significantly increased butyrate concentration in the DV but not PV. Numbers of the key butyrate-producing bacterium Faecalibacterium prausnitzii were significantly increased in the PV and DV by inulin but significantly decreased by XOS in both vessels. Other bacteria examined were also significantly impacted by the carbohydrate treatments or by the vessel (i.e., pH). There was a significant overall inverse correlation between levels of damage induced by the ferments and levels of sulphate-reducing bacteria, Bacteroides fragilis, and acetate. In conclusion, dietary XOS can potentially modulate the genotoxicity of the colonic environment and specific bacterial groups and short chain fatty acids may mediate this. PMID:24064573

  15. Comparison of Different Height–Diameter Modelling Techniques for Prediction of Site Productivity in Natural Uneven-Aged Pure Stands

    Directory of Open Access Journals (Sweden)

    Guangshuang Duan

    2018-01-01

    Full Text Available Reliable estimates of forest site productivity are a central element of forest management. The model of height-diameter relationship of dominant trees using algebraic difference approach (ADA is a commonly used method to measure site productivity of natural uneven-aged stands. However, the existing models of this method do not recognize site type or sample plot specific variability in height curves; thus, it cannot be effectively used to estimate site type or sample plot-related site productivity for natural uneven-aged stands. Two primary subject-specific approaches, ADA with dummy variable (DV (ADA + DV and ADA with combination of dummy variable and nonlinear mixed-effects modelling (CM (ADA + CM, were proposed for height–diameter modelling. Height–diameter models developed with ADA, ADA + DV and ADA + CM were compared using data from 4161 observations on 349 permanent sample plots of four major natural uneven-aged pure stands (Spruce, Korean Larch, Mongolian Oak, and White Birch in northeastern China. It was found that models developed with ADA + CM provided the best performance, followed by the models with ADA + DV, and the models developed with ADA performed the worst. Random effects at the plot level were substantial, and their inclusion greatly improved the model’s accuracy. More importantly, the models developed with ADA + CM provide an effective method for quantifying site type- and sample plot-specific forest site productivity for uneven-aged pure stands.

  16. Perpetration of gross human rights violations in South Africa: association with psychiatric disorders.

    Science.gov (United States)

    Stein, Dan J; Williams, Stacey L; Jackson, Pamela B; Seedat, Soraya; Myer, Landon; Herman, Allen; Williams, David R

    2009-05-01

    A nationally representative study of psychiatric disorders in South Africa provided an opportunity to study the association between perpetration of human rights violations (HRVs) during apartheid and psychiatric disorder. Prior work has suggested an association between perpetration and post-traumatic stress disorder (PTSD), but this remains controversial. Subjects reported on their perpetration of human rights violations, purposeful injury, accidental injury and domestic violence. Lifetime and 12-month prevalence of DSM-IV (Diagnostic and Statistical Manual, 4th edition) disorders were assessed with Version 3.0 of the World Health Organization Composite International Diagnostic Interview (CIDI 3.0). Socio-demographic characteristics of these groups were calculated. Odds ratios for the association between the major categories of psychiatric disorders and perpetration were assessed. HRV perpetrators were more likely to be male, black and more educated, while perpetrators of domestic violence (DV) were more likely to be female, older, married, less educated and with lower income. HRV perpetration was associated with lifetime and 12-month anxiety and substance use disorders, particularly PTSD. Purposeful and DV perpetration were associated with lifetime and 12-month history of all categories of disorders, whereas accidental perpetration was associated most strongly with mood disorders. Socio-demographic profiles of perpetrators of HRV and DV in South Africa differ. While the causal relationship between perpetration and psychiatric disorders deserves further study, it is possible that some HRV and DV perpetrators were themselves once victims. The association between accidental perpetration and mood disorder also deserves further attention.

  17. Floor Heating with Displacement Ventilation: An Experimental and Numerical Analysis

    DEFF Research Database (Denmark)

    Causone, Francesco; Olesen, Bjarne W.; Corgnati, S.P.

    2010-01-01

    The effect of floor heating combined with displacement ventilation (DV) on thermal indoor environments and indoor air quality (IAQ) was studied by means of CFD. The numerical model was validated with experimental data. A typical office room was simulated, and one of the occupants was considered...... to simulate different kinds of contaminant sources, under the same boundary conditions. It was found that DV does not guarantee a better IAQ than full mixing when contaminant sources are not linked to heat sources, even when floor heating is used. Contaminants produced by powerful heat sources require high...

  18. Transceivers and receivers for quantum key distribution and methods pertaining thereto

    Science.gov (United States)

    DeRose, Christopher; Sarovar, Mohan; Soh, Daniel B.S.; Lentine, Anthony; Davids, Paul; Camacho, Ryan

    2018-02-27

    Various technologies for performing continuous-variable (CV) and discrete-variable (DV) quantum key distribution (QKD) with integrated electro-optical circuits are described herein. An integrated DV-QKD system uses Mach-Zehnder modulators to modulate a polarization of photons at a transmitter and select a photon polarization measurement basis at a receiver. An integrated CV-QKD system uses wavelength division multiplexing to send and receive amplitude-modulated and phase-modulated optical signals with a local oscillator signal while maintaining phase coherence between the modulated signals and the local oscillator signal.

  19. Inventory of Materials to be Used in Explosive Effects Mitigating Structures (Inventarisatie van materialen te gebruiken in constructies ter afscherming van explosie-effecten)

    Science.gov (United States)

    2008-11-01

    F +31 15 284 39 91 info-DenV@tno.nl TNO-rapportnummer TNO-DV 2008 A357 Opdrachtnummer Datum november 2008 Auteur (s) ir. O.C. van der Jagt...een keramisch materiaal (ZrSiO.*). TNO-rapport | TNO-DV 2008 A357 32/44 K, 04 035 0.3 0 25 02 0 15 01 005 0 O a 0 X A • • Theory ...47] Molinari. A., et al., Modeling plastic shocks in periodic laminates with gradient plasticity theories . Journal of the Mechanics and Physics of

  20. Secure Computer Systems: Extensions to the Bell-La Padula Model

    Science.gov (United States)

    2009-01-01

    countable and n CX ℜ∈ ; V is a finite collection of input variables. We assume ( )CD VVV ∪= with DV countable and nCV ℜ∈ ; XInit ⊆ is a set of...assume ( )CD VVV ∪= with DV countable and nCV ℜ∈ ; XInit ⊆ is a set of initial states; CXVXf →×: is a vector field, assumed to be globally...built under the Eclipse Swordfish project. As indicated on the project web site,”The goal of the Swordfish project is to provide an extensible SOA

  1. Synthesis of 1,3-Dinitrohexahydropyrimidine via Ring Contraction of Ether-Linked Nitramines

    Science.gov (United States)

    2016-07-01

    21.416 21.328 20.022 Dv (km/s) 7.301 7.491 7.180  Hd (kJ/mL) 7.03 7.19 7.00 OB (%) –77.61 –58.29 –73.96 Impact (cm) >152.4 >152.4 >152.4 Friction (N...detonation velocity, Dv; heat of detonation,  Hd ; oxygen balance, OB; electrostatic discharge, ESD. Using the experimentally determined density with the...investigation it was discovered that the method of addition of 1,3- dinitramopropane 4 to an acidic formaldehyde solution results either in the direct formation

  2. Altri collegamenti a lavori del gruppo di DV

    Directory of Open Access Journals (Sweden)

    Doctor Virtualis Redazione

    2008-08-01

    Full Text Available • Giovanni di Mirecourt, Commento alle Sentenze, libro I Attualmente non raggiungibile perché il server del Dipartimento di filosofia è stato oggetto di un attacco da parte di un hacker Edizione provvisoria on-line Il lavoro nasce dalla collaborazione tra Eugenio Randi e Massimo Parodi, e giunge alla pubblicazione on-line (provvisoria grazie all'intervento di Lucia Caccia Dominioni, che ha ordinato e ripulito il materiale a disposizione. • Seminario su Tommaso De ente et essentia - 1995/96 Il materiale prodotto dagli studenti che hanno partecipato al lavoro di discussione seminariale del De ente et essentia di Tommaso d'Aquino.

  3. Domestic violence: a hidden barrier to contraceptive use among women in Nigeria.

    Science.gov (United States)

    Bishwajit, Ghose; Yaya, Sanni

    2018-01-01

    The nonuse of family planning methods remains a major public health concern in the low-and-middle-income countries, especially due to its impact on unwanted pregnancy, high rate of abortion, and transmission of sexually transmitted diseases. Various demographic and socioeconomic factors have been reported to be associated with the nonuse of family planning methods. In the present study, we aimed at assessing the influence of domestic violence (DV) on contraceptive use among ever married women in Nigeria. Data on 22,275 women aged between 15 and 49 years were collected from the most recent Nigeria Demographic and Health Survey conducted in 2013. The outcome variable was contraceptive utilization status, and the main exposure variable was DV, which was assessed by the self-reported experience of physical and psychological abuse. Complex survey method was employed to account for the multistage design of the survey. Data analyses were performed by using bivariate and multivariable techniques. The mean age of the participants was 31.33±8.26. More than four fifths (84%) of the participants reported that they were not using any contraceptive methods at all. Lifetime prevalence of psychological and physical abuse was, respectively, 19.0% (95% CI =18.0-20.1) and 14.1% (95% CI =13.3-14.9). Women who reported physical abuse were 28% (adjusted odds ratio [AOR] =1.275; 95% CI =1.030-1.578), and those reported both physical and psychological abuse had 52% (AOR =1.520; 95% CI =1.132-2.042) higher odds of not using any contraception. The rate of contraception nonuse was considerably high and was found to be significantly associated with DV. Thus, the high prevalence of DV may compromise the effectiveness of the family planning programs in the long run. Evidence-based intervention strategies should be developed to protect the health and reproductive rights of the vulnerable women and to reduce DV by giving the issue a wider recognition in public policy making.

  4. Qualitative study to explore the health and well-being impacts on adults providing informal support to female domestic violence survivors.

    Science.gov (United States)

    Gregory, Alison; Feder, Gene; Taket, Ann; Williamson, Emma

    2017-03-24

    Domestic violence (DV) is hazardous to survivors' health, from injuries sustained and from resultant chronic physical and mental health problems. Support from friends and relatives is significant in the lives of DV survivors; research shows associations between positive support and the health, well-being and safety of survivors. Little is known about how people close to survivors are impacted. The aim of this study was exploratory, with the following research question: what are the health and well-being impacts on adults who provide informal support to female DV survivors? A qualitative study using semistructured interviews conducted face to face, by telephone or using Skype. A thematic analysis of the narratives was carried out. Community-based, across the UK. People were eligible to take part if they had had a close relationship (either as friend, colleague or family member) with a woman who had experienced DV, and were aged 16 or over during the time they knew the survivor. Participants were recruited via posters in community venues, social media and radio advertisement. 23 participants were recruited and interviewed; the majority were women, most were white and ages ranged from mid-20s to 80. Generated themes included: negative impacts on psychological and emotional well-being of informal supporters, and related physical health impacts. Some psychological impacts were over a limited period; others were chronic and had the potential to be severe and enduring. The impacts described suggested that those providing informal support to survivors may be experiencing secondary traumatic stress as they journey alongside the survivor. Friends and relatives of DV survivors experience substantial impact on their own health and well-being. There are no direct services to support this group. These findings have practical and policy implications, so that the needs of informal supporters are legitimised and met. Published by the BMJ Publishing Group Limited. For permission to

  5. Relação entre diferentes caracteres de plantas jovens de seringueira Correlations and regressions studies among juvenile rubber tree characters

    Directory of Open Access Journals (Sweden)

    César Lavorenti

    1990-01-01

    Full Text Available O presente trabalho foi realizado com o objetivo de determinar a existência e as magnitudes de correlações e regressões lineares simples em plântulas jovens de seringueira (Hevea spp., para melhor condução de seleção nos futuros trabalhos de melhoramento. Foram utilizadas médias de produção de borracha seca por plântulas por corte, através do teste Hamaker-Morris-Mann (P; circunferência do caule (CC; espessura de casca (EC; número de anéis (NA; diâmetro dos vasos (DV; densidade dos vasos laticíleros (D e distância média entre anéis de vasos consecutivos (DMEAVC em um viveiro de cruzamento com três anos e meio de idade. Os resultados mostraram, entre outros fatores, que as correlações lineares simples de P com CC, EC, NA, D, DV e DMEAVC foram, respectivamente, r =t 0,61, 0,34, 0,28, 0,29, 0,43 e -0,13. As correlações de CC com EC, NA, D, DV e DMEAVC foram: 0,65, 0,22, 0,37, 0,33 e 0,096 respectivamente. Estudos de regressão linear simples de P com CC, EC, NA, DV, D e DMEAVC sugerem que CC foi o caráter independente mais significativo, contribuindo com 36% da variação em P. Em relação ao vigor, a regressão de CC com os respectivos caracteres sugere que EC foi o único caráter que contribuiu significativamente para a variação de CC com 42%. As altas correlações observadas da produção com circunferência do caule e com espessura de casca evidenciam a possibilidade de obter genótipos jovens de boa capacidade produtiva e grande vigor, através de seleção precoce dessas variáveis.This study was undertaken aiming to determine the existence of linear correlations, based on simple regression studies for a better improvement of young rubber tree (Hevea spp. breeding and selection. The characters studied were: yield of dry rubber per tapping by Hamaker-Morris-Mann test tapping (P, mean gurth (CC, bark thickness (EC, number of latex vessel rings (NA, diameter of latex vesseis (DV, density of latex vesseis per 5mm

  6. Caracterização do perfil de deposição e do diâmetro de gotas e otimização do espaçamento entre bicos na barra de pulverização Characterization of deposition pattern, droplet diameter and optimization of nozzles spacing in spray boom

    Directory of Open Access Journals (Sweden)

    Ana P. Fernandes

    2007-12-01

    Full Text Available A escolha e o uso adequado de pontas de pulverização são essenciais para a correta aplicação de produtos fitossanitários, sendo, portanto, indispensável o conhecimento de suas características. Este trabalho teve o objetivo de caracterizar o perfil de distribuição e o diâmetro de gotas, oferecendo dados para otimizar o espaçamento entre bicos na barra de pulverização. Foram avaliados os perfis de distribuição da ponta de jato plano Teejet XR 110015 VS, a 0,50 m da altura da mesa de deposição, nas pressões de 200 e 300 kPa, e o diâmetro das gotas pelo método de difração de raios laser. As distâncias máximas foram de 0,85 m, calculadas para um coeficiente de variação (C.V. aceitável para as pressões de 200 e 300 kPa , com os respectivos valores de 9,52 e 9,58%. A distância ótima foi de aproximadamente 0,70 m, para C.V. em torno de 5%. Comparando as pressões, houve diferença significativa para DV0,1 e DV0,5, não havendo diferença para o DV0,9. Embora o aumento da pressão tenha provocado diminuição do tamanho das gotas, não houve diferença significativa de uniformidade entre as duas pressões de trabalho avaliadas. Concluiu-se que o espaçamento máximo entre bicos na barra não deverá ser maior que 0,85 m e que o DV0,5 diminui com o aumento da pressão de 200 para 300 kPa, porém sem alteração significativa da uniformidade de diâmetro de gota.The choice and correct use of nozzles are essential for the best agrochemical deposition, which is indispensable. The aim of this work was characterize the spray pattern and the droplet diameter offering information to optimize the nozzles spaces in spray boom. Deposition pattern of flat fan nozzles Teejet XR 110015 VS were evaluated, in a patternator, with the nozzle placed 0.50 m above patternator under pressures of 200 and 300 kPa, and the droplet diameter by the laser diffraction method. The maximum distance calculated for an acceptable coefficient of variation (C

  7. Characterization and application of newly developed polymorphic microsatellite markers in the Ezo red fox (Vulpes vulpes schrencki).

    Science.gov (United States)

    Tada, T; Seki, Y; Kameyama, Y; Kikkawa, Y; Wada, K

    2016-12-19

    The Ezo red fox (Vulpes vulpes schrencki), a subspecies endemic to Hokkaido island, Japan, is a known host species for the tapeworm Echinococcus multilocularis. To develop tools for molecular ecological studies, we isolated 28 microsatellite regions from the genome of Ezo red fox, and developed 18 polymorphic microsatellite markers. These markers were characterized using 7 individuals and 22 fecal samples of the Ezo red fox. The number of alleles for these markers ranged from 1 to 7, and the observed heterozygosity, estimated on the basis of the genotypes of 7 individuals, ranged from 0.29 to 1.00. All markers, except DvNok5, were in Hardy-Weinberg equilibrium (P > 0.05), and no linkage disequilibrium was detected among these loci, except between DvNok14 and DvNok28 (P = 0.01). Moreover, six microsatellite loci were successfully genotyped using feces-derived DNA from the Ezo red fox. The markers developed in our study might serve as a useful tool for molecular ecological studies of the Ezo red fox.

  8. A Gender Comparison of Motivations for Physical Dating Violence Among College Students

    Science.gov (United States)

    Elmquist, JoAnna; Wolford-Clevenger, Caitlin; Zapor, Heather; Febres, Jeniimarie; Shorey, Ryan C.; Hamel, John; Stuart, Gregory L.

    2015-01-01

    There are limited empirical investigations that directly compare men and women’s motivations, or reasons, for perpetrating physical dating violence (DV). In an attempt to further understand whether men and women have similar or different motives for physical DV, the purpose of the current study was to conduct a gender comparison motives in a sample of male (n = 163) and female (n = 319) college students. Motivations for physical DV were classified according to seven broad categories proposed by Langhinrichsen-Rohling and colleagues (2012): (a) power/control, (b) self-defense, (c) expression of negative emotion (e.g., anger), (d) communication difficulties, (e) retaliation, (f) jealousy, and (g) other (e.g., because it was sexually arousing, the influence of alcohol, the influence of drugs). The prevalence of physical violence perpetration in the overall sample was 29.4%. Results indicated that communication difficulties and self-defense were among the most frequently endorsed motive categories for both male and female perpetrated dating violence. In addition, results demonstrated gender similarity in all of the examined motive categories. Research and clinical implications are discussed. PMID:25392388

  9. The Romantic Relationship Experiences of Young Adult Women Exposed to Domestic Violence.

    Science.gov (United States)

    Haselschwerdt, Megan L; Carlson, Camille E; Hlavaty, Kathleen

    2018-05-01

    Guided by a review of the literature on intergenerational transmission of violence, or "the cycle of violence", and Johnson's typology of domestic violence, the current study qualitatively examined the romantic relationship experiences of 23 young adult women who were exposed to father-mother-perpetrated domestic violence (DV) during childhood and adolescence. Findings are partially consistent with the hypothesis that DV exposure is associated with an increased risk of later experiencing dating violence, such that half of the sample reported having abusive partners or relationships during high school. However, none of the young women reported violence or abuse during the early years of college, suggesting the salience of developmental timing when examining transmission of violence. Beyond whether the women experienced dating violence, they described how their earlier DV exposure experiences influence how they entered into, managed, and exited romantic relationships. By comparing their potential, former, and current romantic relationships with their fathers' violence and abuse, their mothers' victimization, and high school relationship partners' behaviors, the young women actively and strategically managed their relationship involvement over time. Although women exposed to both situational couple and coercive controlling violence reported experiencing abuse during high school, only women with coercive controlling exposure experienced reported having nonabusive, healthy, and supportive relationships. Findings suggest that the romantic relationship experiences of DV-exposed young adult women are complex, warranting a holistic approach that takes into consideration the full range of potential relationship experiences, the role of former relationships, and developmental timing when seeking to prevent and intervene in intergenerational transmission processes.

  10. Teaching Domestic Violence in the New Millennium: Intersectionality as a Framework for Social Change.

    Science.gov (United States)

    McQueeney, Krista

    2016-10-01

    This article describes an intersectional approach to teaching about domestic violence (DV), which aims to empower students as critical thinkers and agents of change by merging theory, service learning, self-reflection, and activism. Three intersectional strategies and techniques for teaching about DV are discussed: promoting difference-consciousness, complicating gender-only power frameworks, and organizing for change. The author argues that to empower future generations to end violence, educators should put intersectionality into action through their use of scholarship, teaching methods, and pedagogical authority. Finally, the benefits and challenges of intersectional pedagogy for social justice education are considered. © The Author(s) 2016.

  11. Simplified PET measurement for evaluating histamine H1 receptors in human brains using [11C]doxepin

    International Nuclear Information System (INIS)

    Mochizuki, Hideki; Kimura, Yuichi; Ishii, Kenji; Oda, Keiichi; Sasaki, Toru; Tashiro, Manabu; Yanai, Kazuhiko; Ishiwata, Kiichi

    2004-01-01

    The aim of this study was to develop simplified positron emission tomography measurement using [ 11 C]doxepin ([ 11 C]DOX) to evaluate histamine H 1 receptors (H1Rs) in human brains. We evaluated the correlation between the distribution volume (DV) of [ 11 C]DOX, estimated quantitatively with a two-compartment model, and the [ 11 C]DOX uptake obtained at various time intervals and normalized using the metabolite-corrected plasma radioactivity. We found that the static 70- to 90-min images normalized using the plasma radioactivity at 10 min postinjection reflected the DV of [ 11 C]DOX-H1R binding

  12. Correlation between Exposure to Bomechanical Stress and Whiplash Associated Disorders (WAD

    Directory of Open Access Journals (Sweden)

    William HM Castro

    2003-01-01

    Full Text Available One of the most discussed questions in WAD is: can an injury of the cervical spine occur in low velocity collisions? Before this question can be answered, the term 'low velocity' and the kind of collisions must first be defined. From the study of Meyer et al. (1994 it is known that the speed change due to collision, Dv, is a suitable parameter to express the biomechanical stress acting on a person in a car collision. This study also showed that from a biomechanical point of view, a bumper car collision is comparable to a normal car collision. In the case of a rear-end collision, Meyer et al. found that the biomechanical stress acting on persons exposed to bumper car collisions (Dv at a fun fair in Germany can be as high as 15 km/h. In literature, one case could be found of an 8-year-old girl with 'whiplash' after being exposed to a bumper car collision at a fun fair (Kamieth 1990. In the Netherlands, a 13-year survey of persons who were admitted to emergency units of hospitals by the 'Consument en Veiligheid' foundation, showed 14 persons with WAD complaints after being exposed to bumper car collisions at a fun fair. In comparison to the enormous amounts of bumper car collisions, these figures are negligible. With regard to these data, one could argue that low velocity collisions can be defined as those where Dv is below 15 km/h. However, it should be noted that the kind of collision is important. From the work of Becke et al. (1999 and Becke and Castro (2000, we know that in side collisions with a Dv of just 3 km/h, head contact with the side window of the car is possible; it can be expected that in such cases the cervical spine will also be exposed to some biomechanical stress (notice however, that not every head contact is automatically equal to an injury of the cervical spine!. In conclusion, before using expressions like 'low velocity collisions', its definition with regard to Dv as well as the kind of collision, has to be discussed. With

  13. Domestic violence: a hidden barrier to contraceptive use among women in Nigeria

    Directory of Open Access Journals (Sweden)

    Bishwajit G

    2018-01-01

    Full Text Available Ghose Bishwajit, Sanni Yaya Faculty of Social Sciences, School of International Development and Global Studies, University of Ottawa, Ottawa, ON, Canada Background: The nonuse of family planning methods remains a major public health concern in the low-and-middle-income countries, especially due to its impact on unwanted pregnancy, high rate of abortion, and transmission of sexually transmitted diseases. Various demographic and socioeconomic factors have been reported to be associated with the nonuse of family planning methods. In the present study, we aimed at assessing the influence of domestic violence (DV on contraceptive use among ever married women in Nigeria. Methods: Data on 22,275 women aged between 15 and 49 years were collected from the most recent Nigeria Demographic and Health Survey conducted in 2013. The outcome variable was contraceptive utilization status, and the main exposure variable was DV, which was assessed by the self-reported experience of physical and psychological abuse. Complex survey method was employed to account for the multistage design of the survey. Data analyses were performed by using bivariate and multivariable techniques. Results: The mean age of the participants was 31.33±8.26. More than four fifths (84% of the participants reported that they were not using any contraceptive methods at all. Lifetime prevalence of psychological and physical abuse was, respectively, 19.0% (95% CI =18.0–20.1 and 14.1% (95% CI =13.3–14.9. Women who reported physical abuse were 28% (adjusted odds ratio [AOR] =1.275; 95% CI =1.030–1.578, and those reported both physical and psychological abuse had 52% (AOR =1.520; 95% CI =1.132–2.042 higher odds of not using any contraception. Conclusion: The rate of contraception nonuse was considerably high and was found to be significantly associated with DV. Thus, the high prevalence of DV may compromise the effectiveness of the family planning programs in the long run. Evidence

  14. Transfer Entropy Estimation and Directional Coupling Change Detection in Biomedical Time Series

    Directory of Open Access Journals (Sweden)

    Lee Joon

    2012-04-01

    Full Text Available Abstract Background The detection of change in magnitude of directional coupling between two non-linear time series is a common subject of interest in the biomedical domain, including studies involving the respiratory chemoreflex system. Although transfer entropy is a useful tool in this avenue, no study to date has investigated how different transfer entropy estimation methods perform in typical biomedical applications featuring small sample size and presence of outliers. Methods With respect to detection of increased coupling strength, we compared three transfer entropy estimation techniques using both simulated time series and respiratory recordings from lambs. The following estimation methods were analyzed: fixed-binning with ranking, kernel density estimation (KDE, and the Darbellay-Vajda (D-V adaptive partitioning algorithm extended to three dimensions. In the simulated experiment, sample size was varied from 50 to 200, while coupling strength was increased. In order to introduce outliers, the heavy-tailed Laplace distribution was utilized. In the lamb experiment, the objective was to detect increased respiratory-related chemosensitivity to O2 and CO2 induced by a drug, domperidone. Specifically, the separate influence of end-tidal PO2 and PCO2 on minute ventilation (V˙E before and after administration of domperidone was analyzed. Results In the simulation, KDE detected increased coupling strength at the lowest SNR among the three methods. In the lamb experiment, D-V partitioning resulted in the statistically strongest increase in transfer entropy post-domperidone for PO2→V˙E. In addition, D-V partitioning was the only method that could detect an increase in transfer entropy for PCO2→V˙E, in agreement with experimental findings. Conclusions Transfer entropy is capable of detecting directional coupling changes in non-linear biomedical time series analysis featuring a small number of observations and presence of outliers. The results

  15. Domestic violence in a UK abortion clinic: anonymous cross-sectional prevalence survey.

    Science.gov (United States)

    Motta, Silvia; Penn-Kekana, Loveday; Bewley, Susan

    2015-04-01

    To measure the prevalence of domestic violence (DV) experienced by women seeking termination of pregnancy (TOP) in a UK abortion clinic. A cross-sectional anonymous questionnaire survey of all women aged over 16 years accessing a TOP clinic in inner London between 20 May 2012 and 2 July 2012. The main outcome measures were: distribution of questionnaires, response rate, lifetime prevalence of abuse, past-year prevalence of physical and sexual abuse, prevalence of physical abuse during current pregnancy, relationship of lifetime abuse to number of terminations, and receptivity to DV services. Questionnaires were distributed to 46% (383/828) of women accessing the clinic. Response rate was 50% (190/383). Lifetime prevalence of abuse was 16%. Past-year prevalence of physical abuse was 11% and sexual abuse was 4%. Prevalence of physical abuse during the current pregnancy was 4%. Prevalence of lifetime abuse was lower in women having a first termination (12%) versus one (20%) or two or more previous terminations (24%), although this was not statistically significant (p=0.192). The majority (75%) of participants expressing an opinion on the possibility of having a support service for DV in the abortion clinic setting were positive, unrelated to their personal experience, but some concerns were raised about implementation. In order to provide effective support for women, services require a needs assessment of their local population. Asking women presenting for abortion about DV, even anonymously, is challenging but feasible. Future work should be directed to women's unmet safety needs. Published by the BMJ Publishing Group Limited. For permission to use (where not already granted under a licence) please go to http://group.bmj.com/group/rights-licensing/permissions.

  16. Comparison of computational to human observer detection for evaluation of CT low dose iterative reconstruction

    Science.gov (United States)

    Eck, Brendan; Fahmi, Rachid; Brown, Kevin M.; Raihani, Nilgoun; Wilson, David L.

    2014-03-01

    Model observers were created and compared to human observers for the detection of low contrast targets in computed tomography (CT) images reconstructed with an advanced, knowledge-based, iterative image reconstruction method for low x-ray dose imaging. A 5-channel Laguerre-Gauss Hotelling Observer (CHO) was used with internal noise added to the decision variable (DV) and/or channel outputs (CO). Models were defined by parameters: (k1) DV-noise with standard deviation (std) proportional to DV std; (k2) DV-noise with constant std; (k3) CO-noise with constant std across channels; and (k4) CO-noise in each channel with std proportional to CO variance. Four-alternative forced choice (4AFC) human observer studies were performed on sub-images extracted from phantom images with and without a "pin" target. Model parameters were estimated using maximum likelihood comparison to human probability correct (PC) data. PC in human and all model observers increased with dose, contrast, and size, and was much higher for advanced iterative reconstruction (IMR) as compared to filtered back projection (FBP). Detection in IMR was better than FPB at 1/3 dose, suggesting significant dose savings. Model(k1,k2,k3,k4) gave the best overall fit to humans across independent variables (dose, size, contrast, and reconstruction) at fixed display window. However Model(k1) performed better when considering model complexity using the Akaike information criterion. Model(k1) fit the extraordinary detectability difference between IMR and FBP, despite the different noise quality. It is anticipated that the model observer will predict results from iterative reconstruction methods having similar noise characteristics, enabling rapid comparison of methods.

  17. CFD study of exhaled droplet transmission between occupants under different ventilation strategies in a typical office room

    Energy Technology Data Exchange (ETDEWEB)

    He, Qibin; Gao, Naiping; Zhu, Tong; Wu, Jiazheng [Institute of Refrigeration and Thermal Engineering, School of Mechanical Engineering, Tongji University, Siping Road 1239, Shanghai (China); Niu, Jianlei [Department of Building Services Engineering, The Hong Kong Polytechnic University, Hung Hom, Kowloon (China)

    2011-02-15

    This paper investigated the transmission of respiratory droplets between two seated occupants equipped with one type of personalized ventilation (PV) device using round movable panel (RMP) in an office room. The office was ventilated by three different total volume (TV) ventilation strategies, i.e. mixing ventilation (MV), displacement ventilation (DV), and under-floor air distribution (UFAD) system respectively as background ventilation methods. Concentrations of particles with aerodynamic diameters of 0.8 {mu}m, 5 {mu}m, and 16 {mu}m as well as tracer gas were numerically studied in the Eulerian frame. Two indexes, i.e. intake fraction (IF) and concentration uniformity index R{sub C} were introduced to evaluate the performance of ventilation systems. It was found that without PV, DV performed best concern protecting the exposed manikin from the pollutants exhaled by the polluting manikin. In MV when the exposed manikin opened RMP the inhaled air quality could always be improved. In DV and UFAD application of RMP might sometimes, depending on the personalized airflow rate, increase the exposure of the others to the exhaled droplets of tracer gas, 0.8 {mu}m particles, and 5 {mu}m particles from the infected occupants. Application of PV could reduce R{sub C} for all the three TV systems of 0.8 {mu}m and 5 {mu}m particles. PV enhanced mixing degree of particles under DV and UFAD based conditions much stronger than under MV based ones. PV could increase the average concentration in the occupied zone of the exposed manikin as well as provide clean personalized airflow. Whether inhaled air quality could be improved depended on the balance of pros and cons of PV. (author)

  18. The effect of change in body mass index on volumetric measures of mammographic density

    Science.gov (United States)

    Hart, Vicki; Reeves, Katherine W.; Sturgeon, Susan R.; Reich, Nicholas G.; Sievert, Lynnette Leidy; Kerlikowske, Karla; Ma, Lin; Shepherd, John; Tice, Jeffrey A.; Mahmoudzadeh, Amir Pasha; Malkov, Serghei; Sprague, Brian L.

    2015-01-01

    Background Understanding how changes in body mass index (BMI) relate to changes in mammographic density is necessary to evaluate adjustment for BMI gain/loss in studies of change in density and breast cancer risk. Increase in BMI has been associated with a decrease in percent density, but the effect on change in absolute dense area or volume is unclear. Methods We examined the association between change in BMI and change in volumetric breast density among 24,556 women in the San Francisco Mammography Registry from 2007-2013. Height and weight were self-reported at the time of mammography. Breast density was assessed using single x-ray absorptiometry measurements. Cross-sectional and longitudinal associations between BMI and dense volume (DV), non-dense volume (NDV) and percent dense volume (PDV) were assessed using multivariable linear regression models, adjusted for demographics, risk factors, and reproductive history. Results In cross-sectional analysis, BMI was positively associated with DV (β=2.95 cm3, 95% CI 2.69, 3.21) and inversely associated with PDV (β=-2.03%, 95% CI -2.09, -1.98). In contrast, increasing BMI was longitudinally associated with a decrease in both DV (β=-1.01 cm3, 95% CI -1.59, -0.42) and PDV (β=-1.17%, 95% CI -1.31, -1.04). These findings were consistent for both pre- and postmenopausal women. Conclusion Our findings support an inverse association between change in BMI and change in PDV. The association between increasing BMI and decreasing DV requires confirmation. Impact Longitudinal studies of PDV and breast cancer risk, or those using PDV as an indicator of breast cancer risk, should evaluate adjustment for change in BMI. PMID:26315554

  19. Experimental study of airflow characteristics of stratum ventilation in a multi-occupant room with comparison to mixing ventilation and displacement ventilation.

    Science.gov (United States)

    Cheng, Y; Lin, Z

    2015-12-01

    The motivation of this study is stimulated by a lack of knowledge about the difference of airflow characteristics between a novel air distribution method [i.e., stratum ventilation (SV)] and conventional air distribution methods [i.e., mixing ventilation (MV) and displacement ventilation (DV)]. Detailed air velocity and temperature measurements were conducted in the occupied zone of a classroom with dimensions of 8.8 m (L) × 6.1 m (W) × 2.4 m (H). Turbulence intensity and power spectrum of velocity fluctuation were calculated using the measured data. Thermal comfort and cooling efficiency were also compared. The results show that in the occupied zone, the airflow characteristics among MV, DV, and SV are different. The turbulent airflow fluctuation is enhanced in this classroom with multiple thermal manikins due to thermal buoyancy and airflow mixing effect. Thermal comfort evaluations indicate that in comparison with MV and DV, a higher supply air temperature should be adopted for SV to achieve general thermal comfort with low draft risk. Comparison of the mean air temperatures in the occupied zone reveals that SV is of highest cooling efficiency, followed by DV and then MV. This study reports the unique profiles of flow, temperature, turbulence intensity, and power spectrum of stratum ventilation, which can have a number of implications for both knowledge and understanding of the flow characteristics in a stratum-ventilated room. With respect to the former, it expounds the fundamental characteristics of this air distribution method; and with respect to the latter, it reveals the mechanism of thermal comfort and energy saving under stratum ventilation. © 2015 John Wiley & Sons A/S. Published by John Wiley & Sons Ltd.

  20. Double-stranded-RNA-specific adenosine deaminase 1 (ADAR1) is proposed to contribute to the adaptation of equine infectious anemia virus from horses to donkeys.

    Science.gov (United States)

    Tang, Yan-Dong; Zhang, Xiang; Na, Lei; Wang, Xue-Feng; Fu, Li-Hua; Zhu, Chun-Hui; Wang, Xiaojun; Zhou, Jian-Hua

    2016-10-01

    Equine infectious anemia virus (EIAV) is a member of the genus Lentivirus of the family Retroviridae. Horses are the most susceptible equids to EIAV infection and are therefore the primary hosts of this virus. In contrast, infected donkeys do not develop clinically active equine infectious anemia (EIA). This phenomenon is similar to what has been observed with HIV-1, which fails to induce AIDS in non-human primates. Interestingly, Shen et al. developed a donkey-tropic pathogenic virus strain (EIAVDV117, DV117) by serially passaging a horse-tropic pathogenic strain, EIAVLN40 (LN40), in donkeys. LN40, which was generated by passaging a field isolate in horses, displayed enhanced virulence in horses but caused no clinical symptoms in donkeys. Infection with DV117 induced acute EIA in nearly 100 % of donkeys. Genomic analysis of DV117 revealed a significantly higher frequency of A-to-G substitutions when compared to LN40. Furthermore, detailed analysis of dinucleotide editing showed that A-to-G mutations had a preference for 5'TpA and 5'ApA. These results strongly implicated the activity of the adenosine deaminase, ADAR1, in this type of mutation. Further investigation demonstrated that overexpression of donkey ADAR1 increased A-to-G mutations within the genome of EIAV. Together with our previous finding that multiple mutations in multiple genes are generated in DV117 during its adaptation from horses to donkeys, the present study suggests that ADAR1-induced A-to-G mutations occur during virus adaption to related new hosts contributing to the alteration of EIAV host tropism.

  1. Exploration of Dating Violence and Related Attitudes Among Adolescents and Emerging Adults.

    Science.gov (United States)

    Courtain, Audrey; Glowacz, Fabienne

    2018-04-01

    Young people's romantic relationships can be marked with various forms of dating violence (DV). However, adolescents and emerging adults do not necessarily acknowledge this violence because of their attitudes toward dating violence. Our study aims to study dating violence and attitudes toward this phenomenon through two well-established questionnaires administered jointly in their entirety. Indeed, too many studies report results on some dimensions and items, neglecting the richness of available tools. The Conflict in Adolescent Dating Relationship Inventory and the Attitudes Toward Dating Violence Scale were self-administered to 1,014 participants ( M age = 18.9) attending secondary schools or a regional college. They reported the frequency of their dating violence perpetration and victimization, and their attitudes toward dating violence. Results show that relational and sexual violence perpetration rates are higher for males, physical violence perpetration rate is higher for females, and relational violence victimization is higher for males. MANCOVAs not only show the same trends for scores but also underline more frequent emotional violence perpetrated by females, physical victimization for males, and sexual victimization for females. Males show higher tolerance toward every form of dating violence; younger participants are also more tolerant. Participants are more tolerant toward male-perpetrated psychological DV than female-perpetrated ones, and more tolerant toward female-perpetrated physical and sexual DV compared with male-perpetrated physical and sexual DV. There are patterns of multiperpetration, multivictimization, bidirectionality, and multi(in)tolerance. Our paper contributes to the symmetry debate, a better understanding of the link between attitudes and violent behaviors, a further step on gendered attitudes regarding who perpetrates and who sustains.

  2. Cultural Competence Training for Law Enforcement Responding to Domestic Violence Emergencies With the Deaf and Hard of Hearing: A Mixed-Methods Evaluation.

    Science.gov (United States)

    Engelman, Alina; Deardorff, Julianna

    2016-03-01

    To evaluate a training workshop for law enforcement as first responders for the purpose of increasing officers' cultural competency in working with Deaf and hard-of-hearing people (Deaf/HH) during domestic violence (DV) emergencies. This evaluation assesses the efficacy of a 2-hour training workshop for law enforcement. Thirty-four participants completed questionnaires at pre- and postintervention to assess participants' (1) satisfaction with training; (2) skills in responding to Deaf/HH individual(s) in a DV emergency; (3) attitudes toward the Deaf/HH, including bias recognition, self-assessment of cultural competency, and perceived self-efficacy; and (4) knowledge of communication. Focus groups (FGs) were also conducted (n = 6 for FG1, n = 13 for FG2). SPSS software was used to analyze survey data; principal components analysis was conducted on the survey instruments. There were significant differences between pre- and posttests for several targeted outcomes, including knowledge and perceived self-efficacy. Both survey and FG results demonstrated that participants gained cultural competency skills as indicated by changes in attitudes toward the Deaf/HH, both in DV emergencies and in large-scale emergencies. Significant differences were evident between pre and posttest results in terms of knowledge and perceived self-efficacy. Nonetheless, survey participants demonstrated a lack of knowledge about policy and the law. Survey findings also suggest that while a onetime training can improve the perceived self-efficacy of participants, shifting attitudes about the capabilities of the Deaf/HH may require different training strategies. FG participants demonstrated a greater awareness of the complexity of working with this population in a DV emergency. © 2015 Society for Public Health Education.

  3. Evidence of Limited Motion of the Prostate by Carefully Emptying the Rectum as Assessed by Daily MVCT Image Guidance with Helical Tomotherapy

    International Nuclear Information System (INIS)

    Fiorino, Claudio Ph.D.; Di Muzio, Nadia; Broggi, Sara; Cozzarini, Cesare; Maggiulli, Eleonora M.Sc.; Alongi, Filippo; Valdagni, Riccardo; Fazio, Ferruccio; Calandrino, Riccardo

    2008-01-01

    Purpose: To assess setup and organ motion error by means of analysis of daily megavoltage computed tomography (MVCT) of patients treated with hypofractionated helical tomotherapy (71.4-74.2 Gy in 28 fractions). Methods and Materials: Data from 21 patients were analyzed. Patients were instructed to empty the rectum carefully before planning CT and every morning before therapy by means of a self-applied rectal enema. The position of the prostate was assessed by means of automatic bone matching (BM) with the planning kilovoltage CT (BM, setup error) followed by a direct visualization (DV) match on the prostate. Deviations between planning and therapy positions referred to BM and BM + DV were registered for the three main axes. In case of a full rectum at MVCT with evident shift of the prostate, treatment was postponed until after additional rectal emptying procedures; in this case, additional MVCT was performed before delivering the treatment. Data for 522 fractions were available; the impact of post-MVCT procedure was investigated for 17 of 21 patients (410 fractions). Results: Prostate motion relative to bony anatomy was limited. Concerning posterior-anterior shifts, only 4.9% and 2.7% of fractions showed deviation of 3 mm or greater of the prostate relative to BM without and with consideration of post-MVCT procedures, respectively. Interobserver variability for BM + DV match was within 0.8 mm (1 SD). Conclusions: Daily MVCT-based correction is feasible. The BM + DV matching was found to be consistent between operators. Rectal emptying using a daily enema is an efficient tool to minimize prostate motion, even for centers that have not yet implemented image-guided radiotherapy

  4. Domestic violence and its impact on married women's health in Eastern Saudi Arabia.

    Science.gov (United States)

    Afifi, Zeinab Emam M; Al-Muhaideb, Nouriah S; Hadish, Nina F; Ismail, Faten I; Al-Qeamy, Fatema M

    2011-06-01

    To identify the prevalence of domestic violence (DV) in Al-Ahsa, and its impact on married women's health. This study is a community-based cross-sectional survey conducted from January to June 2010 in Al-Ahsa oasis in the Eastern province of the Kingdom of Saudi Arabia. It included 2000 ever-married women, 15-60 years old, and selected by a 2-stage proportionate cluster random sample. Data was gathered through structured interviews. Univariate and multivariate analysis was carried out using the Statistical Package for Social Sciences version 15. The prevalence of lifetime DV was 39.3%, 35.9% for mental, 17.9% for physical, and 6.9% for sexual violence. Lower rates of recent (within one month prior to the interview) violence were encountered, that is: overall (32.7%); mental (29.1%); physical (22.8%); and sexual (11.8%). Eleven percent of women were beaten, and 7% were kicked on the abdomen during pregnancy. Lifetime violence was significantly associated with perceived bad general health, disease, abortion, hemorrhage, and body mass index. Recent violence increased the number of doctor visits, and the odds of feeling dizzy (OR=1.93), vaginal bleeding (OR=1.83), movement and activity problems, pain, taking drugs (OR=1.95), and stress significantly during the last 4 weeks before the interview. A large proportion of women tolerated violence without seeking help (41.4%). Common reactions included complaining to own family, treating the perpetrator violently, and complaining to a friend. We found that DV is prevalent in Al-Ahsa. We recommend awareness programs aiming at educating current and future couples, and proper training of health care providers in assisting the cases of DV.

  5. Use of ( sup 11 C)aminocyclohexanecarboxylate for the measurement of amino acid uptake and distribution volume in human brain

    Energy Technology Data Exchange (ETDEWEB)

    Koeppe, R.A.; Mangner, T.; Betz, A.L.; Shulkin, B.L.; Allen, R.; Kollros, P.; Kuhl, D.E.; Agranoff, B.W. (Univ. of Michigan Medical School, Ann Arbor (USA))

    1990-09-01

    A quantitative positron emission tomographic (PET) method to measure amino acid blood-brain barrier (BBB) transport rate and tissue distribution volume (DV) has been developed using {sup 11}C-labeled aminocyclohexanecarboxylate (ACHC), a nonmetabolized amino acid analogue. Dynamic PET data were acquired as a series of 15 scans covering a total of 60 min and analyzed by means of a two-compartment, two-parameter model. Functional images were calculated for the amino acid transport rate constants across the BBB and the amino acid DV in the brain. Results show ({sup 11}C)ACHC to have an influx rate constant in gray matter of approximately 0.03-0.04 ml g-1 min-1, indicating a single-pass extraction fraction of approximately 5-7%. The intersubject coefficient of variation was approximately 15% while intrasubject variability of repeat scans was only slightly greater than 5%. Studies were performed in 15 young normal volunteer control subjects, 5 elderly controls, 7 patients with probable Alzheimer's disease, and one patient with phenylketonuria. Results indicate that ({sup 11}C)-ACHC will serve as the basis of a method for measuring amino acid transport rate and DV in the normal and pathological human brain.

  6. Use of [11C]aminocyclohexanecarboxylate for the measurement of amino acid uptake and distribution volume in human brain

    International Nuclear Information System (INIS)

    Koeppe, R.A.; Mangner, T.; Betz, A.L.; Shulkin, B.L.; Allen, R.; Kollros, P.; Kuhl, D.E.; Agranoff, B.W.

    1990-01-01

    A quantitative positron emission tomographic (PET) method to measure amino acid blood-brain barrier (BBB) transport rate and tissue distribution volume (DV) has been developed using 11 C-labeled aminocyclohexanecarboxylate (ACHC), a nonmetabolized amino acid analogue. Dynamic PET data were acquired as a series of 15 scans covering a total of 60 min and analyzed by means of a two-compartment, two-parameter model. Functional images were calculated for the amino acid transport rate constants across the BBB and the amino acid DV in the brain. Results show [ 11 C]ACHC to have an influx rate constant in gray matter of approximately 0.03-0.04 ml g-1 min-1, indicating a single-pass extraction fraction of approximately 5-7%. The intersubject coefficient of variation was approximately 15% while intrasubject variability of repeat scans was only slightly greater than 5%. Studies were performed in 15 young normal volunteer control subjects, 5 elderly controls, 7 patients with probable Alzheimer's disease, and one patient with phenylketonuria. Results indicate that [ 11 C]-ACHC will serve as the basis of a method for measuring amino acid transport rate and DV in the normal and pathological human brain

  7. Bleeding ectopic duodenal varix: use of a new microvascular plug (MVP) device along with transjugular intrahepatic portosystemic shunt (TIPSS).

    Science.gov (United States)

    Bhardwaj, Richa; Bhardwaj, Gaurav; Bee, Erik; Karagozian, Raffi

    2017-08-16

    Ectopic varices (ECV) occur along the gastrointestinal (GI) tract outside the common variceal sites and represent 2%-5% of all GI variceal bleeds with mortality rates up to 40%. Management is challenging because of inaccessibility and increased risk of rebleeding. We report what is to our knowledge the first clinical use of a new microvascular plug (MVP) with transjugular intrahepatic portosystemic shunt (TIPSS) for a bleeding duodenal varix (DV). A 68-year-old man presented with melena. Endoscopy demonstrated a grade II varix in the second part of the duodenum with red wale sign. TIPSS was performed and portogram revealed a single DV. Poststent placement venogram revealed a persistent varix and hence a 5-7 mm MVP was deployed. Subsequent imaging showed cessation of blood through the DV. The patient had no further bleeding. TIPSS with embolisation is an effective treatment for ECV. This MVP offers advantages due to its size and compatibility and can be redeployed in case of suboptimal placement. © BMJ Publishing Group Ltd (unless otherwise stated in the text of the article) 2017. All rights reserved. No commercial use is permitted unless otherwise expressly granted.

  8. Criminal Protection Orders for Women Victims of Domestic Violence: Explicating Predictors of Level of Restrictions Among Orders Issued.

    Science.gov (United States)

    Sullivan, Tami P; Weiss, Nicole H; Price, Carolina; Pugh, Nicole E

    2017-10-01

    Criminal protection orders (POs), with varying degrees of restrictions, are issued by the criminal justice system to enhance the safety of victims of domestic violence (DV). Limited research exists to elucidate factors associated with their issuance. Therefore, the purpose of this study was to investigate how demographic, relationship, parenting, and court-process-related factors are related to the level of restriction the PO places on the offender. Two-hundred ninety-eight women who were victims in a criminal DV case ( M age 36.4, 50.0% African American) participated in a structured interview approximately 12 to 15 months following the offenders' arraignment. Results revealed that psychological DV severity and fear of the offender in the 30 days prior to arraignment significantly predicted PO level of restriction issued. In addition, level of restriction requested by the victim significantly predicted level of restriction issued by the judge (though closer examination of the data revealed that many orders were issued at a different level of restriction than the victim requested). Other demographic, relationship, parenting, and court-process-related factors did not predict PO level of restriction issued. Findings are discussed with respect to practice and policy in the criminal justice system.

  9. Sizes of particles formed during municipal wastewater treatment.

    Science.gov (United States)

    Lech, Smoczynski; Marta, Kosobucka; Michal, Smoczynski; Harsha, Ratnaweera; Krystyna, Pieczulis-Smoczynska

    2017-02-01

    Volumetric diameters Dv and specific surface area SpS of sludge particles formed during chemical coagulation and electrocoagulation of sewage were determined. The obtained aggregate-flocs differed substantially in both Dv and SpS values. The differences in Dv and SpS values of the analyzed particles were interpreted based on theoretical models for expanding aggregates. The most uniform particles were formed under exposure to: (a) optimal and maximal doses of PIX, (b) optimal doses of PAX, (c) maximal doses of the Al electro-coagulant. The lowest PIX dose produced the least uniform particles. Sludge aggregates-particles produced under exposure to minimal doses of PIX and the Al electro-coagulant were characterized by the lowest SpS values. Sludge particles coagulated by PAX and the particles formed at higher doses of PIX and the Al electro-coagulant had higher SpS values. The particles formed at all doses of the applied coagulants and electro-coagulants were generally classified into two size ranges: the main range and the secondary range. Most particles belonged to the main size range. An increase in the percentage of colloidal hydroxide particles in sewage sludge increased SpS.

  10. Dowry-related domestic violence and complex posttraumatic stress disorder: a case report.

    Science.gov (United States)

    O'Connor, Manjula

    2017-08-01

    This paper draws attention to the mental health impact of coercive practice of dowry demands, associated with domestic violence (DV) in an immigrant woman. This study was based on a case report and selective literature review. This case history illustrates the serious mental health impacts of repeated emotional and physical trauma inflicted by a husband who was dissatisfied with his wife's dowry. Bio-psycho-social / cultural aspects of mental health treatments needed to be augmented with attention to safety, advocacy, and access to support networks. Cultural factors are important determinants of mental illness. Psychiatrists need to be aware of DV and dowry when treating immigrant women.

  11. Uncertainty Modeling for Database Design using Intuitionistic and Rough Set Theory

    Science.gov (United States)

    2009-01-01

    Definition. An intuitionistic rough relation R is a sub- set of the set cross product P(D1)× P(D2) × · · ·× P( Dm )× Dµ.× Dv. For a specific relation, R...that aj ∈ dij for all j. The interpretation space is the cross product D1× D2 × · · ·× Dm × Dµ× Dv but is limited for a given re- lation R to the set...systems, Journal of Information Science 11 (1985), 77–87. [7] T. Beaubouef and F. Petry, Rough Querying of Crisp Data in Relational Databases, Third

  12. Subjective study of thermal acceptability of novel enhanced displacement ventilation system and implication of occupants' personal control

    DEFF Research Database (Denmark)

    Sun, Weimeng; Cheong, K.W.D.; Melikov, Arsen Krikor

    2012-01-01

    with DV and constant heat load at different supply air temperatures, namely 20, 22, and 24 °C and room air temperatures, 22, 24, and 26 °C. Subjective assessments were carried out with 32 tropically-acclimatized college students who were given the choice to adjust the fan speed. Subjects' thermal comfort...... of 22 and 24 °C when the fans were in operation. It was also found that the Whole Body Thermal Sensation (WBTS) reported by the subjects was correlated with the Local Thermal Sensation (LTS) at the waist, the arms, the calf and the feet when the novel DV system was employed. An expression which allows...

  13. Simplified PET measurement for evaluating histamine H{sub 1} receptors in human brains using [{sup 11}C]doxepin

    Energy Technology Data Exchange (ETDEWEB)

    Mochizuki, Hideki [Department of Pharmacology, Tohoku University School of Medicine, Sendai, 980-8575 (Japan); Positron Medical Center, Tokyo Metropolitan Institute of Gerontology, Itabashi, Tokyo, 173-0022 (Japan); Kimura, Yuichi [Positron Medical Center, Tokyo Metropolitan Institute of Gerontology, Itabashi, Tokyo, 173-0022 (Japan)]. E-mail: ukimura@ieee.org; Ishii, Kenji [Positron Medical Center, Tokyo Metropolitan Institute of Gerontology, Itabashi, Tokyo, 173-0022 (Japan); Oda, Keiichi [Positron Medical Center, Tokyo Metropolitan Institute of Gerontology, Itabashi, Tokyo, 173-0022 (Japan); Sasaki, Toru [Positron Medical Center, Tokyo Metropolitan Institute of Gerontology, Itabashi, Tokyo, 173-0022 (Japan); Tashiro, Manabu [Department of Pharmacology, Tohoku University School of Medicine, Sendai, 980-8575 (Japan); Yanai, Kazuhiko [Department of Pharmacology, Tohoku University School of Medicine, Sendai, 980-8575 (Japan); Ishiwata, Kiichi [Positron Medical Center, Tokyo Metropolitan Institute of Gerontology, Itabashi, Tokyo, 173-0022 (Japan)

    2004-11-01

    The aim of this study was to develop simplified positron emission tomography measurement using [{sup 11}C]doxepin ([{sup 11}C]DOX) to evaluate histamine H{sub 1} receptors (H1Rs) in human brains. We evaluated the correlation between the distribution volume (DV) of [{sup 11}C]DOX, estimated quantitatively with a two-compartment model, and the [{sup 11}C]DOX uptake obtained at various time intervals and normalized using the metabolite-corrected plasma radioactivity. We found that the static 70- to 90-min images normalized using the plasma radioactivity at 10 min postinjection reflected the DV of [{sup 11}C]DOX-H1R binding.

  14. Zygotic LvBMP5-8 is required for skeletal patterning and for left-right but not dorsal-ventral specification in the sea urchin embryo.

    Science.gov (United States)

    Piacentino, Michael L; Chung, Oliver; Ramachandran, Janani; Zuch, Daniel T; Yu, Jia; Conaway, Evan A; Reyna, Arlene E; Bradham, Cynthia A

    2016-04-01

    Skeletal patterning in the sea urchin embryo requires coordinated signaling between the pattern-dictating ectoderm and the skeletogenic primary mesenchyme cells (PMCs); recent studies have begun to uncover the molecular basis for this process. Using an unbiased RNA-Seq-based screen, we have previously identified the TGF-ß superfamily ligand, LvBMP5-8, as a skeletal patterning gene in Lytechinus variegatus embryos. This result is surprising, since both BMP5-8 and BMP2/4 ligands have been implicated in sea urchin dorsal-ventral (DV) and left-right (LR) axis specification. Here, we demonstrate that zygotic LvBMP5-8 is required for normal skeletal patterning on the left side, as well as for normal PMC positioning during gastrulation. Zygotic LvBMP5-8 is required for expression of the left-side marker soxE, suggesting that LvBMP5-8 is required for left-side specification. Interestingly, we also find that LvBMP5-8 knockdown suppresses serotonergic neurogenesis on the left side. While LvBMP5-8 overexpression is sufficient to dorsalize embryos, we find that zygotic LvBMP5-8 is not required for normal DV specification or development. In addition, ectopic LvBMP5-8 does not dorsalize LvBMP2/4 morphant embryos, indicating that, in the absence of BMP2/4, BMP5-8 is insufficient to specify dorsal. Taken together, our data demonstrate that zygotic LvBMP5-8 signaling is essential for left-side specification, and for normal left-side skeletal and neural patterning, but not for DV specification. Thus, while both BMP2/4 and BMP5-8 regulate LR axis specification, BMP2/4 but not zygotic BMP5-8 regulates DV axis specification in sea urchin embryos. Copyright © 2016 Elsevier Inc. All rights reserved.

  15. Correlates of Domestic Violence Victimization Among North Korean Refugee Women in South Korea.

    Science.gov (United States)

    Um, Mee Young; Kim, Hee Jin; Palinkas, Lawrence A

    2018-07-01

    Although many North Korean (NK) refugee women are victims of domestic violence (DV) in North Korea, face sexual exploitation during migration, and remain at risk of DV while adapting to life in South Korea, there is no empirical evidence about risk factors for DV in this population. To fill this gap, this study examined whether gender role beliefs, child abuse history, and sociocultural adaptation were associated with past-year physical, emotional, sexual, and economic abuse, and whether they were associated with multiple forms of abuse. We also explored whether these associations were similar or different across different types of DV among NK refugee women. A sample of 180 ever-married NK refugee women in South Korea from the 2010 National Survey on Family Violence was used for analysis. Physical abuse was associated with more traditional gender role beliefs; emotional abuse and multiple forms of abuse were associated with lower levels of sociocultural adaptation; and sexual and economic abuse were associated with an increased likelihood of childhood abuse and poor sociocultural adaptation. Our study findings underscore the importance of assisting NK refugee women to be better adapted to the new culture in a practical way, because better sociocultural adaptation might protect them from experiencing various types of abuse. At the same time, findings of this study highlight the need for empowering NK refugee women who report physical abuse by educating their rights and altering their traditional beliefs of gender roles, and screening of childhood abuse and providing culturally sensitive psychotherapy to those who report sexual or economic abuse. Moreover, we suggest future studies to examine correlates of different forms of abuse separately because they can inform culturally tailored interventions for abused NK refugee women. To prevent further victimization, educational programs should be provided to NK refugee women at an early stage of resettlement in South Korea.

  16. [{sup 11}C]d-threo-Methylphenidate, a new radiotracer for the dopamine transporter. Characterization in baboon and human brain

    Energy Technology Data Exchange (ETDEWEB)

    Ding, Y.S.; Volkow, N.D.; Fowler, J.S. [Brookhaven National Laboratory, Upton, NY (United States)] [and others

    1995-05-01

    dl-threo Methylphenidate (MP, Ritalin) is a psychostimulant drug which binds to the dopamine transporter (DAT). We evaluated [{sup 11}C]d-threo-methylphenidate ([{sup 11}C]d-MP), the more active enantiomer, as a radiotracer for the DAT in baboons and human brain. Stereoselectivity, saturability and pharmacological specificity and reproducibility were examined. Stereoselectivity was examined in baboons by comparing [{sup 11C}]d-MP,[{sup 11}C]l-MP and [{sup 11}C]dl-MP. Unlabeled MP was used to assess the reversibility and saturability of the binding. GBR 12909,{beta}-(4-iodophenyl)tropane-2-carboxylic acid methyl ester ({beta}-CIT), tomoxetine and citalopram were used to assess the specificity of the binding. The ratios between the radioactivity in the striatum to that in cerebellum (ST/CB) were 3.3,2.2 and 1.1 for [{sup 11}C]d-MP,[{sup 11}C]dl-MP and [{sup 11}C]l-MP respectively. Most of the striatal binding of [{sup 11}C]d-threo-MP was displaced by injection of nonradioactive MP demonstrating reversibility. Pretreatment with MP (0.5 mg/kg), GBR12909 (1.5 mg/kg) or {beta}-CIT (0.3 mg/kg) reduced ST/CB by about 60% and the ratios of distribution volumes at the steady-state for the triatum to cerebellum (DV{sub st/}DV{sub cb}) by about 50%. Pretreatment with tomoxetine (3.0 mg/kg) or citalopram (2.0 mg/kg), inhibitors of the norepinephrine and serotonin transporter, had no effect. Studies of [{sup 11}C]d-MP in the human brain showed highest uptake in basal ganglia with a half clearance time of about 60 minutes. Repeated studies in 6 normal human subjects showed differences in DV{sub st/}DV{sub cb} between -7% and 8%. MP pretreatment decreased BG but no cortical or cerebellar binding and reduced Bmax/Kd by 91%.

  17. Evaluation of SmartStax and SmartStax PRO maize against western corn rootworm and northern corn rootworm: efficacy and resistance management.

    Science.gov (United States)

    Head, Graham P; Carroll, Matthew W; Evans, Sean P; Rule, Dwain M; Willse, Alan R; Clark, Thomas L; Storer, Nicholas P; Flannagan, Ronald D; Samuel, Luke W; Meinke, Lance J

    2017-09-01

    Cases of western corn rootworm (WCR) field-evolved resistance to Cry3Bb1 and other corn rootworm (CRW) control traits have been reported. Pyramid products expressing multiple CRW traits can delay resistance compared to single trait products. We used field studies to assess the pyramid CRW corn products, SmartStax (expressing Cry3Bb1 and Cry34Ab1/Cry35Ab1) and SmartStax PRO (expressing Cry3Bb1, Cry34Ab1/Cry35Ab1 and DvSnf7), at locations with high WCR densities and possible Cry3Bb1 resistance, and to assess the reduction in adult emergence attributable to DvSnf7 and other traits. Insect resistance models were used to assess durability of SmartStax and SmartStax PRO to WCR resistance. SmartStax significantly reduced root injury compared to non-CRW-trait controls at all but one location with measurable WCR pressure, while SmartStax PRO significantly reduced root injury at all locations, despite evidence of Cry3Bb1 resistance at some locations. The advantage of SmartStax PRO over SmartStax in reducing root damage was positively correlated with root damage on non-CRW-trait controls. DvSnf7 was estimated to reduce WCR emergence by approximately 80-95%, which modeling indicated will improve durability of Cry3Bb1 and Cry34Ab1/Cry35Ab1 compared to SmartStax. The addition of DvSnf7 in SmartStax PRO can reduce root damage under high WCR densities and prolong Cry3Bb1 and Cry34Ab1/Cry35Ab1 durability. © 2017 Society of Chemical Industry. © 2017 Society of Chemical Industry.

  18. DENGUE, CHIKUNGUNYA AND ZIKA INFECTIONS IMPORTED TO PARIS BETWEEN 2009 AND 2016: CHARACTERISTICS AND CORRELATION WITH OUTBREAKS IN THE FRENCH OVERSEAS TERRITORIES OF GUADELOUPE AND MARTINIQUE.

    Science.gov (United States)

    Vasquez, Victor; Haddad, Elie; Perignon, Alice; Jaureguiberry, Stéphane; Brichler, Ségolène; Leparc-Goffart, Isabelle; Caumes, Eric

    2018-05-18

    Dengue (DV), chikungunya (CV) and Zika virus (ZV) infections are rapidly expanding across countries and diagnosed in returned travelers who represent epidemiological sentinels. French Territories of America (FTA) such as Guadeloupe and Martinique are highly touristic places and have experienced three consecutive outbreaks by such viruses in the last decade. We evaluated how ill returned travelers could be deemed as epidemiological sentinels for these three expanding arboviral diseases during eight consecutive years. We estimated the degree of correlation between the cases of ill returned travelers arriving at our hospital and the three outbreaks that occurred in the FTA during the study period. We included all consecutive ill returned travelers diagnosed at a French tertiary hospital in Paris with imported DV, CV or ZV infections from January 2009 to December 2016. Epidemiological and clinical variables were evaluated. Data concerning the incidence of arboviruses in the FTA, and the temporal relationship between the occurrence of imported cases and outbreaks in FTA were analyzed. Overall, 320 cases of arboviral infections with 216 DV, 68 CV and 36 ZV were reported. Most of the patients presented with fever and exanthema. 115 patients were exposed in Guadeloupe or Martinique which were the at-risk destination in 25% of patients with DV, 59% patients with CV, and 58% patients with ZV. The occurrence of cases diagnosed in returning travelers followed the same time pattern as the outbreaks in these areas. We found a temporal correlation between newly diagnosed imported cases of arboviruses, and the three corresponding outbreaks that occurred in Martinique and Guadeloupe during 8 consecutive years. We show that ill returned travelers act as epidemiological sentinels from the beginning up to the end of outbreaks occurring in touristic places. Copyright © 2018. Published by Elsevier Ltd.

  19. Microbial community composition of transiently wetted Antarctic Dry Valley soils.

    Science.gov (United States)

    Niederberger, Thomas D; Sohm, Jill A; Gunderson, Troy E; Parker, Alexander E; Tirindelli, Joëlle; Capone, Douglas G; Carpenter, Edward J; Cary, Stephen C

    2015-01-01

    During the summer months, wet (hyporheic) soils associated with ephemeral streams and lake edges in the Antarctic Dry Valleys (DVs) become hotspots of biological activity and are hypothesized to be an important source of carbon and nitrogen for arid DV soils. Recent research in the DV has focused on the geochemistry and microbial ecology of lakes and arid soils, with substantially less information being available on hyporheic soils. Here, we determined the unique properties of hyporheic microbial communities, resolved their relationship to environmental parameters and compared them to archetypal arid DV soils. Generally, pH increased and chlorophyll a concentrations decreased along transects from wet to arid soils (9.0 to ~7.0 for pH and ~0.8 to ~5 μg/cm(3) for chlorophyll a, respectively). Soil water content decreased to below ~3% in the arid soils. Community fingerprinting-based principle component analyses revealed that bacterial communities formed distinct clusters specific to arid and wet soils; however, eukaryotic communities that clustered together did not have similar soil moisture content nor did they group together based on sampling location. Collectively, rRNA pyrosequencing indicated a considerably higher abundance of Cyanobacteria in wet soils and a higher abundance of Acidobacterial, Actinobacterial, Deinococcus/Thermus, Bacteroidetes, Firmicutes, Gemmatimonadetes, Nitrospira, and Planctomycetes in arid soils. The two most significant differences at the genus level were Gillisia signatures present in arid soils and chloroplast signatures related to Streptophyta that were common in wet soils. Fungal dominance was observed in arid soils and Viridiplantae were more common in wet soils. This research represents an in-depth characterization of microbial communities inhabiting wet DV soils. Results indicate that the repeated wetting of hyporheic zones has a profound impact on the bacterial and eukaryotic communities inhabiting in these areas.

  20. Child maltreatment and risk patterns among participants in a child abuse prevention program.

    Science.gov (United States)

    Duffy, Jennifer Y; Hughes, Marcia; Asnes, Andrea G; Leventhal, John M

    2015-06-01

    The relationship between risk factors and Child Protective Services (CPS) outcomes in families who participate in home visiting programs to prevent abuse and neglect and who are reported to CPS is largely unknown. We examined the relationship between parental risk factors and the substantiation status and number of CPS reports in families in a statewide prevention program. We reviewed CPS reports from 2006 to 2008 for families in Connecticut's child abuse prevention program. Six risk factors (histories of CPS, domestic violence [DV], mental health, sexual abuse, substance abuse, and criminal involvement) and the number of caregivers were abstracted to create risk scores for each family member. Maltreatment type, substantiation, and number of reports were recorded. Odds ratios were calculated. Of 1,125 families, 171 (15.6%) had at least one CPS report, and reports of 131 families were available for review. Families with a substantiated (25.2%) versus unsubstantiated (74.8%) first report had a high number of paternal risk factors (OR=6.13, 95% CI [1.89, 20.00]) and were more likely to have a history of maternal DV (OR=8.47, 95% CI [2.96, 24.39]), paternal DV (OR=11.23, 95% CI [3.33, 38.46]), and maternal criminal history (OR=4.55; 95% CI [1.32, 15.60]). Families with >1 report (34.4%) versus 1 report (65.6%) were more likely to have >3 caregivers, but this was not statistically significant (OR=2.53, 95% CI [0.98, 6.54]). In a prevention program for first-time families, DV, paternal risk, maternal criminal history, and an increased number of caregivers were associated with maltreatment outcomes. Targeting parental violence may impact child abuse prevention. Copyright © 2014 Elsevier Ltd. All rights reserved.

  1. Thermal Fluctuations in Smooth Dissipative Particle Dynamics simulation of mesoscopic thermal systems

    Science.gov (United States)

    Gatsonis, Nikolaos; Yang, Jun

    2013-11-01

    The SDPD-DV is implemented in our work for arbitrary 3D wall bounded geometries. The particle position and momentum equations are integrated with a velocity-Verlet algorithm and the entropy equation is integrated with a Runge-Kutta algorithm. Simulations of nitrogen gas are performed to evaluate the effects of timestep and particle scale on temperature, self-diffusion coefficient and shear viscosity. The hydrodynamic fluctuations in temperature, density, pressure and velocity from the SDPD-DV simulations are evaluated and compared with theoretical predictions. Steady planar thermal Couette flows are simulated and compared with analytical solutions. Simulations cover the hydrodynamic and mesocopic regime and show thermal fluctuations and their dependence on particle size.

  2. Dicty_cDB: Contig-U15854-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 737759 ) Osmo01894 F. cylindrus osmotic stress library Fra... 42 9e-06 3 ( CX582318 ) TTE00021703 Amplicon Express - Conjugati...lone:XL459m21ex, 5' end. 42 0.11 2 ( CK275852 ) EST721930 potato abiotic stress cDNA library Sola... 40 0.12...HD_XGC_Emb4 Xenopus laevis c... 42 0.12 2 ( CK272208 ) EST718286 potato abiotic stress cDNA library Sola... ...12 2 ( CK265018 ) EST711096 potato abiotic stress cDNA library Sola... 40 0.12 2 ( DV607474 ) EST1210470 Glo... Xenopus l... 42 0.13 2 ( CK278382 ) EST724460 potato abiotic stress cDNA library Sola... 40 0.14 2 ( DV6190

  3. Problematika sebereflexe v románu 20. století

    OpenAIRE

    KOUDELKOVÁ, Jana

    2011-01-01

    This diploma thesis deals with the problems of the self-reflection in the prose of the 20th century. At first there are described the techniques of the narration, which appeared in the 20th century. Then there are defined the general signs of the self-reflection and the influence of social situation on the increase of the self-reflection. In the next section the work involves the analysis of the novel Život a názory blahorodého pana Tristrama Shandyho. The conception of the self-reflection is...

  4. Konference Knižní kultura 19. století

    Czech Academy of Sciences Publication Activity Database

    Holubová, Markéta

    2017-01-01

    Roč. 104, č. 4 (2017), s. 518-519 ISSN 0009-0794 Institutional support: RVO:68378076 Keywords : book culture * conference * 19. century Subject RIV: AC - Archeology, Anthropology, Ethnology OBOR OECD: 6.5 Other Humanities and the Arts

  5. A Comparison of the Structural Factors of the Propensity for Abusiveness Scale for Women and Men in a Domestic Violence Treatment Program.

    Science.gov (United States)

    Allen, Christopher T; Swan, Suzanne C; Maas, Carl D; Barber, Sara

    2015-08-01

    Court-mandated domestic violence (DV) treatment programs across the country have seen a marked increase in female clients. These programs use a variety of measurement tools to assess the needs of their clients. Increased numbers of women in treatment for DV reflect a need to address the measurement of intimate partner violence (IPV) for both males and females. Unfortunately, the reliability and validity of many of measures used to assess IPV and related constructs for women remains unknown. The current study focuses on a particular measure, the Propensity for Abusiveness Scale (PAS). The PAS is not a measure of abusive behavior per se; rather, it assesses risk factors for abuse, including affective lability, anger expression, trauma symptoms, and harsh parenting experienced by the respondent. Specifically, the current study compares the factor structure and the measurement properties of the PAS for males and females in a sample of 885 (647 female, 238 male) participants in a DV treatment program. Findings indicate that the PAS demonstrated configural, metric, and scalar invariance between the female and male samples. These results suggest that it is appropriate for researchers and clinicians to make comparisons between women and men based on PAS factor scores. © The Author(s) 2014.

  6. Geometry and mechanics of teleost gastrulation and the formation of primary embryonic axes.

    Science.gov (United States)

    Cherdantseva, Elena M; Cherdantsev, Vladimir G

    2006-01-01

    Examination of normal shaping dynamics and immediate and long-term responses to blastoderm cutting in zebrafish and loach embryos prior to the onset of gastrulation and during the course of epiboly revealed that anteroposterior (AP) and dorsoventral (DV) polarity formation is connected with shaping of the blastoderm circumferential region, which stretches along and shrinks across its movement axes and originates the non-isotropic fields of tensile stresses. Based on data from cutting experiments and quantitative morphology, we reconstructed the movement-shaping patterns of epiboly and embryonic shield formation. We revealed that AP and DV axes originate as a mass cell movement subject to the movement-shaping equivalence principle, which means the spatial series of differently shaped areas corresponding to the time succession of the same area shaping. Maintenance of the main body axes in orthogonal orientation depends on the mechanical equilibrium principle allowing for converting shape asymmetry into that of tensile stresses and vice versa. The causal relationship between the main movement-shaping axes and that of embryonic polarity was proved in cutting experiments in which the DV axis direction was subject to rearrangement so as to adjust to the new direction of mass cell movement axes induced by healing the wound in the blastoderm circumferential region.

  7. Switchable Polarization in Mn Embedded Graphene.

    Science.gov (United States)

    Noor-A-Alam, Mohammad; Ullah, Hamid; Shin, Young-Han

    2018-03-14

    Graphene, despite its many unique properties, is neither intrinsically polar due to inversion symmetry nor magnetic. However, based on density functional theory, we find that Mn, one of transition metals, embedded in single or double vacancy (Mn@SV and Mn@DV) in a graphene monolayer induces a dipole moment perpendicular to the sheet, which can be switched from up to down by Mn penetration through the graphene. Such switching could be realized by an external stimuli introduced through the tip of a scanning probe microscope, as already utilized in the studies of molecular switches. We estimate the energy barriers for dipole switching, which are found to be 2.60 eV and 0.28 eV for Mn@SV and Mn@DV, respectively. However, by applying biaxial tensile strain, we propose a mechanism for tuning the barrier. We find that 10% biaxial tensile strain, which is already experimentally achievable in graphene-like two-dimensional materials, can significantly reduce the barrier to 0.16 eV in Mn@SV. Moreover, in agreement with previous studies, we find a high magnetic moment of 3 μ B for both Mn@SV and Mn@DV, promising the potential of these structures in spintronics as well as in nanoscale electro-mechanical or memory devices.

  8. Starvation-Survival in Haloarchaea.

    Science.gov (United States)

    Winters, Yaicha D; Lowenstein, Tim K; Timofeeff, Michael N

    2015-11-12

    Recent studies claiming to revive ancient microorganisms trapped in fluid inclusions in halite have warranted an investigation of long-term microbial persistence. While starvation-survival is widely reported for bacteria, it is less well known for halophilic archaea-microorganisms likely to be trapped in ancient salt crystals. To better understand microbial survival in fluid inclusions in ancient evaporites, laboratory experiments were designed to simulate growth of halophilic archaea under media-rich conditions, complete nutrient deprivation, and a controlled substrate condition (glycerol-rich) and record their responses. Haloarchaea used for this work included Hbt. salinarum and isolate DV582A-1 (genus Haloterrigena) sub-cultured from 34 kyear Death Valley salt. Hbt. salinarum and DV582A-1 reacted to nutrient limitation with morphological and population changes. Starved populations increased and most cells converted from rods to small cocci within 56 days of nutrient deprivation. The exact timing of starvation adaptations and the physical transformations differed between species, populations of the same species, and cells of the same population. This is the first study to report the timing of starvation strategies for Hbt. salinarum and DV582A-1. The morphological states in these experiments may allow differentiation between cells trapped with adequate nutrients (represented here by early stages in nutrient-rich media) from cells trapped without nutrients (represented here by experimental starvation) in ancient salt. The hypothesis that glycerol, leaked from Dunaliella, provides nutrients for the survival of haloarchaea trapped in fluid inclusions in ancient halite, is also tested. Hbt. salinarum and DV582A-1 were exposed to a mixture of lysed and intact Dunaliella for 56 days. The ability of these organisms to utilize glycerol from Dunaliella cells was assessed by documenting population growth, cell length, and cell morphology. Hbt. salinarum and DV582A-1

  9. The effect of defect types on the electronic and optical properties of graphene nanoflakes physisorbed by ionic liquids.

    Science.gov (United States)

    Shakourian-Fard, Mehdi; Kamath, Ganesh

    2017-02-08

    Defect engineering and non-covalent interaction strategies allow for dramatically tuning the optoelectronic properties of graphene. Using ab initio density functional theory (M06-2X/cc-pVDZ), we find that the nature of defects on the graphene nanoflakes (GNFs) and the size of defective GNF (DGNF) surfaces affect the binding energy (ΔE b ) of ionic liquids (ILs) and the UV-Vis absorption spectra of DGNFIL complexes. Further, our results indicate that increasing the size of DGNFs affects the geometrical structure of the surfaces and increases the binding energy of ILs by about 10%. Analysis based on AIM and EDA shows that the interactions between ILs and DGNFs are non-covalent in nature (dispersion energy being dominant) and associated with charge transfer between the IL and nanoflakes. A comparison between the ΔE b values of ILs on DGNFs, GNFs, and h-BN nanoflakes (h-BNNF) shows that the presence of defects on the GNF surfaces increases the binding energy values as follows: DGNFIL > pristine GNFIL > h-BNNFIL. Our calculations indicate that increasing the size of DGNF surfaces leads to a decrease in the HOMO-LUMO energy gap (E g ) of the DGNF surfaces. Orbital energy and density of state calculations show that the E g of DV(SW)-GNFs decreases upon IL adsorption and their Fermi energy level is shifted depending on the type of IL, thus enabling better conductivity. Reactivity descriptors generally indicate that the chemical potential (μ) and chemical hardness (η) of nanoflakes decrease upon IL adsorption, whereas the electrophilicity index (ω) increases. The UV-Vis absorption spectrum of DV-GNF and SW-GNF shows four bands in the visible spectrum which correspond to π → π* transitions with the absorption bands of SW-GNF appearing at higher wavelengths than those of DV-GNF. The most intense absorption bands in DV-GNF (λ = 348 nm) and SW-GNF (λ = 375 nm) are associated with electronic transitions HOMO-1 → LUMO+2 and HOMO → LUMO+1, respectively. In addition

  10. Starvation-Survival in Haloarchaea

    Directory of Open Access Journals (Sweden)

    Yaicha D. Winters

    2015-11-01

    Full Text Available Recent studies claiming to revive ancient microorganisms trapped in fluid inclusions in halite have warranted an investigation of long-term microbial persistence. While starvation-survival is widely reported for bacteria, it is less well known for halophilic archaea—microorganisms likely to be trapped in ancient salt crystals. To better understand microbial survival in fluid inclusions in ancient evaporites, laboratory experiments were designed to simulate growth of halophilic archaea under media-rich conditions, complete nutrient deprivation, and a controlled substrate condition (glycerol-rich and record their responses. Haloarchaea used for this work included Hbt. salinarum and isolate DV582A-1 (genus Haloterrigena sub-cultured from 34 kyear Death Valley salt. Hbt. salinarum and DV582A-1 reacted to nutrient limitation with morphological and population changes. Starved populations increased and most cells converted from rods to small cocci within 56 days of nutrient deprivation. The exact timing of starvation adaptations and the physical transformations differed between species, populations of the same species, and cells of the same population. This is the first study to report the timing of starvation strategies for Hbt. salinarum and DV582A-1. The morphological states in these experiments may allow differentiation between cells trapped with adequate nutrients (represented here by early stages in nutrient-rich media from cells trapped without nutrients (represented here by experimental starvation in ancient salt. The hypothesis that glycerol, leaked from Dunaliella, provides nutrients for the survival of haloarchaea trapped in fluid inclusions in ancient halite, is also tested. Hbt. salinarum and DV582A-1 were exposed to a mixture of lysed and intact Dunaliella for 56 days. The ability of these organisms to utilize glycerol from Dunaliella cells was assessed by documenting population growth, cell length, and cell morphology. Hbt. salinarum

  11. Performance of Angus, Devon and crossbred Angus x Devon x Nelore young steers in feedlot/ Desempenho de novilhos superprecoces Angus, Devon e cruzas Angus x Devon x Nelore em confinamento

    Directory of Open Access Journals (Sweden)

    Hélio Radke Bittencourt

    2007-07-01

    Full Text Available The study was based on data from 129 beef steers from three genetic groups: Angus (AN, n=45, Devon (DV, n=35 and Crossbred Angus x Devon x Nelore (CB, n=49, with an average beginning weight (ABWof 277.60, 278.00 and 295.53 kg, respectively. Those animals were in a feedlot with 11 months of age, to be slaughtered at 14 months. The parameters analyzed were: days on feed (DF, average weight gain (AWG, total weight gain (TWG, average slaughter weight (SW, average carcass weight (CW, average carcass yield (CY and carcass classification (CC. The analysis were done using the ABW as a covariate because of these variable in the group CB were higher (p0.05. CB animals got a higher SW (375.04 kg than DV (359.40 (p0.05. The CW (pForam analisados dados de 129 novilhos das raças Angus (AN, n=45, Devon (DV, n=35 e cruzas Angus x Devon x Nelore (CR, n=49, com peso médio inicial (PMI de 277,60, 278,00 e 295,53 kg, respectivamente, confinados aos 11 meses de idade para abate aos 14 meses. As variáveis-resposta mensuradas foram: tempo médio de permanência (TMP; ganho de peso médio diário (GMD; ganho de peso total (GP; peso médio ao abate (PMA; peso médio de carcaça (PC; rendimento médio de carcaça (RC e classificação de carcaça (CC. As análises foram realizadas utilizando o PMI como co-variável, visto que este foi maior (p 0,05. Animais CR apresentaram maior (p 0,05 de DV e CR. O PC (p < 0,05 e o RC (p < 0,01 foram maiores para CR (191,12 kg e 50,99% em relação à AN (179,81 kg e 49,73% e DV (177,23 kg e 49,41%, respectivamente, que não apresentaram variações significativas entre si. Novilhos Angus e Devon obtiveram resultados semelhantes em todas as variáveis analisadas. Animais cruza Angus x Devon x Nelore apresentaram maior peso e rendimento de carcaça do que animais puros.

  12. Innovative Applications of DoD Propulsion Technology for Low-Cost Satellite Missions, Phase II

    Data.gov (United States)

    National Aeronautics and Space Administration — We are proposing to leverage the Missile Defense Agency investments in high-performance propulsion systems for low-cost space missions with large Dv requirements,...

  13. Bringing a Network-Oriented Approach to Domestic Violence Services: A Focus Group Exploration of Promising Practices.

    Science.gov (United States)

    Goodman, Lisa A; Banyard, Victoria; Woulfe, Julie; Ash, Sarah; Mattern, Grace

    2016-01-01

    Despite powerful evidence that informal social support contributes to survivors' safety and well-being, mainstream domestic violence (DV) programs have not developed comprehensive models for helping isolated survivors re-engage with these networks. Although many advocates use network-oriented strategies informally, they often do so without resources, funding, or training. This qualitative focus group study explored advocates' use and perceptions of network-oriented strategies. Advocates working in a range of DV programs across one state described the importance of network-oriented work and articulated its five dimensions, including helping survivors build their capacity to form healthy relationships, identify helpful and harmful network members, re-engage with existing networks, develop new relationships, and respond more effectively to network members. © The Author(s) 2015.

  14. Consequences of Exposure to Domestic Violence for Children: A Systematic Review of the Literature

    Directory of Open Access Journals (Sweden)

    Lelio Moura Lourenco

    2013-05-01

    Full Text Available The aim of this study was to carry out a systematic review of the literature on the consequences of exposure to domestic violence – DV for children. The period 2005-2011 was searched in Medline, Lilacs, Scielo, Web of Science, Dialnet, Redalyc, Google Scholar and PsycInfo, using the following descriptors: intimate partner violence , domestic violence , violence descriptors ( physical , sexual, psychological , and child , exposure or witness . The author, country, methodology, journal and the consequences of exposure to DV were considered. 122 articles were selected. The United States and Brazil accounted for 78.7% of the publications, with children being the main victims (51.6%. The major impacts upon children´s health were posttraumatic stress and insecurity (75.8%.

  15. Vortices in Gaussian beams

    CSIR Research Space (South Africa)

    Roux, FS

    2009-01-01

    Full Text Available , t0)} = P(du, dv) {FR{g(u, v, t0)}} Replacement: u→ du = t− t0 i2 ∂ ∂u′ v → dv = t− t0 i2 ∂ ∂v′ CSIR National Laser Centre – p.13/30 Differentiation i.s.o integration Evaluate the integral over the Gaussian beam (once and for all). Then, instead... . Gaussian beams with vortex dipoles CSIR National Laser Centre – p.2/30 Gaussian beam notation Gaussian beam in normalised coordinates: g(u, v, t) = exp ( −u 2 + v2 1− it ) u = xω0 v = yω0 t = zρ ρ = piω20 λ ω0 — 1/e2 beam waist radius; ρ— Rayleigh range ω ω...

  16. Apropiación tecnológica en personas con discapacidad visual

    Directory of Open Access Journals (Sweden)

    Esther Labrada Martínez

    2011-01-01

    Full Text Available El fenómeno de la apropiación de la tecnología se identifica como un proceso cultural mediante el cual la persona con discapacidad visual (PcDV adquiere un conocimiento que favorece su desarrollo educativo y profesional además de originar una transformación a nivel personal denotando una forma distinta para percibir la discapacidad en la dimensión social. Conceptualmente, el conocer, usar y crear son los criterios a partir de los que se alfabetiza, interactúa y produce los recursos tecnológicos para la generación de competencias en las PcDV, permitiendo trabajar en función de crear espacios sociales para la inserción de las personas con fines productivos.

  17. The Changes in Doppler Indices of Fetal Ductus Venosus and Umbilical Artery After Amnioinfusion for Women With Preterm Premature Rupture of Membranes Before 26 Weeks' Gestation

    Directory of Open Access Journals (Sweden)

    Te-Yao Hsu

    2009-09-01

    Conclusion: Amnioinfusion increases the space for the fetuses and reduces the impedance of the fetoplacental circulation. Improvements in DV and UMA flow may benefit fetuses suffering severe oligohydramnios in mid-pregnancy.

  18. Intervalos de referência longitudinais de parâmetros doplervelocimétricos materno-fetais Longitudinal reference intervals of maternal-fetal Doppler parameters

    Directory of Open Access Journals (Sweden)

    Nelsilene Mota Carvalho Tavares

    2013-01-01

    Full Text Available OBJETIVO: Criar intervalos de referência longitudinais para os valores de índices de pulsatilidade (IP dos fluxos nas artérias umbilicais (AU, cerebral média (ACM e uterinas (AUt e IP venoso do fluxo no ducto venoso (DV com uma amostra da população brasileira. MÉTODOS: Estudo observacional longitudinal realizado de fevereiro de 2010 a maio de 2012. Gestantes de baixo risco foram submetidas a exames ultrassonográficos quinzenais da 18ª a 40ª semana para obtenção dos IP das AU, AUt, ACM e IP venoso do DV. Modelos lineares mistos foram usados para elaboração de intervalos de referência longitudinais (percentis 5, 50 e 95 dos IP dos vasos mencionados. Os IP das porções placentária e abdominal do cordão umbilical foram comparados por meio do teste t de amostras independentes. Valores de p bilaterais menores do que 0,05 foram considerados significativos. RESULTADOS: Cento e sessenta e quatro gestantes foram submetidas a 1.242 exames ultrassonográficos. Houve redução significativa nos valores de todos esses parâmetros com o avançar da IG. Entre a 18ª e a 40ª semana de gravidez, as medianas de IP da AU (porções abdominal e placentária do cordão, da ACM, do DV e do IP médio das AUt variaram de 1,19 a 0,74; 1,33 a 0,78; 1,56 a 1,39; 0,58 a 0,41; e 0,98 a 0,66, respectivamente. As equações obtidas para predição das medianas foram: IP-AU=1,5602786 - (0,020623 x IG; Logaritmo do IP-ACM=0,8149111 - (0,004168 x IG - [0,002543 x (IG - 28,7756²]; Logaritmo do IP-DV=-0,26691- (0,015414 x IG; IP-AUt=1,2362403 - (0,014392 x IG. Houve diferença significativa entre os IP-AU obtidos nas extremidades placentária e abdominal fetal (pPURPOSE: To create longitudinal reference intervals for pulsatility index (PI of the umbilical (UA, middle cerebral (MCA, uterine (UtA arteries and ductus venosus (DV in a Brazilian cohort. METHODS: A longitudinal observational study performed from February 2010 to May 2012. Low risk pregnancies were

  19. Jalutu David tantsib auhinna vääriliselt / Andres Laasik

    Index Scriptorium Estoniae

    Laasik, Andres, 1960-2016

    2006-01-01

    Tantsufilm "Elu hind" ("The Cost of Living") : lavastaja ja koreograaf Lloyd Newson : peaosades David Toole, Eddie Kay : Suurbritannia 2004. Filmi aluseks on Londoni tantsuteatri DV 8 Physical Theatre' 2000.a. valminud lavastus

  20. ORF Alignment: NC_002929 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available a ... bronchiseptica RB50] ... Length = 249 ... Query: 32 ... RPVRLIVPYGAGGAADVLARIMAEKLSAIWKQPVIVEN...KPGGVGTIGIMATVQAEPDGYT 91 ... +PVR++V + AGG ... DV+ARIMA++L+ ... Q ... +VENKPGG ... ... I ... +A PDGYT Sbjct: 1 ... KPVRIVVGFSAGGTTDVIARIMAKELTEALGQSFVVENKPGGGSNIATDYVARATPDGYT 60 ... Query: 152 KPGY

  1. ORF Alignment: NC_002927 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available a ... bronchiseptica RB50] ... Length = 249 ... Query: 32 ... RPVRLIVPYGAGGAADVLARIMAEKLSAIWKQPVIVEN...KPGGVGTIGIMATVQAEPDGYT 91 ... +PVR++V + AGG ... DV+ARIMA++L+ ... Q ... +VENKPGG ... ... I ... +A PDGYT Sbjct: 1 ... KPVRIVVGFSAGGTTDVIARIMAKELTEALGQSFVVENKPGGGSNIATDYVARATPDGYT 60 ... Query: 152 KPGY

  2. Ending domestic violence against women: assessment of ...

    African Journals Online (AJOL)

    Ending domestic violence against women: assessment of knowledge and ... Methods: A descriptive cross-sectional design was utilized for this study. ... study documented poor knowledge and perception of DV among the studied population.

  3. Identifying signs and symptoms of intimate partner violence in an oncology setting.

    Science.gov (United States)

    Mick, JoAnn

    2006-08-01

    Domestic violence (DV), or intimate partner violence (IPV), is a prevailing problem in public health. Often, healthcare providers may be the first people that victims of DV will approach to reveal their problem or seek assistance. IPV is a pattern of control using assault and intimidating behaviors that has devastating effects on individuals, their families, and communities. Oncology nurses need to become familiar with common indicators of DV so that signs and symptoms of abuse can be identified when assessing patients in an oncology setting. Standards of oncology nursing practice support that the psychosocial impact of cancer on patients and their families or significant others needs to be considered at all stages of diagnosis and treatment. The psychosocial impact of other personal situations or concerns, such as IPV, can add to the complexity of cancer management. Routine screening for signs and symptoms of psychosocial distress helps identify patients who require additional interventions. Oncology nursing practice is based on a holistic approach to patient care, which supports that identification of physical and psychosocial needs are equally important. Oncology nursing provides many unique opportunities to help patients cope with cancer. Routine nursing assessment for signs and symptoms of abuse will provide an opportunity to assist patients with cancer to manage not only the life-threatening aspects of their diagnosis but also the life-threatening aspects of IPV.

  4. The minimum knowledge base for predicting organ-at-risk dose-volume levels and plan-related complications in IMRT planning

    International Nuclear Information System (INIS)

    Zhang, Hao H; D'Souza, Warren D; Meyer, Robert R; Shi Leyuan

    2010-01-01

    IMRT treatment planning requires consideration of two competing objectives: achieving the required amount of radiation for the planning target volume and minimizing the amount of radiation delivered to all other tissues. It is important for planners to understand the tradeoff between competing factors so that the time-consuming human interaction loop (plan-evaluate-modify) can be eliminated. Treatment-plan-surface models have been proposed as a decision support tool to aid treatment planners and clinicians in choosing between rival treatment plans in a multi-plan environment. In this paper, an empirical approach is introduced to determine the minimum number of treatment plans (minimum knowledge base) required to build accurate representations of the IMRT plan surface in order to predict organ-at-risk (OAR) dose-volume (DV) levels and complications as a function of input DV constraint settings corresponding to all involved OARs in the plan. We have tested our approach on five head and neck patients and five whole pelvis/prostate patients. Our results suggest that approximately 30 plans were sufficient to predict DV levels with less than 3% relative error in both head and neck and whole pelvis/prostate cases. In addition, approximately 30-60 plans were sufficient to predict saliva flow rate with less than 2% relative error and to classify rectal bleeding with an accuracy of 90%.

  5. Phylogenetic Origins of Brain Organisers

    Directory of Open Access Journals (Sweden)

    Ellen Robertshaw

    2012-01-01

    Full Text Available The regionalisation of the nervous system begins early in embryogenesis, concomitant with the establishment of the anteroposterior (AP and dorsoventral (DV body axes. The molecular mechanisms that drive axis induction appear to be conserved throughout the animal kingdom and may be phylogenetically older than the emergence of bilateral symmetry. As a result of this process, groups of patterning genes that are equally well conserved are expressed at specific AP and DV coordinates of the embryo. In the emerging nervous system of vertebrate embryos, this initial pattern is refined by local signalling centres, secondary organisers, that regulate patterning, proliferation, and axonal pathfinding in adjacent neuroepithelium. The main secondary organisers for the AP neuraxis are the midbrain-hindbrain boundary, zona limitans intrathalamica, and anterior neural ridge and for the DV neuraxis the notochord, floor plate, and roof plate. A search for homologous secondary organisers in nonvertebrate lineages has led to controversy over their phylogenetic origins. Based on a recent study in hemichordates, it has been suggested that the AP secondary organisers evolved at the base of the deuterostome superphylum, earlier than previously thought. According to this view, the lack of signalling centres in some deuterostome lineages is likely to reflect a secondary loss due to adaptive processes. We propose that the relative evolutionary flexibility of secondary organisers has contributed to a broader morphological complexity of nervous systems in different clades.

  6. Chemically-induced liquid film migration with low lattice diffusivity relative to the migration rate in Mo-Ni-(W)

    International Nuclear Information System (INIS)

    Lee, K.R.

    1992-01-01

    This paper reports that when a 90Mo-10Ni alloy (by wt) liquid phase sintered at 1400 degrees C is heat-treated at 1400 degrees C after replacing the matrix with a melt of 44Ni-34Mo-22W (by wt), the liquid films between the grains migrate, leaving behind an Mo alloy enriched with W. The ratio of the lattice diffusivity of W in Mo, D, to the initial migration velocity, v. (D/v) is estimated to be between 0.03 and 0.18 angstrom. Hence it appears that there is no lattice diffusion of W ahead of the migrating liquid film, and is such a case the driving force has been suggested to be the chemical free energy. But the observed v is approximately same as that to be expected if the driving force is assumed to be diffusional coherency strain energy. Likewise, a previous study of den Broeder and Nakahara shows that the rate of chemically-induced grain boundary migration in Cu-Ni shows a smooth variation with temperature as D/v decreases from values much larger than the interatomic spacing to values much smaller with decreasing temperature. The coherency strain energy thus appears to be a general driving force for the migration even when the apparent diffusion length indicated by D/v is smaller than the interatomic spacing

  7. The partition dimension of cycle books graph

    Science.gov (United States)

    Santoso, Jaya; Darmaji

    2018-03-01

    Let G be a nontrivial and connected graph with vertex set V(G), edge set E(G) and S ⊆ V(G) with v ∈ V(G), the distance between v and S is d(v,S) = min{d(v,x)|x ∈ S}. For an ordered partition ∏ = {S 1, S 2, S 3,…, Sk } of V(G), the representation of v with respect to ∏ is defined by r(v|∏) = (d(v, S 1), d(v, S 2),…, d(v, Sk )). The partition ∏ is called a resolving partition of G if all representations of vertices are distinct. The partition dimension pd(G) is the smallest integer k such that G has a resolving partition set with k members. In this research, we will determine the partition dimension of Cycle Books {B}{Cr,m}. Cycle books graph {B}{Cr,m} is a graph consisting of m copies cycle Cr with the common path P 2. It is shown that the partition dimension of cycle books graph, pd({B}{C3,m}) is 3 for m = 2, 3, and m for m ≥ 4. pd({B}{C4,m}) is 3 + 2k for m = 3k + 2, 4 + 2(k ‑ 1) for m = 3k + 1, and 3 + 2(k ‑ 1) for m = 3k. pd({B}{C5,m}) is m + 1.

  8. Role of the parameters involved in the plan optimization based on the generalized equivalent uniform dose and radiobiological implications

    International Nuclear Information System (INIS)

    Widesott, L; Strigari, L; Pressello, M C; Landoni, V; Benassi, M

    2008-01-01

    We investigated the role and the weight of the parameters involved in the intensity modulated radiation therapy (IMRT) optimization based on the generalized equivalent uniform dose (gEUD) method, for prostate and head-and-neck plans. We systematically varied the parameters (gEUD max and weight) involved in the gEUD-based optimization of rectal wall and parotid glands. We found that the proper value of weight factor, still guaranteeing planning treatment volumes coverage, produced similar organs at risks dose-volume (DV) histograms for different gEUD max with fixed a = 1. Most of all, we formulated a simple relation that links the reference gEUD max and the associated weight factor. As secondary objective, we evaluated plans obtained with the gEUD-based optimization and ones based on DV criteria, using the normal tissue complication probability (NTCP) models. gEUD criteria seemed to improve sparing of rectum and parotid glands with respect to DV-based optimization: the mean dose, the V 40 and V 50 values to the rectal wall were decreased of about 10%, the mean dose to parotids decreased of about 20-30%. But more than the OARs sparing, we underlined the halving of the OARs optimization time with the implementation of the gEUD-based cost function. Using NTCP models we enhanced differences between the two optimization criteria for parotid glands, but no for rectum wall

  9. AKUMULASI LISTRIK STATIS PADA GELAS PLASTIK PRODUKSI MESIN INJECTION MOLDING: PENGARUH KELEMBABAN UDARA, TEMPERATUR, DAN BAHAN ADITIF

    Directory of Open Access Journals (Sweden)

    Ratnawati Ratnawati

    2014-12-01

    Full Text Available Akumulasi listrik statis pada gelas polipropilena hasil produksi mesin injection molding dapat menyebabkan gelas memiliki gaya elektrostatik dan tidak dapat turun secara gravitasi. Masalah ini menghambat aplikasi gelas pada mesin pengisian air minum dalam kemasan (AMDK. Penelitian ini bertujuan untuk mengetahui pengaruh kelembaban udara, temperatur, dan penambahan bahan aditif TiO2 terhadap potensial listrik permukaan gelas polipropilena. Hasil penelitian menunjukkan bahwa potensial listrik permukaan dipengaruhi oleh kelembaban udara ruang produksi, temperatur, dan penambahan TiO2. Potensial listrik permukaan semakin kecil dengan naiknya kelembaban udara. Setelah kelembaban mencapai 68% potensial listrik permukaan cenderung konstan. Ditinjau dari beda potensial (DV antara permukaan dua gelas, kelembaban optimum adalah 67-68%, yang ditandai dengan beda potensial yang paling rendah. Beda potensial ≤ 5,2 kV menyebabkan gelas cepat turun, beda potensial 5,2 kV < DV ≤ 6,7 kV menyebabkan gelas turun dengan lambat, dan DV ≥ 6,7 kV menyebabkan gelas sangat lambat turun atau menempel. Potensial listrik turun dengan naiknya temperatur. Potensial listrik statis permukaan hanya sedikit turun akibat penambahan 0,75% berat TiO2. Hasil penelitian ini juga menunjukkan bahwa penggunaan gelas dengan potensial listrik permukaan rendah dapat menaikkan kecepatan mesin pengisian AMDK menjadi 220-250 rpm dan 140-160 rpm, masing-masing untuk mesin pengisian gelas 180 ml dan 225 ml.

  10. Bladder Dysfunction and Vesicoureteral Reflux

    Directory of Open Access Journals (Sweden)

    Ulla Sillén

    2008-01-01

    Full Text Available In this overview the influence of functional bladder disturbances and of its treatment on the resolution of vesicoureteral reflux (VUR in children is discussed. Historically both bladder dysfunction entities, the overactive bladder (OAB and the dysfunctional voiding (DV, have been described in conjunction with VUR. Treatment of the dysfunction was also considered to influence spontaneous resolution in a positive way. During the last decades, however, papers have been published which could not support these results. Regarding the OAB, a prospective study with treatment of the bladder overactivity with anticholinergics, did not influence spontaneous resolution rate in children with a dysfunction including also the voiding phase, DV and DES (dysfunctional elimination syndrome, most studies indicate a negative influence on the resolution rate of VUR in children, both before and after the age for bladder control, both with and without treatment. However, a couple of uncontrolled studies indicate that there is a high short-term resolution rate after treatment with flow biofeedback. It should be emphasized that the voiding phase dysfunctions (DV and DES are more severe than the genuine filling phase dysfunction (OAB, with an increased frequency of UTI and renal damage in the former groups. To be able to answer the question if treatment of bladder dysfunction influence the resolution rate of VUR in children, randomized controlled studies must be performed.

  11. Role of Adult Attachment in the Intergenerational Transmission of Violence: Mediator, Moderator, or Independent Predictor?

    National Research Council Canada - National Science Library

    Merrill, Lex L; Thomsen, Cynthia J; Crouch, Julie L; May, Patricia; Gold, Steven R; Milner, Joel S

    2002-01-01

    ...], child sexual abuse [CSA], domestic violence [DV]) on adult CPA risk and examined whether adult attachment serves as a mediator or moderator of these relationships, or as an independent predictor of CPA risk...

  12. Proti dvěma nepřátelům

    Czech Academy of Sciences Publication Activity Database

    Friedl, Jiří

    2015-01-01

    Roč. 28, 9.5.2015 (2015), 22/4-22/4 ISSN 0862-5921 Institutional support: RVO:67985963 Keywords : Second World War * liberation of Czechoslovakia * Holy Cross Brigade * Polish armed forces Subject RIV: AB - History

  13. Virtual reality training improves da Vinci performance: a prospective trial.

    Science.gov (United States)

    Cho, Jae Sung; Hahn, Koo Yong; Kwak, Jung Myun; Kim, Jin; Baek, Se Jin; Shin, Jae Won; Kim, Seon Hahn

    2013-12-01

    The DV-Trainer™ (a virtual reality [VR] simulator) (Mimic Technologies, Inc., Seattle, WA) is one of several different robotic surgical training methods. We designed a prospective study to determine whether VR training could improve da Vinci(®) Surgical System (Intuitive Surgical, Inc., Sunnyvale, CA) performance. Surgeons (n=12) were enrolled using a randomized protocol. Groups 1 (VR training) and 2 (control) participated in VR and da Vinci exercises. Participants' time and moving distance were combined to determine a composite score: VR index=1000/(time×moving distance). The da Vinci exercises included needle control and suturing. Procedure time and error were measured. A composite index (DV index) was computed and used to measure da Vinci competency. After the initial trial with both the VR and da Vinci exercises, only Group 1 was trained with the VR simulator following our institutional curriculum for 3 weeks. All members of both groups then participated in the second trial of the VR and da Vinci exercises and were scored in the same way as in the initial trial. In the initial trial, there was no difference in the VR index (Group 1 versus Group 2, 8.9 ± 3.3 versus 9.4 ± 3.7; P=.832) and the DV index (Group 1 versus Group 2, 3.85 ± 0.73 versus 3.66 ± 0.65; P=.584) scores between the two groups. At the second time point, Group 1 showed increased VR index scores in comparison with Group 2 (19.3 ± 4.5 versus 9.7 ± 4.1, respectively; P=.001) and improved da Vinci performance skills as measured by the DV index (5.80 ± 1.13 versus 4.05 ± 1.03, respectively; P=.028) and by suturing time (7.1 ± 1.54 minutes versus 10.55 ± 1.93 minutes, respectively; P=.018). We found that VR simulator training can improve da Vinci performance. VR practice can result in an early plateau in the learning curve for robotic practice under controlled circumstances.

  14. Characterizing the mechanism of action of double-stranded RNA activity against western corn rootworm (Diabrotica virgifera virgifera LeConte.

    Directory of Open Access Journals (Sweden)

    Renata Bolognesi

    Full Text Available RNA interference (RNAi has previously been shown to be effective in western corn rootworm (WCR, Diabrotica virgifera virgifera LeConte larvae via oral delivery of synthetic double-stranded RNA (dsRNA in an artificial diet bioassay, as well as by ingestion of transgenic corn plant tissues engineered to express dsRNA. Although the RNAi machinery components appear to be conserved in Coleopteran insects, the key steps in this process have not been reported for WCR. Here we characterized the sequence of events that result in mortality after ingestion of a dsRNA designed against WCR larvae. We selected the Snf7 ortholog (DvSnf7 as the target mRNA, which encodes an essential protein involved in intracellular trafficking. Our results showed that dsRNAs greater than or equal to approximately 60 base-pairs (bp are required for biological activity in artificial diet bioassays. Additionally, 240 bp dsRNAs containing a single 21 bp match to the target sequence were also efficacious, whereas 21 bp short interfering (si RNAs matching the target sequence were not. This result was further investigated in WCR midgut tissues: uptake of 240 bp dsRNA was evident in WCR midgut cells while a 21 bp siRNA was not, supporting the size-activity relationship established in diet bioassays. DvSnf7 suppression was observed in a time-dependent manner with suppression at the mRNA level preceding suppression at the protein level when a 240 bp dsRNA was fed to WCR larvae. DvSnf7 suppression was shown to spread to tissues beyond the midgut within 24 h after dsRNA ingestion. These events (dsRNA uptake, target mRNA and protein suppression, systemic spreading, growth inhibition and eventual mortality comprise the overall mechanism of action by which DvSnf7 dsRNA affects WCR via oral delivery and provides insights as to how targeted dsRNAs in general are active against insects.

  15. Validity of soft-tissue thickness of calf measured using MRI for assessing unilateral lower extremity lymphoedema secondary to cervical and endometrial cancer treatments

    International Nuclear Information System (INIS)

    Lu, Qing; Li, Yulai; Chen, Tian-Wu; Yao, Yuan; Zhao, Zizhou; Li, Yang; Xu, Jianrong; Jiang, Zhaohua; Hu, Jiani

    2014-01-01

    Aim: To determine whether soft-tissue thickness of the calf measured using MRI could be valid for assessing unilateral lower extremity lymphoedema (LEL) secondary to cervical and endometrial cancer treatments. Materials and methods: Seventy women with unilateral LEL and 25 without LEL after cervical or endometrial cancer treatments underwent MRI examinations of their calves. Total thickness of soft-tissue (TT), muscle thickness (MT), and subcutaneous tissue thickness (STT) of the calf, and the difference between the affected and contralateral unaffected calf regarding TT (DTT), MT (DMT), and STT (DSTT) were obtained using fat-suppressed T2-weighted imaging in the middle of the calves. The volume of the calf and difference in volume (DV) between calves were obtained by the method of water displacement. Statistical analysis was performed to determine the validity of MRI measurements by volume measurements in staging LEL. Results: There was a close correlation between volume and TT for the affected (r = 0.927) or unaffected calves (r = 0.896). STT of the affected calf, and DTT or DSTT of the calves were closely correlated with volume of the affected calf or DV of the calves (all p < 0.05). Multivariate analysis showed significant differences in TT, STT, volume of the affected calf, DTT, DSTT, and DV between stages except in volume of the affected calf or in DV between stage 0 and 1. For staging LEL, DSTT showed the best discrimination ability among all the parameters. Conclusions: Soft-tissue thickness of the calf measured at MRI could be valid for quantitatively staging unilateral LEL, and DSTT of the calves could be the best classifying factor. - Highlights: • The soft tissue thickness of calves on MRI could quantitatively assess secondary LEL. • Calf soft tissue thickness indicated concurrent or construct validity of calf volume. • The difference of subcutaneous tissue thickness of calves could be used to stage LEL

  16. Research Article Special Issue

    African Journals Online (AJOL)

    pc

    2018-03-07

    Mar 7, 2018 ... Research organization and stages. The work was conducted at ..... Rivman D.V., Ustinov V.S. Viktimologiya [Victimology]. St. Petersburg: Piter ... Culture in the Asia-Pacific Region Countries (Comparative Study)]. Available at:.

  17. Eau Galllie Oculina Banks Clelia Dive 609 2001 Digital Imagery - Captured from Videotapes tken during Submersible Dives to the Oculina Banks Deep Sea Coral Reefs (NODC Accession 0047190)

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — Digitial imagery, mpegs and jpegs, captured from mini-DV magnetic videotapes collected with an underwater 3-chip CCD color video camera, deployed from the research...

  18. Cocoa Beach Oculina Banks Clelia Dive 617 2001 Digital Imagery - Captured from Videotapes taken during Submersible Dives to the Oculina Banks Deep Sea Coral Reefs (NODC Accession 0047190)

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — Digitial imagery, mpegs and jpegs, captured from mini-DV magnetic videotapes collected with an underwater 3-chip CCD color video camera, deployed from the research...

  19. Chapman's Reef Oculina Banks Clelia Dive 621 2001 Digital Imagery - Captured from Videotapes taken during Submersible Dives to the Oculina Banks Deep Sea Coral Reefs (NODC Accession 0047190)

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — Digitial imagery, mpegs and jpegs, captured from mini-DV magnetic videotapes collected with an underwater 3-chip CCD color video camera, deployed from the research...

  20. Sebastian Pinnacles, Oculina Banks Clelia Dive 615 2001 Digital Imagery - Captured from Videotapes taken during Submersible Dives to the Oculina Banks Deep Sea Coral Reefs (NODC Accession 0047190)

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — Digitial imagery, mpegs and jpegs, captured from mini-DV magnetic videotapes collected with an underwater 3-chip CCD color video camera, deployed from the research...

  1. Sebastian Pinnacles Oculina Banks Clelia Dive 619 2001 Digital Imagery - Captured from Videotapes taken during Submersible Dives to the Oculina Banks Deep Sea Coral Reefs (NODC Accession 0047190)

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — Digitial imagery, mpegs and jpegs, captured from mini-DV magnetic videotapes collected with an underwater 3-chip CCD color video camera, deployed from the research...

  2. Sebastian Pinnacles Oculina Banks Clelia Dive 618 2001 Digital Imagery - Captured from Videotapes taken during Submersible Dives to the Oculina Banks Deep Sea Coral Reefs (NODC Accession 0047190)

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — Digitial imagery, mpegs and jpegs, captured from mini-DV magnetic videotapes collected with an underwater 3-chip CCD color video camera, deployed from the research...

  3. Sebastian Pinnacles, Oculina Banks Clelia Dive 614 2001 Digital Imagery - Captured from Videotapes taken during Submersible Dives to the Oculina Banks Deep Sea Coral Reefs (NODC Accession 0047190)

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — Digitial imagery, mpegs and jpegs, captured from mini-DV magnetic videotapes collected with an underwater 3-chip CCD color video camera, deployed from the research...

  4. Central Experimental Oculina Research Reserve, Clelia Dive 612 2001 Digital Imagery - Captured from Videotapes taken during Submersible Dives to the Oculina Banks Deep Sea Coral Reefs (NODC Accession 0047190)

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — Digitial imagery, mpegs and jpegs, captured from mini-DV magnetic videotapes collected with an underwater 3-chip CCD color video camera, deployed from the research...

  5. South Experimental Oculina Research Reserve, Clelia Dive 610 2001 Digital Imagery - Captured from Videotapes taken during Submersible Dives to the Oculina Banks Deep Sea Coral Reefs (NODC Accession 0047190)

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — Digitial imagery, mpegs and jpegs, captured from mini-DV magnetic videotapes collected with an underwater 3-chip CCD color video camera, deployed from the research...

  6. Jeff's Reef Oculina Banks Clelia Dive 606 2001 Digital Imagery - Captured from Videotapes taken during Submersible Dives to the Oculina Banks Deep Sea Coral Reefs (NODC Accession 0047190)

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — Digitial imagery, mpegs and jpegs, captured from mini-DV magnetic videotapes collected with an underwater 3-chip CCD color video camera, deployed from the research...

  7. Knowledge of primary care nurses regarding domestic violence

    African Journals Online (AJOL)

    Nagham N. Alsafy

    2011-06-12

    Jun 12, 2011 ... Conclusion: Overall, primary care nurses had poor knowledge regarding DV. Although female ... Physical abuse is defined as any behavior in which the body ... activity.5 Psychological abuse essentially and significantly dif-.

  8. Cape Canaveral Oculina Banks Clelia Dive 616 2001 Digital Imagery - Captured from Videotapes taken during Submersible Dives to the Oculina Banks Deep Sea Coral Reefs (NODC Accession 0047190)

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — Digitial imagery, mpegs and jpegs, captured from mini-DV magnetic videotapes collected with an underwater 3-chip CCD color video camera, deployed from the research...

  9. Jeff's Reef Oculina Banks Clelia Dive 607 2001 Digital Imagery - Captured from Videotapes taken during Submersible Dives to the Oculina Banks Deep Sea Coral Reefs (NODC Accession 0047190)

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — Digitial imagery, mpegs and jpegs, captured from mini-DV magnetic videotapes collected with an underwater 3-chip CCD color video camera, deployed from the research...

  10. First-trimester screening for trisomies 18 and 13, triploidy and Turner syndrome by detailed early anomaly scan.

    Science.gov (United States)

    Wagner, P; Sonek, J; Hoopmann, M; Abele, H; Kagan, K O

    2016-10-01

    To examine the performance of first-trimester ultrasound screening for trisomies 18 and 13, triploidy and Turner syndrome based on fetal nuchal translucency thickness (NT), additional fetal ultrasound markers including anatomy of the nasal bone (NB), blood flow across the tricuspid valve (TV) and through the ductus venosus (DV) and a detailed fetal anomaly scan at 11-13 weeks' gestation. This was a retrospective case-matched study involving pregnant women at 11-13 weeks' gestation. The study population consisted of fetuses with trisomy 18, trisomy 13, triploidy or Turner syndrome. For each fetus with an abnormal karyotype, 50 randomly selected euploid fetuses were added to the study population. In all cases, the crown-rump length and NT were measured. In addition NB, TV flow and DV flow were examined. The summed risk for trisomies 21, 18 and 13 was computed based on: first, maternal age (MA); second, MA and fetal NT; third, MA, NT and one of the markers NB, TV flow or DV flow; fourth, MA, NT and all these markers combined; fifth, MA, NT and fetal anomalies; and, finally, MA, NT, all markers and fetal anomalies. The study population consisted of 4550 euploid and 91 aneuploid fetuses. Median NT was 1.8 mm in euploid fetuses and 4.8, 6.8, 1.8 and 10.0 mm in fetuses with trisomy 18, trisomy 13, triploidy and Turner syndrome, respectively. The NB, TV flow and DV flow were abnormal in 48 (1.1%), 34 (0.7%) and 99 (2.2%) euploid fetuses, respectively, and in 42 (46.2%), 31 (34.1%) and 62 (68.1%) aneuploid fetuses, respectively. At least one defect was found in 60 (1.3%) euploid and in 76 (83.5%) aneuploid fetuses. For a false-positive rate of 3%, the detection rate for screening based on MA and fetal NT was 75.8%. It increased to 84.6-86.8% when including one of the additional ultrasound markers and it was 90.1% when all three markers were included. When screening was based on MA, fetal NT and a detailed anomaly scan, the detection rate was 94.5% and increased to 95

  11. Genetic line comparisons and genetic parameters for endoparasite infections and test-day milk production traits.

    Science.gov (United States)

    May, Katharina; Brügemann, Kerstin; Yin, Tong; Scheper, Carsten; Strube, Christina; König, Sven

    2017-09-01

    Keeping dairy cows in grassland systems relies on detailed analyses of genetic resistance against endoparasite infections, including between- and within-breed genetic evaluations. The objectives of this study were (1) to compare different Black and White dairy cattle selection lines for endoparasite infections and (2) the estimation of genetic (co)variance components for endoparasite and test-day milk production traits within the Black and White cattle population. A total of 2,006 fecal samples were taken during 2 farm visits in summer and autumn 2015 from 1,166 cows kept in 17 small- and medium-scale organic and conventional German grassland farms. Fecal egg counts were determined for gastrointestinal nematodes (FEC-GIN) and flukes (FEC-FLU), and fecal larvae counts for the bovine lungworm Dictyocaulus viviparus (FLC-DV). The lowest values for gastrointestinal nematode infections were identified for genetic lines adopted to pasture-based production systems, especially selection lines from New Zealand. Heritabilities were low for FEC-GIN (0.05-0.06 ± 0.04) and FLC-DV (0.05 ± 0.04), but moderate for FEC-FLU (0.33 ± 0.06). Almost identical heritabilities were estimated for different endoparasite trait transformations (log-transformation, square root). The genetic correlation between FEC-GIN and FLC-DV was 1.00 ± 0.60, slightly negative between FEC-GIN and FEC-FLU (-0.10 ± 0.27), and close to zero between FLC-DV and FEC-FLU (0.03 ± 0.30). Random regression test-day models on a continuous time scale [days in milk (DIM)] were applied to estimate genetic relationships between endoparasite and longitudinal test-day production traits. Genetic correlations were negative between FEC-GIN and milk yield (MY) until DIM 85, and between FEC-FLU and MY until DIM 215. Genetic correlations between FLC-DV and MY were negative throughout lactation, indicating improved disease resistance for high-productivity cows. Genetic relationships between FEC-GIN and FEC-FLU with milk

  12. A curve-fitting approach to estimate the arterial plasma input function for the assessment of glucose metabolic rate and response to treatment.

    Science.gov (United States)

    Vriens, Dennis; de Geus-Oei, Lioe-Fee; Oyen, Wim J G; Visser, Eric P

    2009-12-01

    For the quantification of dynamic (18)F-FDG PET studies, the arterial plasma time-activity concentration curve (APTAC) needs to be available. This can be obtained using serial sampling of arterial blood or an image-derived input function (IDIF). Arterial sampling is invasive and often not feasible in practice; IDIFs are biased because of partial-volume effects and cannot be used when no large arterial blood pool is in the field of view. We propose a mathematic function, consisting of an initial linear rising activity concentration followed by a triexponential decay, to describe the APTAC. This function was fitted to 80 oncologic patients and verified for 40 different oncologic patients by area-under-the-curve (AUC) comparison, Patlak glucose metabolic rate (MR(glc)) estimation, and therapy response monitoring (Delta MR(glc)). The proposed function was compared with the gold standard (serial arterial sampling) and the IDIF. To determine the free parameters of the function, plasma time-activity curves based on arterial samples in 80 patients were fitted after normalization for administered activity (AA) and initial distribution volume (iDV) of (18)F-FDG. The medians of these free parameters were used for the model. In 40 other patients (20 baseline and 20 follow-up dynamic (18)F-FDG PET scans), this model was validated. The population-based curve, individually calibrated by AA and iDV (APTAC(AA/iDV)), by 1 late arterial sample (APTAC(1 sample)), and by the individual IDIF (APTAC(IDIF)), was compared with the gold standard of serial arterial sampling (APTAC(sampled)) using the AUC. Additionally, these 3 methods of APTAC determination were evaluated with Patlak MR(glc) estimation and with Delta MR(glc) for therapy effects using serial sampling as the gold standard. Excellent individual fits to the function were derived with significantly different decay constants (P AUC from APTAC(AA/iDV), APTAC(1 sample), and APTAC(IDIF) with the gold standard (APTAC(sampled)) were 0

  13. Beam-energy dependence of the directed flow of protons, antiprotons, and pions in Au+Au collisions.

    Science.gov (United States)

    Adamczyk, L; Adkins, J K; Agakishiev, G; Aggarwal, M M; Ahammed, Z; Alekseev, I; Alford, J; Anson, C D; Aparin, A; Arkhipkin, D; Aschenauer, E C; Averichev, G S; Banerjee, A; Beavis, D R; Bellwied, R; Bhasin, A; Bhati, A K; Bhattarai, P; Bichsel, H; Bielcik, J; Bielcikova, J; Bland, L C; Bordyuzhin, I G; Borowski, W; Bouchet, J; Brandin, A V; Brovko, S G; Bültmann, S; Bunzarov, I; Burton, T P; Butterworth, J; Caines, H; Calderón de la Barca Sánchez, M; Cebra, D; Cendejas, R; Cervantes, M C; Chaloupka, P; Chang, Z; Chattopadhyay, S; Chen, H F; Chen, J H; Chen, L; Cheng, J; Cherney, M; Chikanian, A; Christie, W; Chwastowski, J; Codrington, M J M; Contin, G; Cramer, J G; Crawford, H J; Cui, X; Das, S; Davila Leyva, A; De Silva, L C; Debbe, R R; Dedovich, T G; Deng, J; Derevschikov, A A; Derradi de Souza, R; Dhamija, S; di Ruzza, B; Didenko, L; Dilks, C; Ding, F; Djawotho, P; Dong, X; Drachenberg, J L; Draper, J E; Du, C M; Dunkelberger, L E; Dunlop, J C; Efimov, L G; Engelage, J; Engle, K S; Eppley, G; Eun, L; Evdokimov, O; Eyser, O; Fatemi, R; Fazio, S; Fedorisin, J; Filip, P; Finch, E; Fisyak, Y; Flores, C E; Gagliardi, C A; Gangadharan, D R; Garand, D; Geurts, F; Gibson, A; Girard, M; Gliske, S; Greiner, L; Grosnick, D; Gunarathne, D S; Guo, Y; Gupta, A; Gupta, S; Guryn, W; Haag, B; Hamed, A; Han, L-X; Haque, R; Harris, J W; Heppelmann, S; Hirsch, A; Hoffmann, G W; Hofman, D J; Horvat, S; Huang, B; Huang, H Z; Huang, X; Huck, P; Humanic, T J; Igo, G; Jacobs, W W; Jang, H; Judd, E G; Kabana, S; Kalinkin, D; Kang, K; Kauder, K; Ke, H W; Keane, D; Kechechyan, A; Kesich, A; Khan, Z H; Kikola, D P; Kisel, I; Kisiel, A; Koetke, D D; Kollegger, T; Konzer, J; Koralt, I; Kotchenda, L; Kraishan, A F; Kravtsov, P; Krueger, K; Kulakov, I; Kumar, L; Kycia, R A; Lamont, M A C; Landgraf, J M; Landry, K D; Lauret, J; Lebedev, A; Lednicky, R; Lee, J H; Levine, M J; Li, C; Li, W; Li, X; Li, X; Li, Y; Li, Z M; Lisa, M A; Liu, F; Ljubicic, T; Llope, W J; Lomnitz, M; Longacre, R S; Luo, X; Ma, G L; Ma, Y G; Madagodagettige Don, D M M D; Mahapatra, D P; Majka, R; Margetis, S; Markert, C; Masui, H; Matis, H S; McDonald, D; McShane, T S; Minaev, N G; Mioduszewski, S; Mohanty, B; Mondal, M M; Morozov, D A; Mustafa, M K; Nandi, B K; Nasim, Md; Nayak, T K; Nelson, J M; Nigmatkulov, G; Nogach, L V; Noh, S Y; Novak, J; Nurushev, S B; Odyniec, G; Ogawa, A; Oh, K; Ohlson, A; Okorokov, V; Oldag, E W; Olvitt, D L; Pachr, M; Page, B S; Pal, S K; Pan, Y X; Pandit, Y; Panebratsev, Y; Pawlak, T; Pawlik, B; Pei, H; Perkins, C; Peryt, W; Pile, P; Planinic, M; Pluta, J; Poljak, N; Porter, J; Poskanzer, A M; Pruthi, N K; Przybycien, M; Pujahari, P R; Putschke, J; Qiu, H; Quintero, A; Ramachandran, S; Raniwala, R; Raniwala, S; Ray, R L; Riley, C K; Ritter, H G; Roberts, J B; Rogachevskiy, O V; Romero, J L; Ross, J F; Roy, A; Ruan, L; Rusnak, J; Rusnakova, O; Sahoo, N R; Sahu, P K; Sakrejda, I; Salur, S; Sandweiss, J; Sangaline, E; Sarkar, A; Schambach, J; Scharenberg, R P; Schmah, A M; Schmidke, W B; Schmitz, N; Seger, J; Seyboth, P; Shah, N; Shahaliev, E; Shanmuganathan, P V; Shao, M; Sharma, B; Shen, W Q; Shi, S S; Shou, Q Y; Sichtermann, E P; Singaraju, R N; Skoby, M J; Smirnov, D; Smirnov, N; Solanki, D; Sorensen, P; Spinka, H M; Srivastava, B; Stanislaus, T D S; Stevens, J R; Stock, R; Strikhanov, M; Stringfellow, B; Sumbera, M; Sun, X; Sun, X M; Sun, Y; Sun, Z; Surrow, B; Svirida, D N; Symons, T J M; Szelezniak, M A; Takahashi, J; Tang, A H; Tang, Z; Tarnowsky, T; Thomas, J H; Timmins, A R; Tlusty, D; Tokarev, M; Trentalange, S; Tribble, R E; Tribedy, P; Trzeciak, B A; Tsai, O D; Turnau, J; Ullrich, T; Underwood, D G; Van Buren, G; van Nieuwenhuizen, G; Vandenbroucke, M; Vanfossen, J A; Varma, R; Vasconcelos, G M S; Vasiliev, A N; Vertesi, R; Videbæk, F; Viyogi, Y P; Vokal, S; Vossen, A; Wada, M; Wang, F; Wang, G; Wang, H; Wang, J S; Wang, X L; Wang, Y; Wang, Y; Webb, G; Webb, J C; Westfall, G D; Wieman, H; Wissink, S W; Witt, R; Wu, Y F; Xiao, Z; Xie, W; Xin, K; Xu, H; Xu, J; Xu, N; Xu, Q H; Xu, Y; Xu, Z; Yan, W; Yang, C; Yang, Y; Yang, Y; Ye, Z; Yepes, P; Yi, L; Yip, K; Yoo, I-K; Yu, N; Zawisza, Y; Zbroszczyk, H; Zha, W; Zhang, J B; Zhang, J L; Zhang, S; Zhang, X P; Zhang, Y; Zhang, Z P; Zhao, F; Zhao, J; Zhong, C; Zhu, X; Zhu, Y H; Zoulkarneeva, Y; Zyzak, M

    2014-04-25

    Rapidity-odd directed flow (v1) measurements for charged pions, protons, and antiprotons near midrapidity (y=0) are reported in sNN=7.7, 11.5, 19.6, 27, 39, 62.4, and 200 GeV Au+Au collisions as recorded by the STAR detector at the Relativistic Heavy Ion Collider. At intermediate impact parameters, the proton and net-proton slope parameter dv1/dy|y=0 shows a minimum between 11.5 and 19.6 GeV. In addition, the net-proton dv1/dy|y=0 changes sign twice between 7.7 and 39 GeV. The proton and net-proton results qualitatively resemble predictions of a hydrodynamic model with a first-order phase transition from hadronic matter to deconfined matter, and differ from hadronic transport calculations.

  14. Beam-Energy Dependence of the Directed Flow of Protons, Antiprotons, and Pions in Au+Au Collisions

    Science.gov (United States)

    Adamczyk, L.; Adkins, J. K.; Agakishiev, G.; Aggarwal, M. M.; Ahammed, Z.; Alekseev, I.; Alford, J.; Anson, C. D.; Aparin, A.; Arkhipkin, D.; Aschenauer, E. C.; Averichev, G. S.; Banerjee, A.; Beavis, D. R.; Bellwied, R.; Bhasin, A.; Bhati, A. K.; Bhattarai, P.; Bichsel, H.; Bielcik, J.; Bielcikova, J.; Bland, L. C.; Bordyuzhin, I. G.; Borowski, W.; Bouchet, J.; Brandin, A. V.; Brovko, S. G.; Bültmann, S.; Bunzarov, I.; Burton, T. P.; Butterworth, J.; Caines, H.; Calderón de la Barca Sánchez, M.; Cebra, D.; Cendejas, R.; Cervantes, M. C.; Chaloupka, P.; Chang, Z.; Chattopadhyay, S.; Chen, H. F.; Chen, J. H.; Chen, L.; Cheng, J.; Cherney, M.; Chikanian, A.; Christie, W.; Chwastowski, J.; Codrington, M. J. M.; Contin, G.; Cramer, J. G.; Crawford, H. J.; Cui, X.; Das, S.; Davila Leyva, A.; De Silva, L. C.; Debbe, R. R.; Dedovich, T. G.; Deng, J.; Derevschikov, A. A.; Derradi de Souza, R.; Dhamija, S.; di Ruzza, B.; Didenko, L.; Dilks, C.; Ding, F.; Djawotho, P.; Dong, X.; Drachenberg, J. L.; Draper, J. E.; Du, C. M.; Dunkelberger, L. E.; Dunlop, J. C.; Efimov, L. G.; Engelage, J.; Engle, K. S.; Eppley, G.; Eun, L.; Evdokimov, O.; Eyser, O.; Fatemi, R.; Fazio, S.; Fedorisin, J.; Filip, P.; Finch, E.; Fisyak, Y.; Flores, C. E.; Gagliardi, C. A.; Gangadharan, D. R.; Garand, D.; Geurts, F.; Gibson, A.; Girard, M.; Gliske, S.; Greiner, L.; Grosnick, D.; Gunarathne, D. S.; Guo, Y.; Gupta, A.; Gupta, S.; Guryn, W.; Haag, B.; Hamed, A.; Han, L.-X.; Haque, R.; Harris, J. W.; Heppelmann, S.; Hirsch, A.; Hoffmann, G. W.; Hofman, D. J.; Horvat, S.; Huang, B.; Huang, H. Z.; Huang, X.; Huck, P.; Humanic, T. J.; Igo, G.; Jacobs, W. W.; Jang, H.; Judd, E. G.; Kabana, S.; Kalinkin, D.; Kang, K.; Kauder, K.; Ke, H. W.; Keane, D.; Kechechyan, A.; Kesich, A.; Khan, Z. H.; Kikola, D. P.; Kisel, I.; Kisiel, A.; Koetke, D. D.; Kollegger, T.; Konzer, J.; Koralt, I.; Kotchenda, L.; Kraishan, A. F.; Kravtsov, P.; Krueger, K.; Kulakov, I.; Kumar, L.; Kycia, R. A.; Lamont, M. A. C.; Landgraf, J. M.; Landry, K. D.; Lauret, J.; Lebedev, A.; Lednicky, R.; Lee, J. H.; LeVine, M. J.; Li, C.; Li, W.; Li, X.; Li, X.; Li, Y.; Li, Z. M.; Lisa, M. A.; Liu, F.; Ljubicic, T.; Llope, W. J.; Lomnitz, M.; Longacre, R. S.; Luo, X.; Ma, G. L.; Ma, Y. G.; Madagodagettige Don, D. M. M. D.; Mahapatra, D. P.; Majka, R.; Margetis, S.; Markert, C.; Masui, H.; Matis, H. S.; McDonald, D.; McShane, T. S.; Minaev, N. G.; Mioduszewski, S.; Mohanty, B.; Mondal, M. M.; Morozov, D. A.; Mustafa, M. K.; Nandi, B. K.; Nasim, Md.; Nayak, T. K.; Nelson, J. M.; Nigmatkulov, G.; Nogach, L. V.; Noh, S. Y.; Novak, J.; Nurushev, S. B.; Odyniec, G.; Ogawa, A.; Oh, K.; Ohlson, A.; Okorokov, V.; Oldag, E. W.; Olvitt, D. L.; Pachr, M.; Page, B. S.; Pal, S. K.; Pan, Y. X.; Pandit, Y.; Panebratsev, Y.; Pawlak, T.; Pawlik, B.; Pei, H.; Perkins, C.; Peryt, W.; Pile, P.; Planinic, M.; Pluta, J.; Poljak, N.; Porter, J.; Poskanzer, A. M.; Pruthi, N. K.; Przybycien, M.; Pujahari, P. R.; Putschke, J.; Qiu, H.; Quintero, A.; Ramachandran, S.; Raniwala, R.; Raniwala, S.; Ray, R. L.; Riley, C. K.; Ritter, H. G.; Roberts, J. B.; Rogachevskiy, O. V.; Romero, J. L.; Ross, J. F.; Roy, A.; Ruan, L.; Rusnak, J.; Rusnakova, O.; Sahoo, N. R.; Sahu, P. K.; Sakrejda, I.; Salur, S.; Sandweiss, J.; Sangaline, E.; Sarkar, A.; Schambach, J.; Scharenberg, R. P.; Schmah, A. M.; Schmidke, W. B.; Schmitz, N.; Seger, J.; Seyboth, P.; Shah, N.; Shahaliev, E.; Shanmuganathan, P. V.; Shao, M.; Sharma, B.; Shen, W. Q.; Shi, S. S.; Shou, Q. Y.; Sichtermann, E. P.; Singaraju, R. N.; Skoby, M. J.; Smirnov, D.; Smirnov, N.; Solanki, D.; Sorensen, P.; Spinka, H. M.; Srivastava, B.; Stanislaus, T. D. S.; Stevens, J. R.; Stock, R.; Strikhanov, M.; Stringfellow, B.; Sumbera, M.; Sun, X.; Sun, X. M.; Sun, Y.; Sun, Z.; Surrow, B.; Svirida, D. N.; Symons, T. J. M.; Szelezniak, M. A.; Takahashi, J.; Tang, A. H.; Tang, Z.; Tarnowsky, T.; Thomas, J. H.; Timmins, A. R.; Tlusty, D.; Tokarev, M.; Trentalange, S.; Tribble, R. E.; Tribedy, P.; Trzeciak, B. A.; Tsai, O. D.; Turnau, J.; Ullrich, T.; Underwood, D. G.; Van Buren, G.; van Nieuwenhuizen, G.; Vandenbroucke, M.; Vanfossen, J. A.; Varma, R.; Vasconcelos, G. M. S.; Vasiliev, A. N.; Vertesi, R.; Videbæk, F.; Viyogi, Y. P.; Vokal, S.; Vossen, A.; Wada, M.; Wang, F.; Wang, G.; Wang, H.; Wang, J. S.; Wang, X. L.; Wang, Y.; Wang, Y.; Webb, G.; Webb, J. C.; Westfall, G. D.; Wieman, H.; Wissink, S. W.; Witt, R.; Wu, Y. F.; Xiao, Z.; Xie, W.; Xin, K.; Xu, H.; Xu, J.; Xu, N.; Xu, Q. H.; Xu, Y.; Xu, Z.; Yan, W.; Yang, C.; Yang, Y.; Yang, Y.; Ye, Z.; Yepes, P.; Yi, L.; Yip, K.; Yoo, I.-K.; Yu, N.; Zawisza, Y.; Zbroszczyk, H.; Zha, W.; Zhang, J. B.; Zhang, J. L.; Zhang, S.; Zhang, X. P.; Zhang, Y.; Zhang, Z. P.; Zhao, F.; Zhao, J.; Zhong, C.; Zhu, X.; Zhu, Y. H.; Zoulkarneeva, Y.; Zyzak, M.; STAR Collaboration

    2014-04-01

    Rapidity-odd directed flow (v1) measurements for charged pions, protons, and antiprotons near midrapidity (y =0) are reported in √sNN =7.7, 11.5, 19.6, 27, 39, 62.4, and 200 GeV Au+Au collisions as recorded by the STAR detector at the Relativistic Heavy Ion Collider. At intermediate impact parameters, the proton and net-proton slope parameter dv1/dy|y=0 shows a minimum between 11.5 and 19.6 GeV. In addition, the net-proton dv1/dy|y=0 changes sign twice between 7.7 and 39 GeV. The proton and net-proton results qualitatively resemble predictions of a hydrodynamic model with a first-order phase transition from hadronic matter to deconfined matter, and differ from hadronic transport calculations.

  15. Microbial penetration and utilization of organic aircraft fuel-tank coatings.

    Science.gov (United States)

    Crum, M G; Reynolds, R J; Hedrick, H G

    1967-11-01

    Microorganisms have been found as contaminants in various types of aircraft fuel tanks. Their presence introduces problems in the operation of the aircraft, including destruction of components such as the organic coatings used as protective linings in the fuel tanks. Microbial penetration and utilization of the currently used organic coatings, EC 776, DV 1180, PR 1560, and DeSoto 1080, were determined by changes in electrical resistances of the coatings; mycelial weight changes; growth counts of the bacteria; and manometric determinations on Pseudomonas aeruginosa (GD-FW B-25) and Cladosporium resinae (QMC-7998). The results indicate EC 776 and DV 1180 to be less resistant to microbial degradation than the other coatings. Organic coatings, serving as a source of nutrition, would be conducive to population buildups in aircraft fuel tanks.

  16. Dicty_cDB: Contig-U15349-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available us petioles cDNA library Populus tre... 38 0.58 2 ( AP006852 ) Candida albicans genomic ...CT049626 ) Sus scrofa genomic clone PigE-217H19, genomic sur... 48 0.79 1 ( EG687952 ) RCRBD08TO Castor bean cDNA library...V246458 ) A2FO395TO Aedes aegypti full length cDNA library,... 48 0.79 1 ( DV246174 ) A2FMO77TV Aedes aegypti full length cDNA librar...y,... 48 0.79 1 ( DV231005 ) A1FL491TO Aedes aegypti full length cDNA library,... 4.... 50 0.20 1 ( AZ428968 ) 1M0212M05R Mouse 10kb plasmid UUGC1M library Mus ... 50 0.20 1 ( CR123377 ) Reverse strand re

  17. Ultra-low energy electrons from fast heavy-ion helium collisions: the `target Cusp`

    Energy Technology Data Exchange (ETDEWEB)

    Schmitt, W. [Freiburg Univ. (Germany)]|[Gesellschaft fuer Schwerionenforschung mbH, Darmstadt (Germany); Moshammer, R.; Kollmus, H.; Ullrich, J. [Freiburg Univ. (Germany); O`Rourke, F.S.C. [Queen`s Univ., Belfast, Northern Ireland (United Kingdom); Sarkadi, L. [Magyar Tudomanyos Akademia, Debrecen (Hungary). Atommag Kutato Intezete; Mann, R. [Gesellschaft fuer Schwerionenforschung mbH, Darmstadt (Germany); Hagmann, S. [Kansas State Univ., Manhattan, KS (United States). J.R. MacDonald Lab.; Olson, R.E. [Missouri Univ., Rolla, MO (United States). Dept. of Physics

    1998-09-01

    Doubly differential cross sections d{sup 2}{sigma}/dv {sub parallel} dv {sub perpendicular} {sub to} have been obtained by mapping the 3-dimensional velocity space of ultra-low and low-energy electrons (1.5 meV{<=} E{sub e}{<=}100 eV) emitted in singly ionizing 3.6 MeV/u Au{sup 53+} on helium collisions. A sharp ({Delta}E{sub e} {sub perpendicular} {sub to} {sup FWHM} {<=} 22 meV) asymmetric peak centered at vertical stroke anti {nu} vertical stroke =0 is observed to emerge at ultra-low energies from the strongly forward shifted low-energy electron velocity distribution. The shape of this ``target cusp``, which is very sensitive on the details of the two-center potential, is in excellent accord with theoretical CTMC and CDW-EIS predictions. (orig.)

  18. Briti tantsufilm küsib, mis on elu hind / Tiit Tuumalu

    Index Scriptorium Estoniae

    Tuumalu, Tiit, 1971-

    2006-01-01

    Tantsufilm "Elu hind" ("The Cost of Living") : lavastaja ja koreograaf Lloyd Newson : peaosades jalutu tantsija David Toole ja Eddie Kay : Suurbritannia 2004. Filmi aluseks on Londoni tantsuteatri DV 8 Physical Theatre' 2000.a. valminud lavastus

  19. Typy venkovských kostelů v 17. století

    Czech Academy of Sciences Publication Activity Database

    Švácha, Rostislav

    2017-01-01

    Roč. 77, 1/2 (2017), s. 87-98 ISSN 1210-5538 Institutional support: RVO:68378033 Keywords : rural churches * 18th century architecture * typology of sacral architecture * Bohemia and Moravia Subject RIV: AL - Art, Architecture, Cultural Heritage

  20. Kostel sv. Vavřince - jeho architektura a výzdoba od 16. do konce 19. století. II. část (19. století)

    Czech Academy of Sciences Publication Activity Database

    Kaplanová, Kristina

    č. 1 (2001), s. 4-8 ISSN 1214-2794 Institutional research plan: CEZ:AV0Z8033913 Keywords : St Lawrence church * architecture * interior equipment Subject RIV: AL - Art, Architecture , Cultural Heritage

  1. Metallomics of two microorganisms relevant to heavy metal bioremediation reveal fundamental differences in metal assimilation and utilization

    Energy Technology Data Exchange (ETDEWEB)

    Lancaster, Andrew [Univ. of Georgia, Athens, GA (United States); Menon, Angeli [Univ. of Georgia, Athens, GA (United States); Scott, Israel [Univ. of Georgia, Athens, GA (United States); Poole, Farris [Univ. of Georgia, Athens, GA (United States); Vaccaro, Brian [Univ. of Georgia, Athens, GA (United States); Thorgersen, Michael P. [Univ. of Georgia, Athens, GA (United States); Geller, Jil [Lawrence Berkeley National Laboratory (LBNL); Hazen, Terry C. [Univ. of Tennessee, Knoxville, TN (United States); Oak Ridge National Lab. (ORNL), Oak Ridge, TN (United States); Hurt Jr., Richard Ashley [Oak Ridge National Lab. (ORNL), Oak Ridge, TN (United States); Brown, Steven D. [Oak Ridge National Lab. (ORNL), Oak Ridge, TN (United States); Elias, Dwayne A. [Oak Ridge National Lab. (ORNL), Oak Ridge, TN (United States); Adams, Michael W. W. [Univ. of Georgia, Athens, GA (United States)

    2014-03-26

    Although as many as half of all proteins are thought to require a metal cofactor, the metalloproteomes of microorganisms remain relatively unexplored. Microorganisms from different environments are likely to vary greatly in the metals that they assimilate, not just among the metals with well-characterized roles but also those lacking any known function. Herein we investigated the metal utilization of two microorganisms that were isolated from very similar environments and are of interest because of potential roles in the immobilization of heavy metals, such as uranium and chromium. The metals assimilated and their concentrations in the cytoplasm of Desulfovibrio vulgaris strain Hildenborough (DvH) and Enterobacter cloacae strain Hanford (EcH) varied dramatically, with a larger number of metals present in Enterobacter. For example, a total of 9 and 19 metals were assimilated into their cytoplasmic fractions, respectively, and DvH did not assimilate significant amounts of zinc or copper whereas EcH assimilated both. However, bioinformatic analysis of their genome sequences revealed a comparable number of predicted metalloproteins, 813 in DvH and 953 in EcH. These allowed some rationalization of the types of metal assimilated in some cases (Fe, Cu, Mo, W, V) but not in others (Zn, Nd, Ce, Pr, Dy, Hf and Th). It was also shown that U binds an unknown soluble protein in EcH but this incorporation was the result of extracellular U binding to cytoplasmic components after cell lysis.

  2. Karakteristik Semen Segar dan Kualitas Semen Cair Kuda dalam Pengencer Dimitropoulos yang Disuplementasi dengan Fruktosa, Trehalosa dan Rafinosa

    Directory of Open Access Journals (Sweden)

    Yudi

    2007-12-01

    Full Text Available The objective of the experiment was to study the characteristics of stallion fresh semen and the quality of sperm preserved in Dimitropoulos extender (DV supplemented with different concentration of fructose, trehalose and raffinose. Semen were collected using artificial vagina from three stallions. Semen characteristics and quality were evaluated macro- and microscopically. Prior to extension, semen were centrifugated at 3000 rpm for 20 minutes. The condensed sperm were re-suspended in DV supplemented with different types of carbohydrate to meet the concentration of 200 million spz/ml. All samples were stored at room and chilled temperature, and were evaluated for motility and viability every 3 h and 12 h. The results of the experiments indicated that fresh semen characteristics were fair good; the volume, consistency, motility, live-dead ratio, concentration (106/ml, total spermatozoa (109/ejaculate and abnormality were 29.25±9.33 ml, watery, 7.00±0.12, 67.08±9.08%, 77.89±6.46%, 211.88±21.15, 6.28±2.45 and 27.26±4.64%, respectively. The supplementation of different type and concentration of carbohydrates did not significantly affect the motility and viability. However, the supplementation of 50 mM fructose significantly increased the motility and viability of the sperm compared to the control. In conclusion, carbohydrate supplementation in DV may not maintain the sperm quality, particularly in the medium with the osmolarity higher than 400 mOsm/kg.

  3. Climate Change Vulnerability Analysis of Baluran National Park

    Directory of Open Access Journals (Sweden)

    Beny Harjadi

    2016-12-01

    Full Text Available Every ecosystem has a different level of susceptibility to environmental disturbances it receives, both from natural factors or anthropogenic disturbance. National Park (NP Baluran is one national park that has a representation of a complete ecosystem that includes upland forest ecosystems, lowland forests, coastal forests, mangroves, savanna and evergreen forest. The objective of this study is to get a formula calculation of vulnerability analysis of constant and dynamic factors. Baluran NP vulnerability assessment to climate change done by looking at the dynamic and fixed factors. Vulnerability remains a vulnerability factor to the condition of the original (control, whereas vulnerability is the vulnerability of the dynamic change factors which affected the condition from the outside. Constant Vulnerability (CV in  Baluran NP dominated resistant conditions (61%, meaning that the geomorphology and other fixed factors (slope and slope direction/aspect, then the condition in Baluran NP sufficiently resilient to climate change. Dynamic Vulnerability (DV is the vulnerability of an area or areas that change because of pressure from external factors. DV is influenced by climatic factors (WI = Wetness Index, soil (SBI = Soil Brightness Index, and vegetation (GI = Greenness Index. DV in  Baluran NP from 1999 to 2010 shifted from the original category of being (84.76% and shifted to the susceptible (59.88%.  The role of remote sensing for the analysis of raster digital system, while the geographic information system to display the results of cartographic maps.

  4. Barriers for administering primary health care services to battered ...

    African Journals Online (AJOL)

    Eman H. Alsabhan

    2011-09-15

    Sep 15, 2011 ... Abstract Background: Violence against women is an important public-health problem that draws attention of a wide ... try study on women's health and domestic violence (DV) showed that the lifetime ..... Malaysia. All Women's ...

  5. 15 CFR 762.2 - Records to be retained.

    Science.gov (United States)

    2010-01-01

    ..., Statement by Ultimate Consignee and Purchaser; (17) § 748.13, Delivery Verification (DV); (18) § 748.2(c... to be retained; (38) § 764.2, Violations; (39) § 764.5, Voluntary self-disclosure; and (40) § 766.10...

  6. Modeling and simulation of enhancement mode p-GaN Gate AlGaN/GaN HEMT for RF circuit switch applications

    Science.gov (United States)

    Panda, D. K.; Lenka, T. R.

    2017-06-01

    An enhancement mode p-GaN gate AlGaN/GaN HEMT is proposed and a physics based virtual source charge model with Landauer approach for electron transport has been developed using Verilog-A and simulated using Cadence Spectre, in order to predict device characteristics such as threshold voltage, drain current and gate capacitance. The drain current model incorporates important physical effects such as velocity saturation, short channel effects like DIBL (drain induced barrier lowering), channel length modulation (CLM), and mobility degradation due to self-heating. The predicted I d-V ds, I d-V gs, and C-V characteristics show an excellent agreement with the experimental data for both drain current and capacitance which validate the model. The developed model was then utilized to design and simulate a single-pole single-throw (SPST) RF switch.

  7. Eccentric connectivity index of chemical trees

    International Nuclear Information System (INIS)

    Haoer, R. S.; Atan, K. A.; Said, M. R. Md.; Khalaf, A. M.; Hasni, R.

    2016-01-01

    Let G = (V, E) be a simple connected molecular graph. In such a simple molecular graph, vertices and edges are depicted atoms and chemical bonds respectively, we refer to the sets of vertices by V (G) and edges by E (G). If d(u, v) be distance between two vertices u, v ∈ V(G) and can be defined as the length of a shortest path joining them. Then, the eccentricity connectivity index (ECI) of a molecular graph G is ξ(G) = ∑_v_∈_V_(_G_) d(v) ec(v), where d(v) is degree of a vertex v ∈ V(G). ec(v) is the length of a greatest path linking to another vertex of v. In this study, we focus the general formula for the eccentricity connectivity index (ECI) of some chemical trees as alkenes.

  8. Archive of Core and Site/Hole Data and Photographs from the Deep Sea Drilling Project (DSDP)

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — The Deep Sea Drilling Project (DSDP) operated the D/V GLOMAR CHALLENGER from 1968-1983, drilling 1,112 holes at 624 sites worldwide. The DSDP was funded by the US...

  9. South African Journal of Animal Science - Vol 25, No 4 (1995)

    African Journals Online (AJOL)

    Ruminant nutrition research in South Africa during the decade 198511995 · EMAIL FREE FULL TEXT EMAIL FREE FULL TEXT DOWNLOAD FULL TEXT DOWNLOAD FULL TEXT. H.H. Meissner, W.A. van Niekerk, D.V. Paulsmeier, P.H. Henning, 118-131 ...

  10. Muusikamaailm : "MaerzMusik" Berliinis. Rostropovitshi juubel algas. Wolfganf Rihm 50 / Priit Kuusk

    Index Scriptorium Estoniae

    Kuusk, Priit, 1938-

    2002-01-01

    Endine Saksa DV "Musik-Biennale Berlin" hakkab kandma uut nime "MaerzMusik. Festival für aktuelle Musik". 75aastaseks saav Mstislav Rostropovitsh tähistab oma juubelit mitmete kontsertidega. Lühidalt saksa helilooja Wolfgang Rihmist, kes sai hiljuti 50-aastaseks

  11. Shtazi bjot iz mogilõ / Viktor Kononov

    Index Scriptorium Estoniae

    Kononov, Viktor

    2004-01-01

    Saksa DV salapolitsei Stasi arhiivid, mis ühinemise tagajärjel sattusid lääne uurijate kätte, rikuvad ja mõjutavad ikka veel inimeste elusid. Üks järjekordsetest ohvritest on tuntud Soome poliitik Alpo Rusi

  12. Multi-center randomized controlled trial of cognitive treatment, placebo, oxybutynin, bladder training, and pelvic floor training in children with functional urinary incontinence

    NARCIS (Netherlands)

    van Gool, Jan D.; de Jong, Tom P. V. M.; Winkler-Seinstra, Pauline; Tamminen-Moebius, Tytti; Lax, Hildegard; Hirche, Herbert; Nijman, Rien J. M.; Hjalmas, Kelm; Jodal, Ulf; Bachmann, Hannsjoerg; Hoebeke, Piet; Vande Walle, Johan; Misselwitz, Joachim; John, Ulrike; Bael, An

    Objective Functional urinary incontinence causes considerable morbidity in 8.4% of school-age children, mainly girls. To compare oxybutynin, placebo, and bladder training in overactive bladder (OAB), and cognitive treatment and pelvic floor training in dysfunctional voiding (DV), a multi-center

  13. Multi-center randomized controlled trial of cognitive treatment, placebo, oxybutynin, bladder training, and pelvic floor training in children with functional urinary incontinence

    NARCIS (Netherlands)

    van Gool, Jan D.; de Jong, Tom P. V. M.; Winkler-Seinstra, Pauline; Tamminen-Möbius, Tytti; Lax, Hildegard; Hirche, Herbert; Nijman, Rien J. M.; Hjälmås, Kelm; Jodal, Ulf; Bachmann, Hannsjörg; Hoebeke, Piet; Walle, Johan Vande; Misselwitz, Joachim; John, Ulrike; Bael, An

    2014-01-01

    Functional urinary incontinence causes considerable morbidity in 8.4% of school-age children, mainly girls. To compare oxybutynin, placebo, and bladder training in overactive bladder (OAB), and cognitive treatment and pelvic floor training in dysfunctional voiding (DV), a multi-center controlled

  14. Abnormal umbilical artery Doppler velocimetry and placental ...

    African Journals Online (AJOL)

    fetal. Hence, DV provides information about the fetal side of the placenta and, alongside placental ... The study was prospective and conducted in a low-income setting. .... placental tissue (n=10), and some cases were lost to follow-up (n=6).

  15. Systematic Review: Land Cover, Meteorological, and Socioeconomic Determinants of Aedes Mosquito Habitat for Risk Mapping

    Science.gov (United States)

    Asian tiger and yellow fever mosquitoes (Aedes albopictus and Ae. aegypti) are global nuisances and are competent vectors for viruses such as Chikungunya (CHIKV), Dengue (DV), and Zika (ZIKV). This review aims to analyze available spatiotemporal distribution models of Aedes mosqu...

  16. Genetics Home Reference: Schimke immuno-osseous dysplasia

    Science.gov (United States)

    ... I, Fründ S, Illies F, Joseph M, Kaitila I, Lama G, Loirat C, McLeod DR, Milford DV, Petty ... E, Hinkelmann B, Kanariou M, Kasap B, Kilic SS, Lama G, Lamfers P, Loirat C, Majore S, Milford D, ...

  17. Rasch analysis of the Dutch version of the Oxford elbow score

    Directory of Open Access Journals (Sweden)

    de Haan J

    2011-08-01

    Full Text Available Jeroen de Haan1, Niels Schep2, Wim Tuinebreijer2, Peter Patka2, Dennis den Hartog21Department of Surgery and Traumatology, Westfriesgasthuis, Hoorn, the Netherlands; 2Department of Surgery and Traumatology, Erasmus MC, University Medical Center Rotterdam, Rotterdam, the NetherlandsBackground: The Oxford elbow score (OES is a patient-rated, 12-item questionnaire that measures quality of life in relation to elbow disorders. This English questionnaire has been proven to be a reliable and valid instrument. Recently, the OES has been translated into Dutch and examined for its reliability, validity, and responsiveness in a group of Dutch patients with elbow pathology. The aim of this study was to analyze the Dutch version of the OES (OES-DV in combination with Rasch analysis or the one-parameter item response theory to examine the structure of the questionnaire.Methods: The OES-DV was administered to 103 patients (68 female, 35 male. The mean age of the patients was 44.3 ± 14.7 (range 15–75 years. Rasch analysis was performed using the Winsteps® Rasch Measurement Version 3.70.1.1 and a rating scale parameterization.Results: The person separation index, which is a measure of person reliability, was excellent (2.30. All the items of the OES had a reasonable mean square infit or outfit value between 0.6 and 1.7. The threshold of items were ordered, so the categories can function as intended. Principal component analysis of the residuals partly confirmed the multidimensionality of the English version of the OES. The OES distinguished 3.4 strata, which indicates that about three ranges can be differentiated.Conclusion: Rasch analysis of the OES-DV showed that the data fit to the stringent Rasch model. The multidimensionality of the English version of the OES was partly confirmed, and the four items of the function and three items of the pain domain were recognized as separate domains. The category rating scale of the OES-DV works well. The OES can

  18. Cuidados nos pacientes com hemofilia e doença de von Willebrand na cirurgia eletiva otorrinolaringológica

    Directory of Open Access Journals (Sweden)

    Marques Marise P. C.

    2003-01-01

    Full Text Available FORMA DE ESTUDO Clínico prospectivo. MATERIAL E MÉTODO: Foi realizado um estudo prospectivo de 10 anos de 20 pacientes com hemofilias ou doença de von Willebrand (DvW com indicação de cirurgia otorrinolaringológica. Os pacientes foram submetidos a um total de 25 cirurgias otorrinolaringológicas eletivas. A idade média foi de 23,75 anos (2 a 62 anos. O grupo de estudo consistiu em 14 hemofílicos, 11 com hemofilia A grave (1 do sexo feminino, uma portadora com 30% de atividade de fator VIII (FVIII, um hemofílico B leve e uma com deficiência grave de fator X; 6 com DvW, 4 tinham o tipo 1 (3 mulheres, um o tipo 2A e um o tipo 3. Treze hemofílicos tinham síndrome de imunodeficiência adquirida. A duração média do procedimento foi de 1 hora e 37 minutos (15 minutos a 12 horas. O defeito da coagulação foi corrigido com desmopressina (DDAVP, com concentrado de FVIII de pureza intermediária 8Y, com criopreciptado ou com complexo protrombínico não ativado (PPSB, de acordo com os níveis plasmáticos do fator e da severidade da cirurgia. O ácido épsilon aminocapróico também foi usado em associação. Em 1 hemofílico A grave houve sangramento pós-operatório que se resolveu com a elevação do nível mínimo de FVIII para 80% e em 1 paciente com DvW do Tipo 3 houve sangramento pós-operatório pela dificuldade de identificação do melhor concentrado a ser reposto. Após o uso do concentrado de pureza intermediária 8Y, houve controle do sangramento. RESULTADO: Todos os outros pacientes apresentaram a hemostasia considerada normal ou excelente. CONCLUSÃO: Concluiu-se que pacientes com hemofilias ou DvW não apresentam um risco cirúrgico aumentado se for realizada uma terapia adequada.

  19. Characteristics of spray from a GDI fuel injector for naphtha and surrogate fuels

    KAUST Repository

    Wang, Libing

    2016-11-18

    Characterization of the spray angle, penetration, and droplet size distribution is important to analyze the spray and atomization quality. In this paper, the spray structure development and atomization characterization of two naphtha fuels, namely light naphtha (LN) and whole naphtha (WN) and two reference fuel surrogates, i.e. toluene primary reference fuel (TPRF) and primary reference fuel (PRF) were investigated using a gasoline direct injection (GDI) fuel injector. The experimental setup included a fuel injection system, a high-speed imaging system, and a droplet size measurement system. Spray images were taken by using a high-speed camera for spray angle and penetration analysis. Sauter mean diameter, Dv(10), Dv(50), Dv(90), and particle size distribution were measured using a laser diffraction technique. Results show that the injection process is very consistent for different runs and the time averaged spray angles during the measuring period are 103.45°, 102.84°, 102.46° and 107.61° for LN, WN, TPRF and PRF, respectively. The spray front remains relatively flat during the early stage of the fuel injection process. The peak penetration velocities are 80 m/s, 75 m/s, 75 m/s and 79 m/s for LN, WN, TPRF and PRF, respectively. Then velocities decrease until the end of the injection and stay relatively stable. The transient particle size and the time-averaged particle size were also analyzed and discussed. The concentration weighted average value generally shows higher values than the arithmetic average results. The average data for WN is usually the second smallest except for Dv90, of which WN is the biggest. Generally the arithmetic average particle sizes of PRF are usually the smallest, and the sizes does not change much with the measuring locations. For droplet size distribution results, LN and WN show bimodal distributions for all the locations while TPRF and PRF shows both bimodal and single peak distribution patterns. The results imply that droplet size

  20. Theoretical perspective on structural, electronic and magnetic properties of 3d metal tetraoxide clusters embedded into single and di-vacancy graphene

    Energy Technology Data Exchange (ETDEWEB)

    Rafique, Muhammad [School of Energy Science and Engineering, Harbin Institute of Technology, 92 West Dazhi Street, Harbin 150001 (China); Mehran University of Engineering and Technology, S.Z.A.B, Campus Khairpur Mir' s, Sindh (Pakistan); Shuai, Yong, E-mail: shuaiyong@hit.edu.cn [School of Energy Science and Engineering, Harbin Institute of Technology, 92 West Dazhi Street, Harbin 150001 (China); Tan, He-Ping; Muhammad, Hassan [School of Energy Science and Engineering, Harbin Institute of Technology, 92 West Dazhi Street, Harbin 150001 (China)

    2017-06-30

    Highlights: • First-principles calculations are performed for TMO{sub 4} cluster-doped SV and DV monolayer graphene structures. • Ferromagnetism coupling behavior between TM atoms and neighboring C and O atoms was observed for all structural models. • The direction of charge transfer is always from graphene layer to TMO{sub 4} clusters. • CrO{sub 4} and MnO{sub 4} doped SV graphene systems display dilute magnetic semiconductor (DMS) behavior in their spin down channel. • CoO{sub 4}, CrO{sub 4}, FeO{sub 4} and MnO{sub 4} doped DV graphene systems exhibit DMS behavior in their spin up channel. - Abstract: Structural, electronic and magnetic properties of 3d transition metal tetraoxide TMO{sub 4} superhalogen clusters doped single vacancy (SV) and divacancy (DV) monolayer graphene have been studied using first-principles calculations. We found that in both cases of TMO{sub 4} cluster substitution, all the impurity atoms are tightly bonded with graphene, having significant formation energy and large charge transfer occurs from graphene to TMO{sub 4} clusters. CrO{sub 4} and MnO{sub 4} substituted SV graphene structures exhibit dilute magnetic semiconductor behavior in their spin down channel with 2.15 μ{sub B} and 3.51 μ{sub B} magnetic moment, respectively. However, CoO{sub 4}, FeO{sub 4}, TiO{sub 4} and NiO{sub 4} substitution into SV graphene, leads to Fermi level shifting to conduction band, thereby causing the Dirac cone to move into valence band and a band gap appears at high symmetric K-point. Interestingly, CoO{sub 4}, CrO{sub 4}, FeO{sub 4} and MnO{sub 4} substituted DV graphene structures exhibit dilute magnetic semiconductor behavior in their spin up channel with 1.74 μ{sub B}, 3.27 μ{sub B}, 3.09 μ{sub B} and 1.99 μ{sub B} magnetic moment, respectively. Detailed analysis of density of states (DOS) plots show that d orbitals of 3d TM atoms should be responsible for inducing magnetic moments in graphene. We believe that our results are

  1. New airborne pathogen transport model for upper-room UVGI spaces conditioned by chilled ceiling and mixed displacement ventilation: Enhancing air quality and energy performance

    International Nuclear Information System (INIS)

    Kanaan, Mohamad; Ghaddar, Nesreen; Ghali, Kamel; Araj, Georges

    2014-01-01

    Highlights: • A model of bacteria transport is developed in CC/DV conditioned spaces with UVGI. • The model identifies buoyant, partially mixed, and fully mixed transport zones. • The predicted bacteria concentration agreed well with CFD results. • The higher the supply flow rate, the more restrictive is return air mixing ratio. • Upper-room UVGI results in higher return mixing and 33% in energy savings. - Abstract: The maximum allowable return air ratio in chilled ceiling (CC) and mixed displacement ventilation (DV) system for good air quality is regulated by acceptable levels of CO 2 concentration not to exceed 700 ppm and airborne bacterial count to satisfy World Health Organization (WHO) requirement for bacterial count not to exceed 500 CFU/m 3 . Since the CC/DV system relies on buoyancy effects for driving the contaminated air upwards, infectious particles will recirculate in the upper zone allowing effective utilization of upper-room ultraviolet germicidal irradiation (UVGI) to clean return air. The aim of this work is to develop a new airborne bacteria transport plume-multi-layer zonal model at low computational cost to predict bacteria concentration distribution in mixed CC/DV conditioned room without and with upper-room UVGI installed. The results of the simplified model were compared with layer-averaged concentration predictions of a detailed and experimentally-validated 3-D computational fluid dynamics (CFD) model. The comparison showed good agreement between bacteria transport model results and CFD predictions of room air bacteria concentration with maximum error of ±10.4 CFU/m 3 in exhaust air. The simplified model captured the vertical bacteria concentration distribution in room air as well as the locking effect of highest concentration happening at the stratification level. The developed bacteria transport model was used in a case study to determine the return air mixing ratio that minimizes energy consumption and maintains acceptable IAQ

  2. Puzzling with online games (BAM-COG): reliability, validity, and feasibility of an online self-monitor for cognitive performance in aging adults.

    Science.gov (United States)

    Aalbers, Teun; Baars, Maria A E; Olde Rikkert, Marcel G M; Kessels, Roy P C

    2013-12-03

    Online interventions are aiming increasingly at cognitive outcome measures but so far no easy and fast self-monitors for cognition have been validated or proven reliable and feasible. This study examines a new instrument called the Brain Aging Monitor-Cognitive Assessment Battery (BAM-COG) for its alternate forms reliability, face and content validity, and convergent and divergent validity. Also, reference values are provided. The BAM-COG consists of four easily accessible, short, yet challenging puzzle games that have been developed to measure working memory ("Conveyer Belt"), visuospatial short-term memory ("Sunshine"), episodic recognition memory ("Viewpoint"), and planning ("Papyrinth"). A total of 641 participants were recruited for this study. Of these, 397 adults, 40 years and older (mean 54.9, SD 9.6), were eligible for analysis. Study participants played all games three times with 14 days in between sets. Face and content validity were based on expert opinion. Alternate forms reliability (AFR) was measured by comparing scores on different versions of the BAM-COG and expressed with an intraclass correlation (ICC: two-way mixed; consistency at 95%). Convergent validity (CV) was provided by comparing BAM-COG scores to gold-standard paper-and-pencil and computer-assisted cognitive assessment. Divergent validity (DV) was measured by comparing BAM-COG scores to the National Adult Reading Test IQ (NART-IQ) estimate. Both CV and DV are expressed as Spearman rho correlation coefficients. Three out of four games showed adequate results on AFR, CV, and DV measures. The games Conveyer Belt, Sunshine, and Papyrinth have AFR ICCs of .420, .426, and .645 respectively. Also, these games had good to very good CV correlations: rho=.577 (P=.001), rho=.669 (Pgame Viewpoint provided less desirable results with an AFR ICC of .167, CV rho=.202 (P=.15), and DV rho=-.162 (P=.21). This study provides evidence for the use of the BAM-COG test battery as a feasible, reliable, and

  3. How to monitor pregnancies complicated by fetal growth restriction and delivery before 32 weeks : post-hoc analysis of TRUFFLE study

    NARCIS (Netherlands)

    Ganzevoort, W.; Mensing van Charante, N.; Thilaganathan, B.; Prefumo, Federico; Arabin, B.; Bilardo, Caterina M.; Brezinka, C.; Derks, J. B.; Diemert, A.; Duvekot, Johannes J.; Ferrazzi, E.; Frusca, T.; Hecher, K.; Marlow, N.; Martinelli, P.; Ostermayer, E.; Papageorghiou, Aris T.; Schlembach, D.; Schneider, K. T M; Todros, T.; Valcamonico, A.; Visser, G. H.A.; van Wassenaer-Leemhuis, A.; Lees, Christoph C.; Wolf, H.; Aktas, Ayse; Borgione, Silvia; Chaoui, Rabih; Cornette, Jerome M J; Diehl, Thilo; van Eyck, J.; Fratelli, Nicola; van Haastert, I. C.; Lobmaier, Silvia; Lopriore, E.; Missfelder-Lobos, Hannah; Mansi, Giuseppina; Martelli, Paola; Maso, Gianpaolo; Maurer-Fellbaum, Ute; Mulder-De Tollenaer, Susanne; Napolitano, Raffaele; Oberto, Manuela; Oepkes, D.; Ogge, Giovanna; van der Post, Joris A. M.; Preston, Lucy; Raimondi, Francesco; Rattue, H.; Reiss, Irwin K M; Scheepers, L. S.; Skabar, Aldo; Spaanderman, M.; Weisglas-Kuperus, N.; Zimmermann, Andrea

    2017-01-01

    Objectives: In the recent TRUFFLE study, it appeared that, in pregnancies complicated by fetal growth restriction (FGR) between 26 and 32 weeks' gestation, monitoring of the fetal ductus venosus (DV) waveform combined with computed cardiotocography (CTG) to determine timing of delivery increased the

  4. Halim et al, Afr J Tradit Complement Altern Med. (2018) 15 (2): 19 ...

    African Journals Online (AJOL)

    user

    2018-02-23

    Feb 23, 2018 ... He L, Fong J, von Zastrow M, Whistler JL. (2002). Regulation ... Keith DE, Murray SR, Zaki PA, Chu PC, Lissin DV, Kang L, Evans CJ, von Zastrow M. (1996). Morphine activates ... Tao PL, Lee HY, Chang LR, Loh HH. (1990).

  5. A systematic synthesis of the evidence for domestic violence

    African Journals Online (AJOL)

    Kirstam

    a comprehensive health approach to manage domestic violence victims. The strong .... customer satisfaction and improved health outcomes for individuals and communities. (National .... (b) referrals to DV support services as the primary outcome measure is an intermediate ..... a pragmatic cluster randomised controlled trial.

  6. African Journal of Biomedical Research - Vol 9, No 2 (2006)

    African Journals Online (AJOL)

    Some neuropharmacological effects of the methanolic root extract of Cissus quadrangularis in mice. EMAIL FREE FULL TEXT EMAIL FREE FULL TEXT DOWNLOAD FULL TEXT DOWNLOAD FULL TEXT. A.H.M Viswanatha Swamy, A.H.M Thippeswamy, D.V Manjula, C.B Mahendra Kumar.

  7. Buckshot Routing with Distance Vectors in Three Application Scenarios for Wireless Sensor Networks with Unstable Network Topologies and Unidirectional Links

    Directory of Open Access Journals (Sweden)

    Reinhardt Karnapke

    2015-02-01

    Full Text Available Experiments have shown that the number of asymmetric and unidirectional links often exceeds the number of bidirectional ones, especially in the transitional area of the communication range of wireless sensor nodes. Still, most of today’s routing protocols ignore their existence or try to remove their implications. Also, links are not stable over time, and routes become unusable often, resulting in a need for new routing protocols that can handle highly dynamic links and use unidirectional links to their advantage. At SENSORCOMM' 2014, we presented BuckshotDV, a routing protocol which is resilient against link fluctuations and uses the longer reach of unidirectional links to increase its performance. Furthermore, its distance vector nature makes it scalable for large sensor networks. This paper is an extended version which adds some implementation details and the evaluation of BuckshotDV in two more application scenarios.

  8. H-functions and mixing in violent relaxation

    International Nuclear Information System (INIS)

    Tremaine, S.; Henon, M.; Lynden-Bell, D.

    1986-01-01

    An H-function is any function of the phase space distribution function F(x,v) which is non-decreasing with time. In collisionless systems Boltzmann's H-function - integral F log F dx dv is only one of a variety of H-functions of the form - integral C(F) dx dv, where C is any convex function. Every equilibrium stellar system in which the distribution function is a decreasing function of the energy alone is a stationary point of some H-function of this form. During violent relaxation, all such H-functions must increase, and the distribution function is said to become 'more mixed'. A simple criterion is given for determining whether a given distribution function is more mixed than another; this criterion is used to show that a violently relaxed galaxy resembles observed elliptical galaxies only if the initial state is cold or clumpy. (author)

  9. An EMC Evaluation of the Use of Unshielded Motor Cables in AC Adjustable Speed Drive Applications

    DEFF Research Database (Denmark)

    Hanigovszki, Norbert; Poulsen, J.; Spiazzi, G.

    2004-01-01

    The most common solution for modern adjustable speed drives (ASD) is the use of induction motors (IM) fed by voltage-source inverters (VSI). The inverter generates a pulsewidth modulated (PWM) voltage, with values of about 6 kV/ dv/dt m s or even more. In three-leg inverters for three-phase appli......The most common solution for modern adjustable speed drives (ASD) is the use of induction motors (IM) fed by voltage-source inverters (VSI). The inverter generates a pulsewidth modulated (PWM) voltage, with values of about 6 kV/ dv/dt m s or even more. In three-leg inverters for three......-phase applications the occurrence of common-mode voltage is inherent due to asymmetrical output pulses. As a result, for electromagnetic compatibility (EMC) reasons, in most applications shielded cables are used between the inverter and the motor, implying high installation costs. The present paper discusses the use...

  10. Survivor-Defined Practice in Domestic Violence Work: Measure Development and Preliminary Evidence of Link to Empowerment.

    Science.gov (United States)

    Goodman, Lisa A; Thomas, Kristie; Cattaneo, Lauren Bennett; Heimel, Deborah; Woulfe, Julie; Chong, Siu Kwan

    2016-01-01

    Survivor-defined practice, characterized by an emphasis on client choice, partnership, and sensitivity to the unique needs, contexts, and coping strategies of individual survivors, is an aspirational goal of the domestic violence (DV) movement, assumed to be a key contributor to empowerment and other positive outcomes among survivors. Despite its central role in DV program philosophy, training, and practice, however, our ability to assess its presence and its presumed link to well-being has been hampered by the absence of a way to measure it from survivors' perspectives. As part of a larger university-community collaboration, this study had two aims: (a) to develop a measure of survivor-defined practice from the perspective of participants, and (b) to assess its relationship to safety-related empowerment after controlling for other contributors to survivor well-being (e.g., financial stability and social support). Results supported the reliability and validity of the Survivor-Defined Practice Scale (SDPS), a nine-item measure that assesses participants' perception of the degree to which their advocates help them achieve goals they set for themselves, facilitate a spirit of partnership, and show sensitivity to their individual needs and styles. The items combined to form one factor indicating that the three theoretical aspects of survivor-defined practice may be different manifestations of one underlying construct. Results also support the hypothesized link between survivor-defined practice and safety-related empowerment. The SDPS offers DV programs a mechanism for process evaluation that is rigorous and rooted in the feminist empowerment philosophy that so many programs espouse. © The Author(s) 2014.

  11. Dengue virus enhances thrombomodulin and ICAM-1 expression through the macrophage migration inhibitory factor induction of the MAPK and PI3K signaling pathways.

    Directory of Open Access Journals (Sweden)

    Trai-Ming Yeh

    Full Text Available Dengue virus (DV infections cause mild dengue fever (DF or severe life-threatening dengue hemorrhagic fever (DHF. The mechanisms that cause hemorrhage in DV infections remain poorly understood. Thrombomodulin (TM is a glycoprotein expressed on the surface of vascular endothelial cells that plays an important role in the thrombin-mediated activation of protein C. Prior studies have shown that the serum levels of soluble TM (sTM and macrophage migration inhibitory factor (MIF are significantly increased in DHF patients compared to levels in DF patients or normal controls. In this study, we investigated how MIF and sTM concentrations are enhanced in the plasma of DHF patients and the potential effect of MIF on coagulation through its influence on two factors: thrombomodulin (TM and intercellular adhesion molecule-1 (ICAM-1 in endothelial cells and monocytes. Recombinant human macrophage migration inhibitory factor (rMIF was used to treat monocytic THP-1 cells and endothelial HMEC-1 cells or primary HUVEC cells. The subsequent expression of TM and ICAM-1 was assessed by immunofluorescent staining and flow cytometry analysis. Additionally, the co-incubation of THP-1 cells with various cell signaling pathway inhibitors was used to determine the pathways through which MIF mediated its effect. The data provided evidence that severe DV infections induce MIF expression, which in turn stimulates monocytes or endothelial cells to express TM and ICAM-1 via the Erk, JNK MAPK and the PI3K signaling pathways, supporting the idea that MIF may play an important role as a regulator of coagulation.

  12. Immunogenicity and safety of yellow fever vaccine among 115 HIV-infected patients after a preventive immunisation campaign in Mali.

    Science.gov (United States)

    Sidibe, Mariam; Yactayo, Sergio; Kalle, Abdoulaye; Sall, Amadou A; Sow, Samba; Ndoutabe, Modjirom; Perea, William; Avokey, Fenella; Lewis, Rosamund F; Veit, Olivia

    2012-07-01

    The immune response to yellow fever (YF) vaccine and its safety among HIV-infected individuals living in YF endemic areas is not well understood. Following a national YF preventive immunisation campaign in Mali in April 2008, we assessed the immunogenicity and safety of 17D yellow fever vaccine (17DV) among HIV-infected patients in two HIV treatment centres in Bamako, Mali, by testing for neutralising antibodies and identifying serious adverse events following immunisation (AEFI). A YF neutralisation titre (NT) of 1:≥20 was considered to be adequate and protective. A serious AEFI included hospitalisation, any life-threatening condition, or death, occurring within 30 days following 17DV administration. Of 115 HIV-infected patients who reported having received 17DV, 110 (96%) were on combination antiretroviral therapy and 83 patients were tested for neutralising antibodies. Around the time of vaccination, median CD4 cell count was 389 cells/mm(3) (IQR 227-511cells/mm(3)); HIV-RNA was undetectable in 24 of 46 patients tested. Seventy-six (92%) of 83 participants had adequate immune titres 9 months after the immunisation campaign. Previous vaccination or flavivirus exposure could contribute to this finding. No serious AEFI was found in the 115 participants. In this small series, YF vaccine appeared to be immunogenic with a favourable safety profile in HIV-infected patients on antiretroviral therapy. Higher CD4 cell counts and suppressed HIV-RNA were associated with the presence of an adequate immune titre and higher NTs. Copyright © 2012 Royal Society of Tropical Medicine and Hygiene. Published by Elsevier Ltd. All rights reserved.

  13. Homology and homoplasy of swimming behaviors and neural circuits in the Nudipleura (Mollusca, Gastropoda, Opisthobranchia)

    Science.gov (United States)

    Newcomb, James M.; Sakurai, Akira; Lillvis, Joshua L.; Gunaratne, Charuni A.; Katz, Paul S.

    2012-01-01

    How neural circuit evolution relates to behavioral evolution is not well understood. Here the relationship between neural circuits and behavior is explored with respect to the swimming behaviors of the Nudipleura (Mollusca, Gastropoda, Opithobranchia). Nudipleura is a diverse monophyletic clade of sea slugs among which only a small percentage of species can swim. Swimming falls into a limited number of categories, the most prevalent of which are rhythmic left–right body flexions (LR) and rhythmic dorsal–ventral body flexions (DV). The phylogenetic distribution of these behaviors suggests a high degree of homoplasy. The central pattern generator (CPG) underlying DV swimming has been well characterized in Tritonia diomedea and in Pleurobranchaea californica. The CPG for LR swimming has been elucidated in Melibe leonina and Dendronotus iris, which are more closely related. The CPGs for the categorically distinct DV and LR swimming behaviors consist of nonoverlapping sets of homologous identified neurons, whereas the categorically similar behaviors share some homologous identified neurons, although the exact composition of neurons and synapses in the neural circuits differ. The roles played by homologous identified neurons in categorically distinct behaviors differ. However, homologous identified neurons also play different roles even in the swim CPGs of the two LR swimming species. Individual neurons can be multifunctional within a species. Some of those functions are shared across species, whereas others are not. The pattern of use and reuse of homologous neurons in various forms of swimming and other behaviors further demonstrates that the composition of neural circuits influences the evolution of behaviors. PMID:22723353

  14. Effectiveness of training to promote routine enquiry for domestic violence by midwives and nurses: A pre-post evaluation study.

    Science.gov (United States)

    Baird, Kathleen M; Saito, Amornrat S; Eustace, Jennifer; Creedy, Debra K

    2017-11-01

    Asking women about experiences of domestic violence in the perinatal period is accepted best practice. However, midwives and nurses may be reluctant to engage with, or effectively respond to disclosures of domestic violence due a lack of knowledge and skills. To evaluate the impact of training on knowledge and preparedness of midwives and nurses to conduct routine enquiry about domestic violence with women during the perinatal period. A pre-post intervention design was used. Midwives and nurses (n=154) attended a full day workshop. Of these, 149 completed pre-post workshop measures of knowledge and preparedness. Additional questions at post-training explored participants' perceptions of organisational barriers to routine enquiry, as well as anticipated impact of training on their practice. Training occurred between July 2015 and October 2016. Using the Wilcoxon signed-rank test, all post intervention scores were significantly higher than pre intervention scores. Knowledge scores increased from a pre-training mean of 21.5-25.6 (Z=-9.56, pworkplace allowed adequate time to respond to disclosures of DV. Brief training can improve knowledge, preparedness, and confidence of midwives and nurses to conduct routine enquiry and support women during the perinatal period. Training can assist midwives and nurses to recognise signs of DV, ask women about what would be helpful to them, and address perceived organisational barriers to routine enquiry. Practice guidelines and clear referral pathways following DV disclosure need to be implemented to support gains made through training. Crown Copyright © 2017. Published by Elsevier Ltd. All rights reserved.

  15. PRE-SPECTROSCOPIC FALSE-POSITIVE ELIMINATION OF KEPLER PLANET CANDIDATES

    International Nuclear Information System (INIS)

    Batalha, Natalie M.; Rowe, Jason F.; Borucki, William J.; Koch, David G.; Lissauer, Jack J.; Gilliland, Ronald L.; Jenkins, Jon J.; Caldwell, Douglas; Dunham, Edward W.; Gautier, Thomas N.; Howell, Steve B.; Latham, David W.; Marcy, Geoff W.; Prsa, Andrej

    2010-01-01

    Ten days of commissioning data (Quarter 0) and 33 days of science data (Quarter 1) yield instrumental flux time series of ∼150,000 stars that were combed for transit events, termed threshold crossing events(TCE), each having a total detection statistic above 7.1σ. TCE light curves are modeled as star+planet systems. Those returning a companion radius smaller than 2R J are assigned a Kepler Object of Interest (KOI) number. The raw flux, pixel flux, and flux-weighted centroids of every KOI are scrutinized to assess the likelihood of being an astrophysical false positive versus the likelihood of being a planetary companion. This vetting using Kepler data is referred to as data validation (DV). Herein, we describe the DV metrics and graphics used to identify viable planet candidates amongst the KOIs. Light curve modeling tests for (1) the difference in depth of the odd- versus even-numbered transits, (2) evidence of ellipsoidal variations, and (3) evidence of a secondary eclipse event at phase = 0.5. Flux-weighted centroids are used to test for signals correlated with transit events with a magnitude and direction indicative of a background eclipsing binary. Centroid time series are complimented by analysis of images taken in-transit versus out-of-transit, the difference often revealing the pixel contributing the most to the flux change during transit. Examples are shown to illustrate each test. Candidates passing DV are submitted to ground-based observers for further false-positive elimination or confirmation/characterization.

  16. Large-Scale, Continuous-Flow Production of Stressed Biomass (Desulfovibrio vulgaris Hildenborough)

    Energy Technology Data Exchange (ETDEWEB)

    Geller, Jil T.; Borglin, Sharon E.; Fortney, Julian L.; Lam, Bonita R.; Hazen, Terry C.; Biggin, Mark D.

    2010-05-01

    The Protein Complex Analysis Project (PCAP, http://pcap.lbl.gov/), focuses on high-throughput analysis of microbial protein complexes in the anaerobic, sulfate-reducing organism, DesulfovibriovulgarisHildenborough(DvH).Interest in DvHas a model organism for bioremediation of contaminated groundwater sites arises from its ability to reduce heavy metals. D. vulgarishas been isolated from contaminated groundwater of sites in the DOE complex. To understand the effect of environmental changes on the organism, midlog-phase cultures are exposed to nitrate and salt stresses (at the minimum inhibitory concentration, which reduces growth rates by 50percent), and compared to controls of cultures at midlogand stationary phases. Large volumes of culture of consistent quality (up to 100 liters) are needed because of the relatively low cell density of DvHcultures (one order of magnitude lower than E. coli, for example) and PCAP's challenge to characterize low-abundance membrane proteins. Cultures are grown in continuous flow stirred tank reactors (CFSTRs) to produce consistent cell densities. Stressor is added to the outflow from the CFSTR, and the mixture is pumped through a plug flow reactor (PFR), to provide a stress exposure time of 2 hours. Effluent is chilled and held in large carboys until it is centrifuged. A variety of analyses -- including metabolites, total proteins, cell density and phospholipidfatty-acids -- track culture consistency within a production run, and differences due to stress exposure and growth phase for the different conditions used. With our system we are able to produce the requisite 100 L of culture for a given condition within a week.

  17. Caracterização clínica da demência vascular: avaliação retrospectiva de uma amostra de pacientes ambulatoriais

    Directory of Open Access Journals (Sweden)

    Smid Jerusa

    2001-01-01

    Full Text Available OBJETIVO: analisar as características clínicas e as condições mórbidas (CM associados em uma amostra de pacientes com demência vascular (DV. MÉTODOS: foram estudados retrospectivamente 25 pacientes com diagnóstico de DV, estabelecidos com base critérios do grupo State of California Alzheimer´s Disease Diagnostic and Treatment Centers (ADDTC. Os dados clínicos e de neuroimagem e os exames laboratoriais foram computados para caracterização da amostra. RESULTADOS: a média da faixa etária foi de 68,7 ± 14,6 anos (64,0% homens, com escolaridade média de 5,2 ± 4,4 anos. A instalação súbita do quadro foi observada em 48,0% dos pacientes e a evolução em degraus e o curso flutuante, em 4,0% e 16,0% dos casos, respectivamente. Apresentavam déficit neurológico focal como sintoma inicial 48,0%, sendo constatado déficit ao exame em 80,0%. As principais CM foram: hipertensão arterial sistêmica (92,0%; hipercolesterolemia (64,0%; insuficiência coronariana (40,0%; tabagismo (40,0%; hipertrigliceridemia (36,0%; diabete melito (32,0%; doença de Chagas (8,0%. CONCLUSÕES: observou-se forte correlação entre DV e hipertensão e hipercolesterolemia. A presença de dois pacientes com doença de Chagas sugere que esta doença possa constituir possível fator de risco regional.

  18. Wallops' Low Elevation Link Analysis for the Constellation Launch/Ascent Links

    Science.gov (United States)

    Cheung, Kar-Ming; Ho, Christian; Kantak, Anil; Lee, Charles; Tye, Robert; Richards, Edger; Sham, Catherine; Schlesinger, Adam; Barritt, Brian

    2011-01-01

    Prior to the redirection of the Constellation Program, the Wallops 11.3-meter ground station was tasked to support the Orion's Dissimilar Voice (DV) link and the Ares's Development Flight Instrument (DFI) link. Detailed analysis of the launch trajectories indicates that during the launch and ascent operation, the critical events of Orion-Ares main engine cut off (MECO) and Separation occur at low elevation angle. We worked with engineers from both Wallops Flight Facility (WFF) and Johnson Space Center (JSC) to perform an intensive measurement and link analysis campaign on the DV and DFI links. The main results were as follows: (1) The DV links have more than 3 dB margin at MECO and Separation. (2) The DFI links have 0 dB margin at Separation during certain weather condition in summer season. (3) Tropospheric scintillation loss is the major impairment at low elevation angle. (4) The current scintillation models in the Recommendation ITU-R P.618 (Propagation data and prediction methods required for the design of Earth-space telecommunication systems), which are based on limited experimental and theoretical work, exhibit idiosyncratic behaviors. We developed an improved model based on the measurements of recent Shuttle mission launch and ascent links and the ITU propagation data. (5) Due to the attitude uncertainty of the Orion-Ares stack, the high dynamics of the launch and ascent trajectory, and the irregularity of the Orion and Ares antenna patterns, we employed new link analysis approach to model the spacecraft antenna gain. In this paper we discuss the details of the aforementioned results.

  19. Radiation exposure of children in pediatric radiology, Pt. 8. Radiation doses during thoracoabdominal babygram and abdominal X-ray examination of the newborn and young infants

    International Nuclear Information System (INIS)

    Schneider, Karl; Seidenbusch, M.C.

    2010-01-01

    Purpose: Reconstruction of radiation doses for the thoracoabdominal babygram and the abdomen X-ray from radiographic settings and exposure data acquired at Dr. von Hauner's Kinderspital (children's hospital of the University of Munich, DvHK) between 1976 and 2007; comparison of these dose values with values reported in the literature; recommendation of a reference dose value for the thoracoabdominal babygram. Materials and Methods: The data from all X-ray examinations performed since 1976 at DvHK were stored electronically in a database. After 30 years of data collection, the database now includes 305 107 radiological examinations (radiographs and fluoroscopies), especially 1493 thoracoabdominal babygrams and 3632 abdomen X-rays of newborns and young infants. With the computer program PAeDOS, a specific dose reconstruction algorithm was developed. Results: the entrance dose values of thoracoabdominal babygrams and abdomen X-rays in DvHK could be reduced in the last 30 years by a factor of 5 to 8. They are far below the entrance dose values reported by other radiology departments in Europe. Nevertheless, a slight increase in the entrance doses that correlates with the introduction of a digital storage phosphor system could be observed in the last years. Conclusion: because nearly all radiosensitive body organs in early life are involved during a thoracoabdominal babygram and because of the high radiation sensitivity of newborns, thoracoabdominal babygrams should be performed in neonatology with caution. A dose value of 1.0 cGy cm 2 could serve as the actual reference dose value for the thoracoabdominal babygram of the newborn. (orig.)

  20. Mechanistic deductions from kinetic isotope effects and pH studies of pyridoxal phosphate dependent carbon-carbon lyases: Erwinia herbicola and Citrobacter freundii tyrosine phenol-lyase

    International Nuclear Information System (INIS)

    Kiick, D.M.; Phillips, R.S.

    1988-01-01

    The pH dependence of the kinetic parameters and primary deuterium isotope effects have been determined for tyrosine phenol-lyase from both Erwinia herbicola and Citrobacter freundii. The primary deuterium isotope effects indicate that proton abstraction from the 2-position of the substrate is partially rate-limiting for both enzymes. The C. freundii enzyme primary deuterium isotope effects [DV = 3.5 and D(V/Ktyr) = 2.5] are pH independent, indicating that tyrosine is not sticky (i.e., does not dissociate slower than it reacts to give products). Since Vmax for both tyrosine and the alternate substrate S-methyl-L-cysteine is also pH independent, substrate binds only to the correctly protonated form of the enzyme. For the E. herbicola enzyme, both Vmax and V/K for tyrosine or S-methyl-L-cysteine are pH dependent, as well as both DV and D(V/Ktyr). Thus, while both the protonated and unprotonated enzyme can bind substrate, and may be interconverted directly, only the unprotonated Michaelis complex is catalytically competent. At pH 9.5, DV = 2.5 and D(V/Ktyr) = 1.5. However, at pH 6.4 the isotope effect on both parameters is equal to 4.1. From these data, the forward commitment factor (cf = 5.2) and catalytic ratio (cvf = 1.1) for tyrosine and S-methyl-L-cysteine (cf = 2.2, cvf = 24) are calculated. Also, the Michaelis complex partition ratio (cf/cvf) for substrate and products is calculated to be 4.7 for tyrosine and 0.1 for S-methyl-L-cysteine

  1. ASSESSMENT OF THE LOCALIZATION OF HYPOCENTERS OF CRUSTAL EARTHQUAKES RELATIVE TO THE DEPTH AND RELIEF OF THE BORDER DENSITY STRATIFICATION IN THE CRUST OF THE NORTHEASTERN SECTION OF THE REFERENCE GEOLOGICAL-GEOPHYSICAL PROFILE 3-DV

    Directory of Open Access Journals (Sweden)

    N. K. Gayday

    2017-01-01

    Full Text Available The total length of the seismic profiles in the northeastern regions ofRussiaand, accordingly, the area of the territories covered by the seismic data interpretations, remains insignificant in comparison with the total area of these regions. At the same time, the geological objects in the northeastern regions attract much attention in view of their prospects, including potential mineral resources. The challenge is to construct the regional models of the crust structure without deep seismic survey data, and to analyze the regional seismicity that depends on the features of the deep crust structure. We develop a density model of the crust structure using the new interpretational gravimetry method. The density modeling results show that the density changes in the crust can be used to estimate the position of a surface separating the lower (quasi-homogeneous and upper (heterogeneous parts of the crust, i.e. to assess the density boundary of stratification. This boundary is formed due to a complex of physical and chemical processes that facilitate the transition of the material in the lower part of the crust into the quasi-uniform (homogeneous state. The study area is the junction zone of the Ayan-Yuryakh anticlinorium and Inyali-Debin synclinorium (62‒63°N, 148‒152° E. The initial interpretation of the deep seismic survey data on the reference geological-geophysical profile 3-DV was available, so the ambiguity of the density modeling was reduced. In turn, the density modeling results can provide additional information for geological-geophysical interpretation of the DSS results on the sites wherein the seismic profiles go along the fault zones. The relationship between seismic events and the relief of the density boundary of stratification in the crust was studied quantitatively on the basis of the data from the regional catalog of seismic events and the results of the earlier analysis of seismicity in the study area. The analysis shows that

  2. Family Ambiguity and Domestic Violence in Asia: Concept, Law and Process

    NARCIS (Netherlands)

    Mohamad, M.; Wieringa, S.E.

    2013-01-01

    This book revisits the issue of Domestic Violence (DV) in Asia by exploring the question of family ambiguity, and interrogating DV’s relationship between concept, law and strategy. Comparative experiences in the Asian context enable an examination of the effectiveness of family regulations and laws

  3. Analysis of Source Selection Methods and Performance Outcomes: Lowest Price Technically Acceptable vs. Tradeoff in Air Force Acquisitions

    Science.gov (United States)

    2015-12-01

    fail the homogeneity of regression test for the PALT outcome variable. Fifth, we checked for multicollinearity by assessing the pooled within cell...tolerance for each DV (PALT and CPARS). Multicollinearity is not an issue for our data. Finally, we checked for homogeneity of covariance matrices

  4. Changing environmental conditions in recent past — Reading through the study of geochemical characteristics, magnetic parameters and sedimentation rate of mudflats, central west coast of India

    Digital Repository Service at National Institute of Oceanography (India)

    Singh, K.T.; Nayak, G.N.; Fernandes, L.L.; Borole, D.V.; Basavaiah, N.

    ), +91 982 ak@unigoa.ac.in (G.N. Nayak). rights reserved.nt past — Reading through agnetic parameters and t coast of India a, D.V. Borole c, N. Basavaiah d matology, Palaeoecology ev ie r .com/ locate /pa laeorine sedimentation is usually a reasonably...

  5. Mobilities and dislocation energies of planar faults in an ordered ...

    Indian Academy of Sciences (India)

    ) with the point symmetry 6mm2 and. 6(h): (x, 2x, 1/4) with the point group symmetry .... formations of the fourth-order elasticity tensor (Cijkl) (see. Appendix B). 2.2 Vertical displacement. Vertical shift/dilation (dv) associated with various slip sys-.

  6. Numerical simulation of tsunami-scale wave boundary layers

    DEFF Research Database (Denmark)

    Williams, Isaac A.; Fuhrman, David R.

    2016-01-01

    This paper presents a numerical study of the boundary layer flow and properties induced by tsunami-scalewaves. For this purpose, an existing one-dimensional vertical (1DV) boundary layer model, based on the horizontal component of the incompressible Reynolds-averaged Navier–Stokes (RANS) equation...

  7. Zahraniční politika Japonska v 21. století

    OpenAIRE

    Mikšovská, Petra

    2017-01-01

    Foreign Policy plays an important role in setting of national interests and influences the position of the country in international relations. For a global power in the 21.century, as Japan, foreign policy setting means an important tool or building its position on international political scene. There are many factors incluencing directly creating of the foreing policy, this paper concentrates on teritorrial disputes with neighbor states of Japan - China, Russia, South Korea,that cause tensio...

  8. Rekonstrukce podoby hradu Křivoklátu v 13. století

    Czech Academy of Sciences Publication Activity Database

    Durdík, Tomáš

    45/115, 3-4 (2007), s. 251-254 ISSN 0027-5255 Grant - others:EU(DE) EU Culture 2000 CLT2005/A1/DE-492 Institutional research plan: CEZ:AV0Z80020508 Keywords : castle * castellology * Křivoklát * architecture * visualisation * medieval archaeology * Middle Ages * Bohemia Subject RIV: AC - Archeology, Anthropology, Ethnology

  9. Meče 11.-13. století z území Moravy

    Czech Academy of Sciences Publication Activity Database

    Žákovský, P.; Hošek, Jiří; Sedláčková, L.

    2013-01-01

    Roč. 38, č. 1 (2013), s. 219-270 ISSN 0231-5823 R&D Projects: GA ČR GAP405/12/2289 Institutional support: RVO:67985912 Keywords : sword * Middle Ages * Moravia Subject RIV: AC - Archeology, Anthropology, Ethnology

  10. Ze zlaté Prahy až do Chorvatska 19. století

    Czech Academy of Sciences Publication Activity Database

    Černý, Marcel

    2012-01-01

    Roč. 81, č. 4 (2012), s. 476-481 ISSN 0037-6736 Institutional support: RVO:68378017 Keywords : Czech literature * Croatian-Czech literary relations * Croatian literary journals * literary reception Subject RIV: AJ - Letters, Mass-media, Audiovision

  11. 2 year neurodevelopmental and intermediate perinatal outcomes in infants with very preterm fetal growth restriction (TRUFFLE) : A randomised trial

    NARCIS (Netherlands)

    Lees, Christoph C.; Marlow, Neil; Van Wassenaer-Leemhuis, Aleid; Arabin, Birgit; Bilardo, Caterina M.; Brezinka, Christoph; Calvert, Sandra; Derks, Jan B.; Diemert, Anke; Duvekot, Johannes J.; Ferrazzi, Enrico; Frusca, Tiziana; Ganzevoort, Wessel; Hecher, Kurt; Martinelli, Pasquale; Ostermayer, Eva; Papageorghiou, Aris T.; Schlembach, Dietmar; Schneider, K. T M; Thilaganathan, Baskaran; Todros, Tullia; Valcamonico, Adriana; Visser, Gerard H A; Wolf, Hans; Aktas, Ayse; Borgione, Silvia; Chaoui, Rabih; Cornette, Jerome M J; Diehl, Thilo; Van Eyck, Jim; Fratelli, Nicola; Van Haastert, Inge Lot; Lobmaier, Silvia; Lopriore, Enrico; Missfelder-Lobos, Hannah; Mansi, Giuseppina; Martelli, Paola; Maso, Gianpaolo; Maurer-Fellbaum, Ute; Van Charante, Nico Mensing; De Tollenaer, Susanne Mulder; Napolitano, Raffaele; Oberto, Manuela; Oepkes, Dick; Ogge, Giovanna; Van Der Post, Joris; Prefumo, Federico; Preston, Lucy; Raimondi, Francesco; Reiss, Irwin K M; Scheepers, H. C J; Schuit, Ewoud; Skabar, Aldo; Spaanderman, Marc; Weisglas-Kuperus, Nynke; Zimmermann, Andrea; Moore, Tamanna; Johnson, Samantha; Rigano, Serena

    2015-01-01

    Background: No consensus exists for the best way to monitor and when to trigger delivery in mothers of babies with fetal growth restriction. We aimed to assess whether changes in the fetal ductus venosus Doppler waveform (DV) could be used as indications for delivery instead of cardiotocography

  12. Knowledge and perception of domestic violence among primary ...

    African Journals Online (AJOL)

    Introduction: Domestic violence (DV) has a deteriorating influence on society by affecting victims, their children, families, and friends, as well as social and financial relationships. Primary care providers, including physicians and nurses, frequently are the first in the community to encounter the battered women. Objective: The ...

  13. Super-Ensemble Techniques: Application to Surface Drift Prediction During the DART06 and MREA07 Campaigns

    Science.gov (United States)

    2009-10-08

    Belgium b/sfiruro Nazionale di Oceanografia e di Geofisica sperimentaie (OCS), Trieste, Italy ’Service Hydrographique et Oceanographique de la Marine...13 me dv Chateltier. 29200 Brest, France d Istituto Nazionale di Geofisica e Vulcanologia. Bologna, Italy ’ Palazzo A.M., Viale dellVniversita’ 4

  14. Záboj, Slavoj a Lumír: Postavy bardů z Rukopisu královédvorského v české opeře

    Czech Academy of Sciences Publication Activity Database

    Fránek, Michal; Kopecký, J.

    2018-01-01

    Roč. 50, č. 1 (2018), s. 6-37 ISSN 0862-8505 Institutional support: RVO:68378068 Keywords : The Bards * Záboj * Slavoj * Lumír * Ossian * Opera * Libretto * Dvůr Králové Manscript Subject RIV: AJ - Letters, Mass-media, Audiovision OBOR OECD: Specific literatures

  15. 2 year neurodevelopmental and intermediate perinatal outcomes in infants with very preterm fetal growth restriction (TRUFFLE) : a randomised trial

    NARCIS (Netherlands)

    Lees, Christoph C.; Marlow, Neil; van Wassenaer-Leemhuis, Aleid; Arabin, Birgit; Bilardo, Caterina M.; Brezinka, Christoph; Calvert, Sandra; Derks, Jan B.; Diemert, Anke; Duvekot, Johannes J.; Ferrazzi, Enrico; Frusca, Tiziana; Ganzevoort, Wessel; Hecher, Kurt; Martinelli, Pasquale; Ostermayer, Eva; Papageorghiou, Aris T.; Schlembach, Dietmar; Schneider, K. T. M.; Thilaganathan, Baskaran; Todros, Tullia; Valcamonico, Adriana; Visser, G. H. A.; Wolf, Hans

    2015-01-01

    Background No consensus exists for the best way to monitor and when to trigger delivery in mothers of babies with fetal growth restriction. We aimed to assess whether changes in the fetal ductus venosus Doppler waveform (DV) could be used as indications for delivery instead of cardiotocography

  16. The Story of the Photon

    Indian Academy of Sciences (India)

    versal function of frequency and temperature, independent of the particular material ..... + In V -In E). (13). 8E. T. (3v. ' the dependences of SeE, V) on v and dv being left implicit. ... Note carefully the explicit mention that this refers to radiation in ...

  17. Comparison of Attitude of Primary Health Care Physicians and ...

    African Journals Online (AJOL)

    Background: Domestic violence (DV) against women has increased during the past few years and became an important public health problem. Personal values and beliefs of primary health care workers can affect both diagnostic and management procedures adopted to deal with battered women. Objectives: The current ...

  18. Ductus venosus Doppler and the postnatal outcomes of growth restricted fetuses with absent end-diastolic blood flow in the umbilical arteries

    Directory of Open Access Journals (Sweden)

    Nobuhiro Hidaka

    2017-10-01

    Conclusion: The time interval from initial detection of UA-AEDV to delivery is highly variable, and it is reasonable to manage these growth-restricted fetuses with UA-AEDV expectantly with careful surveillance for fetal well-being. Specifically, Doppler DV analysis is clinically valuable for their evaluation.

  19. Initial Laboratory-Scale Melter Test Results for Combined Fission Product Waste

    Energy Technology Data Exchange (ETDEWEB)

    Riley, Brian J.; Crum, Jarrod V.; Buchmiller, William C.; Rieck, Bennett T.; Schweiger, Michael J.; Vienna, John D.

    2009-10-01

    This report describes the methods and results used to vitrify a baseline glass, CSLNTM-C-2.5 in support of the AFCI (Advanced Fuel Cycle Initiative) using a Quartz Crucible Scale Melter at the Pacific Northwest National Laboratory. Document number AFCI-WAST-PMO-MI-DV-2009-000184.

  20. Deuterium isotope effects on toluene metabolism. Product release as a rate-limiting step in cytochrome P-450 catalysis

    International Nuclear Information System (INIS)

    Ling, K.H.; Hanzlik, R.P.

    1989-01-01

    Liver microsomes from phenobarbital-induced rats oxidize toluene to a mixture of benzyl alcohol plus o-, m- and p-cresol (ca. 69:31). Stepwise deuteration of the methyl group causes stepwise decreases in the yield of benzyl alcohol relative to cresols (ca. 24:76 for toluene-d3). For benzyl alcohol formation from toluene-d3 DV = 1.92 and D(V/K) = 3.53. Surprisingly, however, stepwise deuteration induces stepwise increases in total oxidation, giving rise to an inverse isotope effect overall (DV = 0.67 for toluene-d3). Throughout the series (i.e. d0, d1, d2, d3) the ratios of cresol isomers remain constant. These results are interpreted in terms of product release for benzyl alcohol being slower than release of cresols (or their epoxide precursors), and slow enough to be partially rate-limiting in turnover. Thus metabolic switching to cresol formation causes a net acceleration of turnover

  1. State Equation Determination of Cow Dung Biogas

    Science.gov (United States)

    Marzuki, A.; Wicaksono, L. B.

    2017-08-01

    A state function is a thermodynamic function which relates various macroscopically measurable properties of a system (state variable) describing the state of matter under a given set of physical conditions. A good understanding of a biogas state function plays a very important role in an effort to maximize biogas processes and to help predicting combation performance. This paper presents a step by step process of an experimental study aimed at determining the equation of state of cow dung biogas. The equation was derived from the data obtained from the experimental results of compressibility (κ) and expansivity (β) following the general form of gas state equation dV = βdT + κdP. In this equation, dV is gas volume variation, dT is temperature variation, and dP is pressure variation. From these results, we formulated a unique state equation from which the biogas critical temperature (Tc) and critical pressure were then determined (Tc = 266.7 K, Pc = 5096647.5 Pa).

  2. Size distribution of magnetic iron oxide nanoparticles using Warren-Averbach XRD analysis

    Science.gov (United States)

    Mahadevan, S.; Behera, S. P.; Gnanaprakash, G.; Jayakumar, T.; Philip, J.; Rao, B. P. C.

    2012-07-01

    We use the Fourier transform based Warren-Averbach (WA) analysis to separate the contributions of X-ray diffraction (XRD) profile broadening due to crystallite size and microstrain for magnetic iron oxide nanoparticles. The profile shape of the column length distribution, obtained from WA analysis, is used to analyze the shape of the magnetic iron oxide nanoparticles. From the column length distribution, the crystallite size and its distribution are estimated for these nanoparticles which are compared with size distribution obtained from dynamic light scattering measurements. The crystallite size and size distribution of crystallites obtained from WA analysis are explained based on the experimental parameters employed in preparation of these magnetic iron oxide nanoparticles. The variation of volume weighted diameter (Dv, from WA analysis) with saturation magnetization (Ms) fits well to a core shell model wherein it is known that Ms=Mbulk(1-6g/Dv) with Mbulk as bulk magnetization of iron oxide and g as magnetic shell disorder thickness.

  3. Image quality in conventional chest radiography. Evaluation using the postprocessing tool Diamond View

    International Nuclear Information System (INIS)

    Niemann, Tilo; Reisinger, Clemens; Rau, Philipp; Schwarz, Jochen; Ruis-Lopez, Laura; Bongartz, Georg

    2010-01-01

    The objective of this work was to evaluate the influence of the postprocessing tool Diamond View (Siemens AG Medical Solutions, Germany) on image quality in conventional chest radiography. Evaluation of image quality remains a challenge in conventional radiography. Based on the European Commission quality criteria we evaluated the improvement of image quality when applying the new postprocessing tool Diamond View (Siemens AG Medical solutions, Germany) to conventional chest radiographs. Three different readers prospectively evaluated 102 digital image pairs of chest radiographs. Statistical analysis was performed with a p value <0.05 considered as significant. Images were evaluated on basis of the modified imaging Quality Criteria by the Commission of the European Communities. Each of the 11 image quality criteria was evaluated separately using a five point classification. Statistical analysis showed an overall tendency for improved image quality for Diamond View (DV) for all criteria. Significant differences could be found in most of the criteria. In conclusion DV improves image quality in conventional chest radiographs.

  4. Federated software defined network operations for LHC experiments

    Science.gov (United States)

    Kim, Dongkyun; Byeon, Okhwan; Cho, Kihyeon

    2013-09-01

    The most well-known high-energy physics collaboration, the Large Hadron Collider (LHC), which is based on e-Science, has been facing several challenges presented by its extraordinary instruments in terms of the generation, distribution, and analysis of large amounts of scientific data. Currently, data distribution issues are being resolved by adopting an advanced Internet technology called software defined networking (SDN). Stability of the SDN operations and management is demanded to keep the federated LHC data distribution networks reliable. Therefore, in this paper, an SDN operation architecture based on the distributed virtual network operations center (DvNOC) is proposed to enable LHC researchers to assume full control of their own global end-to-end data dissemination. This may achieve an enhanced data delivery performance based on data traffic offloading with delay variation. The evaluation results indicate that the overall end-to-end data delivery performance can be improved over multi-domain SDN environments based on the proposed federated SDN/DvNOC operation framework.

  5. Molecular regionalization of the developing amphioxus neural tube challenges major partitions of the vertebrate brain.

    Science.gov (United States)

    Albuixech-Crespo, Beatriz; López-Blanch, Laura; Burguera, Demian; Maeso, Ignacio; Sánchez-Arrones, Luisa; Moreno-Bravo, Juan Antonio; Somorjai, Ildiko; Pascual-Anaya, Juan; Puelles, Eduardo; Bovolenta, Paola; Garcia-Fernàndez, Jordi; Puelles, Luis; Irimia, Manuel; Ferran, José Luis

    2017-04-01

    All vertebrate brains develop following a common Bauplan defined by anteroposterior (AP) and dorsoventral (DV) subdivisions, characterized by largely conserved differential expression of gene markers. However, it is still unclear how this Bauplan originated during evolution. We studied the relative expression of 48 genes with key roles in vertebrate neural patterning in a representative amphioxus embryonic stage. Unlike nonchordates, amphioxus develops its central nervous system (CNS) from a neural plate that is homologous to that of vertebrates, allowing direct topological comparisons. The resulting genoarchitectonic model revealed that the amphioxus incipient neural tube is unexpectedly complex, consisting of several AP and DV molecular partitions. Strikingly, comparison with vertebrates indicates that the vertebrate thalamus, pretectum, and midbrain domains jointly correspond to a single amphioxus region, which we termed Di-Mesencephalic primordium (DiMes). This suggests that these domains have a common developmental and evolutionary origin, as supported by functional experiments manipulating secondary organizers in zebrafish and mice.

  6. Radionuclide angiocardiography in the normal dog: first-pass studies

    Energy Technology Data Exchange (ETDEWEB)

    Brom, W.E. van den; Stokhof, A.A. (Utrecht Univ. (Netherlands). Dept. of Clinical Sciences of Companion Animals)

    1989-11-01

    The first pass of a bolus of radioactivity ({sup 99m}Tc) through the heart and lungs was studied in 27 anaesthetised healthy adult mongrel dogs, using a gamma camera with a computer on-line. Bodyweights ranged from 9 to 60 kg, heart rate from 108 to 150 beats min{sup -1}. Quantitative analysis revealed that the distribution volume (DV) of the labelled blood, the cardiac output (CO), the stroke volume (SV) and pulmonary blood volume (PBV) were almost proportional to the bodyweight. Specific results were: DV 120 ml kg{sup -1}, CO 136 ml kg{sup -1}, SV 1.11 ml kg{sup -1}, PBV 6.9 ml kg{sup -1}. The pulmonary transit time varied between 1.0 and 3.6 seconds. Clinical applicability of the method, including visual inspection of camera images and quantitative analysis of a time-activity curve of the lung, was demonstrated for one dog with an aortic stenosis and another with a left-to-right shunt. (author).

  7. Platelet factor 4 activity against P. falciparum and its translation to nonpeptidic mimics as antimalarials.

    Science.gov (United States)

    Love, Melissa S; Millholland, Melanie G; Mishra, Satish; Kulkarni, Swapnil; Freeman, Katie B; Pan, Wenxi; Kavash, Robert W; Costanzo, Michael J; Jo, Hyunil; Daly, Thomas M; Williams, Dewight R; Kowalska, M Anna; Bergman, Lawrence W; Poncz, Mortimer; DeGrado, William F; Sinnis, Photini; Scott, Richard W; Greenbaum, Doron C

    2012-12-13

    Plasmodium falciparum pathogenesis is affected by various cell types in the blood, including platelets, which can kill intraerythrocytic malaria parasites. Platelets could mediate these antimalarial effects through human defense peptides (HDPs), which exert antimicrobial effects by permeabilizing membranes. Therefore, we screened a panel of HDPs and determined that human platelet factor 4 (hPF4) kills malaria parasites inside erythrocytes by selectively lysing the parasite digestive vacuole (DV). PF4 rapidly accumulates only within infected erythrocytes and is required for parasite killing in infected erythrocyte-platelet cocultures. To exploit this antimalarial mechanism, we tested a library of small, nonpeptidic mimics of HDPs (smHDPs) and identified compounds that kill P. falciparum by rapidly lysing the parasite DV while sparing the erythrocyte plasma membrane. Lead smHDPs also reduced parasitemia in a murine malaria model. Thus, identifying host molecules that control parasite growth can further the development of related molecules with therapeutic potential. Copyright © 2012 Elsevier Inc. All rights reserved.

  8. Reliability of the Life Satisfaction Questionnaire to assess patients with chronic musculoskeletal pain

    NARCIS (Netherlands)

    Boonstra, Anne M.; Reneman, Michiel F.; Posthumus, Jitze B.; Stewart, Roy E.; Schiphorst Preuper, Henrica R.

    The aim of this study was to determine the reliability of the Life Satisfaction Questionnaire, Dutch version (LSQ-DV), to assess chronic pain patients. The study was designed as test-retest. The setting was the general rehabilitation centre. There were 51 patients over 18 years of age, suffering

  9. Knowledge of primary care nurses regarding domestic violence ...

    African Journals Online (AJOL)

    Introduction: Domestic violence (DV) against women has been identified as a serious public health problem. Primary care nurses usually play an important role in managing battered women. They must be equipped with the necessary knowledge, training and experience. Objective: The aim of this work was to study the ...

  10. 21 CFR 101.45 - Guidelines for the voluntary nutrition labeling of raw fruits, vegetables, and fish.

    Science.gov (United States)

    2010-04-01

    ... cooked edible portion for fish. The methods used to cook fish should be those that do not add fat... plainly legible, with numeric values for percent of DV highlighted in contrast to the quantitative amounts..., analytical methods, and statistical treatment of the data. Proposed quantitative label declarations may be...

  11. Addressing domestic violence in primary care: what the physician ...

    African Journals Online (AJOL)

    2014-03-14

    Mar 14, 2014 ... stance abuse, suicidal behavior, somatizing disorders, eating disorders, and ... anxiety disorders, and PTSD are at a higher risk of experiencing adult ... reported by mental health and primary care professionals. (29) included ... about the nature and course of DV and assessing the level of readiness to ...

  12. Chemical potential and internal energy of the noninteracting Fermi ...

    Indian Academy of Sciences (India)

    entropy by T, dV is the change in volume by p and µ is the chemical potential. When S .... thin films are actually not 2D objects, but fractals with Hausdorff dimensionalities between 2D ..... sharpness of the edge of the Fermi surface is lost. In the ...

  13. African Journal of Aquatic Science - Vol 34, No 2 (2009)

    African Journals Online (AJOL)

    ... of tissue nitrogen in cultivated Gracilaria gracilis (Rhodophyta) and Ulva lactuca (Chlorophyta) · EMAIL FULL TEXT EMAIL FULL TEXT DOWNLOAD FULL TEXT DOWNLOAD FULL TEXT. DV Robertson-Andersson, DT Wilson, JJ Bolton, RJ Anderson, GW Maneveldt. http://dx.doi.org/10.2989/AJAS.2009.34.2.7.894 ...

  14. Recognizing and reporting domestic violence: attitudes, experiences and behavior of Dutch dentists

    NARCIS (Netherlands)

    van Dam, B.A.F.M.; van der Sanden, W.J.M.; Bruers, J.J.M.

    2015-01-01

    Background On July 1st 2013 the Mandatory Reporting Code Act came into force in the Netherlands, making it compulsory for health professionals to adhere to a reporting code when they suspect patients to be victims of domestic violence (DV) or child abuse (CA). The Royal Dutch Dental Association

  15. Response of water vapour D-excess to land-atmosphere interactions in a semi-arid environment

    KAUST Repository

    Parkes, Stephen; McCabe, Matthew; Griffiths, Alan D.; Wang, Lixin; Chambers, Scott; Ershadi, Ali; Williams, Alastair G; Strauss, Josiah; Element, Adrian

    2016-01-01

    nocturnal inversion layer caused a lowering of dv values near the surface. In addition, transient mixing of vapour with a higher D-excess from above the nocturnal inversion modified these values, causing large variability during the night. These results indicate dET can generally be expected to show

  16. Net-proton measurements at RHIC and the quantum ...

    Indian Academy of Sciences (India)

    net-proton midrapidity dv1/dy, where v1 and y are directed flow and rapidity, respectively, shows non-monotonic ... inviscid liquid property of QGP and has a value of (1–2)/4π [3,4]. ... In §3 we present the experimental results on the directed ...

  17. Examining the Preliminary Efficacy of a Dating Violence Prevention Program for Hispanic Adolescents

    Science.gov (United States)

    Gonzalez-Guarda, Rosa Maria; Guerra, Jessica E.; Cummings, Amanda A.; Pino, Karen; Becerra, Maria M.

    2015-01-01

    The purpose of this study is to evaluate the preliminary efficacy of a dating violence (DV) prevention program for Cuban American adolescents ("JOVEN"/YOUTH: "Juntos Opuestos a la Violence Entre Novios"/Together Against Dating Violence). A randomized-controlled experimental design with a delayed condition was used to evaluate…

  18. Factors That Contribute to the Improvement in Maternal Parenting after Separation from a Violent Husband or Partner

    Science.gov (United States)

    Fujiwara, Takeo; Okuyama, Makiko; Izumi, Mayuko

    2012-01-01

    The authors test the hypothesis that separation from a violent husband or partner improves maternal parenting in Japan and examine how childhood abuse history (CAH), experience of domestic violence (DV), mental health problems, husband or partner's child maltreatment, and other demographic factors affect maternal parenting after such separation. A…

  19. Dicty_cDB: Contig-U16346-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 1 ( DV865969 ) CRP5701 Creeping bentgrass EST Agrostis stolonife... 44 8.6 1 ( D...04_028 O. Alba 47RDOAH ... 44 8.6 1 ( DW230377 ) GH_OVfbl_01-01-10R_A06_InvR_28Jan04_048_R Ovules ... 44 8.6

  20. Hox paralog group 2 genes control the migration of mouse pontine neurons through slit-robo signaling.

    Directory of Open Access Journals (Sweden)

    Marc J Geisen

    2008-06-01

    Full Text Available The pontine neurons (PN represent a major source of mossy fiber projections to the cerebellum. During mouse hindbrain development, PN migrate tangentially and sequentially along both the anteroposterior (AP and dorsoventral (DV axes. Unlike DV migration, which is controlled by the Netrin-1/Dcc attractive pathway, little is known about the molecular mechanisms guiding PN migration along the AP axis. Here, we show that Hoxa2 and Hoxb2 are required both intrinsically and extrinsically to maintain normal AP migration of subsets of PN, by preventing their premature ventral attraction towards the midline. Moreover, the migration defects observed in Hoxa2 and Hoxb2 mutant mice were phenocopied in compound Robo1;Robo2, Slit1;Slit2, and Robo2;Slit2 knockout animals, indicating that these guidance molecules act downstream of Hox genes to control PN migration. Indeed, using chromatin immunoprecipitation assays, we further demonstrated that Robo2 is a direct target of Hoxa2 in vivo and that maintenance of high Robo and Slit expression levels was impaired in Hoxa2 mutant mice. Lastly, the analysis of Phox2b-deficient mice indicated that the facial motor nucleus is a major Slit signaling source required to prevent premature ventral migration of PN. These findings provide novel insights into the molecular control of neuronal migration from transcription factor to regulation of guidance receptor and ligand expression. Specifically, they address the question of how exposure to multiple guidance cues along the AP and DV axes is regulated at the transcriptional level and in turn translated into stereotyped migratory responses during tangential migration of neurons in the developing mammalian brain.