WorldWideScience

Sample records for durch rhodopseudomonas palustris

  1. Photometabolism of Heterocyclic Aromatic Compounds by Rhodopseudomonas palustris OU 11

    Science.gov (United States)

    Sasikala, C.; Ramana, C. V.; Rao, P. Raghuveer

    1994-01-01

    Rhodopseudomonas palustris OU 11 (ATCC 51186; DSM 7375) isolated from a pond of chemical industry effluent could anaerobically photometabolize heterocyclic aromatic compounds belonging to the pyridine and pyrazine groups only after a period of adaptation on pyrazinoic acid of 5 to 6 weeks. Growth on heterocyclic compounds was light dependent. The effects of various concentrations of heterocyclic compounds on growth suggest that higher concentrations of these compounds inhibit growth and are toxic. PMID:16349307

  2. Acclimation strategy of Rhodopseudomonas palustris to high light irradiance.

    Science.gov (United States)

    Muzziotti, Dayana; Adessi, Alessandra; Faraloni, Cecilia; Torzillo, Giuseppe; De Philippis, Roberto

    2017-04-01

    The ability of Rhodopseudomonas palustris cells to rapidly acclimate to high light irradiance is an essential issue when cells are grown under sunlight. The aim of this study was to investigate the photo-acclimation process in Rhodopseudomonas palustris 42OL under different culturing conditions: (i) anaerobic (AnG), (ii) aerobic (AG), and (iii) under H 2 -producing (HP) conditions both at low (LL) and high light (HL) irradiances. The results obtained clearly showed that the photosynthetic unit was significantly affected by the light irradiance at which Rp. palustris 42OL was grown. The synthesis of carotenoids was affected by both illumination and culturing conditions. At LL, lycopene was the main carotenoid synthetized under all conditions tested, while at HL under HP conditions, it resulted the predominant carotenoid. Oppositely, under AnG and AG at HL, rhodovibrin was the major carotenoid detected. The increase in light intensity produced a deeper variation in light-harvesting complexes (LHC) ratio. These findings are important for understanding the ecological distribution of PNSB in natural environments, mostly characterized by high light intensities, and for its growth outdoors. Copyright © 2017 Elsevier GmbH. All rights reserved.

  3. Final report: 'Rhodopseudomonas palustris' genome workshop to be held in Spring of 2001; FINAL

    International Nuclear Information System (INIS)

    Harwood, Caroline S.

    2002-01-01

    The 'Rhodopseudomonas palustris' genome workshop took place in Iowa City on April 6-8, 2001. The purpose of the meeting was to instruct members of the annotation working group in approaches to accomplishing the 'human' phase of the 'R. palustris' genome annotation. A partial draft of a paper describing the 'Rhodopseudomonas palustris' genome has been written and a full version of the paper should be ready for submission by the end of the summer 2002

  4. The anaerobic phototrophic metabolism of 3-chlorobenzoate by Rhodopseudomonas palustris

    Energy Technology Data Exchange (ETDEWEB)

    Kamal, V S

    1992-10-09

    The degradation of chlorinated aromatic compounds by anaerobic bacteria is now known to be an important mechanism of bioremediation. In an experimental study, a mixed phototrophic culture was found to metabolize 3-chlorobenzoate in the presence of benzoate following adaptation on a benzoate and 3-chlorobenzoate medium for 7 weeks. The dominant bacterial isolate was identified as Rhodopseudomonas palustris. Radioisotopic studies showed [sup 14]C-3-chlorobenzoate was converted by the isolate to [sup 14]CO[sub 2] and cell biomass in the absence of oxygen and in the presence of a cosubstrate red light. Cyclohexane carboxylate was able to replace the cosubstrate, benzoate. The isolate also metabolized 3-chlorobenzoate in the presence of pimelic acid, sodium acetate, and sodium succinate; however, the metabolic rate was reduced. Gas chromatography mass spectrometry and high pressure liquid chromatography indicated the intracellular presence of 3-chlorobenzoate and benzoyl-CoA. Cell-free extracts produced benzoate and benzoyl-CoA. A probable route of 3-chlorobenzoate metabolism via dehalogenation followed by steps similar to the benzoate reductive ring fission pathway is suggested. Comparison of kinetic coefficients showed a higher affinity of the isolate for benzoate. Isolates from representative samples of various freshwater and wastewater ecosystems indicated widespread ecological distribution of R. palustris and the common occurrence of the 3-chlorobenzoate metabolic phenotype. R. palustris was found to grow in mixed anaerobic cultures and retained its 3-chlorobenzoate degradation property. 91 refs., 25 figs., 14 tabs.

  5. Acquisition of the ability for Rhodopseudomonas palustris to degrade chlorinated benzoic acids as the sole carbon source

    NARCIS (Netherlands)

    Oda, Y; de Vries, YP; Forney, LJ; Gottschal, JC

    2001-01-01

    Three strains of Rhodopseudomonas palustris were isolated from phototrophic enrichment cultures containing 3-chlorobenzoate (3-CBA) and benzoate (BA). These new strains as well as several previously described strains of R. palustris were tested in this study and shown to degrade 3-CBA if grown in

  6. Revealing the functions of the transketolase enzyme isoforms in Rhodopseudomonas palustris using a systems biology approach.

    Directory of Open Access Journals (Sweden)

    Chia-Wei Hu

    Full Text Available BACKGROUND: Rhodopseudomonas palustris (R. palustris is a purple non-sulfur anoxygenic phototrophic bacterium that belongs to the class of proteobacteria. It is capable of absorbing atmospheric carbon dioxide and converting it to biomass via the process of photosynthesis and the Calvin-Benson-Bassham (CBB cycle. Transketolase is a key enzyme involved in the CBB cycle. Here, we reveal the functions of transketolase isoforms I and II in R. palustris using a systems biology approach. METHODOLOGY/PRINCIPAL FINDINGS: By measuring growth ability, we found that transketolase could enhance the autotrophic growth and biomass production of R. palustris. Microarray and real-time quantitative PCR revealed that transketolase isoforms I and II were involved in different carbon metabolic pathways. In addition, immunogold staining demonstrated that the two transketolase isoforms had different spatial localizations: transketolase I was primarily associated with the intracytoplasmic membrane (ICM but transketolase II was mostly distributed in the cytoplasm. Comparative proteomic analysis and network construction of transketolase over-expression and negative control (NC strains revealed that protein folding, transcriptional regulation, amino acid transport and CBB cycle-associated carbon metabolism were enriched in the transketolase I over-expressed strain. In contrast, ATP synthesis, carbohydrate transport, glycolysis-associated carbon metabolism and CBB cycle-associated carbon metabolism were enriched in the transketolase II over-expressed strain. Furthermore, ATP synthesis assays showed a significant increase in ATP synthesis in the transketolase II over-expressed strain. A PEPCK activity assay showed that PEPCK activity was higher in transketolase over-expressed strains than in the negative control strain. CONCLUSIONS/SIGNIFICANCE: Taken together, our results indicate that the two isoforms of transketolase in R. palustris could affect photoautotrophic growth

  7. Effects of metal ions on biomass and 5-aminolevulinic acid production in Rhodopseudomonas palustris wastewater treatment.

    Science.gov (United States)

    Liu, Shuli; Zhang, Guangming; Li, Jianzheng; Li, Xiangkun; Zhang, Jie

    2016-01-01

    This work investigated the effects of eight metal ions on Rhodopseudomonas palustris growth and 5-aminolevulinic acid (ALA) yield in wastewater treatment. Results show that metal ions (Mg(2+) of 15 mmol/L, Fe(2+) of 400 μmol/L, Co(2+) of 4 μmol/L, Ni(2+) of 8 μmol/L and Zn(2+) of 4 μmol/L) could effectively improve the chemical oxygen demand (COD) removal, Rp. palustris biomass and ALA yield. The highest ALA yield of 13.1 mg/g-biomass was achieved with Fe(2+) of 400 μmol/L. ALA yields were differentially increased under different metal ions in the following order: Fe(2+) group > Mg(2+) group > Co(2+) group = Ni(2+) group > Zn(2+) group = Mo(2+) group > control. Cu(2+) and Mn(2+) inhibited Rp. palustris growth and ALA production. Mechanism analysis revealed that metal ions changed ALA yields by influencing the activities of ALA synthetase and ALA dehydratase.

  8. Uranium interaction with two multi-resistant environmental bacteria: Cupriavidus metallidurans CH34 and Rhodopseudomonas palustris.

    Science.gov (United States)

    Llorens, Isabelle; Untereiner, Guillaume; Jaillard, Danielle; Gouget, Barbara; Chapon, Virginie; Carriere, Marie

    2012-01-01

    Depending on speciation, U environmental contamination may be spread through the environment or inversely restrained to a limited area. Induction of U precipitation via biogenic or non-biogenic processes would reduce the dissemination of U contamination. To this aim U oxidation/reduction processes triggered by bacteria are presently intensively studied. Using X-ray absorption analysis, we describe in the present article the ability of Cupriavidus metallidurans CH34 and Rhodopseudomonas palustris, highly resistant to a variety of metals and metalloids or to organic pollutants, to withstand high concentrations of U and to immobilize it either through biosorption or through reduction to non-uraninite U(IV)-phosphate or U(IV)-carboxylate compounds. These bacterial strains are thus good candidates for U bioremediation strategies, particularly in the context of multi-pollutant or mixed-waste contaminations.

  9. Uranium Interaction with Two Multi-Resistant Environmental Bacteria: Cupriavidus metallidurans CH34 and Rhodopseudomonas palustris

    Science.gov (United States)

    Llorens, Isabelle; Untereiner, Guillaume; Jaillard, Danielle; Gouget, Barbara; Chapon, Virginie; Carriere, Marie

    2012-01-01

    Depending on speciation, U environmental contamination may be spread through the environment or inversely restrained to a limited area. Induction of U precipitation via biogenic or non-biogenic processes would reduce the dissemination of U contamination. To this aim U oxidation/reduction processes triggered by bacteria are presently intensively studied. Using X-ray absorption analysis, we describe in the present article the ability of Cupriavidus metallidurans CH34 and Rhodopseudomonas palustris, highly resistant to a variety of metals and metalloids or to organic pollutants, to withstand high concentrations of U and to immobilize it either through biosorption or through reduction to non-uraninite U(IV)-phosphate or U(IV)-carboxylate compounds. These bacterial strains are thus good candidates for U bioremediation strategies, particularly in the context of multi-pollutant or mixed-waste contaminations. PMID:23251623

  10. How Posttranslational Modification of Nitrogenase Is Circumvented in Rhodopseudomonas palustris Strains That Produce Hydrogen Gas Constitutively

    Science.gov (United States)

    Heiniger, Erin K.; Oda, Yasuhiro; Samanta, Sudip K.

    2012-01-01

    Nitrogenase catalyzes the conversion of dinitrogen gas (N2) and protons to ammonia and hydrogen gas (H2). This is a catalytically difficult reaction that requires large amounts of ATP and reducing power. Thus, nitrogenase is not normally expressed or active in bacteria grown with a readily utilized nitrogen source like ammonium. nifA* mutants of the purple nonsulfur phototrophic bacterium Rhodopseudomonas palustris have been described that express nitrogenase genes constitutively and produce H2 when grown with ammonium as a nitrogen source. This raised the regulatory paradox of why these mutants are apparently resistant to a known posttranslational modification system that should switch off the activity of nitrogenase. Microarray, mutation analysis, and gene expression studies showed that posttranslational regulation of nitrogenase activity in R. palustris depends on two proteins: DraT2, an ADP-ribosyltransferase, and GlnK2, an NtrC-regulated PII protein. GlnK2 was not well expressed in ammonium-grown NifA* cells and thus not available to activate the DraT2 nitrogenase modification enzyme. In addition, the NifA* strain had elevated nitrogenase activity due to overexpression of the nif genes, and this increased amount of expression overwhelmed a basal level of activity of DraT2 in ammonium-grown cells. Thus, insufficient levels of both GlnK2 and DraT2 allow H2 production by an nifA* mutant grown with ammonium. Inactivation of the nitrogenase posttranslational modification system by mutation of draT2 resulted in increased H2 production by ammonium-grown NifA* cells. PMID:22179236

  11. Two Distinct Aerobic Methionine Salvage Pathways Generate Volatile Methanethiol in Rhodopseudomonas palustris

    Science.gov (United States)

    Miller, Anthony R.; North, Justin A.; Wildenthal, John A.

    2018-01-01

    ABSTRACT 5′-Methyl-thioadenosine (MTA) is a dead-end, sulfur-containing metabolite and cellular inhibitor that arises from S-adenosyl-l-methionine-dependent reactions. Recent studies have indicated that there are diverse bacterial methionine salvage pathways (MSPs) for MTA detoxification and sulfur salvage. Here, via a combination of gene deletions and directed metabolite detection studies, we report that under aerobic conditions the facultatively anaerobic bacterium Rhodopseudomonas palustris employs both an MTA-isoprenoid shunt identical to that previously described in Rhodospirillum rubrum and a second novel MSP, both of which generate a methanethiol intermediate. The additional R. palustris aerobic MSP, a dihydroxyacetone phosphate (DHAP)-methanethiol shunt, initially converts MTA to 2-(methylthio)ethanol and DHAP. This is identical to the initial steps of the recently reported anaerobic ethylene-forming MSP, the DHAP-ethylene shunt. The aerobic DHAP-methanethiol shunt then further metabolizes 2-(methylthio)ethanol to methanethiol, which can be directly utilized by O-acetyl-l-homoserine sulfhydrylase to regenerate methionine. This is in contrast to the anaerobic DHAP-ethylene shunt, which metabolizes 2-(methylthio)ethanol to ethylene and an unknown organo-sulfur intermediate, revealing functional diversity in MSPs utilizing a 2-(methylthio)ethanol intermediate. When MTA was fed to aerobically growing cells, the rate of volatile methanethiol release was constant irrespective of the presence of sulfate, suggesting a general housekeeping function for these MSPs up through the methanethiol production step. Methanethiol and dimethyl sulfide (DMS), two of the most important compounds of the global sulfur cycle, appear to arise not only from marine ecosystems but from terrestrial ones as well. These results reveal a possible route by which methanethiol might be biologically produced in soil and freshwater environments. PMID:29636438

  12. Hydrogen production under salt stress conditions by a freshwater Rhodopseudomonas palustris strain.

    Science.gov (United States)

    Adessi, Alessandra; Concato, Margherita; Sanchini, Andrea; Rossi, Federico; De Philippis, Roberto

    2016-03-01

    Hydrogen represents a possible alternative energy carrier to face the growing request for energy and the shortage of fossil fuels. Photofermentation for the production of H2 constitutes a promising way for integrating the production of energy with waste treatments. Many wastes are characterized by high salinity, and polluted seawater can as well be considered as a substrate. Moreover, the application of seawater for bacterial culturing is considered cost-effective. The aims of this study were to assess the capability of the metabolically versatile freshwater Rhodopseudomonas palustris 42OL of producing hydrogen on salt-containing substrates and to investigate its salt stress response strategy, never described before. R. palustris 42OL was able to produce hydrogen in media containing up to 3 % added salt concentration and to grow in media containing up to 4.5 % salinity without the addition of exogenous osmoprotectants. While the hydrogen production performances in absence of sea salts were higher than in their presence, there was no significant difference in performances between 1 and 2 % of added sea salts. Nitrogenase expression levels indicated that the enzyme was not directly inhibited during salt stress, but a regulation of its expression may have occurred in response to salt concentration increase. During cell growth and hydrogen production in the presence of salts, trehalose was accumulated as a compatible solute; it protected the enzymatic functionality against salt stress, thus allowing hydrogen production. The possibility of producing hydrogen on salt-containing substrates widens the range of wastes that can be efficiently used in production processes.

  13. Sequence Analysis of the Cryptic Plasmid pMG101 from Rhodopseudomonas palustris and Construction of Stable Cloning Vectors

    Science.gov (United States)

    Inui, Masayuki; Roh, Jung Hyeob; Zahn, Kenneth; Yukawa, Hideaki

    2000-01-01

    A 15-kb cryptic plasmid was obtained from a natural isolate of Rhodopseudomonas palustris. The plasmid, designated pMG101, was able to replicate in R. palustris and in closely related strains of Bradyrhizobium japonicum and phototrophic Bradyrhizobium species. However, it was unable to replicate in the purple nonsulfur bacterium Rhodobacter sphaeroides and in Rhizobium species. The replication region of pMG101 was localized to a 3.0-kb SalI-XhoI fragment, and this fragment was stably maintained in R. palustris for over 100 generations in the absence of selection. The complete nucleotide sequence of this fragment revealed two open reading frames (ORFs), ORF1 and ORF2. The deduced amino acid sequence of ORF1 is similar to sequences of Par proteins, which mediate plasmid stability from certain plasmids, while ORF2 was identified as a putative rep gene, coding for an initiator of plasmid replication, based on homology with the Rep proteins of several other plasmids. The function of these sequences was studied by deletion mapping and gene disruptions of ORF1 and ORF2. pMG101-based Escherichia coli-R. palustris shuttle cloning vectors pMG103 and pMG105 were constructed and were stably maintained in R. palustris growing under nonselective conditions. The ability of plasmid pMG101 to replicate in R. palustris and its close phylogenetic relatives should enable broad application of these vectors within this group of α-proteobacteria. PMID:10618203

  14. Hydrogen production using Rhodopseudomonas palustris WP 3-5 with hydrogen fermentation reactor effluent

    International Nuclear Information System (INIS)

    Chi-Mei Lee; Kuo-Tsang Hung

    2006-01-01

    The possibility of utilizing the dark hydrogen fermentation stage effluents for photo hydrogen production using purple non-sulfur bacteria should be elucidated. In the previous experiments, Rhodopseudomonas palustris WP3-5 was proven to efficiently produce hydrogen from the effluent of hydrogen fermentation reactors. The highest hydrogen production rate was obtained at a HRT value of 48 h when feeding a 5 fold effluent dilution from anaerobic hydrogen fermentation. Besides, hydrogen production occurred only when the NH 4 + concentration was below 17 mg-NH 4 + /l. Therefore, for successful fermentation effluent utilization, the most important things were to decrease the optimal HRT, increase the optimal substrate concentration and increase the tolerable ammonia concentration. In this study, a lab-scale serial photo-bioreactor was constructed. The reactor overall hydrogen production efficiency with synthetic wastewater exhibiting an organic acid profile identical to that of anaerobic hydrogen fermentation reactor effluent and with effluent from two anaerobic hydrogen fermentation reactors was evaluated. (authors)

  15. Optimization of phototrophic hydrogen production by Rhodopseudomonas palustris PBUM001 via statistical experimental design

    Energy Technology Data Exchange (ETDEWEB)

    Jamil, Zadariana [Department of Civil Engineering, Faculty of Engineering, University of Malaya (Malaysia); Faculty of Civil Engineering, Technology University of MARA (Malaysia); Mohamad Annuar, Mohamad Suffian; Vikineswary, S. [Institute of Biological Sciences, University of Malaya (Malaysia); Ibrahim, Shaliza [Department of Civil Engineering, Faculty of Engineering, University of Malaya (Malaysia)

    2009-09-15

    Phototrophic hydrogen production by indigenous purple non-sulfur bacteria, Rhodopseudomonas palustris PBUM001 from palm oil mill effluent (POME) was optimized using response surface methodology (RSM). The process parameters studied include inoculum sizes (% v/v), POME concentration (% v/v), light intensity (klux), agitation (rpm) and pH. The experimental data on cumulative hydrogen production and COD reduction were fitted into a quadratic polynomial model using response surface regression analysis. The path to optimal process conditions was determined by analyzing response surface three-dimensional surface plot and contour plot. Statistical analysis on experimental data collected following Box-Behnken design showed that 100% (v/v) POME concentration, 10% (v/v) inoculum size, light intensity at 4.0 klux, agitation rate at 250 rpm and pH of 6 were the best conditions. The maximum predicted cumulative hydrogen production and COD reduction obtained under these conditions was 1.05 ml H{sub 2}/ml POME and 31.71% respectively. Subsequent verification experiments at optimal process values gave the maximum yield of cumulative hydrogen at 0.66 {+-} 0.07 ml H{sub 2}/ml POME and COD reduction at 30.54 {+-} 9.85%. (author)

  16. Arsenic-Redox Transformation and Plant Growth Promotion by Purple Nonsulfur Bacteria Rhodopseudomonas palustris CS2 and Rhodopseudomonas faecalis SS5.

    Science.gov (United States)

    Batool, Kanza; Tuz Zahra, Fatima; Rehman, Yasir

    2017-01-01

    Arsenic (As) is a well-known toxic metalloid found naturally and released by different industries, especially in developing countries. Purple nonsulfur bacteria (PNSB) are known for wastewater treatment and plant growth promoting abilities. As-resistant PNSB were isolated from a fish pond. Based on As-resistance and plant growth promoting attributes, 2 isolates CS2 and SS5 were selected and identified as Rhodopseudomonas palustris and Rhodopseudomonas faecalis , respectively, through 16S rRNA gene sequencing. Maximum As(V) resistance shown by R. faecalis SS5 and R. palustris CS2 was up to 150 and 100 mM, respectively. R . palustris CS2 showed highest As(V) reduction up to 62.9% (6.29 ± 0.24 mM), while R. faecalis SS5 showed maximum As(III) oxidation up to 96% (4.8 ± 0.32 mM), respectively. Highest auxin production was observed by R. palustris CS2 and R. faecalis SS, up to 77.18 ± 3.7 and 76.67 ± 2.8  μ g mL -1 , respectively. Effects of these PNSB were tested on the growth of Vigna mungo plants. A statistically significant increase in growth was observed in plants inoculated with isolates compared to uninoculated plants, both in presence and in absence of As. R. palustris CS2 treated plants showed 17% (28.1 ± 0.87 cm) increase in shoot length and 21.7% (7.07 ± 0.42 cm) increase in root length, whereas R. faecalis SS5 treated plants showed 12.8% (27.09 ± 0.81 cm) increase in shoot length and 18.8% (6.9 ± 0.34 cm) increase in root length as compared to the control plants. In presence of As, R. palustris CS2 increased shoot length up to 26.3% (21.0 ± 1.1 cm), while root length increased up to 31.3% (5.3 ± 0.4 cm), whereas R. faecalis SS5 inoculated plants showed 25% (20.7 ± 1.4 cm) increase in shoot length and 33.3% (5.4 ± 0.65 cm) increase in root length as compared to the control plants. Bacteria with such diverse abilities could be ideal for plant growth promotion in As-contaminated sites.

  17. A novel electrophototrophic bacterium Rhodopseudomonas palustris strain RP2, exhibits hydrocarbonoclastic potential in anaerobic environments

    Directory of Open Access Journals (Sweden)

    Krishnaveni Venkidusamy

    2016-07-01

    Full Text Available An electrophototrophic, hydrocarbonoclastic bacterium Rhodopseudomonas palustris stain RP2 was isolated from the anodic biofilms of hydrocarbon fed microbial electrochemical remediation systems (MERS. Salient properties of the strain RP2 were direct electrode respiration, dissimilatory metal oxide reduction, spore formation, anaerobic nitrate reduction, free living diazotrophy and the ability to degrade n-alkane components of petroleum hydrocarbons in anoxic, photic environments. In acetate fed microbial electrochemical cells, a maximum current density of 305±10 mA/m2 (1000Ω was generated (power density 131.65±10 mW/m2 by strain RP2 with a coulombic efficiency of 46.7 ± 1.3%. Cyclic voltammetry studies showed that anaerobically grown cells of strain RP2 is electrochemically active and likely to transfer electrons extracellularly to solid electron acceptors through membrane bound compounds, however, aerobically grown cells lacked the electrochemical activity. The ability of strain RP2 to produce current (maximum current density 21±3 mA/m2; power density 720±7 µW/m2, 1000Ω using petroleum hydrocarbon (PH as a sole energy source was also examined using an initial concentration of 800 mg l-1 of diesel range hydrocarbons (C9- C36 with a concomitant removal of 47.4 ± 2.7% hydrocarbons in MERS. Here, we also report the first study that shows an initial evidence for the existence of a hydrocarbonoclastic behavior in the strain RP2 when grown in different electron accepting and illuminated conditions (anaerobic and MERS degradation. Such observations reveal the importance of photoorganotrophic growth in the utilization of hydrocarbons from contaminated environments. Identification of such novel petrochemical hydrocarbon degrading electricigens, not only expands the knowledge on the range of bacteria known for the hydrocarbon bioremediation but also shows a biotechnological potential that goes well beyond its applications to MERS.

  18. High-throughput transcriptome sequencing analysis provides preliminary insights into the biotransformation mechanism of Rhodopseudomonas palustris treated with alpha-rhamnetin-3-rhamnoside.

    Science.gov (United States)

    Bi, Lei; Guan, Chun-jie; Yang, Guan-e; Yang, Fei; Yan, Hong-yu; Li, Qing-shan

    2016-04-01

    The purple photosynthetic bacterium Rhodopseudomonas palustris has been widely applied to enhance the therapeutic effects of traditional Chinese medicine using novel biotransformation technology. However, comprehensive studies of the R. palustris biotransformation mechanism are rare. Therefore, investigation of the expression patterns of genes involved in metabolic pathways that are active during the biotransformation process is essential to elucidate this complicated mechanism. To promote further study of the biotransformation of R. palustris, we assembled all R. palustris transcripts using Trinity software and performed differential expression analysis of the resulting unigenes. A total of 9725, 7341 and 10,963 unigenes were obtained by assembling the alpha-rhamnetin-3-rhamnoside-treated R. palustris (RPB) reads, control R. palustris (RPS) reads and combined RPB&RPS reads, respectively. A total of 9971 unigenes assembled from the RPB&RPS reads were mapped to the nr, nt, Swiss-Prot, Gene Ontology (GO), Clusters of Orthologous Groups (COGs) and Kyoto Encyclopedia of Genes and Genomes (KEGG) (E-value biotransformation in R. palustris. Furthermore, we propose two putative ARR biotransformation mechanisms in R. palustris. These analytical results represent a useful genomic resource for in-depth research into the molecular basis of biotransformation and genetic modification in R. palustris. Copyright © 2016 Elsevier GmbH. All rights reserved.

  19. Phenotype fingerprinting suggests the involvement of single-genotype consortia in degradation of aromatic compounds by Rhodopseudomonas palustris.

    Directory of Open Access Journals (Sweden)

    Tatiana V Karpinets

    Full Text Available Anaerobic degradation of complex organic compounds by microorganisms is crucial for development of innovative biotechnologies for bioethanol production and for efficient degradation of environmental pollutants. In natural environments, the degradation is usually accomplished by syntrophic consortia comprised of different bacterial species. This strategy allows consortium organisms to reduce efforts required for maintenance of the redox homeostasis at each syntrophic level. Cellular mechanisms that maintain the redox homeostasis during the degradation of aromatic compounds by one organism are not fully understood. Here we present a hypothesis that the metabolically versatile phototrophic bacterium Rhodopseudomonas palustris forms its own syntrophic consortia, when it grows anaerobically on p-coumarate or benzoate as a sole carbon source. We have revealed the consortia from large-scale measurements of mRNA and protein expressions under p-coumarate, benzoate and succinate degrading conditions using a novel computational approach referred as phenotype fingerprinting. In this approach, marker genes for known R. palustris phenotypes are employed to determine the relative expression levels of genes and proteins in aromatics versus non-aromatics degrading condition. Subpopulations of the consortia are inferred from the expression of phenotypes and known metabolic modes of the R. palustris growth. We find that p-coumarate degrading conditions may lead to at least three R. palustris subpopulations utilizing p-coumarate, benzoate, and CO2 and H2. Benzoate degrading conditions may also produce at least three subpopulations utilizing benzoate, CO2 and H2, and N2 and formate. Communication among syntrophs and inter-syntrophic dynamics in each consortium are indicated by up-regulation of transporters and genes involved in the curli formation and chemotaxis. The N2-fixing subpopulation in the benzoate degrading consortium has preferential activation of the

  20. Promoting effects of a single Rhodopseudomonas palustris inoculant on plant growth by Brassica rapa chinensis under low fertilizer input.

    Science.gov (United States)

    Wong, Wai-Tak; Tseng, Ching-Han; Hsu, Shu-Hua; Lur, Huu-Sheng; Mo, Chia-Wei; Huang, Chu-Ning; Hsu, Shu-Chiung; Lee, Kung-Ta; Liu, Chi-Te

    2014-09-17

    Several Rhodopseudomonas palustris strains have been isolated from rice paddy fields in Taiwan by combining the Winogradsky column method and molecular marker detection. These isolates were initially screened by employing seed germination and seedling vigor assays to evaluate their potential as inoculants. To fulfill the demand in the present farming system for reducing the application of chemical fertilizers, we assessed the plant growth-promoting effects of the R. palustris YSC3, YSC4, and PS3 inoculants on Brassica rapa chinensis (Chinese cabbage) cultivated under a half quantity of fertilizer. The results obtained showed that supplementation with approximately 4.0×10(6) CFU g(-1) soil of the PS3 inoculant at half the amount of fertilizer consistently produced the same plant growth potential as 100% fertility, and also increased the nitrogen use efficiency of the applied fertilizer nutrients. Furthermore, we noted that the plant growth-promotion rate elicited by PS3 was markedly higher with old seeds than with new seeds, suggesting it has the potential to boost the development of seedlings that were germinated from carry-over seeds of poor quality. These beneficial traits suggest that the PS3 isolate may serve as a potential PGPR inoculant for integrated nutrient management in agriculture.

  1. Transfer of the high-GC cyclohexane carboxylate degradation pathway from Rhodopseudomonas palustris to Escherichia coli for production of biotin.

    Science.gov (United States)

    Bernstein, Jeffrey R; Bulter, Thomas; Liao, James C

    2008-01-01

    This work demonstrates the transfer of the five-gene cyclohexane carboxylate (CHC) degradation pathway from the high-GC alphaproteobacterium Rhodopseudomonas palustris to Escherichia coli, a gammaproteobacterium. The degradation product of this pathway is pimeloyl-CoA, a key metabolite in E. coli's biotin biosynthetic pathway. This pathway is useful for biotin overproduction in E. coli; however, the expression of GC-rich genes is troublesome in this host. When the native R. palustris CHC degradation pathway is transferred to a DeltabioH pimeloyl-CoA auxotroph of E. coli, it is unable to complement growth in the presence of CHC. To overcome this expression problem we redesigned the operon with decreased GC content and removed stretches of high-GC intergenic DNA which comprise the 5' untranslated region of each gene, replacing these features with shorter low-GC sequences. We show this synthetic construct enables growth of the DeltabioH strain in the presence of CHC. When the synthetic degradation pathway is overexpressed in conjunction with the downstream genes for biotin biosynthesis, we measured significant accumulation of biotin in the growth medium, showing that the pathway transfer is successfully integrated with the host metabolism.

  2. Identification of protein W, the elusive sixth subunit of the Rhodopseudomonas palustris reaction center-light harvesting 1 core complex.

    Science.gov (United States)

    Jackson, Philip J; Hitchcock, Andrew; Swainsbury, David J K; Qian, Pu; Martin, Elizabeth C; Farmer, David A; Dickman, Mark J; Canniffe, Daniel P; Hunter, C Neil

    2018-02-01

    The X-ray crystal structure of the Rhodopseudomonas (Rps.) palustris reaction center-light harvesting 1 (RC-LH1) core complex revealed the presence of a sixth protein component, variably referred to in the literature as helix W, subunit W or protein W. The position of this protein prevents closure of the LH1 ring, possibly to allow diffusion of ubiquinone/ubiquinol between the RC and the cytochrome bc 1 complex in analogous fashion to the well-studied PufX protein from Rhodobacter sphaeroides. The identity and function of helix W have remained unknown for over 13years; here we use a combination of biochemistry, mass spectrometry, molecular genetics and electron microscopy to identify this protein as RPA4402 in Rps. palustris CGA009. Protein W shares key conserved sequence features with PufX homologs, and although a deletion mutant was able to grow under photosynthetic conditions with no discernible phenotype, we show that a tagged version of protein W pulls down the RC-LH1 complex. Protein W is not encoded in the photosynthesis gene cluster and our data indicate that only approximately 10% of wild-type Rps. palustris core complexes contain this non-essential subunit; functional and evolutionary consequences of this observation are discussed. The ability to purify uniform RC-LH1 and RC-LH1-protein W preparations will also be beneficial for future structural studies of these bacterial core complexes. Copyright © 2017 The Authors. Published by Elsevier B.V. All rights reserved.

  3. A two-step fermentation of distillers' grains using Trichoderma viride and Rhodopseudomonas palustris for fish feed.

    Science.gov (United States)

    Zhang, Jian; Zhang, Wen-Xue; Li, Shun-Zhou; You, Ling; Zhang, Chao; Sun, Chuan-Ze; Liu, Xiao-Bin

    2013-10-01

    It is important to provide added value or to make full use of the co-product of grains from ethanol production. In order to convert distillers' grains into a high-quality feed, the Trichoderma viride and Rhodopseudomonas palustris fermentation were combined and investigated in this study. The T. viride fermentation was carried out in an aerobic fermentation installation in favoring of the growth of the fungi and the degradation of the cellulose, and then the fermentation of R. palustris was performed to increase the content of protein with an anaerobic installation. After the two step fermentations, the true protein content of dried distiller' grains increased from 11.4 to 33.6 % (w/w) (the content of crude protein from 14.5 to 39.7 %), the crude fiber content decreased from 21.3 to 7.6 % (w/w), the crude fat content increased from 5.5 to 7.9 % (w/w), the crude ash decreased from 14.6 to 10.2 % (w/w), the total phosphorus content increased from 0.4 to 1.2 % (w/w), and the water content was 11.8 % (w/w). The dried and fermented grains contain the R. palustris viable count of 5.3 × 10¹¹ CFU/g dry matter. The results may support a new application of an active photosynthetic bacteria fish feed in fisheries industry and offer a reference for the further study of lignocellulosic materials as raw materials converting into high-quality feed.

  4. Cloning and characterization of a pyrethroid pesticide decomposing esterase gene, Est3385, from Rhodopseudomonas palustris PSB-S.

    Science.gov (United States)

    Luo, Xiangwen; Zhang, Deyong; Zhou, Xuguo; Du, Jiao; Zhang, Songbai; Liu, Yong

    2018-05-09

    Full length open reading frame of pyrethroid detoxification gene, Est3385, contains 963 nucleotides. This gene was identified and cloned based on the genome sequence of Rhodopseudomonas palustris PSB-S available at the GneBank. The predicted amino acid sequence of Est3385 shared moderate identities (30-46%) with the known homologous esterases. Phylogenetic analysis revealed that Est3385 was a member in the esterase family I. Recombinant Est3385 was heterologous expressed in E. coli, purified and characterized for its substrate specificity, kinetics and stability under various conditions. The optimal temperature and pH for Est3385 were 35 °C and 6.0, respectively. This enzyme could detoxify various pyrethroid pesticides and degrade the optimal substrate fenpropathrin with a Km and Vmax value of 0.734 ± 0.013 mmol·l -1 and 0.918 ± 0.025 U·µg -1 , respectively. No cofactor was found to affect Est3385 activity but substantial reduction of enzymatic activity was observed when metal ions were applied. Taken together, a new pyrethroid degradation esterase was identified and characterized. Modification of Est3385 with protein engineering toolsets should enhance its potential for field application to reduce the pesticide residue from agroecosystems.

  5. Different Metabolomic Responses to Carbon Starvation between Light and Dark Conditions in the Purple Photosynthetic Bacterium, Rhodopseudomonas palustris.

    Science.gov (United States)

    Kanno, Nanako; Matsuura, Katsumi; Haruta, Shin

    2018-03-29

    Purple photosynthetic bacteria utilize light energy for growth. We previously demonstrated that light energy contributed to prolonging the survival of multiple purple bacteria under carbon-starved conditions. In order to clarify the effects of illumination on metabolic states under carbon-starved, non-growing conditions, we herein compared the metabolic profiles of starved cells in the light and dark using the purple bacterium, Rhodopseudomonas palustris. The metabolic profiles of starved cells in the light were markedly different from those in the dark. After starvation for 5 d in the light, cells showed increases in the amount of ATP and the NAD + /NADH ratio. Decreases in the amounts of most metabolites related to glycolysis and the TCA cycle in energy-rich starved cells suggest the active utilization of these metabolites for the modification of cellular components. Starvation in the dark induced the consumption of cellular compounds such as amino acids, indicating that the degradation of these cellular components produced ATP in order to maintain viability under energy-poor conditions. The present results suggest that intracellular energy levels alter survival strategies under carbon-starved conditions through metabolism.

  6. Preservation of H2 production activity in nanoporous latex coatings of Rhodopseudomonas palustris CGA009 during dry storage at ambient temperatures: Preservation of R. palustris latex coatings

    Energy Technology Data Exchange (ETDEWEB)

    Piskorska, M. [Univ. of South Carolina, Aiken, SC (United States); Soule, T. [Savannah River Site (SRS), Aiken, SC (United States). Savannah River National Lab. (SRNL); Gosse, J. L. [North Carolina State Univ., Raleigh, NC (United States); Milliken, C. [Savannah River Site (SRS), Aiken, SC (United States). Savannah River National Lab. (SRNL); Flickinger, M. C. [North Carolina State Univ., Raleigh, NC (United States); Smith, G. W. [Univ. of South Carolina, Aiken, SC (United States); Yeager, C. M. [Savannah River Site (SRS), Aiken, SC (United States). Savannah River National Lab. (SRNL)

    2013-01-21

    To assess the applicability of latex cell coatings as an ‘off-the-shelf’ biocatalyst, the effect of osmoprotectants, temperature, humidity and O2 on preservation of H2 production in Rhodopseudomonas palustris coatings was evaluated. Immediately following latex coating coalescence (24 h) and for up to 2 weeks of dry storage, rehydrated coatings containing different osmoprotectants displayed similar rates of H2 production. Beyond 2 weeks of storage, sorbitol-treated coatings lost all H2 production activity, whereas considerable H2 production was still detected in sucrose- and trehalose-stabilized coatings. The relative humidity level at which the coatings were stored had a significant impact on the recovery and subsequent rates of H2 production. After 4 weeks storage under air at 60% humidity, coatings produced only trace amounts of H2 (0–0.1% headspace accumulation), whereas those stored at < 5% humidity retained 27–53% of their H2 production activity after 8 weeks of storage. In conWhen stored in argon at < 5% humidity and room temperature, R. palustris coatings retained full H2 production activity for 3 months, implicating oxidative damage as a key factor limiting coating storage. Overall, the results demonstrate that biocatalytic latex coatings are an attractive cell immobilization platform for preservation of bioactivity in the dry state.

  7. Single-molecule spectroscopy reveals that individual low-light LH2 complexes from Rhodopseudomonas palustris 2.1.6. have a heterogeneous polypeptide composition.

    Science.gov (United States)

    Brotosudarmo, Tatas H P; Kunz, Ralf; Böhm, Paul; Gardiner, Alastair T; Moulisová, Vladimíra; Cogdell, Richard J; Köhler, Jürgen

    2009-09-02

    Rhodopseudomonas palustris belongs to the group of purple bacteria that have the ability to produce LH2 complexes with unusual absorption spectra when they are grown at low-light intensity. This ability is often related to the presence of multiple genes encoding the antenna apoproteins. Here we report, for the first time to our knowledge, direct evidence that individual low-light LH2 complexes have a heterogeneous alphabeta-apoprotein composition that modulates the site energies of Bchl a molecules, producing absorption bands at 800, 820, and 850 nm. The arrangement of the Bchl a molecules in the "tightly coupled ring" can be modeled by nine alphabeta-Bchls dimers, such that the Bchls bound to six alphabeta-pairs have B820-like site energies and the remaining Bchl a molecules have B850-like site energies. Furthermore, the experimental data can only be satisfactorily modeled when these six alphabeta-pairs with B820 Bchl a molecules are distributed such that the symmetry of the assembly is reduced to C(3). It is also clear from the measured single-molecule spectra that the energies of the electronically excited states in the mixed B820/850 ring are mainly influenced by diagonal disorder.

  8. Anaerobic p-coumarate degradation by Rhodopseudomonas palustris and identification of CouR, a MarR repressor protein that binds p-coumaroyl coenzyme A.

    Science.gov (United States)

    Hirakawa, Hidetada; Schaefer, Amy L; Greenberg, E Peter; Harwood, Caroline S

    2012-04-01

    The phenylpropanoid p-coumarate and structurally related aromatic compounds are produced in large amounts by green plants and are excellent carbon sources for many soil bacteria. Aerobic bacteria remove the acyl side chain from phenylpropanoids to leave an aromatic aldehyde, which then enters one of several possible central pathways of benzene ring degradation. We investigated the pathway for the anaerobic degradation of p-coumarate by the phototrophic bacterium Rhodopseudomonas palustris and found that it also follows this metabolic logic. We characterized enzymes for the conversion of p-coumarate to p-hydroxybenzaldehyde and acetyl coenzyme A (acetyl-CoA) encoded by the couAB operon. We also identified a MarR family transcriptional regulator that we named CouR. A couR mutant had elevated couAB expression. In addition, His-tagged CouR bound with high affinity to a DNA fragment encompassing the couAB promoter region, and binding was abrogated by the addition of nanomolar quantities of p-coumaroyl-CoA but not by p-coumarate. Footprinting demonstrated binding of CouR to an inverted repeat sequence that overlaps the -10 region of the couAB promoter. Our results provide evidence for binding of a CoA-modified aromatic compound by a MarR family member. Although the MarR family is widely distributed in bacteria and archaea and includes over 12,000 members, ligands have been identified for relatively few family members. Here we provide biochemical evidence for a new category of MarR ligand.

  9. Hydrogen photo-evolution by Rhodopseudomonas palustris 6A using pre-treated olive mill wastewater and a synthetic medium containing sugars

    International Nuclear Information System (INIS)

    Pintucci, Cristina; Padovani, Giulia; Giovannelli, Alessio; Traversi, Maria Laura; Ena, Alba; Pushparaj, Benjamin; Carlozzi, Pietro

    2015-01-01

    Highlights: • Adsorbent matrices to convert fresh olive mill wastewater (OMW F ) in feedstock. • Dry-Azolla and granular active carbon for adsorbing polyphenols from OMW F . • Photofermentative processes for biohydrogen production. • Culture mixing by means of an impeller or a magnetic stir bar. • A 30% of dephenolised OMW containing medium suits the photofermentative process. - Abstract: Increasing costs of petroleum, associated with the escalating problems of global climate change, require always greater efforts in order to produce an energy carrier as bioH 2 . In this study, bioH 2 production using photofermentative process was investigated. Two culture broths were used: (a) a synthetic medium rich in sugars (glucose and fructose) and (b) a pre-treated fresh olive-mill wastewater (OMW F ) diluted with water (30%, v:v). The pre-treatment was carried out using two different vegetable matrices (dry-Azolla and granular active carbon) to decrease both the content of polyphenols and the dark colour of wastewater. Rhodopseudomonas palustris 6A isolated from soil spread with OMW was utilized for batch growth experiments, carried out indoors under continuous light (200 μE/m 2 /s). When synthetic medium was used, the culture mixing was performed using either (i) a magnetic stir bar, and (ii) an impeller equipped with five turbines. The latter system made it possible to increase the bioH 2 photo-evolution by 1.4 times. The specific hydrogen photo-evolution rate was 13.5 mL/g(dw)/h in the broth containing diluted OMW F and 11.8 mL/g(dw)/h in the synthetic medium containing sugars (glucose and fructose)

  10. Effect of dilution and L-malic acid addition on bio-hydrogen production with Rhodopseudomonas palustris from effluent of an acidogenic anaerobic reactor

    International Nuclear Information System (INIS)

    Azbar, N.; Tuba, F.; Dokgoz, C.

    2009-01-01

    In this study, H 2 was produced in a two-stage biological process: I) first stage; the dark fermentation of cheese whey wastewater, which is rich in lactose, by mixed anaerobic culture grown at thermophilic temperature in a continuously running fermentor and ii) second stage; the photo-fermentation of the residual medium by R. palustris strain (DSM 127) at 31 o C under illumination of 150 W in batch mode, respectively. In the first part of the study, the effluent from the dark fermentation reactor was used either as it is (no dilution) or after dilution with distilled water at varying ratios such as 1/2 , 1/5, 1/10 (1 volume effluent/5 volume distilled water) before used in photo-fermentation experiments. In the second part of the study, L-malic acid at varying amounts was added into the hydrogen production medium in order to have L-malic acid concentrations ranging from 0 to 4 g/l. Non-diluted and pre-diluted mediums with or without L-malic acid addition were also tested for comparison purpose (as controls). Prior to the hydrogen production experiments, all samples were subjected to pH adjustment, (pH 6.7) and sterilized by autoclave at 121 o C for 15 min. In regards to the experiments in which the effect of dilution of the effluent from dark fermentation was studied, it was observed that dilution of the effluent from dark fermentation resulted in much better hydrogen productions. Among the dilution rates used, the experiments operated with 1/5 dilution ratio produced the best hydrogen production (241 ml H 2 / g COD fed ). On the other hand, it was seen that the mixing the effluent with L-malic acid (0 - 4 g/l) at increasing ratios (studied from 0% L-malic acid up to 100% by volume in the mixture) had further positive effect and improved the hydrogen production. The bioreactors containing only L-malic acid media resulted in the best hydrogen production (438 ml H 2 / g COD fed ). It was found that, undiluted raw cheese whey wastewater effluent from dark hydrogen

  11. Effect of dilution and L-malic acid addition on bio-hydrogen production with Rhodopseudomonas palustris from effluent of an acidogenic anaerobic reactor

    Energy Technology Data Exchange (ETDEWEB)

    Azbar, N.; Tuba, F.; Dokgoz, C. [Bioengineering Dept., Faculty of Engineering, Ege Univ., Izmir (Turkey)], E-mail: nuri.azbar@ege.edu.tr

    2009-07-01

    In this study, H{sub 2} was produced in a two-stage biological process: I) first stage; the dark fermentation of cheese whey wastewater, which is rich in lactose, by mixed anaerobic culture grown at thermophilic temperature in a continuously running fermentor and ii) second stage; the photo-fermentation of the residual medium by R. palustris strain (DSM 127) at 31{sup o}C under illumination of 150 W in batch mode, respectively. In the first part of the study, the effluent from the dark fermentation reactor was used either as it is (no dilution) or after dilution with distilled water at varying ratios such as 1/2 , 1/5, 1/10 (1 volume effluent/5 volume distilled water) before used in photo-fermentation experiments. In the second part of the study, L-malic acid at varying amounts was added into the hydrogen production medium in order to have L-malic acid concentrations ranging from 0 to 4 g/l. Non-diluted and pre-diluted mediums with or without L-malic acid addition were also tested for comparison purpose (as controls). Prior to the hydrogen production experiments, all samples were subjected to pH adjustment, (pH 6.7) and sterilized by autoclave at 121{sup o}C for 15 min. In regards to the experiments in which the effect of dilution of the effluent from dark fermentation was studied, it was observed that dilution of the effluent from dark fermentation resulted in much better hydrogen productions. Among the dilution rates used, the experiments operated with 1/5 dilution ratio produced the best hydrogen production (241 ml H{sub 2}/ g COD{sub fed}). On the other hand, it was seen that the mixing the effluent with L-malic acid (0 - 4 g/l) at increasing ratios (studied from 0% L-malic acid up to 100% by volume in the mixture) had further positive effect and improved the hydrogen production. The bioreactors containing only L-malic acid media resulted in the best hydrogen production (438 ml H{sub 2} / g COD{sub fed}). It was found that, undiluted raw cheese whey wastewater

  12. Effizienzsteigerung durch intelligente Planung

    Science.gov (United States)

    Maier, Walther; Bader, Alexander

    Das Umfeld der produzierenden Unternehmen hat sich in den letzten Jahren sehr gewandelt. Dieser Wandel ist geprägt durch die Folgen der Globalisierung und deren Folgeerscheinungen. Produzierende Unternehmen versuchen auf diese geänderten Rahmenbedingungen durch Steigerung ihrer Produktivität und Flexibilität zu reagieren.

  13. Ecosystem carbon stocks in Pinus palustris forests

    Science.gov (United States)

    Lisa Samuelson; Tom Stokes; John R. Butnor; Kurt H. Johnsen; Carlos A. Gonzalez-Benecke; Pete Anderson; Jason Jackson; Lorenzo Ferrari; Tim A. Martin; Wendell P. Cropper

    2014-01-01

    Longleaf pine (Pinus palustris Mill.) restoration in the southeastern United States offers opportunities for carbon (C) sequestration. Ecosystem C stocks are not well understood in longleaf pine forests, which are typically of low density and maintained by prescribed fire. The objectives of this research were to develop allometric equations for...

  14. Moessbauer spectroscopy on the reaction center of Rhodopseudomonas viridis

    International Nuclear Information System (INIS)

    Frolov, E.; Goldanskii, V.I.; Birk, A.; Parak, F.; Fritzsch, G.; Sinning, I.; Michel, H.

    1992-01-01

    Proteins called 'reaction centers' (RC) can be isolated from many photosynthetic bacteria. They have one non-heme iron in a quinone acceptor region. The RC of Rhodopseudomonas viridis contains an additional tightly bound tetra-heme cytochrome c subunit. The electronic configuration of both cytochrome and the non-heme iron has been studied in the crystallized protein by Moessbauer spectroscopy at different redox potentials, pH-values, and with an addition of o-phenanthroline. At high potentials (E h =+500 mV) all heme irons are in the low spin Fe 3+ -state, and at low potential (E h = 1 50 mV) they are low spin Fe 2+ with the same Moessbauer parameters for all hemes independent of pH. Redox titrations change the relative area of the reduced and oxidized states in agreement with other methods. The non-heme iron shows a high spin Fe 2+ configuration independent of E h and pH with parameters comparable to those of Rhodopseudomonas sphaeroides. Surprisingly, there is strong evidence for another non-heme iron species in part of the molecules with a Fe 2+ low spin configuration. Incubation with o-phenanthroline decreases the relative Fe 2+ hs-area and increases the contribution of Fe 2+ ls-area. Above 210 K the mean square displacement, 2 >, of the RC-crystals increases more than linearly with temperature. This may be correlated with the increase of the electron transfer rate and indicates that intramolecular mobility influences the functional activity of a protein. (orig.)

  15. Variability of Caltha palustris L. populations in garden culture

    Directory of Open Access Journals (Sweden)

    Krystyna Falińska

    2014-01-01

    Full Text Available On the basis of studies performed in the experimental garden the character of the variability of Caltha palustris L. populations is described. Individuals were bred under uniform conditions from diaspores of meadow, springwood, flood-plain forest and alder forest populations. The results obtained allow to evaluate the hypothesis concerning the ecological preference of cytotypes (S m i t 1967, 1968 and the somewhat different ecological requirements of two subspecies: C. palustris ssp. palustris and C. palustris ssp. cornuta. It was found that each population includes individuals with different cytotypes. The situation is similar as far as subspecies are concerned, distinguished on the basis of fruit morphology (Fig. 1. It should be stressed, however, that, investigations of many years duration raised serious doubts as to the diagnostic value of fruit morphology (Figs. 2, 3. On the basis of the preserved differences between the populations in shoot habitus, reproduction and phenology in garden culture, a springwood and an alder forest ecotype were distinguished. Meadow and flood-plain populations exhibited a transitional character with certain similarities both to the alder forest and to the springwood populations.

  16. Aberrante Epigynenbildungen bei der Wolfspinne Pardosa palustris (Araneae, Lycosidae

    Directory of Open Access Journals (Sweden)

    Martin, Dieter

    2013-11-01

    Full Text Available Two cases of aberrant epigyne shape in Pardosa palustris (Linnaeus, 1758 are described. Characteristic is the absence of the posterior lateral parts of the septum. Possible causes, such as `genital damage` during mating or the effects of parasite infestation, are discussed.

  17. Fluorescence spectral fluctuations of single LH2 complexes from Rhodopseudomonas acidophila strain 10050

    NARCIS (Netherlands)

    Rutkauskas, D.; Novoderezkhin, V.; Cogdell, R.J.; van Grondelle, R.

    2004-01-01

    We have investigated the energy landscape of the bacterial photosynthetic peripheral light-harvesting complex LH2 of purple bacterium Rhodopseudomonas acidophila by monitoring sequences of fluorescence spectra of single LH2 assemblies, at room temperature, with different excitation intensities as

  18. ?-Oryzanols of North American Wild Rice (Zizania palustris)

    OpenAIRE

    Aladedunye, Felix; Przybylski, Roman; Rudzinska, Magdalena; Klensporf-Pawlik, Dorota

    2013-01-01

    ?-Oryzanol, a natural mixture of ferulic acid esters of triterpene alcohols and sterols, are an important bioactive components present in rice bran oil. In light of the recent increase in the popularity of wild rice among consumers, and the possibility of a direct relationship between ?-oryzanol composition and its bioactivity, the oryzanol profile of major wild rice (Zizania palustris) grown in North America was studied and compared to regular brown rice (Oryza sativa L.). A total of twenty-...

  19. A new marsh plant community of Eleocharito palustris-Alismatetum lanceolati (Eleocharito palustris-Sagittarion sagittifoliae alliance in Slovakia

    Directory of Open Access Journals (Sweden)

    Richard Hrivnák

    2015-10-01

    Full Text Available Open and species-poor stands with a dominance of Alisma lanceolatum were recorded in periodically flooded habitats of the southern part of central Slovakia (Ipeľ River catchment area during the summer of 2013. Phytosociological relevés correspond to the association Eleocharito palustris-Alismatetum lanceolati (alliance Eleocharito palustris-Sagittarion sagittifoliae, which is reported and documented here for the first time from the territory of Slovakia. It inhabits predominantly temporarily flooded depressions on agricultural land – wet arable fields and extensively used pastures. Detrended correspondence analysis showed that the variability in species composition was most significantly influenced by water depth, the presence of arable fields in the contact area and water conductivity. Special attention was paid to a detailed description of the floristic composition, habitat requirements, distribution patterns and nomenclature of the community.

  20. Louisiana’s Palustris Experimental Forest: 75 years of research that transformed the South

    Science.gov (United States)

    James P. Barnett; James D. Haywood; Henry A. Pearson

    2011-01-01

    The Palustris Experimental Forest, located on Kisatchie National Forest, has been in existence for 75 years. Research at Palustris has focused on southern pine reforestation technology, including seed production, bareroot nursery production, direct seeding, and planting container seedlings. After establishing pine plantations, researchers developed stand management...

  1. Isoprenoid hydrocarbons produced by thermal alteration of Nostoc muscorum and Rhodopseudomonas spheroides

    Science.gov (United States)

    Philp, R. P.; Brown, S.; Calvin, M.

    1978-01-01

    The potential of algae and photosynthetic bacteria to serve as precursors of kerogen was studied to determine what factors affect the relative rates of formation of precursor hydrocarbons. Cells of Nostoc muscorum and Rhodopseudomonas spheroides were subjected to thermal alteration (by heating samples in glass tubes sealed under nitrogen) for two, four, and twelve weeks. Both unextracted and extracted cells in the absence and presence of montmorillonite were investigated, and the isoprenoid hydrocarbons produced in these experiments were determined. Phytane and five isomeric phytenes were the main hydrocarbons observed; their relative rates of formation in the different experimental conditions are described. No phytadienes, pristane, or pristenes were detected.

  2. Stereoskopische Visualisierung einer Infektion mammalischer Zellen durch pathogene Bakterien

    Science.gov (United States)

    Granseier, Michael; Grassmé, Heike; Gulbins, Erich; Lipinski, Hans-Gerd

    Die Infektion mammalischer Zellen durch pathogene Bakterien ist biologisch immer noch nicht sicher geklärt. Mit Hilfe der Laserscanmikroskopie ist es mittlerweile aber möglich, räumliche Bilddaten von Zellproben zu erstellen, auf denen der Eindringvorgang der Bakterien in das Zellinnere durch verschieden leuchtende Fluoreszenzfarbstoffe visualisiert werden kann. Unter Verwendung bekannter und adaptierter 3D-Rekonstruktionsalgorithmen werden dreidimensionale Visualisierungen von Mikroskopiebildern vorgestellt, mit deren Hilfe die Analyse des Infektionsprozesses erleichtert wird. Dabei hat sich gezeigt, dass mit Oberflächenrekonstruktionsverfahren die Topografie der Zelloberfiäche korrekt dargestellt werden kann, während die Darstellung der Farbstoffverteilungen besser durch ein Texture-Mapping-Verfahren gelingt. Die Rekonstruktionen konnten insbesondere durch den Einsatz von stereoskopischen Visualisierungstechniken detailgenau analysiert werden.

  3. Mortalidade em florestas de Pinus palustris causada por tempestade de raios

    Science.gov (United States)

    Kenneth W. Outcalt; Jorge Paladino Corrêa de Lima; Jose Américo de Mello Filho

    2002-01-01

    The importance of lightning as an ignition source for the fire driven Pinus palustris ecosystem is widely recognized. Lightning also impacts this system on a smaller scale by causing individual tree mortality. The objective of this study was to determine the level of mortality due to lightning activity at the Department of Energy's Savannah...

  4. Population Genetic Structure of Cochliobolus miyabeanus on Cultivated Wild Rice (Zizania palustris L.) in Minnesota

    Science.gov (United States)

    Cochliobolus miyabeanus (Bipolaris oryzae) is the causal agent of fungal brown spot (FBS) in wild rice (Zizania palustris L.), an aquatic grass, endemic in Minnesota, Wisconsin, and parts of Canada. Grain yield losses can reach up to 74% when the disease starts at the boot stage and continues until ...

  5. Forest floor depth mediates understory vigor in xeric Pinus palustris ecosystems

    Science.gov (United States)

    J. Kevin Hiers; Joseph J. O' Brien; Rodney E. Will; Robert J. Mitchell

    2007-01-01

    Longleaf pine (Pinus palustris) woodlands and savannas are among the most frequently burned ecosystems in the world with fire return intervals of 1–10 years. This fire regime has maintained high levels of biodiversity in terms of both species richness and endemism. Land use changes have reduced the area of this ecosystem by .95%, and inadequate fire...

  6. Assessing longleaf pine (Pinus palustris) restoration after southern pine beetle kill using a compact experimental design

    Science.gov (United States)

    J.-P. Berrill; C.M. Dagley

    2010-01-01

    A compact experimental design and analysis is presented of longleaf pine (Pinus palustris) survival and growth in a restoration project in the Piedmont region of Georgia, USA. Longleaf pine seedlings were planted after salvage logging and broadcast burning in areas of catastrophic southern pine beetle (Dendroctonus frontalis) attacks on even-aged mixed pine-hardwood...

  7. Nursery response of container Pinus palustris seedlings to nitrogen supply and subsequent effects on outplanting performance

    Science.gov (United States)

    D. Paul Jackson; R. Kasten Dumroese; James P. Barnett

    2012-01-01

    Container longleaf pine (Pinus palustris) seedlings often survive and grow better after outplanting than bareroot seedlings. Because of this, most longleaf pine are now produced in containers. Little is known about nursery fertilization effects on the quality of container longleaf pine seedlings and how that influences outplanting performance. We compared various...

  8. Assembly and structural organization of pigment-protein complexes in membranes of Rhodopseudomonas sphaeroides

    International Nuclear Information System (INIS)

    Hunter, C.N.; Pennoyer, J.D.; Niederman, R.A.

    1982-01-01

    The B875 and B800-850 light-harvesting pigment-protein complexes of Rhodopseudomonas sphaeroides are characterized further by lithium dodecyl sulfate/polyacrylamide gel electrophoresis at 4 degrees C. Bacteriochlorophyll a was shown in reconstruction studies to remain complexed with its respective binding proteins during this procedure. From distributions in these gels, a quantitative description for the arrangement of the complexes is proposed. Assembly of the complexes was examined in delta-aminolevulinate-requiring mutant H-5 after a shift from high- to low-light intensity. After 10 h of delta-[ 3 H]aminolevulinate labeling, the specific radioactivity of bacteriochlorophyll in a fraction containing putative membrane invaginations reached the maximal level, while that of the mature photosynthetic membrane was at only one-third this level. This suggests that membrane invaginations are sites of preferential bacteriochlorophyll synthesis in which completed pigment-proteins exist transiently. Analysis of the 3 H distribution after electrophoretic separation further suggests that photosynthetic membranes grow mainly by addition of B800-850 to preformed membrane consisting largely of B875 and photochemical reaction centers. These results corroborate the above model for the structural organization of the light-harvesting system and indicate that the structurally and functionally discrete B800-850 pool is not completely assembled until all B875 sites for B800-850 interactions are occupied

  9. Ferrochelatase from Rhodopseudomonas sphaeroides: substrate specificity and role of sulfhydryl and arginyl residues

    International Nuclear Information System (INIS)

    Dailey, H.A.; Fleming, J.E.; Harbin, B.M.

    1986-01-01

    Purified ferrochelatase from the bacterium Rhodopseudomonas sphaeroides was examined to determine the roles of cationic and sulfhydryl residues in substrate binding. Reaction of the enzyme sulfhydryl residues with N-ethylmaleimide or monobromobimane resulted in a rapid loss of enzyme activity. Ferrous iron, but not porphyrin substrate, had a protective effect against inactivation by these two reagents. Quantitation with 3 H-labeled N-ethylmaleimide revealed that inactivation required one to two sulfhydryl groups to be modified. Modification of arginyl residues with either 2,3-butanedione or camphorquinone 10-sulfonate resulted in a loss of ferrochelatase activity. A kinetic analysis of the modified enzyme showed that the K/sub m/ for ferrous iron was not altered but that the K/sub m/ for the prophyrin substrate was increased. These data suggested that arginyl residues may be involved in porphyrin binding, possibly via charge pair interactions between the arginyl residue and the anionic porphyrin propionate side chain. Modification of lysyl residues had no effect on enzyme activity. The authors also examined the ability of bacterial ferrochelatase to use various 2,4-disubstituted porphyrins as substrates. The authors found that 2,4-bis-acetal- and 2,4-disulfonate deuteroporphyrins were effective substrates for the purified bacterial enzyme and that N-methylprotoporphyrin was an effective inhibitor of the enzyme. Data for the ferrochelatase of R. sphaeroides are compared with previously published data for the eucaryotic enzyme

  10. Cholinesterase inhibitory activity and chemical constituents of Stenochlaena palustris fronds at two different stages of maturity

    Directory of Open Access Journals (Sweden)

    Nelson Jeng-Yeou Chear

    2016-04-01

    Full Text Available Stenochlaena palustris fronds are popular as a vegetable in Southeast Asia. The objectives of this study were to evaluate the anticholinesterase properties and phytochemical profiles of the young and mature fronds of this plant. Both types of fronds were found to have selective inhibitory effect against butyrylcholinesterase compared with acetylcholinesterase. However, different sets of compounds were responsible for their activity. In young fronds, an antibutyrylcholinesterase effect was observed in the hexane extract, which was comprised of a variety of aliphatic hydrocarbons, fatty acids, and phytosterols. In the mature fronds, inhibitory activity was observed in the methanol extract, which contained a series of kaempferol glycosides. Our results provided novel information concerning the ability of S. palustris to inhibit cholinesterase and its phytochemical profile. Further research to investigate the potential use of this plant against Alzheimer's disease is warranted, however, young and mature fronds should be distinguished due to their phytochemical differences.

  11. Molar extinction coefficients and other properties of an improved reaction center preparation from Rhodopseudomonas viridis

    Energy Technology Data Exchange (ETDEWEB)

    Clayton, R.K.; Clayton, B.J.

    1978-01-01

    Reaction centers have been purified from chromatophores of Rhodopseudomonas viridis by treatment with lauryl dimethyl amine oxide followed by hydroxyapatite chromatography and precipitation with ammonium sulfate. The absorption spectrum at low temperature shows bands at 531 and 543 nm, assigned to two molecules of bacteriopheophytin b. The 600 nm band of bacteriochlorophyll b is resolved at low temperature into components at 601 and 606.5 nm. At room temperature the light-induced difference spectrum shows a negative band centered at 615 nm, where the absorption spectrum shows only a week shoulder adjacent to the 600 nm band. The fluorescence spectrum shows a band at 1000 nm and no fluorescence corresponding to the 830 nm absorption band. Two molecules of cytochrome 558 and three of cytochrome 552 accompany each reaction center. The differential extinction coefficient (reduced minus oxidized) of cytochrome 558 nm was estimated as 20 +- 2 mM/sup -1/.cm/sup -1/ through a coupled reaction with equine cytochrome c. The extinction coefficient of reaction centers at 960 nm was determined to be 123 +- 25 mM/sup -1/.cm/sup -1/ by measuring the light-induced bleaching of P-960 and the coupled oxidation of cytochrome 558. The corresponding extinction coefficient at 830 nm is 300 +- 65 mM/sup -1/.cm/sup -1/. The absorbance ratio ..cap alpha../sub 280nm/..cap alpha../sub 830nm/ in our preparations was 2.1, and there was 190 kg protein per mol of reaction centers. Sodium dodecyl sulfate-polyacrylamide gel electrophoresis showed three major components of apparent molecular weights 31,000, 37,000, and 41,000.

  12. The usage of sulfide and thiosulfate ions by purple non-sulfur bacteria Rhodopseudomonas yavorovii

    Directory of Open Access Journals (Sweden)

    O. V. Tarabas

    2017-07-01

    Full Text Available This article covers the patterns of oxidation of sulfide and thiosulfate ions by bacteria Rhodopseudomonas yavorovii Ya-2016 under different cultivation conditions. In the environments with 1.4–5.6 мМ Na2S2O3, R. yavorovii Ya-2016 bacteria accumulated biomass of 1.4–1.6 g/l, which was higher than biomass (1.2-0.6 g/l accumulated by the bacteria with the same concentrations of Na2S × 9H2O. The efficiency of oxidation of 1.4, 2.8, 5.6 мМ sulfide- and thiosulfate-ions as donors of electrons by the bacteria equaled 97.4, 42.6, 18.7 and 68.8, 28.0, 3.7%, respectively. As a result of bacterial oxidation of 1.4 мМ hydrogen sulfide and sodium thiosulphate in the environment accumulation of 0.13–1.30 мМ sulfate-ions occurs, and the element sulfur becomes an intermediate metabolite in the environment with Na2S×9H2O. R. yavorovii Ya-2016 bacteria are capable of using sulfate-ions as a single source of sulfate at increase in photptrophs. In the environment with 2.5 мМ sulfate-ions concentration the bacteria biomass was 1.4 g/l, the bacteria assimilated 17.7% of sulfates. Because purple non-sulfur bacteria R. yavorovii Ya-2016 are capable of using sulfide-ions as donors of electrons of anoxygenic photosynthesis and using sulfate-ions as a single source of sulfate, they could be successfully used in the technologies of remediating the environment from compounds of sulfur.

  13. The role of oxalic acid in tolerance to N’N-napthaloylhydroxylamine in Tyromyces palustris

    Science.gov (United States)

    R.A. Arango; C.A. Clausen; Frederick Green

    2006-01-01

    Certain wood decay fungi exhibit tolerance to one or more wood preservatives. Copper tolerance of brown-rot fungi has been studied in our laboratory for the past six years. We have observed some degree of tolerance to N’N-naphthaloylhydroxamine (NHA), a recently patented termite bait, by the brown-rot fungus Tyromyces palustris TYP-6137. In an effort to try and confirm...

  14. Development of antioxidative effect in ice cream with Kalakai (Stenochlaena palustris) water extract

    Science.gov (United States)

    Hadhiwaluyo, Kristania; Rahmawati, Della; Gunawan Puteri, Maria D. P. T.

    2017-11-01

    Kalakai (Stenochlaena. palustris) extract was used to develop the ice cream. The antioxidant activity of the extracts and its stability over process and storage were evaluated through various antioxidant assay including DPPH assay, Folin-Ciocalteau assay and aluminum chloride colorimetric method. In general, the leaves of S. palustris had a significantly higher antioxidant activity (p ice cream without affecting the sensory properties of the ice cream. In addition, the high phenolic and flavonoid content also suggest the more compounds that were capable to act as an antioxidant. The result of the stability test also suggested the ability low temperature storage and processing in maintaining the stability of the antioxidant activity of the extract (p > 0.05) over processing and storage. Thus, this strengthen the feasibility of S. palustris to be used as a potential functional food ingredient that is low cost and easily accessible with an antioxidant activity and safe iron content that is beneficial to increase the quality of food produced including in ice cream.

  15. Fast lichtschnell durch die Stadt: Visualisierung relativistischer Effekte

    Science.gov (United States)

    Kraus, Ute; Borchers, Marc P.

    2005-03-01

    Eine Computersimulation ermöglicht es uns, mit annähernd Lichtgeschwindigkeit durch die Tübinger Fußgängerzone zu fahren. Was wir dabei sehen, ist verblüffend: Die Häuser vor uns rücken umso weiter in die Ferne, je mehr wir beschleunigen; gleichzeitig erscheinen die Hauskanten in unserer Nähe immer stärker gekrümmt. Der Grund für diese merkwürdigen Bilder ist die so genannte Aberration: Ein und derselbe Lichtstrahl hat für den fahrenden Beobachter eine andere Richtung als für denjenigen, der am Straßenrand steht. Dieser Effekt ist im Alltag klein. Wenn wir aber in der Simulation fast lichtschnell durch die Tübinger Altstadt rasen, ist er dramatisch groß.

  16. Evidence for a Very Early Intermediate in Bacterial Photosynthesis. A Photon-Echo and Hole-Burning Study of the Primary Donor Band in Rhodopseudomonas Sphaeroides

    NARCIS (Netherlands)

    Meech, S.R.; Hoff, A.J.

    1985-01-01

    Two coherent spectroscopic methods, accumulated photon echo and population bottleneck hole-burning, have been employed in a study of the decay rate of the primary donor (P) of Rhodopseudomonas sphaeroides at 1.5 K. The decay rate is instrument-limited in the photon-echo experiment, implying a

  17. Phosphoenolpyruvate-Dependent Fructose Phosphotransferase System of Rhodopseudomonas sphaeroides : Purification and Physicochemical and Immunochemical Characterization of a Membrane-Associated Enzyme I

    NARCIS (Netherlands)

    Brouwer, Marius; Elferink, Marieke G.L.; Robillard, George T.

    1982-01-01

    The phosphotransferase system (PTS) of the phototrophic bacterium Rhodopseudomonas sphaeroides consists of a component located in the cytoplasmic membrane and a membrane-associated enzyme called “soluble factor” (SF). SF has been partially purified by a combination of hydrophobic interaction and

  18. Evaluation of lung cancer risk from radon in homes. Smoking plays the important part; Bewertung des Lungenkrebsrisikos durch Wohnungsradon. Lungenkrebsrisiko ausschliesslich durch Rauchen verursacht

    Energy Technology Data Exchange (ETDEWEB)

    Schuettmann, W.

    1999-07-01

    Studies of lung cancer risk from the beginning of the century until today are investigated and evaluated. The result shows that the risk in homes with Radon exposure is determined exclusively by the amount of smoking. Further studies of the lung cancer risk from Radon therefore should exclusively treat with non-smokers. (orig.) [German] Studien zum Lungenkrebsrisiko durch Radon vom Anfang dieses Jahrhunderts bis heute werden untersucht und bewertet. Das Ergebnis zeigt, dass das Lungenkrebsrisiko in Wohnungen mit Radonexpositionen ausschliesslich durch den Umfang des Zigarettenrauchens bestimmt wird. Untersuchungen zur Bewertung des Lungenkrebsrisikos durch Radon sollten daher ausschliesslich bei Nichtrauchern durchgefuehrt werden. (orig.)

  19. Muscle senescence in short-lived wild mammals, the soricine shrews Blarina brevicauda and Sorex palustris.

    Science.gov (United States)

    Hindle, Allyson G; Lawler, John M; Campbell, Kevin L; Horning, Markus

    2009-06-01

    Red-toothed (soricine) shrews are consummate predators exhibiting the highest energy turnovers and shortest life spans (ca. 18 months) of any mammal, yet virtually nothing is known regarding their physiological aging. We assessed the emerging pattern of skeletal muscle senescence (contractile/connective tissue components) in sympatric species, the semi-aquatic water shrew (WS), Sorex palustris, and the terrestrial short-tailed shrew (STS), Blarina brevicauda, to determine if muscle aging occurs in wild, short-lived mammals (H(0): shrews do not survive to an age where senescence occurs), and if so, whether these alterations are species-specific. Gracilis muscles were collected from first-year (n=17) and second-year (n=17) field-caught shrews. Consistent with typical mammalian aging, collagen content (% area) increased with age in both species (S. palustris: approximately 50%; B. brevicauda: approximately 60%). Muscle was dominated by stiffer Type I collagen, and the ratio of collagen Type I:Type III more than doubled with age. The area ratio of muscle:collagen decreased with age in both species, but was considerably lower in adult STS, suggesting species-specificity of senescence. Extracellular space was age-elevated in B. brevicauda, but was preserved in S. palustris ( approximately 50 vs. 10% elevation). Though juvenile interspecific comparisons revealed no significance, adult WS myocytes had 68% larger cross-sectional area and occurred at 28% lower fibers/area than those of adult STS. We demonstrate that age-related muscle senescence does occur in wild-caught, short-lived mammals, and we therefore reject this classic aging theory tenet. Our findings moreover illustrate that differential age adjustments in contractile/connective tissue components of muscle occur in the two species of wild-caught shrews. (c) 2009 Wiley-Liss, Inc.

  20. Muscle Senescence in Short-Lived Wild Mammals, the Soricine Shrews Blarina brevicauda and Sorex palustris

    Science.gov (United States)

    HINDLE, ALLYSON G.; LAWLER, JOHN M.; CAMPBELL, KEVIN L.; HORNING, MARKUS

    2015-01-01

    Red-toothed (soricine) shrews are consummate predators exhibiting the highest energy turnovers and shortest life spans (ca. 18 months) of any mammal, yet virtually nothing is known regarding their physiological aging. We assessed the emerging pattern of skeletal muscle senescence (contractile/connective tissue components) in sympatric species, the semi-aquatic water shrew (WS), Sorex palustris, and the terrestrial short-tailed shrew (STS), Blarina brevicauda, to determine if muscle aging occurs in wild, short-lived mammals (H0: shrews do not survive to an age where senescence occurs), and if so, whether these alterations are species-specific. Gracilis muscles were collected from first-year (n = 17) and second-year (n = 17) field-caught shrews. Consistent with typical mammalian aging, collagen content (% area) increased with age in both species (S. palustris: ~50%; B. brevicauda: ~60%). Muscle was dominated by stiffer Type I collagen, and the ratio of collagen Type I:Type III more than doubled with age. The area ratio of muscle:collagen decreased with age in both species, but was considerably lower in adult STS, suggesting species-specificity of senescence. Extracellular space was age-elevated in B. brevicauda, but was preserved in S. palustris (~50 vs. 10% elevation). Though juvenile interspecific comparisons revealed no significance, adult WS myocytes had 68% larger cross-sectional area and occurred at 28% lower fibers/area than those of adult STS. We demonstrate that age-related muscle senescence does occur in wild-caught, short-lived mammals, and we therefore reject this classic aging theory tenet. Our findings moreover illustrate that differential age adjustments in contractile/connective tissue components of muscle occur in the two species of wild-caught shrews. PMID:19296507

  1. Endemic Marsh Mongoose Herpestes palustris (Carnivora: Herpestidae of East Kolkata Wetlands, India: a status report

    Directory of Open Access Journals (Sweden)

    J.K. Mallick

    2009-04-01

    Full Text Available Marsh Mongoose Herpestes palustris is the only extant endemic mammal of the East Kolkata wetlands, which has been declared a RAMSAR site in 2002. Since its first description by the scientists of the Zoological Survey of India, the population of this species has dwindled to an alarming state due to reclamation of the Salt Lake City and Rajarhat expansion, as well as from other anthropogenic causes. Recently, during a field survey only a small population of this endangered mongoose was found in a single location. Immediate conservation measures are required to be taken by the concerned authorities to stop its probable extinction in the near future.

  2. Ressourceneffizienz durch Digitalisierung: Vortrag gehalten beim Runden Tisch "Nachhaltige Digitalisierung", Digitalisierung als Motor der Nachhaltigkeit, 15. März 2017, Stuttgart

    OpenAIRE

    Sauer, Alexander

    2017-01-01

    Der Vortrag "Ressourceneffizienz durch Digitalisierung" behandelt folgende Themenkomplexe: - DigitalisierungalsInnovationstreiber - Geschäftsmodell-Innovation - Ressourceneffiziente Produktion - Expertensicht auf Unternehmenspotenziale durch Industrie 4.0

  3. The potential of Thelypteris palustris and Asparagus sprengeri in phytoremediation of arsenic contamination.

    Science.gov (United States)

    Anderson, LaShunda L; Walsh, Maud; Roy, Amitava; Bianchetti, Christopher M; Merchan, Gregory

    2011-02-01

    The potential of two plants, Thelypteris palustris (marsh fern) and Asparagus sprengeri (asparagus fern), for phytoremediation of arsenic contamination was evaluated. The plants were chosen for this study because of the discovery of the arsenic hyperaccumulating fern, Pteris vittata (Ma et al., 2001) and previous research indicating asparagus fern's ability to tolerate > 1200 ppm soil arsenic. Objectives were (1) to assess if selected plants are arsenic hyperaccumulators; and (2) to assess changes in the species of arsenic upon accumulation in selected plants. Greenhouse hydroponic experiments arsenic treatment levels were established by adding potassium arsenate to solution. All plants were placed into the hydroponic experiments while still potted in their growth media. Marsh fern and Asparagus fern can both accumulate arsenic. Marsh fern bioaccumulation factors (> 10) are in the range of known hyperaccumulator, Pteris vittata Therefore, Thelypteris palustris is may be a good candidate for remediation of arsenic soil contamination levels of arsenic. Total oxidation of As (III) to As (V) does not occur in asparagus fern. The asparagus fern is arsenic tolerant (bioaccumulation factors phytoremediation candidate.

  4. ORF Alignment: NC_005296 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available Query: 350 RNEMTARRIVTADHTILVSGSGYVPKGDLTVDGKDNPEAVSSAMQLVRSALLCNDAQLRP 409 ... RNEMTARRIVTADHT...ILVSGSGYVPKGDLTVDGKDNPEAVSSAMQLVRSALLCNDAQLRP Sbjct: 1 ... RNEMTARRIVTADHTILVSGSGYVPKGDL... ... cation-transporting P-type ATPase [Rhodopseudomonas ... palustris CGA009] ... Length = 203 ...

  5. ORF Alignment: NC_004757 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available ... [Rhodopseudomonas palustris CGA009] ... Length = 102 ... Query: 14 ... ...MRDGEFLVSKTTAKGVITYINEPFIRMSGFTEQELVGQAHNIIRHPDMPPEAFADFWNTL 73 ... + DG ++VSKT ... KG +TY NE F++ SGF+EQ

  6. ORF Alignment: NC_005296 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available ... [Rhodopseudomonas palustris CGA009] ... Length = 150 ... Query: 1 ... MRIALFQPDIPQNTGTILRFCACLNVEAHIIEPAGFPTSD...RHFRRSGMDYLDQVSIVRHD 60 ... MRIALFQPDIPQNTGTILRFCACLNVEAHIIEPAGFPTSD...RHFRRSGMDYLDQVSIVRHD Sbjct: 1 ... MRIALFQPDIPQNTGTILRFCACLNVEAHIIEPAGFPTSDRHFRRSGMDYLDQVSIVRHD 60 ... Qu

  7. Ethylene regulates fast apoplastic acidification and expansin A transcription during submergence-induced petiole elongation in Rumex palustris

    NARCIS (Netherlands)

    Vreeburg, RAM; Benschop, JJ; Peeters, AJM; Colmer, TD; Ammerlaan, AHM; Staal, M; Elzenga, TM; Staals, RHJ; Darley, CP; McQueen-Mason, SJ; Voesenek, LACJ

    The semi-aquatic dicot Rumex palustris responds to complete submergence by enhanced elongation of young petioles. This elongation of petiole cells brings leaf blades above the water surface, thus reinstating gas exchange with the atmosphere and increasing survival in flood-prone environments. We

  8. Modeling silviculture after natural disturbance to sustain biodiversity in the longleaf pine (Pinus palustris) ecosystem : balancing complexity and implementation

    Science.gov (United States)

    Brian J. Palik; Robert J. Mitchell; J. Kevin Hiers

    2002-01-01

    Modeling silviculture after natural disturbance to maintain biodiversity is a popular concept, yet its application remains elusive. We discuss difficulties inherent to this idea, and suggest approaches to facilitate implementation, using longleaf pine (Pinus palustris) as an example. Natural disturbance regimes are spatially and temporally variable. Variability...

  9. Influence of residual basal area on longleaf pine (Pinus palustris Mill.) first year germination and establishment under selection silviculture

    Science.gov (United States)

    Ferhat Kara; Edward F. Loewenstein

    2015-01-01

    Even-aged silvicultural methods have been successfully used to manage longleaf pine (Pinus palustris Mill.) forests for wood production; however, successful use of uneven-aged methods to manage this ecosystem is less well documented. In this study, the effects of varying levels of residual basal area (RBA) (9.2, 13.8, and 18.4 m2...

  10. Phytodesalinization potential of Typha angustifolia, Juncus maritimus, and Eleocharis palustris for removal of de-icing salts from runoff water.

    Science.gov (United States)

    Guesdon, Gaëlle; de Santiago-Martín, Ana; Galvez-Cloutier, Rosa

    2016-10-01

    Typha angustifolia, Juncus maritimus, and Eleocharis palustris were evaluated for de-icing salt removal from runoff water. Plants were exposed to a range of de-icing salt levels (0.2, 0.7, 4, 8, and 13 dS m(-1)) in laboratory-scale subsurface constructed wetlands (CWs) for 2 months under greenhouse conditions. Effluent characteristics, plant height, biomass, and Cl and Na removal rates and uptake were monitored. More water volume was retained in CWs of T. angustifolia (∼60 %) than of J. maritimus and E. palustris (∼37.5 %), which accounted for the electrical conductivity increase in effluents (1.3-1.9-fold). Based on the NaCl removal rate, T. angustifolia showed the greatest phytodesalinization ability (31-60 %) with the highest removal at the lowest salt levels (0.2-0.7 dS m(-1)), followed by J. maritimus (22-36 %) without differences in removal among levels, and E. palustris (3-26 %) presenting a removal rate highly decreased with increasing salt levels. Plant height and biomass were stimulated at low de-icing salt levels, but, at higher levels, T. angustifolia and E. palustris growth was inhibited (tolerance index ∼67 and 10 %, respectively, in the worst cases). Salt amounts in aboveground biomass in g m(-2) differed among levels and ranged as follows: 13.6-29.1 (Cl), 4.2-9.3 (Na; T. angustifolia); 7.0-12.0 (Cl), 2.7-6.4 (Na; J. maritimus); and 0.9-7.6 (Cl), 0.3-1.6 (Na; E. palustris). Chloride and Na translocation decreased with de-icing salt increase in T. angustifolia, while no significant differences were found in J. maritimus, which is interesting for harvesting purposes.

  11. Experiments on accumulation of phosphorus in the plants Myosotis palustris, Glyceria maxima and Nasturtium officinale

    Directory of Open Access Journals (Sweden)

    O. Prokopchuk

    2016-10-01

    Full Text Available The problem of availability of quality water is highly relevant today, so the technologies of prediction and prevention of water pollution and purification are very important. Biological methods of cleaning, in paticular cleaning water by the so-called method of biosorption, have been increasingly used in the last decade. This method means the removal of dangerous substances and improvement of water condition by using aquatic organisms, in particular plants. Therefore, in view of the rich experience of research conducted in the biosorption sphere, we decided to predict the effectiveness of this method by using the cumulative ability of higher water plants to absorb phosphorus compounds. For this purpose, we selected water and plant samples (Glyceria maxima (C. Hartm. Holmb., Nasturtium officinale R. Br., Myosotis palustris (L. L. from the river Seret (Ternopil, Ukraine. The plants were placed into sterilized glass jars filled with 3 liters of water from the river Seret (control samples and still tap water with addition of sodium phosphate with phosphorus concentration of 3.5 mg/dm³ (research sample, which were cultured in laboratory conditions for four months. We determined the content of phosphates, permanganate and dichromate oxidation in the water and the total content of phosphorus in the plants. We traced the dynamic of organic substances and the content of phosphates in the water, the accumulation of phosphorus in plants and the rate of accumulation of phosphorus in the plants and in the water. We calculated correlation coefficients to detect the dependence between phosphorus indicators in the aquatic plants and the concentration of phosphate ions in the water. We found that M. palustris had the greatest capacity to accumulate phosphorus and the highest rate of phosphorus accumulation from water, which allows us to consider it the most effective aquatic plant for absorption of elements and decreasing water pollution. We also established

  12. Entgrenzung durch Medien: Internationalisierungsprozesse als Rahmenbedingung der Mediendidaktik

    Directory of Open Access Journals (Sweden)

    Michael Klebl

    2006-07-01

    Full Text Available Die Mediendidaktik ist eine Teildisziplin der Medienpädagogik und hat in den vergangenen Jahren einen enormen Zuwachs an Nachfrage und Bedeutung erfahren. Dieser Bedeutungszuwachs ist bedingt durch den verstärkten Einsatz digitaler Informations- und Kommunikationstechniken in Bildungsprozessen (Stichwort «E- Learning». Der vorliegende Beitrag entwickelt die These, dass die Mediendidaktik ausgehend von medientechnischen Entwicklungen im Kontext von Globalisierung einer Entgrenzung unterworfen ist. Diese Entgrenzung ist Chance und Risiko zugleich. Der vorliegende Beitrag klärt zunächst den Begriff der Entgrenzung. Anhand dreier Phänomene werden Prozesse der Entgrenzung für die Mediendidaktik beschrieben. Ausgehend von der Problematisierung der Prozesse von Entgrenzung werden abschliessend einige Folgerungen für die Mediendidaktik als Teildisziplin der Medienpädagogik zur Diskussion gestellt.

  13. Amerikanisierung durch Internationalisierung: Die Expansion der International Communication Association (ICA

    Directory of Open Access Journals (Sweden)

    Thomas Wiedemann

    2016-12-01

    Full Text Available Basierend auf der Soziologie Bourdieus problematisiert dieser Beitrag die Bemühungen der International Communication Association (ICA, sich über die Öffnung ihrer Führungsetage für Wissenschaftler außerhalb der USA in eine wahrhaft internationale Fachgesellschaft zu verwandeln und der Herausforderung einer global vernetzten Disziplin zu begegnen. Geleistet werden soll so ein kritischer Beitrag zur Selbstreflexion der Kommunikationswissenschaft, zu verstehen als Deutungsangebot und Ausgangspunkt für die wissenschaftliche Diskussion. Die Untersuchung von Habitus und Kapital der 29 ICA-Präsidenten und ICA Fellows aus der internationalen Scientific Community zeigt, dass die weltweit größte kommunikationswissenschaftliche Fachgesellschaft trotz der Ausweitung ihrer Führungsriege immer noch deutlichen US-Einflüssen unterliegt. Die neuen ICAWürdenträger, die für nationale und fachliche Vielfalt stehen sollen, stammen aus Weltregionen, die eine besondere Nähe zu den Vereinigten Staaten auszeichnet, und wurden an US-Universitäten sozialisiert oder stark von der US-amerikanischen Forschungstradition geprägt. Ausnahmen („Einkäufe“ von führenden Vertretern anderer Fachgesellschaften oder alternativer Paradigmen bestätigen die Regel. Die Internationalisierung der ICA-Führungsetage veränderte demzufolge weniger den Machtpol im Fach als vielmehr die Kommunikationswissenschaft weltweit. Zwar gelangten neue Perspektiven ins Zentrum der Disziplin. Im Gegenzug fand jedoch eine Amerikanisierung nationaler Felder statt, allen voran durch ICA Fellows als Vorbilder im Kampf um wissenschaftliches Kapital. Die Bemühungen der ICA, sich durch die Expansion ihrer Führungsriege zu internationalisieren, dürften somit die Machtstrukturen im Fach weiter verfestigt haben.

  14. Current status of Marsh Crocodiles Crocodylus palustris (Reptilia: Crocodylidae in Vishwamitri River, Vadodara City, Gujarat, India

    Directory of Open Access Journals (Sweden)

    R. Vyas

    2012-11-01

    Full Text Available Data presented here is based on a three year study (2008-2010 on a population of Mugger Crocodylus palustris inhabiting Vishwamitri River near Vadodara City, Gujarat State, India. In total, 155 Muggers were counted in the 25km river stretch during 2010. In all, 40 burrows were observed along the river bank, and the same were clumped in certain sections of the river. Muggers fed eight species of birds, and domestic livestock in addition to scavenging. Eight instances of human-crocodile conflicts were observed including four human causalities. A total 90 Muggers were rescued from the urban areas and the same were relocated elsewhere in the river system. Various types of threats to Mugger were also noticed including habitat loss, alteration and soil erosion and mortality due to rail traffic. The present study suggests further research to propose strategies to conserve this population.

  15. Differences in mycorrhizal communities between Epipactis palustris, E. helleborine and its presumed sister species E. neerlandica.

    Science.gov (United States)

    Jacquemyn, Hans; Waud, Michael; Lievens, Bart; Brys, Rein

    2016-07-01

    In orchid species that have populations occurring in strongly contrasting habitats, mycorrhizal divergence and other habitat-specific adaptations may lead to the formation of reproductively isolated taxa and ultimately to species formation. However, little is known about the mycorrhizal communities associated with recently diverged sister taxa that occupy different habitats. In this study, 454 amplicon pyrosequencing was used to investigate mycorrhizal communities associating with Epipactis helleborine in its typical forest habitat and with its presumed sister species E. neerlandica that almost exclusively occurs in coastal dune habitats. Samples of the phylogenetically more distant E. palustris, which co-occurred with E. neerlandica, were also included to investigate the role of habitat-specific conditions on mycorrhizal communities. A total of 105 operational taxonomic units (OTUs) of putative orchid mycorrhizal fungi were observed in the three studied species. The majority of these fungi were endophytic fungi of Helotiales and ectomycorrhizal fungi belonging to Thelephoraceae, Sebacinaceae and Inocybaceae. In addition, a large number of other ectomycorrhizal taxa were detected, including Cortinarius, Cenococcum, Tuber, Geopora, Wilcoxina, Meliniomyces, Hebeloma, Tricholoma, Russula and Peziza Mycorrhizal communities differed significantly between the three species, but differences were most pronounced between the forest species (E. helleborine) and the two dune slack species (E. neerlandica and E. palustris). The results clearly showed that recently diverged orchid species that occupy different habitats were characterized by significantly different mycorrhizal communities and call for more detailed experiments that aim at elucidating the contribution of habitat-specific adaptations in general and mycorrhizal divergence in particular to the process of speciation in orchids. © The Author 2016. Published by Oxford University Press on behalf of the Annals of Botany

  16. R-prime site-directed transposon Tn7 mutagenesis of the photosynthetic apparatus in Rhodopseudomonas capsulata

    Energy Technology Data Exchange (ETDEWEB)

    Youvan, D C [Univ. of California, Berkeley; Elder, J T; Sandlin, D E; Zsebo, K; Alder, D P; Panopoulos, N J; Marrs, B L; Hearst, J E

    1982-01-01

    Site-directed mutagenesis of the photosynthetic apparatus (PSA) genes in Rhodopseudomonas capsulata is presented utilizing a transposon Tn7 mutagenized R-prime. The R-prime, pRPS404, bears most of the genes necessary for the differentiation of the photosynthetic apparatus. Mutagenesis of the R-prime with Tn7 in Escherichia coli, conjugation into R. capsulata, and homologous recombination with the wild-type alleles efficiently generates photosynthetic apparatus lesions. Wild-type alleles are lost spontaneously and the Tn7-induced lesions are revealed by subsequent intramolecular recombination between IS21 insertion elements that bracket the prime sequences in direct repeat. The molecular nature of the intermediates involved in the transposition, recombination and deletion have been investigated by Southern hybridization analysis. The spontaneous loss of wild-type alleles after homologous recombination with the chromosome may be of general use to other prokaryotic site-directed transposon mutagenesis schemes. The IS21-mediated deletion of the prime DNA is dependent on the RecA protein in E. coli, generating the parental R-factor bearing one IS21 element. A genetic-physical map exists for a portion of the prime photosynthetic apparatus DNA. When Tn7 is inserted into a bacteriochlorophyll gene in the R-prime and then crossed into R. capsulata, mutants are produced that accumulate a bacteriochlorophyll precursor, which is in excellent agreement with the existing genetic-physical map. This corroborates the mutagenesis scheme.

  17. Traffic-emitted metal status and uptake by Carex meyeriana Kunth and Thelypteris palustris var. pubescens Fernald growing in roadside turfy swamp in the Changbai Mountain area, China.

    Science.gov (United States)

    Wang, Hong; Nie, Lei; Xu, Yan; Li, Miao; Lv, Yan

    2018-04-26

    Six traffic-emitted metals (Cr, Zn, Cu, Cd, Pb, and Ni) were determined in soil and plants for below- and aboveground parts along different distances from highway to evaluate their behavior and uptake by Carex meyeriana Kunth and Thelypteris palustris var. pubescens Fernald growing in turfy swamps. The results indicated that the different plant tissues showed significantly different levels of metal content. Nonlinear regression analysis indicated that metal contents leveled off at constant values before they decreased as the distance from the roadside increased. The high R 2 values of the regression model indicated good fit of the exponential function applied to depict the distribution pattern of the metal elements. It was deduced that Cr, Cu, and Cd in Thelypteris palustris var. pubescens Fernald were mainly derived from the soil; Carex meyeriana Kunth and Thelypteris palustris var. pubescens Fernald absorbed Pb mainly through the stomata from atmospheric depositions; Cr, Cu, and Cd in Carex meyeriana Kunth and Zn in Thelypteris palustris var. pubescens Fernald were mainly affected by soil and atmospheric depositions. After excluding the effects of traffic, only the bioaccumulation factor of Cd (1.34) in Carex meyeriana Kunth and the translocation factor of Zn (1.13) in Thelypteris palustris var. pubescens Fernald were greater than 1, suggesting that Carex meyeriana Kunth could be a good candidate for assimilating Cd from soils and Thelypteris palustris var. pubescens Fernald could be suitable for the phytoextraction of Zn.

  18. Correlation between oxalic acid production and tolerance of Tyromyces palustris strain TYP-6137 to N',N-naphthaloylhydroxamine

    Science.gov (United States)

    Rachel A. Arango; Patricia K. Lebow; Frederick III Green

    2009-01-01

    Eleven strains of T. palustris were evaluated for mass loss and production of phosphate buffer soluble oxalic acid on pine wood blocks treated with 0.5% N’,N-naphthaloylhydroxamine (NHA) in a soil-block test. After 12 weeks higher percentage mass loss was observed in control groups for 10 strains, while TYP-6137 was shown to be tolerant with no difference between the...

  19. Israelische Public Diplomacy und ihre Wahrnehmung durch deutsche Journalisten

    Directory of Open Access Journals (Sweden)

    Florian Fleischer

    2014-07-01

    Full Text Available Public Diplomacy stellt insbesondere für Staaten in internationalen Konflikten wie Israel ein wichtiges Kommunikationsinstrument dar, um ausländische Bevölkerungen zu erreichen. Der Artikel zeigt die Ergebnisse einer Studie, in der untersucht wurde, wie die israelische Public Diplomacy von deutschen Journalisten aufgenommen und verarbeitet wird. Journalisten kommt dabei eine Schlüsselrolle als Mittler zwischen dem israelischen Staat und der deutschen Bevölkerung zu. In Anlehnung an den Katalog der Public Diplomacy-Maßnahmen von Gilboa (2006 wurde die Relevanz einzelner Maßnahmen für Journalisten erfragt. Die Ergebnisse zeigen, dass persönliche Kontakte für Journalisten nach wie vor eine wichtige Quelle darstellen und nicht von Cyber-Public Diplomacy ersetzt werden können. Staatliche Public Diplomacy wird zwar wahrgenommen, jedoch wird ihre Objektivität bezweifelt, während NGOs und Stiftungen als vertrauenswürdiger eingestuft werden. Des Weiteren wird Israel in der Öffentlichkeit nach wie vor dominierend mit dem Nahostkonflikt identifiziert, was sich nach Meinung der befragten Journalisten auch in Zukunft nicht durch gezielte Öffentlichkeitsarbeit verhindern lässt.

  20. Toxicity of sulfide to early life stages of wild rice (Zizania palustris).

    Science.gov (United States)

    Fort, Douglas J; Todhunter, Kevin; Fort, Troy D; Mathis, Michael B; Walker, Rachel; Hansel, Mike; Hall, Scott; Richards, Robin; Anderson, Kurt

    2017-08-01

    The sensitivity of wild rice (Zizania palustris) to sulfide is not well understood. Because sulfate in surface waters is reduced to sulfide by anaerobic bacteria in sediments and historical information indicated that 10 mg/L sulfate in Minnesota (USA) surface water reduced Z. palustris abundance, the Minnesota Pollution Control Agency established 10 mg/L sulfate as a water quality criterion in 1973. A 21-d daily-renewal hydroponic study was conducted to evaluate sulfide toxicity to wild rice and the potential mitigation of sulfide toxicity by iron (Fe). The hydroponic design used hypoxic test media for seed and root exposure and aerobic headspace for the vegetative portion of the plant. Test concentrations were 0.3, 1.6, 3.1, 7.8, and 12.5 mg/L sulfide in test media with 0.8, 2.8, and 10.8 mg/L total Fe used to evaluate the impact of iron on sulfide toxicity. Visual assessments (i.e., no plants harvested) of seed activation, mesocotyl emergence, seedling survival, and phytoxicity were conducted 10 d after dark-phase exposure. Each treatment was also evaluated for time to 30% emergence (ET30), total plant biomass, root and shoot lengths, and signs of phytotoxicity at study conclusion (21 d). The results indicate that exposure of developing wild rice to sulfide at ≥3.1 mg sulfide/L in the presence of 0.8 mg/L Fe reduced mesocotyl emergence. Sulfide toxicity was mitigated by the addition of Fe at 2.8 mg/L and 10.8 mg/L relative to the control value of 0.8 mg Fe/L, demonstrating the importance of iron in mitigating sulfide toxicity to wild rice. Ultimately, determination of site-specific sulfate criteria taking into account factors that alter toxicity, including sediment Fe and organic carbon, are necessary. Environ Toxicol Chem 2017;36:2217-2226. © 2017 SETAC. © 2017 SETAC.

  1. Hydrogen gas production by fermentation from various organic wastewater using Clostridium butyricum NCIB 9576 and Rhodopseudomonas sphaeroides E15-1

    Energy Technology Data Exchange (ETDEWEB)

    Yoon, Young Sue; Kim, Hyun Kyung; Rye, Hye Yeon; Lee, In Gu; Kim, Mi Sun [Biomass Research Team, Korea Institute of Energy Research, Taejeon (Korea)

    2000-03-01

    Anaerobic fermentation using Clostidium butyricum NCIB 9576, and phto-fermentation using Rhodopseudomonas sphaeroides E15-1 were studied for the production of hydrogen from Makkoli, fruits (orange and apple, watermelon and melon) and Tofu wastewaters. From the Makkoli wastewater, which contained 0.94 g/liter sugars and 2.74 g/liter solubel starch, approximately 49 mM H{sub 2}/liter wastewater was produced during the initial 18h of the anaerobic fermentation with pH control between 6.5-7.0. Several organic acids such as butyric acid, acetic acid, propionic acid, lactic acid and ethanol were also produced. From watermelon and melon wastewater, which contained 43 g/liter sugars, generated about approximately 71 mM H{sub 2}/liter wastewater was produced during the initial 24h of the anaerobic fermentation. Tofu wastewater, pH 6.5, containing 12.6 g/liter soluble starch and 0.74 g/liter sugars, generated about 30mM H{sub 2}/liter wastewater, along with some organic acids, during the initial 24 h of anaerobic fermentation. Makkoli and Tofu wastewaters as substrates for the photo-fermentation by Rhodopseudomonas sphaeroides E15-1 produced approximately 37.9 and 22.2 {mu}M H{sub 2}/ml wastewaters, respectively for 9 days of incubation under the average of 9,000010,000 lux illumination at the surface of reactor using tungsten halogen lamps. Orange and apple wastewater, which contained 93.4 g/l produced approximately 13.1 {mu}M H{sub 2}/ml wastewater only for 2 days of photo-fermentation and the growth of Rhodopseudomonas spnaeroides E15-1 and hydrogen production were stopped. 22 refs, 4 figs., 2 tabs.

  2. Synchrotron small-angle x-ray scattering investigation on integral membrane protein light-harvesting complex LH2 from photosynthetic bacterium rhodopseudomonas acidophila

    International Nuclear Information System (INIS)

    Du Luchao; Weng Yuxiang; Hong Xinguo; Xian Dingchang; Kobayashi Katsumi

    2006-01-01

    Structures of membrane protein in solution are different from that in crystal phase. We present the primary results of small angle x-ray scattering (SAXS) resolved topological structures of a light harvesting antenna membrane protein complex LH2 from photosynthetic bacteria Rhodopseudomonas acidophila in detergent solution for the first time. Our results show that the elliptical shape of the LH2 complex in solution clearly deviates from its circular structure in crystal phase determined by x-ray diffraction. This result provides an insight into the structure and function interplay in LH2. (authors)

  3. Aptitude of Lymnaea palustris and L. stagnalis to Fasciola hepatica larval development through the infection of several successive generations of 4-mm-high snails.

    Science.gov (United States)

    Vignoles, P; Rondelaud, D; Dreyfuss, G

    2016-06-01

    Bimiracidial infections of Lymnaea palustris and Lymnaea stagnalis (shell height at exposure, 4 mm) with Fasciola hepatica were carried out during six successive snail generations to determine if prevalence and intensity of snail infection increased over time through descendants issuing from eggs laid by parents already exposed to this digenean. Controls were constituted by a French population of Galba truncatula (a single generation) infected according to the same protocol. In a first experiment performed with the F1 to F5 generations of L. palustris, the prevalence and intensity of F. hepatica infection in snails progressively increased. Immature rediae and a few cercariae-containing rediae of the digenean were observed in L. stagnalis from the F3 generation, but no free cercaria was noted in the bodies of this lymnaeid from the F4 to F6 generations. In another experiment carried out with the F6 generation of L. palustris, the prevalence of F. hepatica infection and the number of shed cercariae were significantly lower in L. palustris than in G. truncatula. This mode of snail infection suggests an explanation for cases of human fasciolosis occurring in central France after the collection of wild watercress from beds where L. palustris was the sole lymnaeid.

  4. Linear-dichroism measurements on the LH2 antenna complex of Rhodopseudomonas Acidophila strain 10050 show that the transition dipole moment of the Carotenoid Rhodopin Glucoside us nit collinair with the long molecular axis

    NARCIS (Netherlands)

    Georgakopoulou, S.; Gogdell, R.J.; Grondelle, van R.; Amerongen, van H.

    2003-01-01

    We have applied linear-dichroism experiments to determine the orientation of the transition dipole moment, corresponding to the main absorption band of the carotenoid, rhodopin glucoside, in the light-harvesting complex LH2 from Rhodopseudomonas acidophila strain 10050. The crystal structure of this

  5. Gnotobiotic cultures of rice plants up to ear stage in the absence of combined nitrogen source but in the presence of free living nitrogen fixing bacteria Azotobacter vinelandii and Rhodopseudomonas capsulata

    International Nuclear Information System (INIS)

    Maudinas, B.; Chemardin, M.; Yovanovitch, E.; Gadal, P.

    1981-01-01

    An all glass tight growth chamber, entirely sterilizable, has been constructed to carry out axenic and gnotobiotic cultures of rice plants (Oryza sativa L.). When grown in liquid medium and in the absence of combined nitrogen but in the presence of the diazotrophs Azotobacter vinelandii and Rhodopseudomonas capsulata, rice plants exhibited a complete biological cycle from germination up to ear stage, during a period of time similiar to the one encountered in French paddy soil of Camargue. In one experiment, mannitol was given to rice culture medium together with Azotobacter vinelandii and Rhodopseudomonas capsulata. In another experiment, mannitol was not given together with Rhodopseudomonas, and still positive nitrogen gain was obtained, although it was less than culture with mannitol. When 15 N labeled cells of Rhodopseudomonas were added in rice culture medium, 15 N was partly transferred to rice plant. Among the nitrogen substances excreted from the bacteria in the rhizosphere medium, large organic molecules were shown to be the most abundant in our experimental conditions. Moreover, the concentration of free ammonia or aminoacids present in the rice rhizosphere were always compatible with a bacterial nitrogenase activity. (orig.)

  6. Hydraulic architecture and tracheid allometry in mature Pinus palustris and Pinus elliottii trees.

    Science.gov (United States)

    Gonzalez-Benecke, C A; Martin, T A; Peter, G F

    2010-03-01

    Pinus palustris Mill. (longleaf pine, LL) and Pinus elliottii Engelm. var. elliottii (slash pine, SL) frequently co-occur in lower coastal plain flatwoods of the USA, with LL typically inhabiting slightly higher and better-drained microsites than SL. The hydraulic architecture and tracheid dimensions of roots, trunk and branches of mature LL and SL trees were compared to understand their role in species microsite occupation. Root xylem had higher sapwood-specific hydraulic conductivity (k(s)) and was less resistant to cavitation compared with branches and trunk sapwood. Root k(s) of LL was significantly higher than SL, whereas branch and trunk k(s) did not differ between species. No differences in vulnerability to cavitation were observed in any of the organs between species. Across all organs, there was a significant but weak trade-off between water conduction efficiency and safety. Tracheid hydraulic diameter (D(h)) was strongly correlated with k(s) across all organs, explaining >73% of the variation in k(s). In contrast, tracheid length (L(t)) explained only 2.4% of the variability. Nevertheless, for trunk xylem, k(s) was 39.5% higher at 20 m compared with 1.8 m; this increase in k(s) was uncorrelated with D(h) and cell-wall thickness but was strongly correlated with the difference in L(t). Tracheid allometry markedly changed between sapwood of roots, trunks and branches, possibly reflecting different mechanical constraints. Even though vulnerability to cavitation was not different for sapwood of roots, branches or the trunks of LL and SL, higher sapwood to leaf area ratio and higher maximum sapwood-specific hydraulic conductivity in roots of LL are functional traits that may provide LL with a competitive advantage on drier soil microsites.

  7. Ecosystem engineering potential of the gastropod Terebralia palustris (Linnaeus, 1767) in mangrove wastewater wetlands - A controlled mesocosm experiment

    Energy Technology Data Exchange (ETDEWEB)

    Penha-Lopes, Gil, E-mail: gil.penha-lopes@biology-research.co [Centro de Oceanografia - Laboratorio Maritimo da Guia, Departamento de Biologia Animal, Faculdade de Ciencias da Universidade de Lisboa, Avenida Na, Senhora do Cabo 939, 2750-374 Cascais (Portugal); Department of Analytical and Environmental Chemistry, Vrije Universiteit Brussels, Brussels (Belgium); Bartolini, Fabrizio [Dipartimento di Biologia Evoluzionistica, Universita degli Studi di Firenze, via Romana 17, I-50125 Firenze (Italy); Limbu, Samwel [University of Dar es Salaam, Department of Aquatic Sciences and Fisheries, P.O. Box 35064, Dar es Salaam (Tanzania, United Republic of); Cannicci, Stefano [Dipartimento di Biologia Evoluzionistica, Universita degli Studi di Firenze, via Romana 17, I-50125 Firenze (Italy); Mgaya, Yunus [University of Dar es Salaam, Department of Aquatic Sciences and Fisheries, P.O. Box 35064, Dar es Salaam (Tanzania, United Republic of); Kristensen, Erik [Institute of Biology, University of Southern Denmark, DK-5230 Odense M (Denmark); Paula, Jose [Centro de Oceanografia - Laboratorio Maritimo da Guia, Departamento de Biologia Animal, Faculdade de Ciencias da Universidade de Lisboa, Avenida Na, Senhora do Cabo 939, 2750-374 Cascais (Portugal)

    2010-01-15

    The effect of different sewage concentrations (0, 20, 60 and 100%), vegetation (Bare, Avicennia marina or Rhizophora mucronata) and immersion periods (immersion/emersion period of 12/12 h or 3/3 days just for 100%) conditions were studied for 6 months on survival and growth rates of Terebralia palustris (Linnaeus, 1767). Gastropods' activity and ecosystem engineering preformed at bare and A. marina planted cells and 3 sewage conditions (0, 20 and 60%) were determined. Survival rates were higher than 70% in all treatments. Growth rate decreased significantly with increasing sewage concentrations (mainly at unplanted conditions) and longer immersion periods. A complete shift (from immersion to emersion periods) and a significant decrease in mobility and consequently its engineer potential, due to sewage contamination, lead to a 3-4 fold decrease in the amount of sediment disturbed. Sewage contamination, primary producers' abundance and environmental conditions may have influenced the gastropods survival, growth and its ecosystem engineering potential. - Terebralia palustris high ecosystem engineering potential in constructed mangrove wetlands.

  8. Differential responses of the freshwater wetland species Juncus effusus L. and Caltha palustris L. to iron supply in sulfidic environments

    International Nuclear Information System (INIS)

    Welle, Marlies E.W. van der; Niggebrugge, Karla; Lamers, Leon P.M.; Roelofs, Jan G.M.

    2007-01-01

    Sulfur pollution can lead to serious problems in freshwater wetlands, including phosphorus eutrophication and sulfide toxicity. We tested the effects of anaerobic iron-rich groundwater discharge in fens, simulated by iron injection, on two characteristic species (Juncus effusus and Caltha palustris) in a sulfidic environment. Biomass production of C. palustris roots showed an optimum response to the combined addition of iron and sulfide, with highest values at intermediate concentrations of both substances. Iron deficiency apparently occurred at low iron concentrations, while at high iron concentrations, growth was decreased. For J. effusus, in contrast, no toxic effects were found of both iron and sulfide. This could be explained by larger radial oxygen loss (ROL) of J. effusus and could not be explained by differences in phosphorous concentrations. The results of our experiments confirm that iron-rich groundwater discharge has the potential to affect vegetation composition through toxicity modification in sulfidic environments. - Toxicity of iron and sulfide are interacting with each other and have the potential to affect vegetation composition

  9. Fluorescence-excitation and emission spectra from LH2 antenna complexes of Rhodopseudomonas acidophila as a function of the sample preparation conditions.

    Science.gov (United States)

    Kunz, Ralf; Timpmann, Kõu; Southall, June; Cogdell, Richard J; Köhler, Jürgen; Freiberg, Arvi

    2013-10-10

    The high sensitivity of optical spectra of pigment-protein complexes to temperature and pressure is well known. In the present study, we have demonstrated the significant influence of the environments commonly used in bulk and single-molecule spectroscopic studies at low temperatures on the LH2 photosynthetic antenna complex from Rhodopseudomonas acidophila. A transfer of this LH2 complex from a bulk-buffer solution into a spin-coated polymer film results in a 189 cm(-1) blue shift of the B850 excitonic absorption band at 5 K. Within the molecular exciton model, the origin of this shift could be disentangled into three parts, namely to an increase of the local site energies, a contraction of the exciton band, and a decrease of the displacement energy.

  10. Correlation of paramagnetic states and molecular structure in bacterial photosynthetic reaction centers: The symmetry of the primary electron donor in Rhodopseudomonas viridis and Rhodobacter sphaeroides R-26

    International Nuclear Information System (INIS)

    Norris, J.R.; Budil, D.E.; Gast, P.; Chang, C.H.; El-Kabbani, O.; Schiffer, M.

    1989-01-01

    The orientation of the principal axes of the primary electron donor triplet state measured in single crystals of photosynthetic reaction centers is compared to the x-ray structures of the bacteria Rhodobacter (Rb.) sphaeroides R-26 and Rhodopseudomonas (Rps.) viridis. The primary donor of Rps. viridis is significantly different from that of Rb. sphaeroides. The measured directions of the axes indicate that triplet excitation is almost completely localized on the L-subunit half of the dimer in Rps. viridis but is more symmetrically distributed on the dimeric donor in Rb. sphaeroides R-26. The large reduction of the zero field splitting parameters relative to monomeric bacteriochlorophyll triplet in vitro suggests significant participation of asymmetrical charge transfer electronic configurations in the special pair triplet state of both organisms

  11. Genome assembly of the fungus Cochliobolus miyabeanus, and transcriptome analysis during early stages of infection on American wild rice (Zizania palustris L.)

    Science.gov (United States)

    Cochliobolus miyabeanus causes a severe, yield-reducing leaf spot disease on rice (Oryza sativa) and two North American specialty crops, American wildrice (Zizania palustris) and switchgrass (Panicum virgatum). Despite the importance of the pathogen in wildrice, little is known about mechanisms of p...

  12. Long-term effects of fire and fire-return interval on population structure and growth of longleaf pine (Pinus palustris)

    Science.gov (United States)

    Chelcy R. Ford; Emily S. Minor; Gordon A. Fox

    2010-01-01

    We investigated the effect of fire and fire frequency on stand structure and longleaf pine (Pinus palustris P. Mill.) growth and population demography in an experimental research area in a southwest Florida sandhill community. Data were collected from replicated plots that had prescribed fire-return intervals of 1, 2, 5, or 7 years or were left...

  13. Effects of site preparation treatments on early growth and survival of planted longleaf pine (Pinus palustris Mill.) seedlings in North Carolina

    Science.gov (United States)

    Benjamin O. Knapp; G. Geoff Wang; Joan L. Walker; Susan Cohen

    2006-01-01

    We tested the effects of eight site preparation treatments on early growth and survival of container-grown longleaf pine (Pinus palustris Mill.) seedlings. Treatments included an untreated check, six combinations of two initial vegetation control treatments (chopping or herbicide) with three planting site conditions (flat [no additional treatment],...

  14. High-resolution bioactivity profiling combined with HPLC-HRMS-SPE-NMR: α-glucosidase inhibitors and acetylated ellagic acid rhamnosides from Myrcia palustris DC. (Myrtaceae)

    DEFF Research Database (Denmark)

    Wubshet, Sileshi Gizachew; Moresco, Henrique H.; Tahtah, Yousof

    2015-01-01

    , and therefore improved drug leads or functional foods containing α-glucosidase inhibitors are needed for management of blood glucose. In this study, leaves of Myrcia palustris were investigated by high-resolution α-glucosidase inhibition profiling combined with HPLC–HRMS–SPE–NMR. This led to identification...

  15. Purification, molecular cloning, and enzymatic properties of a family 12 endoglucanase (EG-II) from fomitopsis palustris: role of EG-II in larch holocellulose hydrolysis.

    Science.gov (United States)

    Shimokawa, Tomoko; Shibuya, Hajime; Nojiri, Masanobu; Yoshida, Shigeki; Ishihara, Mitsuro

    2008-09-01

    A family 12 endoglucanase with a molecular mass of 23,926 Da (EG-II) from the brown-rot basidiomycete Fomitopsis palustris was purified and characterized. One of the roles of EG-II in wood degradation is thought to be to loosen the polysaccharide network in cell walls by disentangling hemicelluloses that are associated with cellulose.

  16. Comparison of red-cockaded woodpecker (Picoides borealis) nestling diet in old-growth and old-field longleaf pine (Pinus palustris) habitats

    Science.gov (United States)

    James L. Hanula; R. Todd Engstrom

    2000-01-01

    Automatic cameras were used to record adult red-cockaded woodpecker (Picoides borealis) nest visits with food for nestlings. Diet of nestlings on or near an old-growth longleaf pine (Pinus palustris) remnant in southern Georgia was compared to that in longleaf pine stands established on old farm fields in western South Carolina....

  17. Review: Findeisen, Genia: Frauen in Indonesien: Geschlechtergleichheit durch Demokratisierung? Eine Analyse des Demokratisierungsprozesses aus Frauenperspektive (2008 Buchbesprechung: Findeisen, Genia: Frauen in Indonesien: Geschlechtergleichheit durch Demokratisierung? Eine Analyse des Demokratisierungsprozesses aus Frauenperspektive (2008

    Directory of Open Access Journals (Sweden)

    Carola von der Dick

    2009-04-01

    Full Text Available Review of the monograph: Findeisen, Genia: Frauen in Indonesien: Geschlechtergleichheit durch Demokratisierung? Eine Analyse des Demokratisierungsprozesses aus Frauenperspektive Wettenberg: Johannes Herrmann J&J Verlag, 2008, ISBN 978-3-937983-11-0, 434 pages Besprechung der Monographie: Findeisen, Genia: Frauen in Indonesien: Geschlechtergleichheit durch Demokratisierung? Eine Analyse des Demokratisierungsprozesses aus Frauenperspektive Wettenberg: Johannes Herrmann J&J Verlag, 2008, ISBN 978-3-937983-11-0, 434 Seiten

  18. Multiple benefits through intelligent combination. Economic inventory optimization through the use of photovoltaics; Mehrfachnutzen durch intelligente Kombination. Wirtschaftliche Bestandsoptimierung durch Nutzung von Photovoltaik

    Energy Technology Data Exchange (ETDEWEB)

    Anon.

    2013-10-15

    By installing a PV system the roof areas are additionally used for power generation. To ensure the operability permanently, they must be carefully planned, built and maintained. Based on three demonstration examples it is shown how inventory optimization can be achieved by maintaining high quality standards (tennis hall Oberthal and Ottweiler, warehouse roof of the building material dealer Lauer). [German] Durch die Installation einer PV-Anlage werden die Dachflaechen zusaetzlich zur Energiegewinnung genutzt. Um die Funktionsfaehigkeit dauerhaft zu gewaehrleisten, muessen sie sorgfaeltig geplant, gebaut und gewartet werden. Anhand von drei Demonstrationsbeispielen (Tennishalle Oberthal und Ottweiler, Lagerhallendach des Baustoffhaendlers Lauer) wird gezeigt, wie die Bestandsoptimierung unter Einhaltung hoher Qualitaetsstandards geloest werden kann.

  19. Lipase-katalysierte Synthese strukturierter Triglyceride: Verfahrensoptimierung und Erzeugung selektiver Lipasemutanten durch gerichtete Evolution

    OpenAIRE

    Schmid, Ulrike

    1999-01-01

    In der vorliegenden Arbeit wurde zum einen die Lipase-Katalysierte Synthese strukturierter Triglyceride, zum anderen die Veränderung der Kettenlängenselektivität der slip1-Lipase aus C. rugosa durch gerichtete Evolution untersucht. Besonderes Interesse galt der Synthese von strukturierten Triglyceriden des ABA-Typs, die aufgrund ihrer symmetrischen Struktur zur Therapie von Fettabsorptionsproblemen wie z.B. Pankreasinsuffizienz eingesetzt werden können. Besonderes Interesse galt dabei der ...

  20. Size-dependent distribution and feeding habits of Terebralia palustris in mangrove habitats of Gazi Bay, Kenya

    Science.gov (United States)

    Pape, Ellen; Muthumbi, Agnes; Kamanu, Chomba Peter; Vanreusel, Ann

    2008-03-01

    The gastropod Terebralia palustris often dominates the surface of muddy to sandy substrates of intertidal mudflats and mangrove forests, where they clearly destabilize the sediment. In the present study, it was investigated whether and to what extent the behaviour of juvenile and adult snails differs among habitats (mudflat vs. mangrove stand) in a Sonneratia alba mangal at Gazi Bay, Kenya. For this purpose we: (1) examined their distribution along three land-sea transects; and (2) applied stable isotope analysis to determine the feeding patterns of different-sized snails from the mangrove and mudflat habitats. Additionally, we investigated if these gastropods exert an impact on microphytobenthic (diatom) biomass, and whether this is size-dependent. The latter objective was met by either enclosing or excluding different-sized snails from experimental cages on the intertidal mudflat and the subsequent assessment of a change in pigment concentration of the sediment surface. In agreement with several previous studies conducted in other mangroves and geographical locations, a spatial segregation was demonstrated between juveniles (more common on the mudflat) and adults (more common in the mangrove forest). On the intertidal mudflat juveniles avoided sediment patches characterized by highly saline water in intertidal pools and a high mud content, while adults tended to dwell on substrates covered by a high amount of leaf litter. Stable carbon isotope analysis of the foot tissue of snails sampled from the S. alba stand and the mudflat indicated a transition in food source when a shell length of 51 mm is reached. Considering the δ13C value of juveniles, it seems they might be selecting for microphytobenthos, which might explain their preference for the mudflat. The diet of size classes found in both habitats did not differ significantly, although juveniles inhabiting the mangrove forest were slightly more depleted in 13C compared to those residing on the mudflat

  1. Transparency and efficiency through plant operations management systems; Transparenz und Effizienz durch Betriebsfuehrungssysteme

    Energy Technology Data Exchange (ETDEWEB)

    Ladage, L. [RWE Power AG, Essen (Germany). Informationsmanagement

    2001-04-01

    Plant operations management systems, being IT application systems, provide integral support of the business processes making up plant operations management. The use of plant operations management systems improves mutually interdependent factors, such as high economic performance, high availability, and maximum safety. Since its commissioning in 1988, the Emsland nuclear power station (KKE) has been run with the IBFS plant operations management system. The work flow management system (WfMS), a module of IBFS, is described as an example of job order processing. IBFS-WfMS is to optimize all processes, thus cutting costs and ensuring that processes are run and documented reliably. Assessing the savings effect achieved through the use of IBFS-WfMS clearly reveals the savings in work/time achieved by the system. These savings are quoted as approx. 4 minutes and DM 10, respectively, per working step, which corresponds to several dozens of manyears or several million DM per annum in the KKE plant under consideration. This result can be extrapolated to other plants. (orig.) [German] Betriebsfuehrungssysteme stuetzen als EDV-Anwendungssystem integral die Geschaeftsprozesse der Kraftwerksbetriebsfuehrung. Durch den Einsatz von Betriebsfuehrungssystemen werden die in gegenseitiger Abhaengigkeit befindlichen Faktoren hohe Wirtschaftlichkeit, hohe Verfuegbarkeit und groesstmoegliche Sicherheit im Verbund gefoerdert. Im Kernkraftwerk Emsland (KKE) wird seit Inbetriebnahme der Anlage im Jahr 1988 das Betriebsfuehrungssystem IBFS eingesetzt. Am Beispiel des Workflowmanagementsystems (WfMS), einem Modul des IBFS, wird die Abwicklung von Arbeitsauftraegen dargestellt. Das IBFS-WfMS soll dabei durch Optimierung aller Prozesse sowohl kostensenkend wirken als auch sicherstellen, dass die Prozesse verlaesslich abgewickelt und dokumentiert werden. Eine Abschaetzung des Einspareffektes des IBFS-WfMS zeigt deutlich die durch das System erzielten Ersparnisse an Arbeits-/Zeitaufwand auf

  2. Ausschöpfung der vollen Leistungsfähigkeit von Sortiersystemen durch neue Einschleustechnik

    OpenAIRE

    Sadowsky, Volker; Semrau, Kai F.

    2012-01-01

    Die Ausschöpfung der vollen Leistungsfähigkeit von Stückgut-Sortiersystemen bedingt eine stetige Zuförderung der Stückgüter über die Einschleusungen zum Sorter. Für Sortiersysteme mit nur einer Einschleusung trifft dies in besonderer Weise zu, da in diesem Fall die maximale Durchsatzleistung des Sorters direkt durch die maximale Durchsatzleistung der Einschleusung begrenzt wird. Im Rahmen dieses Artikels werden unterschiedliche Gestaltungsmöglichkeiten für die Einschleusung am Drehsorter vorg...

  3. Effects of landfills on the limnology of associated running waters; Gefaehrdung von Oberflaechengewaessern durch Altablagerungen

    Energy Technology Data Exchange (ETDEWEB)

    Baier, B. [Hohenheim Univ., Stuttgart (Germany). Inst. fuer Zoologie; Kappus, B. [Hohenheim Univ., Stuttgart (Germany). Inst. fuer Zoologie; Boehmer, J. [Hohenheim Univ., Stuttgart (Germany). Inst. fuer Zoologie; Nill, A. [Hohenheim Univ., Stuttgart (Germany). Inst. fuer Zoologie; Rahmann, H. [Hohenheim Univ., Stuttgart (Germany). Inst. fuer Zoologie

    1997-10-01

    Five small brooks influenced by runoff from landfills were surveyed from May 1993 to March 1994 using chemical and biological methods. Results showed clear impacts on the macroinvertebrate fauna as a result of pollutants in three of the five brooks studied. (orig.) [Deutsch] Im Einflussbereich von Altdeponien wurden fuenf kleine Fliessgewaesser von Mai 1993 bis Maerz 1994 wasserchemisch und biologisch untersucht. Anhand der Untersuchungsergebnisse wurde eine Gefaehrdungsabschaetzung der Oberflaechengewaesser durch die Altablagerungen vorgenommen. Danach waren bei drei der fuenf untersuchten Deponien aufgrund von Schadstoffeintraegen Auswirkungen auf die Makrobenthosfauna der angrenzenden Fliessgewaesser erkennbar. (orig.)

  4. Differentiation of epipactis palustris (l.) crantz (orchidaceae) in habitats altered by man based on species populations within poznan city (poland)

    International Nuclear Information System (INIS)

    Wieloch, M.K.; Raszewska, M.W.; Drapikowska, M.

    2017-01-01

    The aim of the study was to compare two populations of Epipactis palustris (Orchidaceae) growing in the valley of Junikowski Stream, in the south-western part of the Poznan city (square of ATPOL BD08) and to compare current results to data on the species described in the literature. Group characteristics of both populations, such as population size, average density and congestion factor, as well as the average coefficient of dispersion, were defined. Specimen variability was determined by measuring 250 generative ramets in each population. The following plant traits were included: stem length, inflorescence length, number of flowers per inflorescence, number of leaves per stem and length and width of the largest leaf. Obtained data were subjected to statistical analyses. Descriptive statistics were calculated (arithmetic average, standard deviation, minimum and maximum). The variation coefficient (V) was established to determine the variation degree of each trait. In order to determine statistical significance of average values of traits of the samples in question, the factor variance ANOVA F-statistics was used. The significance degree was examined with Scheffe's test. Principal component analysis (PCA) enabled the examination of mutual relations between the samples in the system of two first principal components. This work confirmed previous information about low variability of marsh helleborine. Individual traits in both populations were very similar. The differences concerned the group characteristics. The plants were in good condition irrespective of occupied habitat. (author)

  5. An evaluation of memory accuracy in food hoarding marsh tits Poecile palustris--how accurate are they compared to humans?

    Science.gov (United States)

    Brodin, Anders; Urhan, A Utku

    2013-07-01

    Laboratory studies of scatter hoarding birds have become a model system for spatial memory studies. Considering that such birds are known to have a good spatial memory, recovery success in lab studies seems low. In parids (titmice and chickadees) typically ranging between 25 and 60% if five seeds are cached in 50-128 available caching sites. Since these birds store many thousands of food items in nature in one autumn one might expect that they should easily retrieve five seeds in a laboratory where they know the environment with its caching sites in detail. We designed a laboratory set up to be as similar as possible with previous studies and trained wild caught marsh tits Poecile palustris to store and retrieve in this set up. Our results agree closely with earlier studies, of the first ten looks around 40% were correct when the birds had stored five seeds in 100 available sites both 5 and 24h after storing. The cumulative success curve suggests high success during the first 15 looks where after it declines. Humans performed much better, in the first five looks most subjects were 100% correct. We discuss possible reasons for why the birds were not doing better. Copyright © 2013 Elsevier B.V. All rights reserved.

  6. Nitrate removal through combination of nanofiltration and electrocatalysis; Nitratentfernung durch Kombination von Nanofiltration und Elektrokatalyse

    Energy Technology Data Exchange (ETDEWEB)

    Roehricht, M.; Stadlbauer, E.A.; Happel, H. [Fachhochschule Giessen (Germany). Zentrum fuer Umwelttechnik

    1999-07-01

    In a new process combination, nitrate-containing ground water is first of all separated by nanofiltration into a concentrate stream (some 25 %) and a largely nitrate-free permeate (75 %). Then the enriched nitrate in the concentrate is converted into nitrogen by means of electrocatalytic nitrate reduction. Whereas, in nanofiltration, a concentration takes place, electrocatalytic nitrate reduction is a process by which nitrate is converted into elemental nitrogen and, thus, removed. Nanofiltration is a membrane separating process making use of 'open' reverse osmosis membranes, which are characterized by high flow but also reduced retention. (orig.) [German] In einer neuen Verfahrenskombination wird das nitrathaltige Grundwasser zuerst durch Nanofiltration in einen Konzentratstrom (ca. 25%) und ein weitgehend nitratfreies Permeat (75%) aufgeteilt. Im Konzentrat wird dann mittels Elektrokatalytischer Nitratreduktion (EKN) das angereicherte Nitrat zu Stickstoff umgewandelt. Waehrend bei der Nanofiltration eine Aufkonzentrierung erfolgt, wird durch die Elektrokatalytische Nitratreduktion das Nitrat in elementaren Stickstoff umgewandelt und so entfernt. Die Nanofiltration ist ein Membrantrennverfahren, bei dem 'offene' Umkehrosmosemembranen eingesetzt werden, die einen hohen Fluss aber auch eine verminderte Rueckhaltung aufweisen. (orig.)

  7. Eficiencia de pseudomonas sp, rhodopseudomonas sp, micrococcus sp y bacillus sp empleados como cultivos individuales y en consorcio, en la degradación de petróleo diesel ii

    OpenAIRE

    Otiniano García, Nélida Milly Esther

    2010-01-01

    In order to evaluate the efficiency of Pseudomonas sp, Rhodopseudomonas sp, Micrococcus sp, Bacillus sp, and the consortium formed by these four microorganisms in the diesel II petroleum degradation, it was worked in 5 bioreactors of aerated and shaken tank of 1.5 litters of capacity, with speed agitation of 120 rpm, and air flow of 0.5 vvm; in which were placed; 940 mL of Minimum Broth of Davies pH 7.0; 50 mL of diesel II petroleum as source of carbon and 10 mL of a suspension of approx...

  8. The electronically excited states of LH2 complexes from Rhodopseudomonas acidophila strain 10050 studied by time-resolved spectroscopy and dynamic Monte Carlo simulations. II. Homo-arrays of LH2 complexes reconstituted into phospholipid model membranes.

    Science.gov (United States)

    Pflock, Tobias J; Oellerich, Silke; Krapf, Lisa; Southall, June; Cogdell, Richard J; Ullmann, G Matthias; Köhler, Jürgen

    2011-07-21

    We performed time-resolved spectroscopy on homoarrays of LH2 complexes from the photosynthetic purple bacterium Rhodopseudomonas acidophila. Variations of the fluorescence transients were monitored as a function of the excitation fluence and the repetition rate of the excitation. These parameters are directly related to the excitation density within the array and to the number of LH2 complexes that still carry a triplet state prior to the next excitation. Comparison of the experimental observations with results from dynamic Monte Carlo simulations for a model cluster of LH2 complexes yields qualitative agreement without the need for any free parameter and reveals the mutual relationship between energy transfer and annihilation processes.

  9. ORF Alignment: NC_005296 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available clase ... (GGDEF) [Rhodopseudomonas palustris CGA009] ... Length = 124 ... Query: 353 PDILWHETYACGEPTIDAQHRELFDLANVILGPEI...EMLEPARLSELVELLLTRVAEHFQY 412 ... PDILWHETYACGEPTIDAQHRELFDLANVILGPEI...EMLEPARLSELVELLLTRVAEHFQY Sbjct: 1 ... PDILWHETYACGEPTIDAQHRELFDLANVILGPEIEMLEPARLSELVELLLTRVAEHFQY 60 ... Query: 473 DRRF 476 ... DRRF Sbjct: 121 DRRF 124

  10. ORF Alignment: NC_005296 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_005296 gi|39936477 >1kmoA 7 661 92 753 2e-72 ... emb|CAE28855.1| putative hydroxamate-type ferris... ... putative hydroxamate-type ferrisiderophore receptor ... [Rhodopseudomonas palustris CGA009] ...

  11. Magnitude and direction of the change in dipole moment associated with excitation of the primary electron donor in Rhodopseudomonas sphaeroides reaction centers

    Energy Technology Data Exchange (ETDEWEB)

    Lockhart, D.J.; Boxer, S.G.

    1987-02-10

    The magnitude and direction of the change in dipole moment, ..delta mu.., associated with the Q/sub y/ transition of the dimeric primary electron donor (special pair or P870) in Rhodopseudomonas sphaeroides reaction centers have been measured by Stark spectroscopy at 20 /sup 0/C. The magnitude of ..delta mu.. is found to be f/sup -1/ (10.3 +/- 0.7) D, where f is a correction factor for the local dielectric properties of the protein matrix. With the spherical cavity approximation and an effective local dielectric constant of 2, f = 1.2, and absolute value of ..delta mu.. is 8.6 +/- 0.6 D. Absolute value of ..delta mu.. for the Q/sub y/ transition of the special pair is approximately a factor of 3.4 and 2 greater than for the monomeric bacteriochlorophylls and bacteriopheophytins, respectively, in the reaction center. The angle between ..delta mu.. and the transition dipole moment for excitation of the first singlet electron state of the special pair was found to be 24 +/- 2/sup 0/. The measured values are combined to suggest a physical model in which the lowest excited singlet state of the special pair has substantial charge-transfer character and where charge is separated between the two monomers comprising the dimeric special pair. This leads to the hypothesis that the first charge-separated state in bacterial photosynthesis is formed directly upon photoexcitation. These data provide stringent values for comparison with theoretical calculations of the electronic structure of the chromophores in the reaction center.

  12. Environmental pollution caused by coal mining and utilization in China; Umweltbelastungen durch Kohlefoerderung und -nutzung in China

    Energy Technology Data Exchange (ETDEWEB)

    Bai, Fuchen [Guangdong Ocean Univ., Zhanjiang (China). Dept. of Scientific Research Management

    2013-07-15

    After the BP Statistical Review of World Energy of 2010 45.6% of coal production and 46.9% of coal consumption in the world in 2009 are accounted for China. The large-scale coal production and use cause major environmental impacts. A large environmental impact is through the emission of some unavoidable reaction products (for example waste gas, waste heat) that affect and damage the ecosystem. A steady influence can lead to long-term climate changes and medium term damage to the ecosystem. Other environmental impacts occur during mining of coal by the change in the water balance and the transformation of the landscape (surface mining, spoil tips). The environmental problems caused by coal mining and utilization can not be ignored in China. [German] Nach der BP-Statistik der Weltenergie 2010 sind 45,6% der Kohleproduktion und 46,9% des Kohleverbrauchs in der Welt im Jahr 2009 auf China entfallen. Die grossangelegte Kohlefoerderung und -verwendung fuehren zu grossen Umweltbelastungen. Eine grosse Umweltbeeinflussung erfolgt durch die Emission von zum Teil unvermeidbaren Umsetzungsprodukten (zum Beispiel Abgas, Abwaerme), die das Oekosystem beeinflussen und schaedigen. Eine stetige Beeinflussung kann langfristig zu den Klimaveraenderungen und mittelfristig zur Schaedigung des Oekosystems fuehren. Weitere Umweltbelastungen erfolgen beim Abbau der Kohle durch die Veraenderung des Wasserhaushalts und durch die Umgestaltung der Landschaft (Tagebau, Abbauhalden). Die Umweltprobleme, die durch die Kohlefoerderung und -nutzung verursacht werden, koennen in China nicht ignoriert werden.

  13. Deutsch Durch Audio-Visuelle Methode: An Audio-Lingual-Oral Approach to the Teaching of German.

    Science.gov (United States)

    Dickinson Public Schools, ND. Instructional Media Center.

    This teaching guide, designed to accompany Chilton's "Deutsch Durch Audio-Visuelle Methode" for German 1 and 2 in a three-year secondary school program, focuses major attention on the operational plan of the program and a student orientation unit. A section on teaching a unit discusses four phases: (1) presentation, (2) explanation, (3)…

  14. Decontamination of contaminated soils by microwave heating; Dekontaminierung verseuchter Boeden durch Mikrowellenheizung

    Energy Technology Data Exchange (ETDEWEB)

    Pauli, Mario

    2011-07-01

    The paper describes a system for the thermal decontamination of contaminated soils by microwaves. In addition to the determination of the dielectric material parameters of different soils, a focus is on antennas for the efficient coupling of the microwaves into the ground. The developed simulation model takes into account the electromagnetic-thermal interaction and makes it possible to predict optimal plant configuration, duration and costs of a sanitation measure in advance. [German] Die Arbeit beschreibt ein System zur thermischen Dekontaminierung verseuchter Boeden durch Mikrowellen. Neben der Bestimmung der dielektrischen Materialparameter verschiedener Boeden liegt ein Schwerpunkt auf Antennen zur effizienten Einkopplung der Mikrowellen in den Boden. Das entwickelte Simulationsmodell beruecksichtigt die elektromagnetisch-thermische Wechselwirkung und ermoeglicht es, bereits im Vorfeld optimale Anlagenkonfiguration, Dauer und Kosten einer Sanierungsmassnahme vorherzusagen.

  15. Auto-ignition generated combustion. Pt. 2. Thermodynamic fundamentals; Verbrennungssteuerung durch Selbstzuendung. T. 2. Experimentelle Analyse

    Energy Technology Data Exchange (ETDEWEB)

    Guibert, P. [Paris-6 Univ. (France). Lab. de Mecanique Physique; Morin, C. [Paris-6 Univ. (France); Mokhtari, S.

    2004-02-01

    The combustion initiation by auto-ignition demonstrates benefits in NO{sub x} reduction and in process stability for both spark-ignited and compression ignited engines. Based on the better thermodynamic particularities of the auto-ignition, which have been presented in the first part, the characteristics of this process are demonstrated in the second part by experimental analysis. For comparison with similar studies, the analyses have been carried out in base of a two stroke loop scavenged spark-ignition single cylinder engine. (orig.) [German] Die Steuerung der Verbrennung durch Selbstzuendung zeigt Vorteile bezueglich Senkung der NO{sub x}-Emission und Prozessstabilitaet, sowohl bei Otto- als auch bei Dieselmotoren. Auf Grundlage der thermodynamischen Besonderheiten der Selbstzuendvorgaenge, die im ersten Teil praesentiert wurden, erfolgt im zweiten Teil eine experimentelle Betrachtung der Prozesscharakteristika. Zur Vergleichbarkeit mit aehnlichen Untersuchungen wird die experimentelle Analyse auf Basis eines Zweitakt-Einzylinder-Ottomotors mit Umkehrspuelung durchgefuehrt. (orig.)

  16. Conformational heterogeneity of the bacteriopheophytin electron acceptor HA in reaction centers from Rhodopseudomonas viridis revealed by Fourier transform infrared spectroscopy and site-directed mutagenesis.

    Science.gov (United States)

    Breton, J; Bibikova, M; Oesterhelt, D; Nabedryk, E

    1999-08-31

    The light-induced Fourier transform infrared (FTIR) difference spectra corresponding to the photoreduction of either the HA bacteriopheophytin electron acceptor (HA-/HA spectrum) or the QA primary quinone (QA-/QA spectrum) in photosynthetic reaction centers (RCs) of Rhodopseudomonas viridis are reported. These spectra have been compared for wild-type (WT) RCs and for two site-directed mutants in which the proposed interactions between the carbonyls on ring V of HA and the RC protein have been altered. In the mutant EQ(L104), the putative hydrogen bond between the protein and the 9-keto C=O of HA should be affected by changing Glu L104 to a Gln. In the mutant WF(M250), the van der Waals interactions between Trp M250 and the 10a-ester C=O of HA should be modified. The characteristic effects of both mutations on the FTIR spectra support the proposed interactions and allow the IR modes of the 9-keto and 10a-ester C=O of HA and HA- to be assigned. Comparison of the HA-/HA and QA-/QA spectra leads us to conclude that the QA-/QA IR signals in the spectral range above 1700 cm-1 are largely dominated by contributions from the electrostatic response of the 10a-ester C=O mode of HA upon QA photoreduction. A heterogeneity in the conformation of the 10a-ester C=O mode of HA in WT RCs, leading to three distinct populations of HA, appears to be related to differences in the hydrogen-bonding interactions between the carbonyls of ring V of HA and the RC protein. The possibility that this structural heterogeneity is related to the observed multiexponential kinetics of electron transfer and the implications for primary processes are discussed. The effect of 1H/2H exchange on the QA-/QA spectra of the WT and mutant RCs shows that neither Glu L104 nor any other exchangeable carboxylic residue changes appreciably its protonation state upon QA reduction.

  17. A Tribal Story Written in Silica: Using Phytoliths to Research the Effects of Mining on Past Wild Rice (Zizania palustris) Abundance in Sandy Lake, Minnesota

    Science.gov (United States)

    Clarke, I. R.; Jones, M. A.; Yost, C. L.; Drake, C.; Ladwig, J. L.; Myrbo, A.; Howes, T.

    2014-12-01

    Wild rice (Zizania palustris, manoomin) is an emergent aquatic plant that grows annually in the northern Great Lakes region of North America. This region is also rich in iron ore deposits and correspondingly has an extensive history of mining activities. Wild rice no longer grows in some areas where it was previously abundant. Sandy Lake, located in St. Louis County on federally protected lands that are ceded territory of the Fond du Lac Band of Lake Superior Chippewa in Minnesota and downstream of the nearby U.S. Steel Minntac mine, was selected as a test site. This lake has a history of ricing activities by the Ojibwe (Chippewa) People, for whom manoomin has cultural importance. Lake cores were taken on June 17, 2014 by LacCore and FDLRM staff and samples were obtained. This project used phytolith analysis to answer the question of past wild rice presence and abundance in Sandy Lake. Phytoliths are microscopic opal silica deposits produced in some plants. Zizania palustris produces phytolith morphotypes that are unequivocally diagnostic of this species in this region. Microscopic slides were prepared and analyzed for wild rice phytoliths. Concentration values ranged from 25 to 4379 phytoliths per cm3/year, and wild rice accumulation figures ranged from 7 to 789 phytoliths/cm2/year, the maximum values of which occurred in the 1920s and generally declined to the current lowest levels observed. Mining has likely impacted wild rice populations by causing increased sulfate levels and possibly contributing to higher lake levels.

  18. Allodaposuchus palustris sp. nov. from the upper cretaceous of Fumanya (South-Eastern Pyrenees, Iberian Peninsula: systematics, palaeoecology and palaeobiogeography of the enigmatic allodaposuchian crocodylians.

    Directory of Open Access Journals (Sweden)

    Alejandro Blanco

    Full Text Available The controversial European genus Allodaposuchus is currently composed of two species (A. precedens, A. subjuniperus and it has been traditionally considered a basal eusuchian clade of crocodylomorphs. In the present work, the new species A. palustris is erected on the base of cranial and postcranial remains from the lower Maastrichtian of the southern Pyrenees. Phylogenetic analyses here including both cranial and postcranial data support the hypothesis that Allodaposuchus is included within Crocodylia. The studied specimen suggests little change in postcranial skeleton along the evolutionary history of crocodylians, except for some bone elements such as the axis, the first caudal vertebra and the ilium. The specimen was found in an organic mudstone corresponding to a coastal wetland environment. Thus, A. palustris from Fumanya is the first Allodaposuchus reported in lacustrine-palustrine settings that expand the ecological range for this genus. The S-DIVA palaeobiogeographic reconstruction of ancestral area suggests that early members of Crocodylia rapidly widespread for the Northern Hemisphere landmasses no later than the Campanian, leading the apparition of endemic groups. In that way "Allodaposuchia" represents an endemic European clade probably originated in the Ibero-Armorican domain in the late Campanian and dispersed by the Southern European archipelago prior to the early Maastrichtian.

  19. Effects of sorption agents on heavy metal release form incinerator slag; Laesst sich die Freisetzung von Schwermetallen aus MVA-Schlacken durch Zugabe von Sorbenten veraendern?

    Energy Technology Data Exchange (ETDEWEB)

    Heiser, U. [Johannes Gutenberg-Univ. Mainz, Mainz (Germany); Kersten, M. [Johannes Gutenberg-Univ. Mainz, Mainz (Germany). Inst. fuer Geowissenschaften

    2003-11-01

    It was investigated inhowfar additions of sorption agents will influence the solution of heavy metals in incinerator slag. [German] Es wurde untersucht, ob nicht durch Zugabe bestimmter Stoffe zur Muellschlacke die Loesung von Schwermetallen beschleunigt werden kann. (orig.)

  20. Action of sulfurous acid on pollen. [Hepatica triloba; Helleborus orientalis; Vinca minor; Viola tricolor; Primula officinalis; Lilium candidum; Petunia; Pisum; Helleborus viridus; Galanthus nivealis; Vinca major; Convallaria maialis; Narcissus poeticus; Caltha palustris; Cystisus laburnum; Orchis maculata; Bilbergia; Eranthus; Crocus

    Energy Technology Data Exchange (ETDEWEB)

    Sabachnikoff, V

    1912-01-23

    The following ornamental plants: Hepatica triloba, Helleborus orientalis, Vinca minor, Viola tricolor, Primula officinalis, Lilium candidum, Petunia, Pisum, Helleborus viridus, Galanthus nivealis, Vinca major, Convallaria maialis, Narcissus poeticus, Caltha palustris, Cystisus laburnum, Orchis maculata, Bilbergia, Eranthus, and Crocus were tested for seed production. Exposure to sulfuric acid ranged from three to forty-eight hours. Responses were noted for varying concentrations.

  1. Komplexitätsbeherrschung in der wertschöpfungspartnerschaftsübergreifenden Produktspezifikationserstellung bei unvollkommenen Informationen durch Simplifizierungsregeln

    OpenAIRE

    Ludwig, Ralf

    2005-01-01

    Probleme/Forschungsfragen: Ein stetiger Komplexitätsanstieg des Produktes und der Produktentwicklungsumgebung erschweren in Wertschöpfungspartnerschaften das Erreichen einer gemeinsamen Win-Win-Situation. Bei der frühen Erarbeitung der Produktauslegung oder im Rahmen der Produktspezifikationserstellung ist durch die hohe Komplexität von Entwicklungsaufgabe und -umgebung eine umfassende gesamtheitliche Berücksichtigung der wirtschaftlichen Erfolgsdeterminanten nur sehr begrenzt möglich. Ein...

  2. Objektverfolgung durch Fusion von Radar- und Monokameradaten auf Merkmalsebene für zukünftige Fahrerassistenzsysteme

    OpenAIRE

    Liu, Feng

    2010-01-01

    Die vorliegende Arbeit beschreibt eine neuartige Objektverfolgung durch Fusion von Radar- und Monokameradaten auf Merkmalsebene. Dabei werden zuerst die statistischen Fehlermodelle der Sensoren analysiert. Anschließend wird ein neues Assoziationsverfahren auf Basis der PDA-Methodik untersucht. Der Schwerpunkt dieser Arbeit ist die Behandlung der Objektdynmaik mit Hilfe eines adaptiven IMM-Filters. Schließlich wird die Thematik Objektklassifikation sowie Gassenbreiteschätzung beleuchtet.

  3. Scheuchzeria palustris L

    Czech Academy of Sciences Publication Activity Database

    Šída, O.; Štěpánková, Jitka

    2015-01-01

    Roč. 50, č. 1 (2015), s. 100-101 ISSN 1211-5258 R&D Projects: GA ČR GB14-36079G Institutional support: RVO:67985939 Keywords : floristics * distribution * endangered species Subject RIV: EF - Botanics

  4. The electronically excited states of LH2 complexes from Rhodopseudomonas acidophila strain 10050 studied by time-resolved spectroscopy and dynamic Monte Carlo simulations. I. Isolated, non-interacting LH2 complexes.

    Science.gov (United States)

    Pflock, Tobias J; Oellerich, Silke; Southall, June; Cogdell, Richard J; Ullmann, G Matthias; Köhler, Jürgen

    2011-07-21

    We have employed time-resolved spectroscopy on the picosecond time scale in combination with dynamic Monte Carlo simulations to investigate the photophysical properties of light-harvesting 2 (LH2) complexes from the purple photosynthetic bacterium Rhodopseudomonas acidophila. The variations of the fluorescence transients were studied as a function of the excitation fluence, the repetition rate of the excitation and the sample preparation conditions. Here we present the results obtained on detergent solubilized LH2 complexes, i.e., avoiding intercomplex interactions, and show that a simple four-state model is sufficient to grasp the experimental observations quantitatively without the need for any free parameters. This approach allows us to obtain a quantitative measure for the singlet-triplet annihilation rate in isolated, noninteracting LH2 complexes.

  5. Heating power stations - influencing costs by organisational measures; Heizkraftwerke - Kostenbeeinflussung durch organisatorische Massnahmen

    Energy Technology Data Exchange (ETDEWEB)

    Riedlinger, R.A.

    1993-12-31

    The products of district heating and, in the foreseeable future also electrical power, must compete in the market with low prices. Low prices, which still provide a profit, are only possible based on low costs. Low costs are achieved by cost control. The basis for cost control is transparency of costs. Mainly organisational measures were proposed and described. From the individual stages of the organisation, the organisational build-up is obtained, the important feature of which is the allocation of competence to make decisions. (orig./KO) [Deutsch] Die Produkte Fernwaerme und in absehbarer Zeit auch elektrische Energie, muessen sich im Markt mit niedrigen Preisen behaupten. Niedrige Preise, die trotzdem einen Gewinn erbringen sollen, sind nur auf der Basis niedriger Kosten moeglich. Niedrige Kosten erreicht man durch Kostensteuerung, Controlling. Grundlage der Kostensteuerung ist Kostentransparenz. Es wurden im wesentlichen ablauforganisatorische Massnahmen vorgeschlagen und beschrieben. Aus den einzelnen Stationen der Ablauforganisation ergibt sich letztendlich die Aufbauorganisation, deren wesentliches Merkmal die Zuordnung von Entscheidungskompetenz ist. (orig./KO)

  6. Processing of maize plants by rotary kiln pyrolysis; Veredlung von Maispflanzen durch Pyrolyse im Drehrohrreaktor

    Energy Technology Data Exchange (ETDEWEB)

    Klose, W.; Wiest, W. [Kassel Univ. (Gesamthochschule) (Germany). Inst. fuer Thermische Energietechnik

    1996-12-31

    The fuel quality of maize plants is to be characterized by short, elementary and thermonalysis. The plants will be pyrolyzed in order to facilitate transport and storage. The formal kinetic parameters of three parallel reactions describing solid matter decomposition are defined by means of TG-DSC, and the reaction enthalpy is measured. Pyrolysis experiments in a rotary kiln converter in the kg range show a strong dependence of the product spectrum on process temperature. In particular, the pyrolysis gas yield increases with temperature at the expense of pyrolysis oil and water. (orig) [Deutsch] Zur energetischen Nutzung von Kulturpflanzen wird die brennstofftechnische Charakterisierung von Maispflanzen durch Kurz-, Elementar- und Thermoanalyse durchgefuehrt. Zur Reduzierung des Aufwands fuer Transport und Lagerung sollen die Pflanzen pyrolysiert weren. Mit Hilfe der TG-DSC werden formalkinetische Parameter von drei Parallelreaktionen zur Beschreibung der Feststoffzersetzung bestimmt und die Reaktionsenthalpie gemessen. Pyrolyseversuche in einem Drehrohrreaktor im Kilogramm-Massstab ergeben eine starke Abhaengigkeit des Produktspektrums von der Prozesstemperatur. Insbesondere steigt die Pyrolysegasausbeute auf Kosten der Bildung von Pyrolyseoel und Wasser mit der Temperatur stark an. (orig)

  7. Processing of maize plants by rotary kiln pyrolysis; Veredlung von Maispflanzen durch Pyrolyse im Drehrohrreaktor

    Energy Technology Data Exchange (ETDEWEB)

    Klose, W; Wiest, W [Kassel Univ. (Gesamthochschule) (Germany). Inst. fuer Thermische Energietechnik

    1997-12-31

    The fuel quality of maize plants is to be characterized by short, elementary and thermonalysis. The plants will be pyrolyzed in order to facilitate transport and storage. The formal kinetic parameters of three parallel reactions describing solid matter decomposition are defined by means of TG-DSC, and the reaction enthalpy is measured. Pyrolysis experiments in a rotary kiln converter in the kg range show a strong dependence of the product spectrum on process temperature. In particular, the pyrolysis gas yield increases with temperature at the expense of pyrolysis oil and water. (orig) [Deutsch] Zur energetischen Nutzung von Kulturpflanzen wird die brennstofftechnische Charakterisierung von Maispflanzen durch Kurz-, Elementar- und Thermoanalyse durchgefuehrt. Zur Reduzierung des Aufwands fuer Transport und Lagerung sollen die Pflanzen pyrolysiert weren. Mit Hilfe der TG-DSC werden formalkinetische Parameter von drei Parallelreaktionen zur Beschreibung der Feststoffzersetzung bestimmt und die Reaktionsenthalpie gemessen. Pyrolyseversuche in einem Drehrohrreaktor im Kilogramm-Massstab ergeben eine starke Abhaengigkeit des Produktspektrums von der Prozesstemperatur. Insbesondere steigt die Pyrolysegasausbeute auf Kosten der Bildung von Pyrolyseoel und Wasser mit der Temperatur stark an. (orig)

  8. Optimization of sewage treatment plants through adjustment of the acid capacity; Optimierung von Klaeranlagen durch Saeurekapazitaetseinstellung

    Energy Technology Data Exchange (ETDEWEB)

    Herbst, B.; Soelter, K. [Bundesverband der Deutschen Kalkindustrie e.V., Koeln (Germany)

    1999-07-01

    In many areas with soft water (low water hardness), variations of degradation behaviour are noted in the biological cleaning of municipal and industrial waste water. The use of acidic precipitation agents and processes of biological ammonium oxidation (nitrification) reduce the acid capacity of water. Addition of lime in different forms can prevent this drop in acid capacity. As a new development in this field, lime hydrate can be added in dry form. This form of application dispenses with some of the elements normally installed at sewage treatment plants. Several examples demonstrate the advantages offered by this technique, especially the need for less metal salts to eliminate phosphate. (orig.) [German] In vielen Weichwassergebieten (geringer Wasserhaerte) treten bei der biologischen Reinigung von kommunalen und industriellen Abwaessern Schwankungen des Abbauverhaltens auf. Der Einsatz von sauren Faellmitteln und die Prozesse der biologischen Ammoniumoxidation (Nitrifikation) senken die Saeurekapazitaet des Wassers ab. Durch die Zugabe von Kalk in verschiedenen Dosierformen kann die Saeurekapazitaetsabsenkung verhindert werden. Eine neue Entwicklung auf diesem Gebiet ist die Trockendosierung von Kalkhydrat. Wesentliche Teile der sonst installierten Anlagentechnik sind bei dieser Art der Dosierung nicht mehr notwendig. Anhand von mehreren Beispielen wird erlaeutert, welche Vorteile dieses Verfahren bieten kann, insbesondere bei der Einsparung von Metallsalzen zur Phosphatentfernung. (orig.)

  9. Mechatronics in the car: success through efficient methodological development; Mechatronik im Kraftfahrzeug: Erfolg durch effiziente Entwicklungsmethodik

    Energy Technology Data Exchange (ETDEWEB)

    Dieterle, W.; Dilger, E. [Bosch (R.) GmbH, Gerlingen (Germany). Zentralbereich Forschung und Vorausentwicklung; Buerger, K.G. [Bosch (R.) GmbH (Germany)

    2001-04-01

    The ever increasing requirements with respect to fuel consumption, emissions as well as safety and comfort necessitate ever increasing complex functionalities in the car. They are realized, as a rule, by a combination of mechanics, hydraulics, electrics/electronics and, more and more, software. In the past, the development of the various electric/electronic, mechanical or hydraulic components tended to happen at separate levels, nowadays the focus is more on a comprehensive approach to the overall system. In this context, the integrated development of 'mechatronic' components, including the respective software, leads to a targeted solution. (orig.) [German] Staendig steigende Anforderungen hinsichtlich Kraftstoffverbrauch, Emissionen sowie Sicherheit und Komfort bedingen immer komplexere Funktionalitaeten im Kraftfahrzeug. Sie werden in der Regel durch eine Kombination von Mechanik, Hydraulik, Elektrik/Elektronik und zunehmend auch Software realisiert. Nachdem in der Vergangenheit die Entwicklung meist noch auf getrennten Ebenen verlief, steht heute ein uebergreifender, das Gesamtsystem umfassender Ansatz im Vordergrund. Dieser Beitrag der Robert Bosch GmbH berichtet ueber aktuelle Mechatronik-Entwicklungen. Dabei sorgt die integrierte Entwicklung der 'mechatronischen' Komponenten unter Einbezug der zugehoerigen Software fuer eine zielgerichtete Loesung. (orig.)

  10. Biosorption of heavy metals by immobilized microalgae; Biosorption von Schwermetallen durch immobilisierte Mikroalgen

    Energy Technology Data Exchange (ETDEWEB)

    Wilke, A.; Bunke, G.; Goetz, P.; Buchholz, R. [Technische Univ. Berlin (Germany). Fachgebiet Bioverfahrenstechnik

    1999-07-01

    . Durch geeignete Versuche muessen die verschiedenen Stofftransportwiderstaende (Filmwiderstand, Diffusionswiderstand im Innern der Partikel) voneinander entkoppelt werden, damit eine Bestimmung derselben ermoeglicht wird. (orig.)

  11. Continuous high-temperature recycling of waste by the Thermoselect process; Unterbrechungsloses Hochtemperaturrecycling - Abfallveredelung durch Thermoselect

    Energy Technology Data Exchange (ETDEWEB)

    Stahlberg, R [Thermoselect Engineering S.r.l., Verbania (Italy)

    1998-09-01

    Based on the experience with the Thermoselect plant at Fondotoce, Italy (100 Mg/d), which was commissioned in 1992, a 225,000 Mg/a plant with three units (720 Mg/d) is being constructed at Karlsruhe, Germany. The plant is scheduled for commissioning in 1998. The contribution presents the product balance, the approved emission levels, and the energy uses envisaged for the Karlsruhe project. Final product quality data and energy yields illustrate the differences from conventional thermal processes. An ecobalance comparing the Thermoselect process with grate furnaces shows that water, soil and air pollution is much reduced by the new Termoselect process. Apart from high product quality, the plant also has the advantage of reduced dumping cost and no long-term ecological hazards. (orig./SR) [Deutsch] Auf Basis der grosstechnischen Erfahrung mit einer seit 1992 in Fondotoce (Italien) betriebenen THERMOSELECT-Anlage (Kapazitaet 100 Mg/d), Restmuell umweltgerecht zu behandeln, wird 1998 der Aufbau einer 225.000 Mg/a-Anlage mit 3 Linien (720 Mg/d) in Karlsruhe (Deutschland) abgeschlossen. Die Produktebilanz und die genehmigten Emissionswerte sind in dem Artikel belegt. Gezeigt wird die fuer das Projekt Karlsruhe vorgesehene Energienutzung. Die Endprodduktqualitaeten und die Energieausbeute verdeutlichen die Unterschiede zu bisherigen konventionellen thermischen Verfahren. Eine erarbeitete Oekobilanz mit einem Vergleich von THERMOSELECT und Rostfeuerung zeigt die deutlich geringe Belastung der Umweltkompartimente Wasser, Boden und Luft durch das neue THERMOSELECT-Verfahren. Neben hohen Produktqualitaeten wird - verglichen mit traditionellen Techniken - ein deutlich verringerter Entsorgungspreis erreicht, wobei gleichzeitig oekologische Belastungen auszuschliessen sind. (orig./SR)

  12. Untersuchungen der Narbenqualität nach unterschiedlichen Verfahren des Wundverschlusses und der Wundbehandlung durch autologe Hauttransplantation

    OpenAIRE

    Zeplin, Philip Helge

    2005-01-01

    Die qualitative und quantitative Narbenqualitätsmessungen im Verlauf der Wundheilung ist von großer Bedeutung, da durch sie Einflussgrößen, die mit hoher Wahrscheinlichkeit zu pathologischen Narbenformationen führen, frühzeitig erkannt werden könnten und Rückschlüsse auf die jeweils angewandten Techniken und Materialien zulassen würden. Dass für die Analyse der Heilung von Schnitt- und Defektwunden objektive Messungen unabdingbar sind, sollte am Beispiel des Göttinger Miniaturschweins gezeigt...

  13. Detection and enumeration of methanotrophs in acidic Sphagnum peat by 16S rRNA fluorescence in situ hybridization, including the use of newly developed oligonucleotide probes for Methylocella palustris.

    Science.gov (United States)

    Dedysh, S N; Derakshani, M; Liesack, W

    2001-10-01

    Two 16S rRNA-targeted oligonucleotide probes, Mcell-1026 and Mcell-181, were developed for specific detection of the acidophilic methanotroph Methylocella palustris using fluorescence in situ hybridization (FISH). The fluorescence signal of probe Mcell-181 was enhanced by its combined application with the oligonucleotide helper probe H158. Mcell-1026 and Mcell-181, as well as 16S rRNA oligonucleotide probes with reported group specificity for either type I methanotrophs (probes M-84 and M-705) or the Methylosinus/Methylocystis group of type II methanotrophs (probes MA-221 and M-450), were used in FISH to determine the abundance of distinct methanotroph groups in a Sphagnum peat sample of pH 4.2. M. palustris was enumerated at greater than 10(6) cells per g of peat (wet weight), while the detectable population size of type I methanotrophs was three orders of magnitude below the population level of M. palustris. The cell counts with probe MA-221 suggested that only 10(4) type II methanotrophs per g of peat (wet weight) were present, while the use of probe M-450 revealed more than 10(6) type II methanotroph cells per g of the same samples. This discrepancy was due to the fact that probe M-450 targets almost all currently known strains of Methylosinus and Methylocystis, whereas probe MA-221, originally described as group specific, does not detect a large proportion of Methylocystis strains. The total number of methanotrophic bacteria detected by FISH was 3.0 (+/-0.2) x 10(6) cells per g (wet weight) of peat. This was about 0.8% of the total bacterial cell number. Thus, our study clearly suggests that M. palustris and a defined population of Methylocystis spp. were the predominant methanotrophs detectable by FISH in an acidic Sphagnum peat bog.

  14. Microbiological studies in enhanced sewage sludge degradation through cell membrane break-up; Mikrobiologische Untersuchungen zum verbesserten Klaerschlammabbau durch Zellaufschluss. Mechanische und thermische Behandlung von Schlaemmen

    Energy Technology Data Exchange (ETDEWEB)

    Battenberg, S.; Naeveke, R. [Gesellschaft fuer Biotechnologische Forschung mbH, Braunschweig (Germany). Bereich Mikrobiologie

    1999-07-01

    Mechanical disintegration breaks up the flake structure of excess sludge and solubilizes organic constituents. Bacterial cells are rendered soluble. Thermal conditioning of excess sludge, too, can release sludge constituents. This makes for enhanced and accelerated hydrolysis of polymeric sludge constituents in subsequent anaerobic processing. The yield of useful biogas is increased. (orig.) [German] Durch die mechanische Desintegration von Ueberschussschlamm wird die Flockenstruktur zerschlagen und organische Inhaltsstoffe werden in Loesung gebracht. Bakterienzellen werden aufgeschlossen. Auch durch eine thermische Behandlung von Ueberschussschlamm koennen Schlamminhaltsstoffe freigesetzt werden. Dadurch wird bei einer anschliessenden anaeroben Behandlung die Hydrolyse der polymeren Schlamminhaltsstoffe gefoerdert und beschleunigt. Die Ausbeute an verwertbarem Biogas wird gesteigert. (orig.)

  15. Energy saving by hot operating bearings in high temperature kilns. Final report; Energieeinsparung durch Heisslager in Hochtemperaturanlagen. Schlussbericht

    Energy Technology Data Exchange (ETDEWEB)

    Maier, H.R.

    2003-07-01

    The project intended to show that ceramic sliding bearings will ensure longer life, energy and cost savings, reduced environmental pollution, and functional improvements. Ceramic sliding bearings were tested at high temperatures of up to 1400 C and low sliding rates, with and without lubrication. High-temperature test stands were constructed in the two partner institutes and adapted to the specifications of the industrial partners concerning the parameters to be investigated. (orig.) [German] Ziel des Forschungsvorhabens 'Energieeinsparung durch Heisslager in Hochtemperaturanlagen' (EHIH) ist nachzuweisen, dass durch den Einsatz von keramischen Gleitlagern im Hochtemperaturbereich Standzeiterhoehungen, Energie- und Kosteneinsparungen, Umweltentlastungen und Funktionsverbesserungen moeglich sind. Auf der Basis der Anforderungsprofile der Industrie- und Forschungspartner waren umfangreiche Verschleisstests keramischer Gleitlager bei hohen Temperaturen (bis 1400 C) sowie niedrigen Gleitgeschwindigkeiten ohne und mit Feststoff-Schmierung vorgesehen. Hierzu wurden an beiden beteiligten Instituten Hochtemperatur-Pruefstaende aufgebaut, die den Anforderungen der jeweiligen Industriepartner hinsichtlich der zu testenden Lagerparameter (Drehzahl, Flaechenpressung, Temperaturprofile, etc.) angepasst wurden. (orig.)

  16. Pollution and pollution tolerance in the case of polycyclic aromatic hydrocarbons (PAH); Belastung durch Polyzyklische aromatische Kohlenwasserstoffe (PAK)

    Energy Technology Data Exchange (ETDEWEB)

    Renger, M.; Mekiffer, B. [Technische Univ. Berlin (Germany). Inst. fuer Oekologie-Bodenkunde

    1997-12-31

    The purpose of the present follow-up project was to examine the contamination with polycyclic aromatic hydrocarbons (PAH) of different anthropogenic urban soils including clay soils containing demolition waste, household waste, ash, and residues from a coking plant. A further task was to analyse, or infer from other part-projects, standard soil parameters such as organic carbon content, pH, and anion levels in order to clarify any relationships between PAH contamination and the more easily determinable soil characteristics. Furthermore, the sorption behaviour for PAH of selected anthropogenic urban soils was to be characterised by means of batch experiments. [Deutsch] Im Rahmen des Anschlussvorhabens sollte die Kontamination von anthropogenen Stadtboeden- darunter Truemmerschutt-, Hausmuell-, Asche- sowie Kokereilehmboden- durch polyzyklische aromatische Kohlenwasserstoffe (PAK) untersucht werden. Zusaetzlich sollten die bodenkundlichen Standardparameter Corg, pH-Wert, Anionengehalte und KAKpot analysiert bzw. von den anderen Teilvorhaben uebernommen werden, um Zusammenhaenge zwischen der PAK-Kontamination und relativ leicht zu bestimmenden bodenkundlichen Kennwerten klaeren zu koennen. Das Sorptionsverhalten ausgewaehlter anthropogener Stadtboeden fuer PAK sollte durch Batchversuche charakterisiert werden. (orig./SR)

  17. Methylocella palustris gen. nov., sp. nov., a new methane-oxidizing acidophilic bacterium from peat bogs, representing a novel subtype of serine-pathway methanotrophs.

    Science.gov (United States)

    Dedysh, S N; Liesack, W; Khmelenina, V N; Suzina, N E; Trotsenko, Y A; Semrau, J D; Bares, A M; Panikov, N S; Tiedje, J M

    2000-05-01

    A new genus, Methylocella, and a new species, Methylocella palustris, are proposed for three strains of methane-oxidizing bacteria isolated from acidic Sphagnum peat bogs. These bacteria are aerobic, Gram-negative, colourless, non-motile, straight and curved rods that utilize the serine pathway for carbon assimilation, multiply by normal cell division and contain intracellular poly-beta-hydroxybutyrate granules (one at each pole). These strains use methane and methanol as sole sources of carbon and energy and are moderately acidophilic organisms with growth between pH 4.5 and pH 7.0, the optimum being at pH 5.0-5.5. The temperature range for growth is 10-28 degrees C with the optimum at 15-20 degrees C. The intracytoplasmic membrane system is different from those of type I and II methanotrophs. Cells contain an extensive periplasmic space and a vesicular membrane system connected to the cytoplasmic membrane. The strains grew only on media with a low salt content (0.2-0.5 g l(-1)). All three strains were found to possess soluble methane monooxygenase and are able to fix atmospheric nitrogen via an oxygen-sensitive nitrogenase. No products were observed in a PCR with particulate methane monooxygenase-targeted primers; hybridization with a pmoA probe was also negative. The major phospholipid fatty acids are 18:1 acids. The G+C content of the DNA is 61.2 mol%. The three strains share identical 16S rRNA gene sequences and represent a novel lineage of methane-oxidizing bacteria within the alpha-subclass of the class Proteobacteria and are only moderately related to type II methanotrophs of the Methylocystis-Methylosinus group. The three strains are most closely related to the acidophilic heterotrophic bacterium Beijerinckia indica subsp. indica (96.5% 16S rDNA sequence similarity). Collectively, these strains comprise a new species and genus Methylocella palustris gen. nov., sp. nov.; strain KT (= ATCC 700799T) is the type strain.

  18. Sulfide Generated by Sulfate Reduction is a Primary Controller of the Occurrence of Wild Rice (Zizania palustris) in Shallow Aquatic Ecosystems

    Science.gov (United States)

    Myrbo, A.; Swain, E. B.; Engstrom, D. R.; Coleman Wasik, J.; Brenner, J.; Dykhuizen Shore, M.; Peters, E. B.; Blaha, G.

    2017-11-01

    Field observations suggest that surface water sulfate concentrations control the distribution of wild rice, an aquatic grass (Zizania palustris). However, hydroponic studies show that sulfate is not toxic to wild rice at even unrealistically high concentrations. To determine how sulfate might directly or indirectly affect wild rice, potential wild rice habitat was characterized for 64 chemical and physical variables in over 100 sites spanning a relatively steep climatic and geological gradient in Minnesota. Habitat suitability was assessed by comparing the occurrence of wild rice with the field variables, through binary logistic regression. This analysis demonstrated that sulfide in sediment pore water, generated by the microbial reduction of sulfate that diffuses or advects into the sediment, is the primary control of wild rice occurrence. Water temperature and water transparency independently control the suitability of habitat for wild rice. In addition to generating phytotoxic sulfide, sulfate reduction also supports anaerobic decomposition of organic matter, releasing nutrients that can compound the harm of direct sulfide toxicity. These results are important because they show that increases in sulfate loading to surface water can have multiple negative consequences for ecosystems, even though sulfate itself is relatively benign.

  19. Kocuria palustris sp. nov. and Kocuria rhizophila sp. nov., isolated from the rhizoplane of the narrow-leaved cattail (Typha angustifolia).

    Science.gov (United States)

    Kovács, G; Burghardt, J; Pradella, S; Schumann, P; Stackebrandt, E; Màrialigeti, K

    1999-01-01

    Two Gram-positive, aerobic spherical actinobacteria were isolated from the rhizoplane of narrow-leaved cattail (Typha angustifolia) collected from a floating mat in the Soroksár tributary of the Danube river, Hungary. Sequence comparisons of the 16S rDNA indicated these isolates to be phylogenetic neighbours of members of the genus Kocuria, family Micrococcaceae, in which they represent two novel lineages. The phylogenetic distinctness of the two organisms TA68T and TAGA27T was supported by DNA-DNA similarity values of less than 55% between each other and with the type strains of Kocuria rosea, Kocuria kristinae and Kocuria varians. Chemotaxonomic properties supported the placement of the two isolates in the genus Kocuria. The diagnostic diamino acid of the cell-wall peptidoglycan is lysine, the interpeptide bridge is composed of three alanine residues. Predominant menaquinone was MK-7(H2). The fatty acid pattern represents the straight-chain saturated iso-anteiso type. Main fatty acid was anteiso-C15:0. The phospholipids are diphosphatidylglycerol, phosphatidylglycerol and an unknown component. The DNA base composition of strains TA68T and TAGA27T is 69.4 and 69.6 mol% G+C, respectively. Genotypic, morphological and physiological characteristics are used to describe two new species of Kocuria, for which we propose the names Kocuria palustris, type strain DSM 11925T and Kocuria rhizophila, type strain DSM 11926T.

  20. High-resolution bioactivity profiling combined with HPLC-HRMS-SPE-NMR: α-Glucosidase inhibitors and acetylated ellagic acid rhamnosides from Myrcia palustris DC. (Myrtaceae).

    Science.gov (United States)

    Wubshet, Sileshi G; Moresco, Henrique H; Tahtah, Yousof; Brighente, Inês M C; Staerk, Dan

    2015-08-01

    Type 2 diabetes (T2D) is an endocrine metabolic disease with a worldwide prevalence of more than 8%, and an expected increase close to 50% in the next 15-20years. T2D is associated with severe and life-threatening complications like retinopathy, neuropathy, nephropathy, and cardiovascular diseases, and therefore improved drug leads or functional foods containing α-glucosidase inhibitors are needed for management of blood glucose. In this study, leaves of Myrcia palustris were investigated by high-resolution α-glucosidase inhibition profiling combined with HPLC-HRMS-SPE-NMR. This led to identification of casuarinin, myricetin 3-O-β-d-(6″-galloyl)galactopyranoside, kaempferol 3-O-β-d-galactopyranoside, myricetin, and quercetin as α-glucosidase inhibitors. In addition, four acetylated ellagic acid rhamnosides, i.e., 4-O-(2″,4″-O-diacetyl-α-l-rhamnopyranosyl)ellagic acid, 4-O-(2″,3″-O-diacetyl-α-l-rhamnopyranosyl)ellagic acid, 4-O-(3″,4″-O-diacetyl-α-l-rhamnopyranosyl)ellagic acid, and 4-O-(2″,3″,4″-O-triacetyl-α-l-rhamnopyranosyl)ellagic acid were identified. Copyright © 2015 Elsevier Ltd. All rights reserved.

  1. Verbesserung der Lebensqualität bei Kinderwunsch-Behandlung durch den Gebrauch patientenfreundlicher Follitropin-Fertigpens

    Directory of Open Access Journals (Sweden)

    Bitzer J

    2011-01-01

    Full Text Available Zur Behandlung des unerfüllten Kinderwunsches unterziehen sich viele Frauen einer assistierten Reproduktionstherapie mit ovarieller Stimulation. Dazu erfolgen tägliche subkutane Injektionen mit Gonadotropinen, welche die Patientinnen eigenständig durchführen können. Häufig haben Patientinnen dabei Angst vor Spritzen und injektionsbedingten Schmerzen. Die vorliegende Beobachtungsstudie zum Einfluss der Anwendung des Follitropin alfa-Fertigpens (Gonal-f®-Pen auf die Lebensqualität der Patientinnen zeigt die Ergebnisse einer Befragung von 170 Frauen zu Angst und Zufriedenheit mit diesem Applikationssystem. Die Erfahrungen wurden vor und nach den Behandlungszyklen auf numerischen Analogskalen quantifiziert und nachfolgend verglichen. Die Studie ergab, dass durch die Verwendung des Gonal-f®-Pens die Angst vor der Injektion und vor Schmerzen signifikant abnahm. Zudem waren die Patientinnen mit dem Applikationssystem äußerst zufrieden.

  2. Energy conservation by technical means: the control systems matter.; Energiesparen durch technische Hilfsmittel: auf die Regelkreise kommt es an.

    Energy Technology Data Exchange (ETDEWEB)

    Benecke, J. [Verein Deutscher Ingenieure (VDI), Muenchen (Germany)

    2000-07-01

    The new German regulation on energy conservation in buildings (draft) offers certain flexibility for choosing the quality of the building envelope (thermal resistance and air tightness) and of the HV equipment (AC not considered) in order to balance and minimize the yearly heating-energy demand. Up to now, there was little consideration given to control systems which are able to assist the inhabitants in using heating and ventilation efficiently. The performance of such systems is being discussed. (orig.) [German] In Deutschland betraegt der Anteil der Raumheizenergie am Endenergieverbrauch rund 35%; ihr Anteil am Endenergieverbrauch der Haushalte und Kleinverbraucher betraegt rund 76%. Die Vorgaben der bisherigen Waermeschutzverordnungen und der geplanten Energieeinsparverordnung veranschaulichen das Energieeinsparpotential, das durch effizientere Energienutzung im Gebaeudebereich erschlossen werden kann. (orig.)

  3. Contrast generation in the nuclear-spin tomography by pulsed ultrasound; Kontrasterzeugung in der Kernspintomographie durch gepulsten Ultraschall

    Energy Technology Data Exchange (ETDEWEB)

    Oehms, Ole Benjamin

    2009-07-10

    In the framework of this thesis a combined method of ultrasound and nuclear-spin tomography is presented. Via ultrasound pulses by the sound-radiation force in liquids and tissue phantoms motions are generated, which depend on ther viscoelastic properties. This motions are made visible by a motion-sensitive tomograph sequence in the phase image of the tomograph in form of a phase change. The first measurements on simple phantoms and liquids are presented. [German] Im Rahmen dieser Arbeit wird eine kombinierte Methode aus Ultraschall und Kernspintomographie vorgestellt. Ueber Ultraschallpulse werden durch die Schallstrahlungskraft in Fluessigkeiten und Gewebephantomen Bewegungen erzeugt, die von den viskoelastischen Eigenschaften abhaengen. Diese Bewegungen werden mit einer bewegungssensitiven Tomographensequenz im Phasenbild des Tomographen in Form einer Phasenaenderung sichtbar gemacht. Die ersten Messungen an einfachen Phantomen und Fluessigkeiten werden praesentiert. (orig.)

  4. Genome Assembly of the Fungus Cochliobolus miyabeanus, and Transcriptome Analysis during Early Stages of Infection on American Wildrice (Zizania palustris L..

    Directory of Open Access Journals (Sweden)

    Claudia V Castell-Miller

    Full Text Available The fungus Cochliobolus miyabeanus causes severe leaf spot disease on rice (Oryza sativa and two North American specialty crops, American wildrice (Zizania palustris and switchgrass (Panicum virgatum. Despite the importance of C. miyabeanus as a disease-causing agent in wildrice, little is known about either the mechanisms of pathogenicity or host defense responses. To start bridging these gaps, the genome of C. miyabeanus strain TG12bL2 was shotgun sequenced using Illumina technology. The genome assembly consists of 31.79 Mbp in 2,378 scaffolds with an N50 = 74,921. It contains 11,000 predicted genes of which 94.5% were annotated. Approximately 10% of total gene number is expected to be secreted. The C. miyabeanus genome is rich in carbohydrate active enzymes, and harbors 187 small secreted peptides (SSPs and some fungal effector homologs. Detoxification systems were represented by a variety of enzymes that could offer protection against plant defense compounds. The non-ribosomal peptide synthetases and polyketide synthases (PKS present were common to other Cochliobolus species. Additionally, the fungal transcriptome was analyzed at 48 hours after inoculation in planta. A total of 10,674 genes were found to be expressed, some of which are known to be involved in pathogenicity or response to host defenses including hydrophobins, cutinase, cell wall degrading enzymes, enzymes related to reactive oxygen species scavenging, PKS, detoxification systems, SSPs, and a known fungal effector. This work will facilitate future research on C. miyabeanus pathogen-associated molecular patterns and effectors, and in the identification of their corresponding wildrice defense mechanisms.

  5. [Peter von Brackel. Christlich Gesprech von der grawsamen Zerstörung in Lifland durch den Muscowiter vom 58. Jar her geschehenn...] / Stefan Donecker

    Index Scriptorium Estoniae

    Donecker, Stefan, 1977-

    2015-01-01

    Arvustus: Christlich Gesprech von der grawsamen Zerstörung in Lifland durch den Muscowiter vom 58. Jar her geschehenn: auch ihren Ursachen mit einer kurtzen Predig und Vermanung, wie beid, Gotlosenn unnd Frommen, diese schreckliche Mutation fruchtbarlich behertzigen und ihnen zu Nutz machen sollen: durch Timannum Brakel Livoniensem, der Gemeine Christi vonn der Augsburgischen Confession Prediger zu Anttorf einfeltig gestellet unnd inn Druck verfertiget = Darstellung der Geschichte Livlands vor und während des "Livländischen Krieges" bis 1578 in gereimter Dialogform und Prosa von dem Prediger und Geschichtsschreiber Timann Brakel : Originaltext und Übersetzung ins Hochdeutsche mit Kommentaren, Ergänzungen, Bildern und dem Lebenslauf des Timann Brakel. (Beiträge zur baltischen Geschichte, 19). Verlag Harro von Hirschheydt. Wedemark 2012

  6. Regenerierung fester Katalysatoren für die Isobutan-Buten-Alkylierung durch hydrierende Behandlung in flüssiger Phase

    OpenAIRE

    Klingmann, Raoul

    2005-01-01

    In der vorliegenden Arbeit wurde die Regenerierung fester Katalysatoren für die Isobutan/Buten-Alkylierung durch hydrierende Behandlung in flüssiger Phase untersucht. Als Katalysatoren dienten edelmetallhaltige Zeolithe des Typs La-X (FAU). Die Alkylierungs- und Regenerierungsexperimente wurden in einer Apparatur mit kontinuierlich betriebenem Rührkesselreaktor und Analytikeinheit mit On-line-Probenahmevorrichtung durchgeführt. Zunächst wurde der Aufbau der Koksdeposite in Abhängigkeit von...

  7. Aktive Steuerung des Transmissionsverhaltens stochastischer Störquellen durch flächige Leichtbaustrukturen [Active feedforward control of the transmission of stochastic disturbances through lightweight panel structures

    OpenAIRE

    Misol, Malte

    2014-01-01

    Leichtbaustrukturen weisen eine geringe Schalldämmung bei tiefen Frequenzen auf. Ihr Einsatz bei Gebäuden, Fahr- oder Flugzeugen ist daher mit negativen Auswirkungen auf die Innenraumakustik verbunden. Adaptronische Maßnahmen, wie die aktive Struktur-Akustik-Regelung (ASAC), können passive Maßnahmen der Schalldämmung flankieren oder ersetzen. Gegenstand dieser Arbeit ist die Beeinflussung der Transmission stochastischer Störquellen durch ein- und doppelwandige Leichtbaustruktursysteme mithilf...

  8. THESEUS - achieving maximum possible road transport tanker safety by means of experimental accident simulation; THESEUS - Tankfahrzeuge mit hoechsterreichbarer Sicherheit durch experimentelle Unfallsimulation

    Energy Technology Data Exchange (ETDEWEB)

    Rompe, K.; Heuser, G.

    1996-03-01

    In spring 1990, the Federal German Minister for Education, Science, Research and Technology (BMBF) commissioned the team from the Federal Institute for Materials Research and Testing (BAM), DEKRA, Daimler-Benz, the Federal Road Research Institute (BASt) with the University of Cologne, Ellinghaus and TUeV Rheinland (project leader) to perform the research project `THESEUS` (the acronym THESEUS comes from the German `Tankfahrzeuge mit hoechst erreichbarer Sicherheit durch experimentelle Unfallsimulation`, which translates as `achieving maximum possible road transport tanker safety by means of experimental accident simulation`). Arting from an analysis of road transport tanker accidents, crash tests and overturn tests were performed and supplemented by investigations of road transport tanker components and accompanying complex calculations of the failure processes. Parallel to this, the static side-tilt stability of road transport tankers was determined on a tilting test platform. The causes of and constructive possibilities for avoiding overturning, which is the most common cause of accidents in which hazardous materials escape, wewre analysed in dynamic driving tests with supplementary computer simulation. Various measures for improving the safety of road transport tankers were determined and subjected to a cost-benefit analysis. (orig.) [Deutsch] Das Bundesministerium fuer Bildung, Wissenschaft, Forschung und Technologie hat seit 1990 das Forschungsproject `THESEUS` (Tankfahrzeuge mit hoechst erreichbarer Sicherheit durch experimentelle Unfallsimulation) der Arbeitsgemeinschaft aus TUeV Rheinland (Federfuehrung), Bundesanstalt fuer Materialforschung und -pruefung (BAM), DEKRA, Daimler Benz, Bundesanstalt fuer Strassenwesen (BASt), Universitaet Koeln und Ellinghaus gefoerdert. Ausgehend von der detaillierten Analyse von 231 Tankfahrzeugunfaellen wurden Tankfahrzeug-Crashversuche und Tankfahrzeug-Umsturzversuche durchgefuehrt. Diese Messungen an kompletten Fahrzeugen

  9. Reuse of filter backwash water with a submerged microfiltration membrane system; Wiederverwendung von Filterspuelwaessern durch Mikrofiltration mit getauchten Membranen

    Energy Technology Data Exchange (ETDEWEB)

    Koetzle, T.; Merkl, G.; Wilderer, P. [Technische Univ. Muenchen, Garching (Germany). Lehrstuhl und Lab. fuer Wasserguete- und Abfallwirtschaft; Backhaus, J. [Erlanger Stadtwerke AG, Erlangen (Germany); Hagen, K. [VA TECH WABAG GmbH Kulmbach, Kulmbach (Germany)

    2000-12-01

    During the treatment of groundwater by filtration for drinking water purposes, approximately 3% of the treated water volume has to be used as filter backwash water. Until now this backwash water charged with the accumulated filtrate is then redirected into sewers or receiving waters, either directly or after a sedimentation step. With sufficient separation of the filtered substances from backwash water this could again be used for drinking water purposes. This conserves natural groundwater resources and significantly reduces the volume of wastewater discharged. Especially in the face of the increasing shortage of useable groundwater resources in many countries, this will become increasingly important in the future. In our project, supported by 'EU-Life', the Technical University of Munich will examine on a large-scale plant according to the WABAG-SMS-Process, how far cross-flow microfiltration is capable of purifying the backwash waters for drinking water purposes again. The pilot-plant consists of two treatment parts, one charged with backwash water from the iron-, manganese- and arsenic-elimination, the other charged with backwash water from the deacidification. The membrane modules are submerged in closed storage basins for backwash water. Air is supplied under the modules to generate a defined cross-flow. This article discusses the results after one year of operation of the plant. (orig.) [German] Bei der Aufbereitung von Grundwasser durch Filtration in der Trinkwasseraufbereitung muessen etwa 3% der aufbereiteten Wassermenge zur Rueckspuelung der Filter verwendet werden. Bisher werden die hierbei anfallenden und mit den zuvor abfiltrierten Stoffen belasteten Filterspuelwaesser je nach den oertlichen Gegebenheiten unmittelbar oder nach einer Sedimentationsstufe in Vorfluter oder die oeffentliche Sammelkanalisation abgeschlagen. Durch eine hinreichende Trennung der abfiltrierten Stoffe vom Filterspuelwasser koennte dieses wieder der

  10. Replacement of coal-fuelled stoves by modern room heating systems in multistorey dwellings; Abloesung der Kohle-Einzelofenheizung durch moderne Raumheizungssysteme in Mehrgeschossbauten

    Energy Technology Data Exchange (ETDEWEB)

    Lindner, K. [Institut fuer Energetik und Umwelt gGmbH, Leipzig (Germany)

    1997-12-31

    In eastern Germany, approximately one million residential units in multi-storey apartment buildings are still heated with coal-fired stoves. Not all building societies or private house-owners can afford to substitute modern heating systems for individual coal stoves within the foreseeable future. Problems encountered when modernizing heating systems are described. A way of pre-financing modernization is by loans given by the tenants to the building society. The paper deals with individual aspects, such as contract conditions, organization and experience with this model, as well as its advantages for the landlord and tenant. (MSK) [Deutsch] In Ostdeutschland werden noch rund 1 Million Wohnungen in mehrgeschossigen Wohnhaeuern mit Kohle geheizt. Nicht alle Wohnungsgenossenschaften oder privaten Hauseigentuemer sind finanziell in der Lage in absehbarer Zeit die Kohle-Einzelheizung durch moderne Heizungssysteme abzuloesen. Im Folgenden werden die Probleme bei der Heizungsmodernisierung beschrieben. Der Weg Heizungsmodernisierung durch Mieterdarlehen wird in einzelnen Punkten wie Finanzierung durch Mieterdarlehen, deren Organisation und Erfahrungen mit diesem Modell sowie die Vorteile fuer Vermieter und Mieter dargelegt.

  11. Climate protection by reducing the emissions of greenhouse gases in households and the tertiary sector through climate-conscious behaviour. Vol. 1; Klimaschutz durch Minderung von Treibhausgasemissionen im Bereich Haushalte und Kleinverbrauch durch klimagerechtes Verhalten. Bd. 1. Private Haushalte

    Energy Technology Data Exchange (ETDEWEB)

    Brohmann, B; Cames, M

    2000-06-01

    The aim of the project was to identify areas in households and the tertiary sector in which changes in behaviour could result in energy conservation and thus a reduction of greenhouse gas emissions, and to quantify the potentials for 1995, 2005 and 2020. A second focus was on the analysis and evaluation of programmes and instruments to realise the potentials. With literature evaluation, expert interviews, and a household servey potentials and further technical development have been identified. In sum, behavioural measures can contribute to the CO2 reduction by 64 million tons in 1995 in households and 27 in the commercial sector in which the potential decreases to 18 million tons in 2020 due to the autonomous technical development. Adequate promotion programmes can help to realise 20-30% of the potential by 2020. (orig.) [German] Ziel des Vorhabens war, im Sektor private Haushalte und Kleinverbrauch Bereiche zu identifizieren, in denen Verhaltensaenderungen zur Energieeinsparung fuehren koennen, und diese Potenziale fuer 1995, 2005 und 2020 zu quantifizieren. Darauf aufbauend waren Programme und Instrumente zur Umsetzung aufzuzeigen und zu bewerten. Gestuetzt auf Literaturrecherchen und Expertengespraeche wurden Einzelpotenziale, Rahmenbedingungen, Entwicklungstrends in der Technik und im Ausstattungsgrad ermittelt. Insgesamt koennten Verhaltensmassnahmen im Haushaltssektor die CO2-Emissionen im Basisjahr 1995 um 64 Mio, im Kleinverbrauch um 27 Mio t vermindern. Bis 2020 bleibt dieses Potenzial im Haushaltssektor in etwa gleich. Im Kleinverbrauch sinkt es infolge der autonomen Technikentwicklung auf 18 Mio t ab. Durch geeignete Programme koennen bis 2020 etwa 20-30% des Potenzials erreicht werden. (orig.)

  12. On-line analysis of water contamination by organic compounds; On-line-Analytik der Wasserverschmutzung durch organische Substanzen

    Energy Technology Data Exchange (ETDEWEB)

    Wagt, R. van der; Vos, F. de [Skalar Analytical (Netherlands); Babichenko, S.; Poryvkina, L. [Institute of Ecology, Tallinn (Estonia)

    1999-08-01

    In many environmental applications decomposing the mixture of substances in the water into its various chemical ingredients, for subsequent analysis, is a very complicated task. The most productive approach to on-line diagnosis is to treat the object as an integral spectroscopic sample, characterized by certain specific Spectral Fluorescent Signatures (SFS). The SFS are recorded as a matrix of fluorescent intensity of organic compounds in water, in co-ordinates of excitation and emission spectra, providing a three-dimensional spectrum. Spectral windows of SFS are defined by fluorescent characteristics of basic groups of organic substances in the water sample. The novel Skalar Fluo Imager, based on this principle, is intended for the analysis of organic compounds in natural, domestic, and technological waters in an on-line mode. (orig.) [German] In vielen Umweltschutzanwendungen stellt die Auftrennung eines Substanzgemisches zum Zweck der Analyse eine sehr komplizierte Aufgabe dar. Ein erfolgversprechender Ansatz fuer eine on-line-Diagnostik besteht darin, das Objekt als integrale Spektroskopieprobe zu betrachten, die durch bestimmte spezifische Spektral-Fluoreszenz-Signaturen (SFS) charakterisiert wird. Diese werden als Fluoreszenz-Intensitaets-Matrix organischer Verbindungen in Wasser dargestellt, mit Anregungs- und Emissionsspektren als weiteren Koordinaten, wodurch ein dreidimensionales Spektrum entsteht. Spektrale Fenster der SFS sind definiert als Fluoreszenzcharakteristika von Funktionsgruppen organischer Substanzen in der Wasserprobe. Der auf diesem Prinzip basierende Skalar Fluo Imager ist fuer die on-line-Analyse organischer Bestandteile in natuerlichen, Haus- und technischen Waessern gedacht. (orig.)

  13. Neue Möglichkeiten in der archäologischen arbeit durch den Einsatz digitales Bildauswertung und photogrammetrischer Messtechniken

    Directory of Open Access Journals (Sweden)

    Jan Wesbuer

    2005-01-01

    Full Text Available Die digitale Bildbearbeitung und die digitale Photogrammetrie haben in den letzten Jahren, neben vielen anderen Gebieten, die Dokumentation von Ausgrabungsstätten beeinflusst. Die Photogrammetrie hat ihren Ursprung in der Vermessungskunde. Sie wird heutzutage in vielen Bereichen der Ingenieurwissenschaften eingesetzt und hat somit viele Schnittbereiche zu angrenzenden wissenschaftlichen Gebieten. In der Archäologie hat sie daher die Möglichkeit, in vielen Bereichen die herkömmliche Geodäsie zu erweitern bzw. neue Möglichkeiten der Visualisierung zu schaffen oder bei der Bildauswertung zu helfen.Durch die Bildbearbeitung ist es heutzutage möglich, schnell und vor Ort die Dokumentation vorzunehmen. Mit ihrer Hilfe können z.B. nicht orthogonale Aufnahmen perspektivisch entzerrt werden, so dass in ihnen wieder gemessen werden kann.Der Artikel unterteilt sich in 3 Bereiche:• als erstes werden die Möglichkeiten der digitalen Bildbearbeitung bzw. Auswertung von Photos dargestellt.• danach wird auf die photogrammetrische Auswertung und Vermessung von Ausgrabungsstätten eingegangen. • und zuletzt werden einige Visualisierungsmöglichkeiten gezeigt, die mit Hilfe der photogrammetrischen Auswertung und 3DModellerstellung realisiert werden können.

  14. Advantages of variable-speed operation of hydraulic turbo-engines; Vorteile durch den drehzahlvariablen Betrieb von hydraulischen Stroemungsmaschinen

    Energy Technology Data Exchange (ETDEWEB)

    Harbort, T. [Stuttgart Univ. (Germany). Inst. fuer Stroemungsmechanik und Hydraulische Stroemungsmaschinen

    1997-12-31

    The performance of current hydraulic turbo-engines in the variable speed sector is monitored and judged. The study covers radial and axial engines as well as Pelton turbines. Variable-speed operation of hydraulic turbo-engines can be realized by means of different combinations of electrical rotating machines and frequency converters. The operating range of the frequency converter plays an important role in the optimization of performance and is taken into account. The smoothness of run of reaction turbines and their cavitation performance can be enhanced by speed regulation. But above all, efficiency is more or less substantially enhanced during partial load or in the case of greatly varying heights of drop. The latter holds true also of Pelton turbines. (orig.) [Deutsch] Das Betriebsverhalten der gaengigen hydraulischen Stroemungsmaschinen wird in Hinblick auf den drehzahlvariablen Betrieb erfasst und beurteilt. Die Untersuchung erfolgt fuer Radialmaschinen, Axialmaschinen und Peltonturbinen. Der drehzahlvariable Betrieb hydraulischer Stroemungsmaschinen kann mit verschiedenen Kombinationen von elektrischen Maschinen und Frequenzumrichtern realisiert werden. Der Arbeitsbereich des Frequenzumrichters spielt eine wichtige Rolle fuer die Optimierung des Betriebsverhaltens und wird beruecksichtigt. Bei Ueberdruckturbinen kann man durch Drehzahlregelung eine groessere Laufruhe sowie ein guenstigeres Kavitationsverhalten erreichen. Vor allem aber sind im Teillastbereich oder bei stark schwankenden Fallhoehen mehr oder weniger grosse Wirkungsgradgewinne erzielbar. Das letztere gilt auch fuer Peltonturbinen. (orig.)

  15. Altitude dependence of trace substance deposition from clouds to forests. Final report; Hoehenabhaengigkeit der Spurenstoffdeposition durch Wolken auf Waelder. Abschlussbericht

    Energy Technology Data Exchange (ETDEWEB)

    Pahl, S.; Winkler, P.

    1995-12-31

    Novel forest decline is particularly pronounced in the area of the ridges of medium-range mountains. Whereas acid precipitation was viewed as its sole cause early on in the discussions, it turned out later that the impact of trace gases, too, contributes to the damaging of forests. This report wants to point out the importance of fog interception, which equally plays a part in the pollutant receipts of forests. The deposition of fog water to a forest stand depends very much on altitude, so that trace substance deposition, too, is to be expected to be dependent on altitude. By attempting to quantify this effect, the report helps to pinpoint areas of relevance of this deposition pathway (orig./KW) [Deutsch] Die neuartigen Waldschaeden sind in den Kammlagen der Mittelgebirge besonders ausgepraegt. Waehrend in der anfaenglichen Diskussion die sauren Niederschlaege als alleinige Ursache angesehen wurden, zeigte sich spaeter, dass auch Einwirkungen von Spurengasen zur Schaedigung des Waldes beitragen. Dieser Bericht soll auf die Bedeutung der Nebelinterzeption aufmerksam machen, die ebenfalls zum Schadstoffeintrag in den Wald beitraegt. Die Deposition von Wolkenwasser auf einen Waldbestand ist stark abhaengig von der Hoehenlage, in der sich der Waldbestand befindet, so dass auch eine Hoehenabhaengigkeit des Spurenstoffeintrages zu erwarten ist. Durch den Versuch der Quantifizierung traegt dieser Bericht dazu bei, Gebiete zu erkennen, in denen dieser Eintragspfad eine Rolle spielt. (orig./KW)

  16. Retrospektive Analyse von Zufallsbefunden, die bei Patienten mit kutanem malignen Malignom durch (18) F-Fluordeoxyglucose-PET/CT erhoben wurden.

    Science.gov (United States)

    Conrad, Franziska; Winkens, Thomas; Kaatz, Martin; Goetze, Steven; Freesmeyer, Martin

    2016-08-01

    Bei der (18) F-Fluordeoxyglucose-Positronenemissionstomographie/Computertomographie (FDG-PET/CT) ergeben sich häufig Zufallsbefunde. In der vorliegenden Studie konzentrierten wir uns auf mittels FDG-PET/CT erhaltene Zufallsbefunde bei Patienten mit kutanem Melanom und überprüften deren Relevanz hinsichtlich weiterer diagnostischer Maßnahmen und Interventionen. Die Krankenakten von 181 konsekutiven Melanom-Patienten wurden retrospektiv ausgewertet, um das Management von Zufallsbefunden zu dokumentieren. Der Schwerpunkt lag dabei auf den histologischen Befunden. Bei 33 von 181 (18 %) Patienten lagen 39 relevante Zufallsbefunde vor, und zwar im Kolorektalbereich (n = 15 Patienten), in der Schilddrüse (n = 8), der Prostata (n = 2), dem Bewegungsapparat (n = 2), in Lymphknoten (n = 2), der Parotis (n = 1), den Mandeln (n = 1), den Nieren (n = 1) und der Gallenblase (n = 1). Bei 25 Patienten schlossen sich weitere diagnostische Verfahren an, wobei in 21 Fällen ein klinisches Korrelat nachgewiesen wurde. Bei 16 von 21 Patienten ergab sich eine Neoplasie, darunter fünf maligne Läsionen (vier Kolonkarzinome und ein Prostatakarzinom). Die Malignome wurden frühzeitig diagnostiziert und in der Mehrzahl der Fälle erfolgreich entfernt. Der Einsatz der FDG-PET/CT als Routine-Diagnostik wird in den Leitlinien empfohlen und ist indiziert bei malignem Melanom ab Stadium IIC. In dieser Studie wurden auf effektive Weise ansonsten nicht erkannte Krebserkrankungen, insbesondere Kolonkarzinome, detektiert. In den meisten Fällen war eine frühe Intervention möglich. Zufallsbefunde durch FDG-PET/CT sollten, unter Berücksichtigung des Zustands und der Wünsche des Patienten, mit den geeigneten diagnostischen Maßnahmen abgeklärt werden. © 2016 Deutsche Dermatologische Gesellschaft (DDG). Published by John Wiley & Sons Ltd.

  17. Potential and possibilities of supplying energy from biomass and biogas; Potentiale und Moeglichkeiten der Energiebereitstellung durch Biomasse und Biogas

    Energy Technology Data Exchange (ETDEWEB)

    Sonnenberg, H. [Bundesforschungsanstalt fuer Landwirtschaft, Braunschweig (Germany). Inst. fuer Betriebstechnik; Weiland, P.; Ahlgrimm, H.J. [Bundesforschungsanstalt fuer Landwirtschaft (FAL), Braunschweig (Germany). Inst. fuer Technologie

    1998-06-01

    Agriculture`s potential contribution to the energy supply of the ``town of the future`` through the conversion of biomass to energy, including biogas production, is a rather modest one. Supposing that the share of total renewable energy in Germany`s primary energy demand rises to approximately 4%, then the proportion of biomass from biotic raw materials especially produced for the purpose will at the most make up an eighth of this amount. Beyond this, biomass is burdened with other drawbacks such as low supply efficiency, limited availability, and weather-dependent reliability. On the other hand, biomass is well suited for conversion to solid, liquid, and gaseous fuels, including inexpensive ones with low energy density (solid fuels), mostly used for stationary heating applications, as well as more expensive ones such as liquid fuels with a high energy density for mobile applications in the automotive sector. Thanks to its capacity to regenerate, biomass is an inexhaustible resource. Moreover, its natural life cycle has a small impact on the environment. [Deutsch] Der Beitrag, den die Landwirtschaft durch energetische Nutzung von Biomasse, z.B. auch mit der Erzeugung von Biogas, zur Energieversorgung der `Stadt der Zukunft` leisten kann, nimmt sich bescheiden aus. Wird erwartet, dass innerhalb des naechsten Jahrzehnts der Anteil regenerativer Energien insgesamt auf etwa 4% des Primaerenergie-Verbrauchs Deutschlands ansteigen koennte, so duerfte Biomasse als speziell zur Energiegewinnung angebaute nachwachsende Rohstoffe mit bestensfalls 0,5 Prozentpunkten daran beteiligt sein. Es beduerfen darueber hinaus auch Nachteile, wie geringe Bereitstellungseffizienz, beschraenkte Verfuegbarkeit und witterungsabhaengige Zuverlaessigkeit, der Beachtung. Die Biomasse kann jedoch mit Erfolg in feste, fluessige und gasfoermige Energietraeger konvertiert werden, sowohl in preiswerte mit geringer Energiedichte (Festbrennstoffe) fuer bevorzugt stationaeren Heizungs-Einsatz als auch

  18. Higher efficiency of steam flooding projects with horizontal production wells; Verbesserung der Effizienz von Dampfflutprojekten durch horizontale Foerderbohrungen

    Energy Technology Data Exchange (ETDEWEB)

    Leonhardt, B. [Wintershall AG Erdoelwerke, Barnstorf (Germany)

    2001-07-01

    For 50 years, the Emlichheim oil field has had a production level of about 150,000 t.p.a. of crude oil. Reinjection of deposit water was started in 1952 already in order to maintain the required pressure. Until 1997, all wells were sunk vertically as the loose sandstone was considered unstable. The Emlichheim 300 well was constructed in 1999; it was the first horizontal well that proved that horizontal drilling is possible in this bedrock material. The contribution describes the history of this field and the projecting and implementation of a steam flooding project involving horizontal production wells. [German] Das Erdoelfeld Emlichheim weist seit nunmehr 50 Jahren ein Foerderplateau von rund 150.000 Jahrestonnen Reinoel auf. Nach der Produktionsaufnahme in 1944 wurde dieses Niveau erstmals 1950 erreicht. Bereits 1952 musste zur Druckerhaltung mit der Reinjektion von Lagerstaettenwasser begonnen werden. Bis 1997 wurden alle Bohrungen im Erdoelfeld Emlichheim vertikal abgeteuft. Als groesstes Problem fuer Horizontalbohrungen wurde die Bohrlochstabilitaet in der Bohr- und Komplettierungsphase erachtet, da der Bentheimer Sandstein unverfestigt ist. Mit dem Abteufen der Emlichheim 300 im Jahre 1999 wurde der Nachweis erbracht, dass das Bohren und Komplettieren einer ca. 280 m langen Horizontalstrecke in diesem Traeger erfolgreich moeglich ist. Vorliegende Publikation gibt einen kurzen Einblick in die Geschichte des Feldes, die Planung und Realisierung eines laufenden Dampfflutprojektes unter Einbindung von horizontalen Foerderbohrungen und vergleicht deren Performance mit frueheren Projekten. Zusaetzlich wird auf gewonnene Erkenntnisse durch das Abteufen von Horizontalbohrungen im nicht verfestigten Sandstein eingegangen. Abschliessend soll ein Ausblick auf die weitere Feldentwicklung gegeben werden. (orig.)

  19. Detection of partial discharges in oil transformers with the aid of acoustic emission analysis; Detektion von Teilentladungen in Oeltransformatoren durch die Schallemissionsanalyse

    Energy Technology Data Exchange (ETDEWEB)

    Loehr, M. [Physical Acoustics BV - Deutschland, Hamburg (Germany)

    2007-07-01

    Since the early eighties, acoustic emission analysis has been used for functional testing of transformers. Partial discharges of 150 pC and above are detected reliably. Transformers with oil/paper insulation as a rule are inspected during operation by analysis of the transformer oil at regular intervals or continuously. This integral method provides no information on the operating conditions causing partial discharge and no information on their location. This information gap may be closed by acoustic emission analysis, which will provide the key information required for selective planning of preventive measures. Physical Acoustics (PAC) tested several hundreds of transformers successfully for their operating performance (see also EPRI Project I.D. No. 051481). As a result, e.g., transformers can now be operated for a longer period of time below critical load. [German] Die Schallemissionsanalyse wird seit den fruehen 80-iger Jahren letzten Jahrhunderts von Transformator-Herstellern bei der Funktionspruefung eingesetzt. Hierbei werden Teilentladungen von 150 pC und mehr zuverlaessig detektiert. Oel-papierisolierte Transformatoren werden in der Regel waehrend des Betriebs durch eine Analyse des Transformator-Oels inspeziert. Die Oelanalyse kann in regelmaessigen Abstaenden oder dauerhaft erfolgen. Als integrales Verfahren bietet diese Methode keine Information zu den Betriebsbedingungen unter den Teilentladungen auftreten und gibt auch keine Information zum Ort deren Auftretens. Diese Informationsluecke kann durch den Einsatz einer Schallemissionspruefung (AT) geschlossen werden. Mit dem Messen der Schallemission durch am Trafokessel angebrachte Sensoren kann der Ort und der Zeitpunkt von Stoerungen festgestellt werden. Mit diesen Schluesselinformationen wird es moeglich, die weiteren notwendigen Massnahmen gezielt zu planen. Physical Acoustics (PAC) hat mehrere hunderte von Transformatoren erfolgreich auf ihr Betriebsverhalten untersucht (siehe auch EPRI-Projekt I

  20. Wir überwachen uns. Wie die Sicherheit durch die Digitalisierung immer tiefer in den Alltag eingreift und warum uns das nicht interessiert

    Directory of Open Access Journals (Sweden)

    Martin Schinagl

    2014-10-01

    Full Text Available Der Bereich der Überwachung und Sicherheit unterliegt einer neoliberalen Neuausrichtung. Mit der Entstehung unheiliger Allianzen zwischen Staat und Wirtschaft, gezielter Privatisierung und einer neuen Warenförmigkeit von Sicherheit entgrenzen sich zunehmend auch deren Produktionsprozesse. Das Subjekt wird durch eine Digitalisierung der Alltagswelten zunehmend in die Sicherheitsarbeit mit eingebunden und übernimmt zentrale Aufgaben. Der Mensch, ohne dessen Zutun das digitale Überwachungssystem nicht so gut funktionieren würde, erscheint außerstande und unwillig, sich dieser Entwicklung zu entziehen.

  1. Attenuation corrections through energy spectra analysis of whole body and partial body measurements applying gamma spectroscopy; Schwaechungskorrektur bei gammaspektroskopischen Ganz- und Teilkoerpermessungen durch Analyse der Energiespektren

    Energy Technology Data Exchange (ETDEWEB)

    Schelper, L.F.; Lassmann, M.; Haenscheid, H.; Reiners, C. [Wuerzburg Univ. (Germany). Klinik und Poliklinik fuer Nuklearmedizin

    1997-12-01

    The study was carried out within the framework of activities for testing means of direct determination of radioactivity levels in the human body due to incorporated, inhomogenously distributed radionuclides. A major task was to derive the average depth of activity distributions, particularly from photon radiation at energies below 500 keV, for the purpose of making suitable attenuation corrections. The paper presents two applicable methods which yield information on the mean depths of activity distributions, obtained through additional analyses of the energy spectra. The analyses are based on measuring the dependence of intensity of the Compton radiation on the length of pathways of the photons penetrating the soft tissue, or on measuring the energy-dependent absorption effects with photons. (orig./CB) [Deutsch] Im Rahmen der direkten Aktivitaetsbestimmung bei inhomogener Radionukliddeposition im menschlichen Koerper mittels Ganz- oder Teilkoerpermessanlagen im klinischen Bereich oder im Strahlenschutz sollte besonders bei Photonenstrahlung mit Energien von weniger als 500 keV eine Ermittlung der mittleren Tiefe der Aktivitaetsverteilung zur Schwaechungskorrektur erfolgen. Im klinischen Umfeld ist es haeufig moeglich, zur Tiefenkorrektur die mittlere Organtiefe und damit die schwaechende Gewebsschicht mittels Ultraschall zu bestimmen. Ergaenzend hierzu werden im Folgenden zwei Methoden vorgestellt, welche Aussagen ueber die mittlere Tiefe von Aktivitaetsverteilungen durch Gewinnung von Zusatzinformationen aus dem Energiespektrum im Rahmen von gamma-spektroskopischen Personenmessungen ermoeglichen. Dazu werden einerseits die Abhaengigkeit der Intensitaet der Comptonstrahlung von der Laenge der Wegstrecke von Photonen durch Weichgewebe und andererseits energieabhaengige Absorptionseffekte bei Photonen als Grundlage herangezogen. (orig.)

  2. Fetal lung development on MRI. Normal course and impairment due to premature rupture of membranes; Fetale Lungenentwicklung in der MRT. Normaler Verlauf und Beeintraechtigung durch vorzeitigen Blasensprung

    Energy Technology Data Exchange (ETDEWEB)

    Kasprian, G. [Medizinische Universitaet Wien (Austria). Klinik fuer Radiodiagnostik; Zentrum fuer Anatomie und Zellbiologie der Medizinischen Universitaet Wien (Austria). Arbeitsgruppe Integrative Morphologie; Brugger, P.C. [Zentrum fuer Anatomie und Zellbiologie der Medizinischen Universitaet Wien (Austria). Arbeitsgruppe Integrative Morphologie; Helmer, H.; Langer, M. [Medizinische Universitaet Wien (Austria). Klinik fuer Frauenheilkunde; Balassy, C.; Prayer, D. [Medizinische Universitaet Wien (Austria). Klinik fuer Radiodiagnostik

    2006-02-15

    A well-organized interplay between many molecular factors as well as mechanical forces influence fetal lung development. At the end of this complex process a sufficiently sized and structurally mature organ should ensure the postnatal survival of the newborn. Besides prenatal ultrasonography, magnetic resonance imaging (MRI) can now be used to investigate normal and pathological human lung growth in utero. Oligohydramnios, due to premature rupture of membranes (PROM), is an important risk factor for compromised fetal lung growth. In these situations MR volumetry can be used to measure the size of the fetal lung quite accurately. Together with the evaluation of lung signal intensities on T2-weighted sequences, fetuses with pulmonary hypoplasia can be readily detected. (orig.) [German] Die fetale Lungenentwicklung wird einerseits durch eine Vielzahl molekularer Faktoren und andererseits durch mechanisch-physiologische Kraefte beeinflusst. Ein geordnetes Zusammenspiel dieser Mechanismen fuehrt zu einem ausreichend grossen und strukturell reifen Organ, das sofort nach der Geburt das Ueberleben des Neugeborenen sicherstellt. Neben der praenatalen Ultraschalluntersuchung bietet nun auch die Magnetresonanztomographie (MRT) die Moeglichkeit, die normale und pathologische fetale Lungenentwicklung zu untersuchen. Ein wesentlicher Risikofaktor fuer eine Beeintraechtigung der Lungenentwicklung ist die verminderte Fruchtwassermenge nach vorzeitigem Blasensprung. In diesen Faellen kann die MR-Volumetrie dazu eingesetzt werden, die Groesse der fetalen Lungen relativ genau zu bestimmen. Gemeinsam mit der Beurteilung der MR-Signalintensitaeten des Lungengewebes auf T2-gewichteten Sequenzen koennen Feten mit hypoplastischen Lungen mit zunehmender Sicherheit bereits praenatal identifiziert werden. (orig.)

  3. Mobilization of PAH by synthetic gastrointestinal juice from contaminated soil of a former landfill area; Mobilisierung von PAK durch synthetische Verdauungssaefte aus dem kontaminierten Bodenmaterial einer Altlastenflaeche

    Energy Technology Data Exchange (ETDEWEB)

    Hack, A.; Selenka, F.; Wilhelm, M. [Bochum Univ. (Germany). Abt. fuer Hygiene, Sozial- und Umweltmedizin

    1998-10-01

    In the present study, the amount of polycyclic aromatic hydrocarbons (PAH) in contaminated soil material, which may be available for absorption in the gastrointestinal tract, is estimated by means of evaluating the PAH mobilization by synthetic gastric and intestinal juice in an in vitro test system. Five contaminated soil materials from a former landfill site are analysed in this gastrointestinal model for the PAH of the U.S.EPA-standard. For quantification, an HPLC method with reversed-phase chromatography and on line fluorescence detection is used. The PAH concentration of the contaminated soil materials ranged from 37 {mu}g/g up to 196 {mu}g/g in total. The mobilization of the PAH in the gastrointestinal model ranged from 0.3% up to 1.3% when gastrointestinal juice was used alone. In the presence of whole milk powder, however, the mobilization was enhanced to values from 10.8% up to 14.5%. Since the soil material was taken from different parts of the contaminated area, and since the mobilization of the PAH from the different materials shows only minor differences, the mobilization data evaluated may be considered as representative for the whole contaminated area. Compared to other contaminated soil materials, especially those from gas work areas or coke plants, the mobilization rate of PAH by the gastrointestinal model from the soil materials used in this study is low. The health risk caused, by ingestion of this soil material, as far as PAH are concerned, is actually smaller than the risk calculated from the total content of PAH of the contaminated soil. (orig.) [Deutsch] Im allgemeinen wird nur ein Teil der Schadstoffe aus oral aufgenommenem kontaminiertem Bodenmaterial im Gastrointestinaltrakt resorbiert. In der vorliegenden Studie wird der resorptionsverfuegbare Anteil der PAK aus dem real kontaminierten Bodenmaterial einer ehemaligen Deponie aus dem sueddeutschen Raum anhand der Mobilisierbarkeit der PAK durch die Verdauungssaefte des oberen

  4. ORF Alignment: NC_005296 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_005296 gi|39936538 >1u07A 13 88 186 259 1e-09 ... emb|CAE28917.1| possible energy ...transducer TonB [Rhodopseudomonas palustris CGA009] ... ref|NP_948814.1| possible energy transducer T

  5. ORF Alignment: NC_005296 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_005296 gi|39935198 >1u07A 9 88 204 283 1e-12 ... emb|CAE27570.1| possible energy t...ransducer TonB, C-terminal region ... [Rhodopseudomonas palustris CGA009] ref|NP_947474.1| ... possible energy

  6. ORF Alignment: NC_002939 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_002939 gi|39995137 >1u07A 13 88 186 259 1e-09 ... emb|CAE28917.1| possible energy ...transducer TonB [Rhodopseudomonas palustris CGA009] ... ref|NP_948814.1| possible energy transducer T

  7. ORF Alignment: NC_002939 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_002939 gi|39996799 >1u07A 9 88 204 283 1e-12 ... emb|CAE27570.1| possible energy t...ransducer TonB, C-terminal region ... [Rhodopseudomonas palustris CGA009] ref|NP_947474.1| ... possible energy

  8. ORF Alignment: NC_002678 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_002678 gi|13471241 >1u07A 13 88 186 259 1e-09 ... emb|CAE28917.1| possible energy ...transducer TonB [Rhodopseudomonas palustris ... CGA009] ref|NP_948814.1| possible energy transducer ...

  9. ORF Alignment: NC_004463 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_004463 gi|27379019 >1u07A 13 88 186 259 1e-09 ... emb|CAE28917.1| possible energy ...transducer TonB [Rhodopseudomonas palustris CGA009] ... ref|NP_948814.1| possible energy transducer T

  10. ORF Alignment: NC_005296 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_005296 gi|39933548 >1v7zA 10 254 14 256 2e-44 ... emb|CAE25915.1| putative creatin...e amidohydrolase [Rhodopseudomonas palustris ... CGA009] ref|NP_945824.1| putative creatine ...

  11. ORF Alignment: NC_005296 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_005296 gi|39933534 >1rkd0 3 296 29 346 6e-36 ... emb|CAE25901.1| possible cabohydr...ate kinases [Rhodopseudomonas palustris CGA009] ... ref|NP_945810.1| possible cabohydrate kinases ...

  12. Durch Zwang zur Freiheit?

    Directory of Open Access Journals (Sweden)

    Peter Collin

    2011-01-01

    Full Text Available Economic self-government occurs when organized economic actors fulfill public duties, participate in providing law and law enforcement, and are given scope for the exercise of their interests. It takes place in advisory boards, chambers and cooperatives regulated by public law. Economic self-government emerged in the 19th century. Its importance increased primarily from the end of the 19th century, the time of the emergence of the interventionist state. This development seemed to be accompanied by a loss of freedom because self-government was legally constructed as a state-dependent form of organization. Above all, it was subject to state supervision. However, this review would be one-sided. The establishment of self-government, simultaneously, created the possibility of increased influence on public affairs. The semi-official character of self-government institutions strengthened the legitimacy of the economic representation of interests and the power of enforcement in relation to government authorities and other organized societal actors. Economic self-government was a way of coordinating divergent interests more effectively in a highly differentiated society and enlarging the space for the collective exercise of freedom. The resulting increased dependence on the state was a price which large parts of society were willing to pay.

  13. Hautreizungen durch Propylenglykol

    DEFF Research Database (Denmark)

    Andersen, Klaus Ejner; Storrs, F J

    1982-01-01

    Propylene glycol is used in foods, medicine and cosmetics because it is a good solvent which has, simultaneously, moisture-regulating, antiseptic, and preservative effects. Propylene glycol may produce eczematous skin reactions of toxic and, more rarely, of allergic nature. Positive patch test...... by dermatologists as propylene glycol is used in local steroids and other topical preparations....

  14. Properties of polymer-silver nanocomposites fabricated by co-sputtering; Eigenschaften von Polymer-Silber-Nanokompositen hergestellt durch Co-Sputtern

    Energy Technology Data Exchange (ETDEWEB)

    Schuermann, Ulrich

    2006-07-01

    In this thesis polymer-metal nanocomposites were fabricated by simultaneous sputtering of silver and polymers from two independent magnetron sputtering sources. By the netted structure and the dielectric properties PTFE is suited for the use as matrix material. The metal content of the composite films was determined via the measurement of EDX intensities. The size of the nanoparticles was determined by means of TEM and XRD and lies in the range of 10 nm. The composite materials show at the percolation limit a sudden transition of the properties from polymer- to metal-like behaviour. The specific resistance decreases in a range between 35 and 40 % silver content by at least nine orders of magnitude. The optical properties change with the metal content. The absorption caused by plasmon resonance, which has at small filling degrees its maximum at about 000 nm and has an intense yellow colour of the composite material as consequence shifts with increasing silver content to longer wavelengths. The difference in the optical.behaviour of the nanocomposites and the pure polymers can be used for the fabrication of Bragg reflectors. Small changes in the metal content can in the polymer-silver nanocomposites in the range of the percolation threshold effect a drastic change in ther properties, by which applications as sensors are thinkable. [German] In dieser Arbeit wurden Polymer-Metall-Nanokomposite durch gleichzeitiges Sputtern von Silber und Polymeren aus zwei unabhaengigen Magnetron-Sputterquellen hergestellt. Durch die vernetzte Struktur und die dielektrischen Eigenschaften eignet sich PTFE zur Verwendung als Matrixmaterial. Der Metallgehalt der Kompositfilme wurde ueber die Messung von EDX-Intensitaeten ermittelt. Die Groesse der Nanopartikel wurde mit Hilfe von TEM und XRD bestimmt und liegt im Bereich von 10 nm. Die Kompositmaterialien zeigen an der Perkolationsgrenze einen schlagartigen Uebergang der Eigenschaften vom polymer- zum metallaehnlichen Verhalten. Der

  15. BioCrack {sup registered}. Enhanced gas yield by electrokinetic disintegration; BioCrack {sup registered}. Steigerung der Gasausbeute durch elektrokinetische Desintegration

    Energy Technology Data Exchange (ETDEWEB)

    Liebich, Markus [Hugo Vogelsang Maschinenbau GmbH (Germany)

    2011-07-01

    In the electrokinetic disintegration process, the fluid flows through a pipeline system to which a HV field is applied. The electric forces of the HV field deform and destabilise the cell membrane. Once the deformation exceeds the elastic resistance of the cell membrane, the cell membrane will become permeable, and the cell content will be released and can be used for gas production. The advantages of theprocess are the low investment cost, simple retrofitting, high availability, and low energy cost (35 W per module). [German] Bei der elektrokinetischen Desintegration durchfliesst das Medium ein Rohrleitungssystem in dem ein Hochspannungsfeld anliegt. Durch die auftretenden elektrischen Kraefte im Hochspannungsfeld wird die Zellmembran verformt und destabilisiert. Uebersteigt die Verformung die elastische Widerstandkraft der Zellmembran, so wird diese durchlaessig. Dadurch werden die Zellinhaltsstoffe freigesetzt und koennen zur Gaserzeugung genutzt werden. Die Vorteile dieses Verfahrens liegen in den geringen Investitionskosten gegenueber anderen Desintegrationsverfahren, der einfachen Nachruestbarkeit, der hoher Anlagenverfuegbarkeit sowie in den geringen Energiekosten (35 W pro Modul).

  16. A practical example of how companies can cut down their costs by means of an environmental management system; Moeglichkeit der Kostensenkung in Betrieben durch Umweltmanagement am praktischen Beispiel

    Energy Technology Data Exchange (ETDEWEB)

    Grooterhorst, A. [SIG Consult GmbH, Essen (Germany)

    1997-01-01

    Regular acquisition of environmentally relevant data permits systematic monitoring of the environmental impact of industrial operations. This, together with a systematic documentation and the efficient organization of operations, creates the basis for an environmental management system. When designing an environmental protection concept or introducing an environmental management system, it may be convenient to make use of the services of consultancies. (orig./ABI) [Deutsch] Durch regelmaessige Erfassung umweltrelevanter Daten wird eine systematische Kontrolle betrieblicher Umweltauswirkungen moeglich. Zusammen mit einer systematischen Dokumentation und einer nachweislichen Regelung zur Aufbau- und Ablauforganisation ist damit die Grundlage fuer ein Umweltmanagementsystem geschaffen. Bei der Erarbeitung eines Umweltschutzkonzeptes und der Einfuehrung eines Umweltmanagementsystems kann es sinnvoll sein einen externen Berater einzuschalten. (orig./ABI)

  17. Revolution by way of technical transfer in the development of locomotive brake systems; Revolutionierung in der Entwicklung von Bremssystemen bei Lokomotiven durch Technologietransfer

    Energy Technology Data Exchange (ETDEWEB)

    Wright, E.C. [New York Air Brake (United States). Bereich Engineering; Sinn, R. [New York Air Brake (United States). Bereich Elektronik und Software

    1997-12-31

    With the use of components from other sectors and orientation on the technologies of other fields it has been possible to enhance the standard of electronic braking systems. The reliability of the CCBII is ten times greater than with conventional systems. The physical volume could be reduced by 40 percent and the weight by 30 percent. The CCBII has functional redundancy and the Locotrol Distributed Power System is already integrated. A diagnostics system allows repair times to be reduced to 20 minutes. Production is now commencing and it is planned to make the first deliveries starting from January 1998. (orig.) [Deutsch] Durch das Einbinden von Entwurfsverfahren aus der Luft- und Raumfahrtindustrie sowie der Verwendung von Komponenten aus dem Automobilsektor, hochentwickelter Werkstoffe und Techniken ist es moeglich, neue Wege bei Bremssystemen zu gehen. Der Beitrag beschreibt die Entwicklung einer neuen Generation von computergesteuerten Bremssystemen fuer Lokomotiven. (orig.)

  18. Efficient turbine control. Advantages through controlling internal turbine power in place of turbo generator output; Effektive Turbinenregelung. Vorteile durch die Regelung der inneren Turbinenleistung anstelle der Turbogeneratorleistung

    Energy Technology Data Exchange (ETDEWEB)

    Sindelar, R.

    1999-07-01

    Hitherto, the electrical output of turbo generators has generally been controlled by means of power output controllers. Load changes caused, for example, by changeovers to isolated unit operation where the load requirements are unknown at first, often resulted in `wrong way control` effects that sometimes even caused entire turbine generator sets to fail. Controlling the internal turbine power makes it possible to avoid such consequences. (orig.) [Deutsch] Die elektrische Leistung eines Turbogenerators wurde bislang durch Leistungsregler geregelt. Im Falle einer Lastaenderung, wie sie beispielsweise beim Uebergang in den Betrieb auf ein Teilnetz (Insel-) mit vorher unbekannter Last vorkommt, trat ein Falschregeleffekt auf. Auf diesen wurden bereits Turbosatzausfaelle zurueckgefuehrt. Wird anstelle der elektrischen Leistung allerdings die innere Turbinenleistung geregelt, so tritt der Falschregeleffekt nicht ein. (orig.)

  19. Reducing available amounts of heavy metals in contaminated soils by adding iron oxides. Final report; Verringerung der Bioverfuegbarkeit von Schwermetallen in kontaminierten Boeden durch Zugabe von Eisenoxiden. Abschlussbericht

    Energy Technology Data Exchange (ETDEWEB)

    Pluquet, E; Mueller, I

    1998-02-01

    This project was part of a German-French research co-operation and investigated the practicability to immobilize heavy metals by adding iron oxides to contaminated soils (harbour sediment, bracky marsh contaminated by emission of a zinc/lead smelter, alluvial Gley soil contaminated by mining activity). Pot and field trials were carried out using three different soils. Five iron bearing materials were added to the soil (1% pure Fe in soil dry matter): Red mud from Al-industry, Fe-precipitation sludge from drinking water treatment, bog iron ore, unused steel shot and steel shot waste from surface treatment of rolled steel plates. When mixed with the soil NH{sub 4}NO{sub 3} and DTPA extractable amounts of heavy metals and uptake by plants was markedly reduced. It was demonstrated that precipitated Fe-bearing sludge from drinking water treatment was a very effective material reducing the NH{sub 4}NO{sub 3} soluble amounts by 40-50% (DTPA 30-40%) in the pot tests while the uptake by plants was reduced by 40% and more. Heavy metals were strongly bound in a fixed order Cd>Pb>Zn>Cu and stayed immobilized until the end of project. Heavy metals were immobilized to a certain extent in field trials, but less effect was observed on concentration in plants and soil extracts compared with the pot tests. In practice the treatment should exceed the 1% pure Fe tested and the application should more homogeneously affect the soil layer where the plant roots mainly grow. (orig.) [Deutsch] Im Rahmen eines deutsch-franzoesischen Projektverbundes wurde die Moeglichkeit der Immobilisierung von Schwermetallen in kontaminierten Boeden durch gezielte Zufuhr von Eisenoxiden untersucht. Die praxisorientierten Untersuchungen wurden in Gefaess- und Feldversuchen mit drei unterschiedlichen Boeden (Spuelfeldboden aus Hafenschlick, immissionsbelastete Brackmarsch, durch Bergbau belasteter Auenboden) ausgefuehrt. Dazu wurden fuenf eisen(oxid)haltige Materialien (Rotschlamm aus der Al

  20. Optimizing biological waste water cleaning by means of modern control systems (fuzzy logic); Optimierung der biologischen Abwasserreinigung durch moderne Regelsysteme (Fuzzy-Logik)

    Energy Technology Data Exchange (ETDEWEB)

    Lohse, M.; Boening, T.; Hegemann, G. [Fachhochschule Muenster (Germany). Inst. fuer Abfall- und Abwasserwirtschaft e.V.

    1999-07-01

    Within the framework of a project sponsored by EUREGIO, test series with the biological activation stages of a German and a Dutch sewage treatment plant each are carried out using different process concepts for the control of oxygen supply by fuzzy logic. As the currently available results demonstrate, the developed fuzzy-logic fields of characteristic curves permit establishing a stable and, thus, little energy-consuming process with optimum oxygen supply in comparison with conventional control. (orig.) [German] Im Rahmen eines von der EUREGIO gefoerderten Forschungsprojektes werden Versuchsreihen im Bereich der biologischen Belebungsstufen einer deutschen und einer niederlaendischen Abwasserreinigungsanlage (ARA) mit unterschiedlichen Verfahrenskonzepten hinsichtlich der Regelung der Sauerstoffzufuhr mit Hilfe der Fuzzy-Logik Technik durchgefuehrt. Die bisherigen Versuchsergebnisse zeigen, dass - im Vergleich zur konventionellen Regelung - durch die entwickelten Fuzzy-Logik Kennfelder ein stabiler und damit energiearmer Prozess mit optimaler Sauerstoffzufuhr erzeugt wird. (orig.)

  1. Minimisation of loads on the azimuthal drive by control of the slip brake momentum; Minimierung der Azimutantriebsbelastungen durch Steuerung des Schleifbremsen-Momentes

    Energy Technology Data Exchange (ETDEWEB)

    Boehmeke, G. [PVO Engineering OY, Helsinki (Finland)

    2000-07-01

    The influence of the slip brake momentum on the load acting on the azimuthal drives is investigated and is minimised by a variable, optimised braking momentum. An option for automatic control is proposed. Measures to improve the availability of wind power systems in cold climates were developed in the context of a development study, including closer investigations of the azimuthal region. [German] Der Einfluss des Schleifbremsenmomentes auf die Belastung der Azimut-Verstellantriebe wird untersucht und durch variables stets optimales Bremsmoment minimiert. Eine Option zur automatisierten Steuerung wird vorgeschlagen. Im Rahmen einer Entwicklungsstudie wurden Massnahmen zur Erhoehung der Betriebssicherheit von Windkraftanlagen in kaltem Klima ausgearbeitet, und unter anderem auch der Azimutbereich naeher untersucht. (orig.)

  2. Material modifications in lithium niobate and lithium tantalate crystals by ion irradiation; Materialmodifikationen in Lithiumniobat- und Lithiumtantalat-Kristallen durch Ionenbestrahlung

    Energy Technology Data Exchange (ETDEWEB)

    Raeth, Niels Lennart

    2017-02-17

    ''. An explanation for the different behavior of the refractive index changes after irradiation of LiNbO{sub 3} and LiTaO{sub 3} is provided by the following model: The refractive index changes caused by effects such as volume increase, change in polar polarizabilities, and decrease of spontaneous polarization partially cancel each other out, so that the change of ordinary and extraordinary refractive index in LiNbO{sub 3} just coincidentally the same amount fails. In LiTaO{sub 3}, the compensating fraction is normally insufficient to cause a positive change in the extraordinary refractive index. [German] Die kuenstlich hergestellten Kristalle Lithiumniobat (LiNbO{sub 3}) und das eng verwandte Lithiumtantalat (LiTaO{sub 3}) sind bewaehrte Ausgangsmaterialien zur Herstellung aktiver und passiver Bauelemente, die Licht fuehren, verstaerken, schalten und verarbeiten koennen. Hierfuer ist es oft notwendig, den Brechungsindex des Substrats gezielt beeinflussen zu koennen, was neben anderer Methoden auch durch Bestrahlung der Materialien mit schnellen leichten Ionen moeglich ist. Im Rahmen dieser Arbeit werden Lithiumniobat- und Lithiumtantalat-Kristalle mit Alphateilchen, {sup 3}He-Ionen, Deuteronen und Protonen bei Projektilenergien von bis zu 14 MeV/Nukleon bestrahlt. Energie und Kristalldicke sind dabei so gewaehlt, dass die Projektile die gesamte Probe durchdringen und nicht implantiert werden. Alle fuer die unerwuenschte, durch die Bestrahlung entstehende, nukleare Aktivierung der Kristalle verantwortlichen Isotope sind relativ kurzlebig und insgesamt nimmt die Aktivierung schnell genug ab, um nach einer Lagerfrist von einigen Tagen bis wenigen Wochen den gefahrlosen Umgang mit den bestrahlten Proben zu ermoeglichen. Die in Lithiumniobat und Lithiumtantalat durch die Bestrahlung mit den verschiedenen Projektilen erzeugten Brechungsindexaenderungen werden interferometrisch bestimmt und koennen durch geeignete Wahl der Probengeometrie auch in Abhaengigkeit von der

  3. In Situ Dark Adaptation Enhances the Efficiency of DNA Extraction from Mature Pin Oak (Quercus palustris Leaves, Facilitating the Identification of Partial Sequences of the 18S rRNA and Isoprene Synthase (IspS Genes

    Directory of Open Access Journals (Sweden)

    Csengele E. Barta

    2017-10-01

    Full Text Available Mature oak (Quercus spp. leaves, although abundantly available during the plants’ developmental cycle, are rarely exploited as viable sources of genomic DNA. These leaves are rich in metabolites difficult to remove during standard DNA purification, interfering with downstream molecular genetics applications. The current work assessed whether in situ dark adaptation, to deplete sugar reserves and inhibit secondary metabolite synthesis could compensate for the difficulties encountered when isolating DNA from mature leaves rich in secondary metabolites. We optimized a rapid, commercial kit based method to extract genomic DNA from dark- and light-adapted leaves. We demonstrated that in situ dark adaptation increases the yield and quality of genomic DNA obtained from mature oak leaves, yielding templates of sufficiently high quality for direct downstream applications, such as PCR amplification and gene identification. The quality of templates isolated from dark-adapted pin oak leaves particularly improved the amplification of larger fragments in our experiments. From DNA extracts prepared with our optimized method, we identified for the first time partial segments of the genes encoding 18S rRNA and isoprene synthase (IspS from pin oak (Quercus palustris, whose full genome has not yet been sequenced.

  4. Integrated power-heat-cold-coupling by switchable Stirling-Vuilleumier-Hybrid-Machines; Integrierte Kraft-Waerme-Kaelte-Kopplung durch umschaltbare Stirling-Vuilleumier-Hybrid-Maschinen

    Energy Technology Data Exchange (ETDEWEB)

    Kuehl, Hans-Detlev [Technische Univ. Dortmund (Germany). Lehrstuhl fuer Thermodynamik

    2017-07-01

    experimental effort, a similarity-theoretical scaling was carried out while keeping all dimensionless parameters relevant to the internal gas circulation process constant. Although the experimental results presented in this article therefore require a correction due to some external, not correctly scalable friction and insulation losses, they nevertheless prove that the realization of such switchable systems for decentralized, demand-oriented energy supply of buildings in a practical size and performance class is possible. In coordinated operation of a larger number of such systems - e.g. via ripple control or network load-dependent power consumption tariffs and power feed-in tariffs - can respond by appropriate switching between the operating conditions on load fluctuations in the public grid and so valuable, short-term retrievable control energy can be provided. Furthermore, applications in the field of drive-independent air conditioning, heating and power supply of vehicles are conceivable. [German] Ein Stirlingmotor besteht in seiner sogenannten Gamma-Bauart zum einen aus einem thermischen Verdichter, in dem ein doppelseitig wirkender Verdraengerkolben das Arbeitsgas zwischen einem heissen'' und einem ''warmen'' (d. h. auf dem Waermenutzungstemperaturniveau der KWK-Anwendung befindlichen) Zylinderraum isochor ueber einen Regenerator periodisch hin- und herschiebt. Zum anderen besitzt er ein hiervon raeumlich getrenntes, einseitig wirkendes Arbeitskolben-Zylinder-System, das mit der ''warmen'' Seite des thermischen Verdichters durch einen Ueberstroemkanal verbunden ist und sich somit auf aehnlichem Temperaturniveau befindet. Fuegt man in diesen Ueberstroemkanal einen zusaetzlichen Regenerator ein, so kommt es zu einer Trennung der Temperaturniveaus, da die Waermeabgabe des Prozesses primaer ueber den warmen Zylinderraum des Verdraengersystems erfolgt, waehrend der Zylinderraum des Arbeitskolbens eine Waermesenke darstellt

  5. Transport of Phanerochaete chrysosporium and Mucor hiemalis f. irnsingii spores through water-saturated quartz sands; Transport von Phanerochaete chrysosporium- und Mucor hiemalis f. irnsingii-Sporen durch wassergesaettigten Quarzsand

    Energy Technology Data Exchange (ETDEWEB)

    Hoque, E.; Klotz, D.; Teichmann, G.; Lang, H.; Wolf, M. [GSF - Forschungszentrum fuer Umwelt und Gesundheit GmbH, Neuherberg (Germany). Inst. fuer Hydrologie; Beisker, W. [GSF, Inst. fuer Pathologie (Germany)

    2001-11-01

    Just as bacteria so can aquatic fungi contribute effectively to pollutant elimination, at least in superficial groundwaters. However, very little is known about this. Nor is it known whether fungal spores are capable of being transported through sedimentary cavities. At least fungal spores are for some part of similar size as bacteria. We here report for the first time on a demonstration of the migration through quartz sand of spores of the two fungal species Phanerochaete chrysosporium and Mucor hiemalis f. irnsingii. [German] Neben Bakterien koennen auch aquatische Pilze, zumindest im oberflaechennahen Grundwasser, effiziente Beitraege zur Schadstoffentgiftung leisten. Darueber ist aber sehr wenig bekannt. Es ist auch nicht bekannt, ob ueberhaupt Pilzsporen durch Sedimenthohlraeume transportiert werden koennen, obwohl die Pilzsporen z.T. aehnliche Abmessungen wie Bakterien haben. Hier berichten wir erstmalig ueber den Nachweis der Migration von Sporen der beiden Pilzarten Phanerochaete chrysosporium und Mucor hiemalis f. irnsingii durch Quarzsand. (orig.)

  6. Increase of the efficiency of heat pumps by partial defrosting of evaporator during the heating operation; Effizienzsteigerung von Waermepumpen durch partielle Verdampferabtauung waehrend des Heizbetriebs

    Energy Technology Data Exchange (ETDEWEB)

    Mader, Gunda; Thybo, Claus [Danfoss A/S, Nordborg (Denmark)

    2011-07-01

    eine regelmaessige Abtauung des Verdampfers vorgenommen werden. Eine weitverbreitete Methode dazu ist die Umkehrung des Kaeltemittelstroms, bei der heisses Gas aus dem Verdichter in den Verdampfer eingeleitet wird. Neben deutlichen Effizienzverlusten entstehen dabei Probleme der Materialbelastung und bei manchen Anlagentypen Komforteinbussen. Die Methode der partiellen Abtauung zielt darauf ab, die Haeufigkeit der Kreislaufumkehr zu reduzieren oder ganz zu vermeiden. Das Prinzip beruht darauf, einzelne Straenge des Verdampfers abwechselnd zu deaktivieren um dort eine energiesparende Abtauung durch die ueberstroemende Luft zu ermoeglichen. In den uebrigen Bereichen des Verdampfers wird weiterhin Waerme von der Aussenluft auf das Kaeltemittel uebertragen, so dass der Betrieb der Anlage kontinuierlich aufrecht erhalten werden kann. Ermoeglicht wird dies durch ein spezielles Ventil, welches Expansion und Verteilung kombiniert und damit erlaubt, die Kaeltemittelmassenstroeme in den einzelnen Verdampferstraengen gezielt einzustellen. Anhand eines mathematischen Modells werden Details der Methode vorgestellt und diskutiert. Durch experimentelle Untersuchungen an Luft-Luft-Waermepumpen wird gezeigt, dass unter Standard-Betriebsbedingungen mit Lufttemperaturen ueber dem Gefrierpunkt waehrend der Deaktivierungsphase der gesamte Reif abgetaut werden kann und somit keine Kreislaufumkehr erforderlich ist.

  7. Energy saving by enhanced temperature measurement of stock materials of heat- and heat treatment process. Final report; Energieeinsparung durch verbesserte Nutzguttemperaturbestimmung bei Waerm- und Waermebehandlungsprozessen. Schlussbericht

    Energy Technology Data Exchange (ETDEWEB)

    Ley, I.; Klima, R.

    1999-06-01

    Thermoelementes, welches moeglichst gut im Strahlungsaustausch mit dem Nutzgut steht, gemessen. Somit kann die Oberflaechentemperatur weitgehend unabhaengig vom Emissionsgrad des Nutzgutes gemessen werden. Die Vorteile der Thermoelementsonde konnten durch eine Installation an einem Waermeofen und einer Waermebehandlungsanlage deutlich aufgezeigt werden. Durch die dauerhafte betriebliche Installation konnten umfangreiche Verbesserungsmassnahmen zur Energieeinsparung und zur Qualitaetsverbesserung an den Oefen realisiert werden. Die Thermoelementsonde ermoeglicht eine strenge Optimierung mittels modellgestuetzter Steuerung und damit deutliche Produktverbesserungen und Energieeinsparungen. (orig.)

  8. A 400-year phytolith-based reconstruction of wild rice (Zizania palustris) abundance from Mud Lake core sediments, Fond du Lac Band of Lake Superior Chippewa Reservation, Minnesota, USA.

    Science.gov (United States)

    Munoz, R.; Caylor, E.; Yost, C. L.; Drake, C.; Ladwig, J. L.; Myrbo, A.; Howes, T.

    2014-12-01

    Wild rice (Zizania palustris L.) is an aquatic grass with spiritual and subsistence significance to Native people of the Great Lakes region of North America. Mud Lake (Mashkiigwaagamaag), located on the Fond du Lac Band of Lake Superior Chippewa Reservation in Carlton County, Minnesota, USA, once supported an extensive population of wild rice (manoomin). However, early 20th century attempts to ditch and drain surrounding wetlands for landuse intensification severely altered the natural hydrological system that supports wild rice. Fond du Lac Resource Management (FDLRM) technicians are currently working to increase the wild rice population in Mud Lake. As part of these efforts, this phytolith study was undertaken to better understand how wild rice abundance has fluctuated over the past 400 years, with particular emphasis on the 19th and 20th centuries. Phytoliths are microscopic opal silica plant remains that are incorporated into soils and lake sediments after the plant-parts that contain them decay. Wild rice produces phytolith morphotypes that are unequivocally diagnostic. Mud Lake core MNMN-MUD11-1C-1P-1 (46°43'38.39"N, 92°42'2.45"W) was piston cored by LacCore (National Lacustrine Core Facility) and FDLRM technicians on 24 May 2011. Initial core descriptions, multi-sensor core logging, phytolith sampling and phytolith extractions were completed during the summer of 2014 at LacCore. Wild rice phytolith identification and quantification was conducted on twelve samples using brightfield microscopy at 400x magnification. Wild rice phytolith concentration values ranged from 68 to 2,300 phytoliths/cm3. Wild rice accumulation rates ranged from 9 to 383 phytoliths/ cm2/yr, peaking in 1952 AD. Wild rice abundance in Mud Lake appears to be influenced by a complex set of variables that include anthropogenic disturbance, climatic events and aquatic plant community succession.

  9. Development of a Novel Escherichia coli–Kocuria Shuttle Vector Using the Cryptic pKPAL3 Plasmid from K. palustris IPUFS-1 and Its Utilization in Producing Enantiopure (S-Styrene Oxide

    Directory of Open Access Journals (Sweden)

    Hiroshi Toda

    2017-11-01

    Full Text Available The novel cryptic pKPAL3 plasmid was isolated from the Gram-positive microorganism Kocuria palustris IPUFS-1 and characterized in detail. pKPAL3 is a circular plasmid that is 4,443 bp in length. Open reading frame (ORF and homology search analyses indicated that pKPAL3 possesses four ORFs; however, there were no replication protein coding genes predicted in the plasmid. Instead, there were two nucleotide sequence regions that showed significant identities with untranslated regions of K. rhizophila DC2201 (NBRC 103217 genomic sequences, and these sequences were essential for autonomous replication of pKPAL3 in Kocuria cells. Based on these findings, we constructed the novel Escherichia coli–Kocuria shuttle vectors pKITE301 (kanamycin resistant and pKITE303 (thiostrepton resistant from pKPAL3. The copy numbers of the constructed shuttle vectors were estimated to be 20 per cell, and they exhibited low segregation stability in Kocuria transformant cells in the absence of antibiotics. Moreover, constructed vectors showed compatibility with the other K. rhizophila shuttle vector pKITE103. We successfully expressed multiple heterologous genes, including the styrene monooxygenase gene from Rhodococcus sp. ST-10 (rhsmo and alcohol dehydrogenase gene from Leifsonia sp. S749 (lsadh, in K. rhizophila DC2201 using the pKITE301P and pKITE103P vectors under the control of the glyceraldehyde 3-phosphate dehydrogenase (gapdh promotor. The RhSMO–LSADH co-expressing K. rhizophila was used as a biocatalyst in an organic solvent–water biphasic reaction system to efficiently convert styrene into (S-styrene oxide with 99% ee in the presence of 2-propanol as a hydrogen donor. The product concentration of the reaction in the organic solvent reached 235 mM after 30 h under optimum conditions. Thus, we demonstrated that this novel shuttle vector is useful for developing biocatalysts based on organic solvent-tolerant Kocuria cells.

  10. Purification of industrial effluents with a high load of organic pollutants by a combined anaerobic/aerobic process; Reinigung organisch hochbelasteter Industriebwaesser durch eine anaerob/aerobe Verfahrenskombination

    Energy Technology Data Exchange (ETDEWEB)

    Reidl, H.H. [AEW ESMIL GmbH fuer Wasser- und Abwassersyteme, Ratingen (Germany)

    1994-12-31

    Organically polluted sewage water can be economically cleaned in an aerobic biological sewage treatment plant with upstream anaerobic as this saves activation volume and ventilation energy. This was demonstrated in the sewage treatment plant of the PWA in Redenfelden, where an anaerobic stage was installed which uses the BIOTHANE{sup R} process. The CARROUSEL-system of the anaerobic stage has proved a istself both in the PWA ans in municipal plants between 5000 to 100000 EW. It is a robust system with uncomplicated control which guarantees observance of maximum values and allows elimation of P and N. (orig.) [Deutsch] Organisch hochbelastete Abwaesser werden oekonomisch durch eine aerobe biologische Klaeranlage mit vorgeschalteter Anaerobie gereinigt, weil dadurch Belebungsvolumen und Belueftungsenergie eingespart werden. Dies wurde am Beispiel der Abwasserreinigungsanlage der PWA Redenfelden gezeigt, bie der eine Anaerobstufe nach den BIOTHANE{sup R}-Verfahren installiert ist. Das dort eingesetzte CARROUSEL-System fuer die Aerobstufe hat sich sowohl bei der PWA als auch im kommunalen Bereich bei Anlagen zwischen 5000 und 100000 EW, als robustes System mit unkomplizierter Steuerung bewaehrt, das eine sichere Einhaltung der Grenzwerte garantiert und die Moeglichkeit zur P- und N-Elimination bietet. (orig.)

  11. Efficient sorting of waste by means of dry stabilisation and separation of inert materials; Effiziente Sortierung von Restabfall durch Trockenstabilisierung und Inertstoffabscheidung

    Energy Technology Data Exchange (ETDEWEB)

    Heering, B.M. [Herhof-Umwelt GmbH, Solms-Niederbiel (Germany); Heil, J. [Lehr- und Forschungsgebiet Kokereiwesen, Brikettierung und Thermische Abfallbehandlung, Aachen (Germany)

    1999-07-01

    Sorting of waste takes place in two stages: First, the waste is dried to a moisture of 15 % by weight, making use of its microbial activities. After this, the stabilised residue is sorted according to grain size, density, magnetic susceiptibility, electric conductivity, and comminution characteristics. This way, recyclable materials are recovered almost completely (e.g. metals, stone, ceramics, glass). The refuse-derived fuel fraction has significantly lower heavy metal concentrations because the metals were sorted out, and its calorific value and homogemeity are optimised as well. The fuel fraction can be combusted at once or stored for further use. [German] Die stoffliche Trennung des Restabfalls kann in zwei aufeinander folgende Schritte unterteilt werden. Den ersten Schritt stellt eine Trocknung unter Ausnutzung der mikrobiellen Aktivitaeten des Materials dar. Durch diese Massnahme wird ein trockenes Material mit einer Restfeuchte von unter 15 Gew.-% erzeugt. Den zweiten Verfahrensschritt stellt die Sortierung des stabilisierten Restabfall dar. Als Sortierkriterium werden die Eigenschaften Korngroesse, Dichte, magnetische Suszeptibilitaet, elektrische Leitfaehigkeit und Zerkleinerungsverhalten angewandt. Hierdruch ist eine nahezu vollstaendige und sortenreine Rueckgewinnung der im Abfall enthaltenen Wertstoffe wie Eisen-/Nichteisenmetalle, Steine/Keramik und Glas sichergestellt. Weiterhin erhaelt man als Brennstofffraktion das Trockenstabilat {sup circledR}. Aufgrund der Abtrennung der hauptsaechlichen Schwermetalltraeger, Eisen- und Nichteisenmetalle, besitzt dieser Sekundaerbrennstoff gegenueber dem unbehandeltem Restabfall deutlich verminderte Schwermetallkonzentrationen. Zudem sind seine verbrennungstechnisch relevanten Eigenschaften Heizwert und Homogenitaet deutlich optimiert. Das Trockenstabilat {sup circledR} wird sofort oder zeitversetzt der energetischen Verwertung zugefuehrt. (orig.)

  12. THERMOSELECT. Continuous environment-friendly treatment of residues by gasification and direct melting; THERMOSELECT. Unterbrechungslose umweltgerechte Restabfallbehandlung durch Vergasung und Direkteinschmelzung

    Energy Technology Data Exchange (ETDEWEB)

    Gaeng, P.; Klein, K.; Stahlberg, R.; Weisenburger, P. [Thermoselect Suedwest GmbH, Karlsruhe (Germany)

    1996-12-31

    The Thermoselect process comprises waste compaction, degassing, gasification with pure oxygen, and melting of inorganic components in a continuous closed cycle process. The high-quality products can be recycled almost completely: The synthesis gas can be used as feedstock or combusted, also in high-efficiency power generation processes. The other products, e.g. the high-grade mineral and metal granulates, can be utilized without restrictions. The residual fraction which must be dumped is very small. (orig) [Deutsch] Mit Thermoselect ist eine neue Technik auf dem Markt, die durch die konsequente Umsetzung der Verfahrensschritte Abfallverdichtung, Entgasung, Vergasung mit reinem Sauerstoff und Einschmelzung der anorganischen Muellbestandteile in einem unterbrechungslosen geschlossenen Prozess hochwertige Produkte aus Abfaellen erzeugt, die nahezu vollstaendig verwertet werden koennen. Das erzeugte Synthesegas kann sowohl stofflich als auch thermisch genutzt werden, wobei der Einsatz von stromerzeugungsverfahren mit hohen Wirkungsgraden moeglich ist. Die ubrigen Produkte, z.B. das mineralische und das metallische Granulat, erreichen eine Qualitaet, die eine uneingeschraenkte Nutzung zulaesst. Die Anteile der z.Zt. noch zu entsorgenden Reststoffe ist gering, wobei derzeit meist wirtschafatliche Gruende deren Entsorgung nahelegen. (orig)

  13. Use of dexpanthenol and aloe vera to influence the irradiation response of the oral mucous membrane (mouse); Beeinflussung der Strahlenreaktion der Mundschleimhaut (Maus) durch Dexpanthenol {+-} Aloe vera

    Energy Technology Data Exchange (ETDEWEB)

    Schlichting, S. [Klinik und Poliklinik fuer Strahlentherapie und Radioonkologie, Dresden Univ. (Germany); Spekl, K.; Doerr, W. [Klinik und Poliklinik fuer Strahlentherapie und Radioonkologie, Dresden Univ. (Germany)]|[Experimentelles Zentrum, Medizinische Fakultaet Carl Gustav Carus, Dresden Univ. (Germany)

    2004-07-01

    In summarising the outcome of the present study it can be said spraying the agent on the oral mucous membrane once a day had an effect on the incidence of mucous membrane ulceration in the case of both placebo and dexpanthenol treatment. However, there was no significant difference between placebo and dexpanthenol treatment, the only finding being a slight prolongation of latency time through aloe vera. These experimental findings give good reason to critically reconsider the clinical use of dexpanthenol as a supportive treatment for the prevention of radiogenic mucositis enoralis following irradiation of tumours in the head and neck region. However thorough oral lavage is an effective means of moderating the irradiation response of the oral mucous membrane. [German] Zusammenfassend ist festzustellen, dass in den vorliegenden Versuchen mit einmal taeglichem Aufspruehen des Praeparates auf die Mundschleimhaut sowohl die Placebo - wie auch die Dexpanthenol-Behandlung die Inzidenz von Schleimhautulzerationen modifiziert hat; zwischen Placebo- und Dexpanthenol-Behandlung ergab sich jedoch kein signifikanter Unterschied. Lediglich eine geringe Verlaengerung der Latenzzeit durch Aloe vera war zu beobachten. Auf der Basis dieser experimentellen Ergebnisse muss der klinische Einsatz von Dexpanthenol im Rahmen der Supportivtherapie zur Prophylaxe der radiogenen Mucositis enoralis bei der Bestrahlung von Kopf-Hals-Tumoren kritisch ueberdacht werden. Regelmaessige, intensive Mundspuelungen sind jedoch ein probates Mittel zur Verminderung der Strahlenreaktion der Mundschleimhaut. (orig.)

  14. THERMOSELECT. Continuous environment-friendly treatment of residues by gasification and direct melting; THERMOSELECT. Unterbrechungslose umweltgerechte Restabfallbehandlung durch Vergasung und Direkteinschmelzung

    Energy Technology Data Exchange (ETDEWEB)

    Gaeng, P; Klein, K; Stahlberg, R; Weisenburger, P [Thermoselect Suedwest GmbH, Karlsruhe (Germany)

    1997-12-31

    The Thermoselect process comprises waste compaction, degassing, gasification with pure oxygen, and melting of inorganic components in a continuous closed cycle process. The high-quality products can be recycled almost completely: The synthesis gas can be used as feedstock or combusted, also in high-efficiency power generation processes. The other products, e.g. the high-grade mineral and metal granulates, can be utilized without restrictions. The residual fraction which must be dumped is very small. (orig) [Deutsch] Mit Thermoselect ist eine neue Technik auf dem Markt, die durch die konsequente Umsetzung der Verfahrensschritte Abfallverdichtung, Entgasung, Vergasung mit reinem Sauerstoff und Einschmelzung der anorganischen Muellbestandteile in einem unterbrechungslosen geschlossenen Prozess hochwertige Produkte aus Abfaellen erzeugt, die nahezu vollstaendig verwertet werden koennen. Das erzeugte Synthesegas kann sowohl stofflich als auch thermisch genutzt werden, wobei der Einsatz von stromerzeugungsverfahren mit hohen Wirkungsgraden moeglich ist. Die ubrigen Produkte, z.B. das mineralische und das metallische Granulat, erreichen eine Qualitaet, die eine uneingeschraenkte Nutzung zulaesst. Die Anteile der z.Zt. noch zu entsorgenden Reststoffe ist gering, wobei derzeit meist wirtschafatliche Gruende deren Entsorgung nahelegen. (orig)

  15. Bubble-free ozone addition through ceramic membranes for wet-oxidative waste water treatment; Blasenfreier Ozoneintrag durch keramische Membranen zur nassoxidativen Abwasserbehandlung

    Energy Technology Data Exchange (ETDEWEB)

    Janknecht, P.; Wilderer, P.A. [Technische Univ. Muenchen, Garching (Germany). Lehrstuhl und Pruefamt fuer Wasserguete- und Abfallwirtschaft

    1999-07-01

    A prerequisite for successful wet oxidation is very accurately tuned and carefully monitored process control. In the alternative, a decline in water quality is actually possible. In particular, earlier studies in the ozonification of landfill leachate encountered problems in reducing levels of AOX in the presence of halogenated hydrocarbons. Serious problems in process control may arise when ozone is conventionally added and forms bubbles in the presence of surface-active substances; this foam accumulates and is so persistent as to evade mechanical control. Since the formation of foam is directly due to gas bubbles carried in, bubble-free addition of ozone through a membrane may be a viable approach. (orig.) [German] Voraussetzung fuer den Erfolg einer Nassoxidation ist eine sehr genau eingestellte und sorgfaeltig ueberwachte Prozessfuehrung, da anderenfalls auch eine Verschlechterung der Wasserqualitaet eintreten kann; insbesondere haben sich hier bei frueheren Untersuchungen zur Ozonung von Deponiesickerwaessern Schwierigkeiten bei der Reduzierung des AOX-Wertes in Anwesenheit von halogenierten Kohlenwasserstoffen ergeben. Gravierende Schwierigkeiten in der Prozessfuehrung kann Schaum bereiten, der sich bei konventionellem Blaseneintrag des Ozons in Anwesenheit von oberflaechenaktiven Substanzen bildet, sich in der Anlage ansammelt und dabei so bestaendig ist, dass er auf mechanische Weise nicht zu kontrollieren ist. Da die Schaumbildung direkt auf die eingetragenen Gasblasen zurueckzufuehren ist, stellt der blasenfreie Eintrag von Ozon durch eine Membran einen moeglichen Loesungsansatz dar. (orig.)

  16. Control-technical optimization of topped denitrification through fuzzy control; Regelungstechnische Optimierung der vorgeschalteten Denitrifikation durch Anwendung von Fuzzy-Control

    Energy Technology Data Exchange (ETDEWEB)

    Meyer, U. [Hydroplan Ingenieurgesellschaft, Worms (Germany); Poepel, H.J. [Technische Univ. Darmstadt (Germany). Inst. WAR - Wasserversorgung, Abwassertechnik, Abfalltechnik, Umwelt- und Raumplanung

    1999-07-01

    The present paper describes complex fuzzy systems for controlling nitrogen elimination at plants with topped denitrification. For the design and testing of the fuzzy systems, dynamic simulation calculations and experimental tests were carried out in a semi-technical pilot plant. The controlling fuzzy systems indicate the supposed oxygen values for individual tank areas and the most appropriate partitioning of the activated sludge tank (anoxic/aerobic zone) as a function of the input quantities used. It is established that, with the more flexible control behaviour, a more stable nitrogen elimination and, at the same time, a cut in the amount of air transferred to the system can be attained in comparison with a conventional control. (orig.) [German] Im Rahmen dieses Beitrags werden komplexe Fuzzy-Systeme zur Regelung der Stickstoffelimination in Anlagen mit vorgeschalteter Denitrifikation vorgestellt. Zum Entwurf und zur Erprobung der Fuzzy-Systeme wurden dynamische Simulationsrechnungen und experimentelle Untersuchungen an einer halbtechnischen Versuchsanlage durchgefuehrt. Die uebergeordneten Fuzzy-Systeme geben in Abhaengigkeit der verwendeten Eingangsgroessen Sauerstoffsollwerte fuer die einzelnen Beckenbereiche und die jeweils guenstigste Aufteilung des Belebungsbeckens (anoxische/aerobe Zone) vor. Die Ergebnisse zeigen, dass durch das flexible Reglerverhalten eine stabilere Stickstoffelimination und gleichzeitig eine Einsparung an eingetragener Luftmenge im Vergleich zu einem konventionellen Regelsystem erreicht werden kann. (orig.)

  17. Self-management by firm, non-elastic adjustable compression wrap device [Translation of Druckmessungen unter Klettverschluss-Kompression - Selbstbehandlung durch feste, unelastische Beinwickelung

    Directory of Open Access Journals (Sweden)

    Giovanni Mosti

    2017-09-01

    Full Text Available Severe forms of chronic venous insufficiency and lymphedema require strong compression-pressure, which exceeds the pressure exerted by medical compression stockings (>40 mmHg. The aim was to investigate if patients are able to apply a Velcro-band compression device (Circaid Juxta Lite™ themselves with sufficient pressure. Thirty-one patients (CEAP C6=23, C5=5, C3=2, mixed ulcer=1 applied Juxta Lite™ on their own legs after a short instruction and were asked to readjust the pressure by their subjective feeling. Sub- bandage pressure was measured after application and 24 h later. In 30 patients without arterial occlusive disease the median sub- bandage pressure values on day 1 and day 2 were 44,5 mmHg (IQR 42-48, and 46 mmHg (IQR 44-48,25 respectively. One patient with an arterialvenous leg ulcer showed pressures of 34 and 36 mmHg. All measured pressure values corresponded to the pursued target range, demonstrating that adequate self application of Velcro bands is feasible and that patents can maintain this pressure by re-adjustment. Source: this paper is an abridged translation of Mosti G, Partsch H. Druckmessungen unter Klettverschluss-Kompression - Selbstbehandlung durch feste, unelastische Beinwickelung. Vasomed 2017;5:212-6.

  18. Substitution of wastes for fuels and raw materials in high-temperature processes; Substitution von Brennstoffen und Rohstoffen durch Abfaelle in Hochtemperaturprozessen

    Energy Technology Data Exchange (ETDEWEB)

    Scholz, R. [Technische Univ. Clausthal, Clausthal-Zellerfeld (Germany). Inst. fuer Energieverfahrenstechnik; Beckmann, M. [Clausthaler Umwelttechnik-Institut GmbH (CUTEC), Clausthal-Zellerfeld (Germany)

    1998-09-01

    burning processes in the cement industry. To do justice to the steel and iron industry it also deals with fuel substitution in a natural gas fired cokeless cupola furnace. [Deutsch] Die energetische und die stoffliche Verwertung von Abfaellen ist ein bereits seit langem diskutiertes Thema. Dabei interessieren zunaechst die Fragestellungen im Zusammenhang mit dem jeweils spezifischen Einsatz wie z.B. bei der Co-Verbrennung von Klaerschlamm in Kraftwerksfeuerungen, der Substitution von Primaerbrennstoffen durch Kunststoffabfaelle beim Brennprozess in der Zementindustrie usw. Darueber hinaus wird weiter der Vergleich der jeweiligen Anwendung untereinander sowie die Gegenueberstellung mit den zum Stand der Technik gehoerenden thermischen Abfallbehandlungsverfahren diskutiert. Diese Verfahrensvergleiche muessen selbstverstaendlich unter Einbeziehung aller insgesamt erforderlichen Aufwendungen an Zusatzstoffen und Zusatzenergie mit gleichen Randbedingungen durchgefuehrt werden. Dabei sind u.a. die sich aus den spezifischen Eigenschaften der Abfallstoffe fuer den jeweiligen Anwendungsfall ergebenden Besonderheiten zu beruecksichtigen. Das betrifft insbesondere die Auswirkungen einer Substitution von Primaerbrennstoffen durch Ersatzbrennstoffe aus Abfaellen (Sekundaerbrennstoffe) z.B. bei einem Brennprozess auf die Waermeuebertragungsbedingungen, die Stroemungsverhaeltnisse und damit zusammenhaengend auf die Temperaturverteilungen, den Guttransport und den spezifischen Energieaufwand. Ersatzbrennstoffe muessen sich sowohl aus stofflicher Sicht als auch aus brennstoff- und waermetechnischer Sicht fuer eine Substitution eignen. In dem vorliegenden Beitrag wird insbesondere auf die Anforderungen an Abfaellen, die zur Substitution von Primaerbrennstoffen dienen aus brennstoff- und waermetechnischer Sicht eingegangen. Hierzu werden zunaechst kurz einige wesentliche Gesichtspunkte der Waermeuebertragung in Feuerungen und Industrieoefen eroertert. Wichtig fuer die Bewertung einer

  19. Degradation of organic pollutants in sewage sludge by aerobic-thermophilic sludge treatment. Final report; Abbau organischer Schadstoffe im Klaerschlamm durch aerob-thermophile Schlammbehandlung. Abschlussbericht

    Energy Technology Data Exchange (ETDEWEB)

    Prechtl, S.

    1999-07-01

    Klaerschlamm. Im organischen Anteil des Klaerschlammfeststoffes sind bis heute ueber 300 verschiedene organische Spurenstoffe nachgewiesen worden. Neben den in der Klaerschlammverordnung erfassten Stoffgruppen (Dioxine/Furane und PCB) sind weitere Stoffgruppen als relevant eingestuft worden. Um die in diesem Bereich z.T. noch unzureichende Datenlage zu erweitern wurde im Forschungsvorhaben die Moeglichkeit untersucht, durch eine aerob-thermophile Schlammbehandlung (ATS) eine Verbesserung der Klaerschlammqualitaet, bei der Stoffgruppe der Phthalate (Di-(2-ethylhexyl)phthalat), den polyzklischen aromatischen Kohlenwasserstoffen (PAK) und beim 4-Nonylphenol (Abbauprodukt von nichtionischen Tensiden), zu erreichen. Zur Beurteilung der Abbaueffektivitaet aus der komplexen Matrix Klaerschlamm bildete die Schadstoffanalytik mittels HPLC und GC/MS einen Schwerpunkt des Vorhabens. Der Gehalt an Di-(2-ethylhexyl)phthalat (DEHP) und 4-Nonylphenol (4-NP) konnte in Laborversuchen mit dotierten Schlaemmen um 70% bzw. 50% und in undotierten Schlaemmen um 61% bzw. 53% reduziert werden. Bei halbtechnischen Versuchen lag die Reduktion fuer DEHP bei 14% und fuer 4-NP bei 68%. Fuer Pyren liess sich in Laborversuchen ein Abbau bis zu 57% erreichen, im Vergleich zu halbtechnischen Untersuchungen mit 22% Abbau. Die Ergebnisse erster grundlegender Untersuchungen zu einer Verfahrenskombination aus verkuerzter Faulstufe und ATS-Folgestufe zeigten fuer DEHP eine Reduktion von ca. 60%. Der Gehalt an einzelnen PAK konnten bis Anthracen reduziert werden. Fuer hoeherkondensierte PAK (Grundbelastung im ppb-Bereich) ergab sich keine einheitliche Aussage. Ein Abbau von 4-NP wurde bei den Versuchen zur Verfahrenskombination durch die Neubildung von 4-NP aus Alkylphenolethoxylaten unter anaeroben und aeroben Bedingungen ueberdeckt. Die erhaltenen Untersuchungsergebnisse bestaetigen die Korrelation zwischen einer Hygienisierung des Klaerschlamms und der entsprechenden Verweilzeit im Reaktorsystem. Sowohl in der

  20. Epiphyseal injuries of the distal tibia. Does MRI provide useful additional information?; Epiphysenfugenverletzungen der distalen Tibia. Sinnvolle Mehrinformation durch die MRT?

    Energy Technology Data Exchange (ETDEWEB)

    Iwinska-Zelder, J.; Schmidt, S.; Ishaque, N.; Klose, K.J.; Hoppe, M. [Marburg Univ. (Germany). Abt. fuer Strahlendiagnostik; Schmitt, J.; Gotzen, L. [Marburg Univ. (Germany). Medizinisches Zentrum fuer Operative Medizin

    1999-01-01

    Plain film radiography often underestimates the extent of injury in children with epiphyseal fracture. Especially Salter-Harris V fractures (crush fracture of the epiphyseal plate) are often primarily not detected. MRI of the ankle was performed in 10 children aged 9-17 (mean 14) years with suspected epiphyseal injury using 1.0-T Magnetom Expert. The fractures were classified according to the Salter-Harris-Rang-Odgen classification and compared with the results of plain radiography. In one case MRI could exclude epiphyseal injury; in four cases the MRI findings changed the therapeutic management. The visualisation of the fracture in three orthogonal planes and the possibility of detection of cartilage and ligamentous injury in MR imaging makes this method superior to conventional radiography and CT. With respect to radiation exposure MRI instead of CT should be used for the diagnosis of epiphyseal injuries in children. (orig.) [Deutsch] Die konventionelle Roentgendiagnostik unterschaetzt haeufig das Ausmass der kindlichen Extremitaetenfrakturen mit Epiphysenbeteiligung (Typ Salter-Harris). Insbesondere werden die Kompressionsfrakturen der Wachstumsfuge (Salter-Harris V) primaer haeufig nicht erkannt. Prospektiv wurden 10 Kinder im Alter von 9-17 Jahren (Durchschnittsalter = 14 J.) mit Verdacht auf eine epiphysaere Fraktur der distalen Tibia magnetresonanztomographisch (1.0-Tesla Magnetom Expert), untersucht. Die MRT-Ergebnisse wurden auf der Basis der Klassifikation nach Salter-Harris-Rang-Odgen mit den konventionellen Roentgenbildern verglichen. In einem Fall, bei einem 15jaehrigen Patienten, gelang durch die MRT der Ausschluss einer epiphysaeren Verletzung. In 7 Faellen fuehrte der MRT-Einsatz zu einer Aenderung der Klassifikation nach Salter-Harris. Hieraus resultierte bei 4 Patienten ein Therapiewechsel. Da Frakturen, die sie begleitenden Knorpellaesionen und ligamentaere Verletzungen multiplanar dargestellt werden koennen, weist die MRT deutliche Vorteile

  1. Study on the planning of a demonstration plant for hydrogen fuel production by electrolysis using caching in salt caverns under pressure; Studie ueber die Planung einer Demonstrationsanlage zur Wasserstoff-Kraftstoffgewinnung durch Elektrolyse mit Zwischenspeicherung in Salzkavernen unter Druck

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    2015-02-05

    In a two year research project the long-term storage of hydrogen as energy carrier has been assessed in detail for large renewable electricity quantities in underground storage caverns in Germany. Next to a regions analysis for potential storage sites, the benchmarking against other large scale storage concepts, a comparative and perspective analysis of alkaline and PEM-electrolysers also potential business cases for Power-to-Hydrogen in the mobility sector as well as for the chemical, electricity and natural gas industry have been analysed. [German] Durch den geplanten Ausbau der Stromerzeugung aus fluktuierenden, erneuerbaren Energien in Deutschland ruecken Speichertechnologien fuer elektrische Energie immer staerker in den Fokus des industriellen und politischen Interesses. Eine vielversprechende Moeglichkeit fuer eine Langzeitspeicherung bei hohen Anteilen von Wind- und Photovoltaikanlagen sind Speichertechnologien wie die Wasserstoffspeicherung mit Hilfe von Wasserelektrolyseuren. Diese koennen erneuerbaren Strom in grossen Mengen und bei entsprechender Steuerung selektiv in Zeiten mit hohem Dargebot z.B. an Windstrom chemisch speichern. Der gespeicherte Wasserstoff kann dann entweder zu einem spaeteren Zeitpunkt wieder rueckverstromt oder direkt stofflich verwertet werden, z.B. als Kraftstoff fuer den Verkehrssektor, als chemischer Rohstoff oder fuer den Hausenergiebereich durch Einspeisung in das Erdgastransportnetz. Thema der vorliegenden Studie sind Analysen und Planungen fuer die Erprobung des Gesamtsystems ''Wasserstoff-Elektrolyse-Speicherung'' in energiewirtschaftlich relevanten Dimensionen. Dazu werden mit einem neuen Ansatz techno-oekonomische Entwicklungspfade fuer Wasserstoff-Systeme unterschiedlicher Groesse und Technologien charakterisiert und technologische Risiken bei der Realisierung dieser Systeme identifiziert und bewertet. Diese Arbeiten werden ergaenzt durch Arbeiten auf dem Gebiet der Salzkavernenspeicherung in Form

  2. Optimizing customer contact management to bolster loyalty and profitability. Optimizing specifically quality of service and cost; Loyalitaet und Profitabilitaet von Privat- und Gewerbekunden durch optimiertes Kundenkontaktmanagement steigern. Servicequalitaet und Kosten zielgerichtet optimieren

    Energy Technology Data Exchange (ETDEWEB)

    Hillebrand, S.; Fratzke-Weiss, B.; Handschuh, M.; Muench, U.; Kreuz, W. [A.T. Kearney Management Consultants, Frankfurt/Main (Germany)

    2003-09-08

    Building on the sales strategy, the customer care center's processes, systems, and organization can be optimized in a focused way. Based on the set of success factors described by the authors private and commercial customers' value can be increased significantly. (orig.) [German] Eine klar definierte Vertriebsstrategie ist von elementarer Bedeutung, um das Kundenkontaktmanagement so auszurichten, dass es maximalen Wert fuer das Unternehmen generiert. Ausgehend von der Vertriebsstrategie koennen die Prozesse, die Systeme und die Organisation von Customer Care Centern zielgerichtet optimiert werden. Durch die Beruecksichtigung der von den Verfassern beschriebenen Erfolgsfaktoren kann der Wert von Privat- und Gewerbekunden dabei signifikant gesteigert werden. (orig.)

  3. Molecular Regulation of Photosynthetic Carbon Dioxide Fixation in Nonsulfur Purple Bacteria

    Energy Technology Data Exchange (ETDEWEB)

    Tabita, Fred Robert [The Ohio State Univ., Columbus, OH (United States)

    2015-12-01

    The overall objective of this project is to determine the mechanism by which a transcriptional activator protein affects CO2 fixation (cbb) gene expression in nonsulfur purple photosynthetic bacteria, with special emphasis to Rhodobacter sphaeroides and with comparison to Rhodopseudomonas palustris. These studies culminated in several publications which indicated that additional regulators interact with the master regulator CbbR in both R. sphaeroides and R. palustris. In addition, the interactive control of the carbon and nitrogen assimilatory pathways was studied and unique regulatory signals were discovered.

  4. Climate protection by reducing the emissions of greenhouse gases in households and the tertiary sector through climate-conscious behaviour. Vol. 2; Klimaschutz durch Minderung von Treibhausgasemissionen im Bereich Haushalte und Kleinverbrauch durch klimagerechtes Verhalten. Bd. 2. Gewerbe, Handel und Dienstleistung

    Energy Technology Data Exchange (ETDEWEB)

    Boede, U; Gruber, E [Fraunhofer-Institut fuer Systemtechnik und Innovationsforschung (ISI), Karlsruhe (Germany); Deutscher, P; Elsberger, M; Rouvel, L [Technische Univ., Muenchen (Germany). Lehrstuhl fuer Energiewirtschaft und Innovationsforschung; Brakhage, A; Jaekel, M [Abacus, Trier (Germany); Renner, G [Innovative Energieberatung, Koeln (Germany); Brohmann, B; Cames, M; Herold, A

    2000-08-01

    The aim of the project was to identify areas in households and the tertiary sector in which changes in behaviour could result in energy conservation and thus a reduction of greenhouse gas emissions, and to quantify the potentials for 1995, 2005 and 2020. A second focus was on the analysis and evaluation of programmes and instruments to realise the potentials. With literature evaluation, expert interviews, and a household servey potentials and further technical development have been identified. In sum, behavioural measures can contribute to the CO2 reduction by 64 million tons in 1995 in households and 27 in the commercial sector in which the potential decreases to 18 million tons in 2020 due to the autonomous technical development. Adequate promotion programmes can help to realise 20-30% of the potential by 2020. (orig.) [German] Ziel des Vorhabens war, im Sektor private Haushalte und Kleinverbrauch Bereiche zu identifizieren, in denen Verhaltensaenderungen zur Energieeinsparung fuehren koennen, und diese Potenziale fuer 1995, 2005 und 2020 zu quantifizieren. Darauf aufbauend waren Programme und Instrumente zur Umsetzung aufzuzeigen und zu bewerten. Gestuetzt auf Literaturrecherchen und Expertengespraeche wurden Einzelpotenziale, Rahmenbedingungen, Entwicklungstrends in der Technik und im Ausstattungsgrad ermittelt. Insgesamt koennten Verhaltensmassnahmen im Haushaltssektor die CO2-Emissionen im Basisjahr 1995 um 64 Mio, im Kleinverbrauch um 27 Mio t vermindern. Bis 2020 bleibt dieses Potenzial im Haushaltssektor in etwa gleich. Im Kleinverbrauch sinkt es infolge der autonomen Technikentwicklung auf 18 Mio t ab. Durch geeignete Programme koennen bis 2020 etwa 20-30% des Potenzials erreicht werden. (orig.)

  5. Instruments. Climate protection of reduction of no-load losses in electric appliances and equipment; Klimaschutz durch Minderung von Leerlaufverlusten bei Elektrogeraeten. Instrumente

    Energy Technology Data Exchange (ETDEWEB)

    Rath, U.; Hellmann, R. [Ingenieurbuero fuer Energieberatung, Haustechnik und Oekologische Konzepte GbR (eboek), Tuebingen (Germany); Moehring-Hueser, W.; Wortmann, K.; Bregas, J. [Energiestiftung Schleswig-Holstein, Kiel (Germany); Mordziol, C. [Umweltbundesamt, Berlin (Germany)

    1999-12-01

    Two studies on the subject of 'Climate Protection through Reduction of No-load Losses in Electric Applicances and Equipment' have been performed on behalf of the German Federal Ministry for the Environment, Nature Conservation and Nuclear Safety and the German Federal Environmental Agency. The first study, carried out by the Tuebingen-based engineering bureau eboek, has been published in the Federal Environmental Agency's TEXTE series (Texte 45/97, 2{sup nd} edition, 1998). It was the starting point for a multitude of activities among them two information campaigns carried out in 1998 and 1999 that were funded by the Federal Ministry for the Environment and the German Section of the Friends of the Earth (BUND). The study also served as a basis for decisions taken by the German Bundestag and the Bundesrat (Council of Constituent States). The second study on the subject was carried out by the engineering bureau eboek and Energiestiftung Schleswig-Holstein. Building on the results obtained in the first study, it presents estimates of relevant data for the European Union and examines various approaches for possible measures to reduce no-load losses as to their suitability. The studies impressively show that effective climate protection can be achieved in all relevant sectors, and in many cases even save costs. The results are detailed below. (orig.) [German] Im Auftrag des Bundesministeriums fuer Umwelt, Naturschutz und Reaktorsicherheit sowie des Umweltbundesamtes wurden zwei Studien zum Thema: 'Klimaschutz durch Minderung von Leerlaufverlusten bei Elektrogeraeten' durchgefuehrt: Die erste, vom Ingenieurbuero fuer Energieberatung, Haustechnik und oekologische Konzepte (eboek), Tuebingen, earbeitete Studie wurde in der Reihe TEXTE des UBA veroeffentlicht (Texte 45/97, 2. Auflage 1998). Sie bildete den Ausgangspunkt fuer eine Vielzahl von Aktivitaeten, unter anderem zwei vom Bundesumweltministerium finanzierte und vom Bund fuer Umwelt und

  6. Workflow improvement and efficiency gain with near digitalization of a Radiology Department; Workflowverbesserung und Effizienzsteigerungsaspekte durch nahezu vollstaendige Digitalisierung einer Roentgenabteilung

    Energy Technology Data Exchange (ETDEWEB)

    Langen, H.L.; Bielmeier, J.; Selbach, R. [Missionsaerztlichen Klinik Wuerzburg (Germany). Radiologische Abteilung; Wittenberg, G. [Univ. Wuerzburg (Germany). Inst. fuer Roentgendiagnostik; Feustel, H. [Missionsaerztlichen Klinik Wuerzburg (Germany). Chirurgische Abteilung

    2003-10-01

    Purpose: To determine the temporal changes of the workflow caused by digitalization of the radiology department after installation of digital luminescence-radiography (DLR), a radiology information system (RIS) and picture archiving and communication system (PACS) at the Missionsaerztliche Klinik in April 2000. Materials and methods: In a comparative study, a workflow analysis by manual registration of different work steps was performed before (1999) and after (2001) digitalization of a radiology department. Results: The digitalization shortened the examination time for patients from a mean of 8 min to 5 min. The time the patient is absent from the emergency room did not change. Reporting radiographic examinations including comparison with previous studies begins earlier from a mean of 2 h 37 min to 17 min. Using PACS, 85.9% of all cases could be interpreted on the day of the examination (without PACS 41.2%) and 87.2% of the reports were completed the day after the examination (without PACS 64.5%). No time differences were found between reading conventional studies on the monitor or as soft-copy. Conclusion: Compared to conventional film-screen systems, complete digitalization of a radiology department is time saving at nearly all steps of the workflow, with expected positive effects on the workflow quality of the entire hospital. (orig.) [German] Fragestellung/Zielsetzung: An der Missionsaerztlichen Klinik folgte im April 2000 mit der Einfuehrung der digitalen Lumineszenzradiographie (DLR), eines radiologischen Informationssystems (RIS) und eines Bildarchivierungs- und Kommunkationssystems (PACS) die vollstaendige Digitalisierung der Roentgenabteilung. Die durch diese Umstellung bedingten zeitlichen Veraenderungen der Prozessablaeufe in der Roentgenabteilung wurden untersucht. Material und Methode: In Form einer Vorher-Nachher-Studie wurde 1999 im konventionellen und 2001 im digitalen Routinebetrieb anhand von Analysen der Prozessablaeufe eine manuelle

  7. Instruments. Climate protection of reduction of no-load losses in electric appliances and equipment; Klimaschutz durch Minderung von Leerlaufverlusten bei Elektrogeraeten. Instrumente

    Energy Technology Data Exchange (ETDEWEB)

    Rath, U; Hellmann, R [Ingenieurbuero fuer Energieberatung, Haustechnik und Oekologische Konzepte GbR (eboek), Tuebingen (Germany); Moehring-Hueser, W; Wortmann, K; Bregas, J [Energiestiftung Schleswig-Holstein, Kiel (Germany); Mordziol, C [Umweltbundesamt, Berlin (Germany)

    1999-12-01

    Two studies on the subject of 'Climate Protection through Reduction of No-load Losses in Electric Applicances and Equipment' have been performed on behalf of the German Federal Ministry for the Environment, Nature Conservation and Nuclear Safety and the German Federal Environmental Agency. The first study, carried out by the Tuebingen-based engineering bureau eboek, has been published in the Federal Environmental Agency's TEXTE series (Texte 45/97, 2{sup nd} edition, 1998). It was the starting point for a multitude of activities among them two information campaigns carried out in 1998 and 1999 that were funded by the Federal Ministry for the Environment and the German Section of the Friends of the Earth (BUND). The study also served as a basis for decisions taken by the German Bundestag and the Bundesrat (Council of Constituent States). The second study on the subject was carried out by the engineering bureau eboek and Energiestiftung Schleswig-Holstein. Building on the results obtained in the first study, it presents estimates of relevant data for the European Union and examines various approaches for possible measures to reduce no-load losses as to their suitability. The studies impressively show that effective climate protection can be achieved in all relevant sectors, and in many cases even save costs. The results are detailed below. (orig.) [German] Im Auftrag des Bundesministeriums fuer Umwelt, Naturschutz und Reaktorsicherheit sowie des Umweltbundesamtes wurden zwei Studien zum Thema: 'Klimaschutz durch Minderung von Leerlaufverlusten bei Elektrogeraeten' durchgefuehrt: Die erste, vom Ingenieurbuero fuer Energieberatung, Haustechnik und oekologische Konzepte (eboek), Tuebingen, earbeitete Studie wurde in der Reihe TEXTE des UBA veroeffentlicht (Texte 45/97, 2. Auflage 1998). Sie bildete den Ausgangspunkt fuer eine Vielzahl von Aktivitaeten, unter anderem zwei vom Bundesumweltministerium finanzierte und vom Bund fuer Umwelt und Naturschutz (BUND) 1998 und

  8. MTBE experts' discussion: Environmental pollution from MTBE fuel additives. Proceedings; MTBE-Fachgespraech: Umweltbelastungen durch die Nutzung von MTBE (Methyl-tertiaer-butylether) als Kraftstoffzusatz. Tagungsband

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    2002-07-01

    Normalbenzin bei uns durchschnittlich 0,3% und Super 1,6% MTBE enthalten, liegen die Werte fuer SuperPlus und Optimax bei etwa 6-12% Vol-%. In neun Fachvortraegen und einer ausfuehrlichen Diskussionsrunde, die in dem vorliegenden Tagungsband wiedergegeben sind, wurden Messdaten zur Konzentration von MTBE in Luft, Niederschlag, Oberflaechen- und Grundwasser vorgestellt und die Moeglichkeiten einer Modellbildung eroertert. Die Teilnehmer des Fachgespraechs waren sich einig, dass die derzeitige Datenlage und die Kenntnisse zum Vorkommen und zu den Verbreitungswegen von MTBE in den Umweltmedien keinesfalls geeignet sind, abschliessend Entwarnung zu geben und eine Grundwassergefaehrdung durch MTBE auszuschliessen. (orig.)

  9. Low-cost development of the Algyoefield in Hungary by means of horizontal re-entry boreholes; Die kostenguenstige Entwicklung des Algyoe-West-Feldes in Ungarn durch horizontale Re-Entry-Bohrungen

    Energy Technology Data Exchange (ETDEWEB)

    Kinzel, H. [Weatherford Oil Tool GmbH, Langenhagen (Germany); Osz, A. [Magyar Olaj (MOL), Budapest (Hungary); Kerk, T. [Becfield Drilling Services, Edemissen-Berkhoepen (Germany)

    1998-12-31

    Planning and implementation of a typical re-entry borehole in southern Hungary are described. The cost is about half that of a new borehole, and the available infrastructure can be used. The production index of a typical Algyoehorizontal borehole is higher by a factor of 12 than for a vertical borehole in the same field. (orig.) [Deutsch] Anhand einer Beispielbohrung (Algyoe488) wird die Planung und Durchfuehrung einer typischen Re-Entry Bohrung in Suedungarn beschrieben. Durch die weitgehende Verwendung von standardisierten Komponenten und Verfahren sowie durch die enge Zusammenarbeit zweier deutscher Service Unternehmen mit dem Auftraggeber wurde bei insgesamt 35 Horizontalbohrungen in Ungarn der Effekt der Lernkurve zur optimierten Erstellung der Bohrung und damit zur Kostensenkung effektiv eingesetzt. Die so aufgearbeiteten Bohrungen werden im Vergleich zu einer neuen Bohrung fuer etwa die Haelfte der Kosten erstellt. Die vorhandene Infrastruktur des Feldes kann weiter verwendet werden. Der Produktionsindex einer typischen AlgyoeHorizontalbohrung liegt um den Faktor 12 hoeher als eine Vertikalbohrung im gleichen Feld. (orig.)

  10. Integrating large-scale functional genomics data to dissect metabolic networks for hydrogen production

    Energy Technology Data Exchange (ETDEWEB)

    Harwood, Caroline S

    2012-12-17

    The goal of this project is to identify gene networks that are critical for efficient biohydrogen production by leveraging variation in gene content and gene expression in independently isolated Rhodopseudomonas palustris strains. Coexpression methods were applied to large data sets that we have collected to define probabilistic causal gene networks. To our knowledge this a first systems level approach that takes advantage of strain-to strain variability to computationally define networks critical for a particular bacterial phenotypic trait.

  11. Attempted treatment of meningeosis leucaemica by intrathecal application of 90-silicate and 90Y-citrate colloid in a case of chronic myleoic leukaemia; Behandlungsversuch einer Meningeosis leucaemica durch intrathekale Applikation von {sup 90}Y-Silikat- und {sup 90}Y-Zitrat-Kolloid bei chronisch-myleoischer Leukaemie

    Energy Technology Data Exchange (ETDEWEB)

    Kittner, C.; Schuemichen, C. [Rostock Univ. (Germany). Klinik und Poliklinik fuer Nuklearmedizin; Steiner, B.; Kahl, C.; Wolff, D.; Freund, M. [Rostock Univ. (Germany). Klinik fuer Innere Medizin, Abt. fuer Haematologie; Putzar, H.; Roesler, K.; Hauenstein, K.H. [Rostock Univ. (Germany). Inst. fuer Diagnostische und Interventionalle Radiologie

    2003-12-01

    A 41-year-old man with chronic myeoloic leukaemia was treated for Meningeosis leucaemica by intrathecal application of yttrium-90-citrate colloide as palliative therapy. (orig.) [German] Wir berichten ueber einen 41-jaehrigen Mann mit chronisch-myeloischer Leukaemie bei dem eine Meningeosis leucaemica durch eine intrathekale Applikation von Yttrium-90-Zitrat-Kolloid palliativ therapiert wurde. (orig.)

  12. Energy conservation in refrigerating machines by combining of thermo-static expansion valve and interior heat transfer material; Energieeinsparung in Kaelteanlagen durch Kombination von thermostatischem Expansionsventil und innerem Waermeuebertrager

    Energy Technology Data Exchange (ETDEWEB)

    Tambovtsev, Alexander

    2007-12-15

    bekannten Komponenten TEV und IWUeals inkompatibel miteinander, weil die einfache Aneinanderreihung zu einem instabilen Regelverhalten fuehrt. Nach detaillierter Analyse der Ursachen dieser Instabilitaet wird die Hypothese aufgestellt, dass durch eine absichtliche ''Verschlechterung'' des IWUeein stabiler Arbeitsbereich gefunden werden kann. Bei dieser ''Verschlechterung'' kann es sich z. B. um den Bypass eines Teils des Hochdruckstromes oder um eine Gleichstromanordnung der Stroeme im Waermeuebertrager handeln. Diese Hypothese wurde primaer durch Experimente, aber zusaetzlich auch durch Simulationsrechnungen bestaetigt. Dafuer wurde ein Versuchsstand aufgebaut, mit welchem verschiedene Konfigurationen und Regelstrategien getestet wurden. Es wurde eine deutliche Verringerung des Energieverbrauchs gegenueber herkoemmlichen Anordnungen erreicht. (orig.)

  13. Remediation of heavy-metal contaminated sediments by means of bioleaching. Study: project results - economic efficiency - market assessment. Final report; Reinigung schwermetallbelasteter Sedimente durch Bioleaching. Studie: Projektergebnisse - Wirtschaftlichkeit - Marktbewertung. Schlussbericht

    Energy Technology Data Exchange (ETDEWEB)

    Loeser, C; Zehnsdorf, A; Hoffmann, P; Seidel, H; Schmerold, R

    2002-07-01

    Sedimente mit Sauerstoff in Kontakt, gehen die Schwermetalle durch mikrobielle Oxidations- und Versauerungsprozesse teilweise in Loesung. Dieses natuerliche Bioleaching, welches unkontrolliert ein Gefahrenpotential fuer die Umwelt darstellt, soll durch Aktivierung der autochthonen schwefeloxidierenden Bakterien (z.B. Thiobacilli) beschleunigt und zur Reinigung der Sedimente genutzt werden. Ziel ist es, ein naturnahes Verfahren zur Sedimentdekontamination unter Nutzung des natuerlichen biologischen Solubilisierungspotentials bereitzustellen. Die gereinigten Sedimente sollen in den Stoffkreislauf als Bodensubstrat zurueckgefuehrt werden. Die Verfahrensentwicklung erfolgte am Beispiel von hochbelasteten Sedimenten der Weissen Elster aus dem Suedraum Leipzig. Aus oekonomischen Gruenden soll das Bioleaching der Schwermetalle durch Festbettlaugung nach dem Perkolationsprinzip erfolgen. Das Verfahren erfordert mehrere Prozessstufen. Der Schwerpunkt der Untersuchungen im Labor- und Technikumsmassstab lag auf der Erarbeitung und technischen Umsetzung von Massnahmen zur Beschleunigung der Metallsolubilisierung. (orig.)

  14. Measurements of size distributions of radon progeny for improved quantification of the lung cancer risk emanating from exposure to radon decay products; Messungen der Groessenverteilungen von Radon-Folgeprodukten zur Verbesserung der Quantifizierung des durch Radonexposition verursachten Lungenkrebsrisikos

    Energy Technology Data Exchange (ETDEWEB)

    Haninger, T

    1998-12-31

    A major issue in radiation protection is to protect the population from the harmful effects of exposure to radon and radon progeny. Quantification of the lung cancer risk emanating from exposure to radon decay products in residential and working environments poses problems, as epidemiologic studies yield information deviating from the results obtained by the indirect method of assessment based on dosimetric respiratory tract models. One important task of the publication here was to characterize the various exposure conditions and to quantify uncertainties that may result from application of the ``dose conversion convention``. A special aerosol spectrometer was therefore designed and built in order to measure the size distributions of the short-lived radon decay products in the range between 0.5 nm and 10 000 nm. The aerosol spectrometer consists of a three-step diffusion battery with wire nets, an 11-step BERNER impactor, and a detector system with twelve large-surface proportional detectors. From the measured size distributions, dose conversion coefficients, E/P{sup eq}, were calculated using the PC software RADEP; the RADEP program was developed by BIRCHALL and JAMES and is based on the respiratory tract model of the ICRP. The E/P{sup eq} coefficients indicate the effective dose E per unit exposure P{sup eq} to radon decay products. (orig./CB) [Deutsch] Eines der groessten Probleme des Strahlenschutzes ist der Schutz der Bevoelkerung vor einer Strahlenexposition durch Radon und seine Folgeprodukte. Die Quantifizierung des Lungenkrebsrisikos, das durch Radonexpositionen in Wohnungen und an Arbeitsplaetzen verursacht wird, ist ein grosses Problem, weil epidemiologische Studien ein anderes Ergebnis liefern, als die indirekte Methode der Abschaetzung mit dosimetrischen Atemtrakt-Modellen. Eine wichtige Aufgabe der vorliegenden Arbeit war es, unterschiedliche Expositionsbedingungen zu charakterisieren und die Unsicherheiten zu quantifizieren, die sich aus der

  15. Racism, Ethnicity and the Media in Africa: Reflections Inspired by Studies of Xenophobia in Cameroon and South Africa Rassismus, Ethnizität und die Medien in Afrika: Reflektionen angeregt durch Studien zu Fremdenfeindlichkeit in Kamerun und Südafrika

    Directory of Open Access Journals (Sweden)

    Francis B. Nyamnjoh

    2010-01-01

    Full Text Available This paper demonstrates the extent to which the media and belonging in Africa are torn between competing and often conflicting claims of bounded and flexible ideas of culture and identity. It draws on studies of xenophobia in Cameroon and South Africa, inspired by the resilience of the politicization of culture and identity, to discuss the hierarchies and inequalities that underpin political, economic and social citizenship in Africa and the world over, and the role of the media in the production, enforcement and contestation of these hierarchies and inequalities. In any country with liberal democratic aspirations or pretensions, the media are expected to promote national citizenship and its emphasis on large-scale, assimilationist and territorially bounded belonging, while turning a blind eye to those who fall through the cracks as a result of racism and/or ethnicity. Little wonder that such an exclusionary articulation of citizenship is facing formidable challenges from its inherent contradictions and closures, and from an upsurge in the politics of recognition and representation by small-scale communities claiming autochthony at a historical juncture where the rhetoric espouses flexible mobility, postmodern flux and discontinuity. Der vorliegende Beitrag zeigt auf, inwieweit die Medien und gesellschaftliche Bindungen in Afrika zwischen konfligierenden Ansprüchen abgegrenzter und sich wandelnder kultureller Identitäten zerrissen sind. Angeregt durch die Erfahrung der kontinuierlichen Politisierung kultureller und sozialer Identitäten zieht der Autor Studien zu Fremdenfeindlichkeit in Kamerun und Südafrika heran, um die Hierarchien und Ungleichheiten zu diskutieren, auf denen politische, wirtschaftliche und soziale Staatsbürgerschaft in Afrika und darüber hinaus basiert, sowie die Rolle der Medien bei der Entstehung, Verstärkung und im Wettstreit dieser Hierarchien und Ungleichheiten. In jedem liberal-demokratisch ausgerichteten Staat

  16. Measurements of size distributions of radon progeny for improved quantification of the lung cancer risk emanating from exposure to radon decay products; Messungen der Groessenverteilungen von Radon-Folgeprodukten zur Verbesserung der Quantifizierung des durch Radonexposition verursachten Lungenkrebsrisikos

    Energy Technology Data Exchange (ETDEWEB)

    Haninger, T.

    1997-12-31

    A major issue in radiation protection is to protect the population from the harmful effects of exposure to radon and radon progeny. Quantification of the lung cancer risk emanating from exposure to radon decay products in residential and working environments poses problems, as epidemiologic studies yield information deviating from the results obtained by the indirect method of assessment based on dosimetric respiratory tract models. One important task of the publication here was to characterize the various exposure conditions and to quantify uncertainties that may result from application of the ``dose conversion convention``. A special aerosol spectrometer was therefore designed and built in order to measure the size distributions of the short-lived radon decay products in the range between 0.5 nm and 10 000 nm. The aerosol spectrometer consists of a three-step diffusion battery with wire nets, an 11-step BERNER impactor, and a detector system with twelve large-surface proportional detectors. From the measured size distributions, dose conversion coefficients, E/P{sup eq}, were calculated using the PC software RADEP; the RADEP program was developed by BIRCHALL and JAMES and is based on the respiratory tract model of the ICRP. The E/P{sup eq} coefficients indicate the effective dose E per unit exposure P{sup eq} to radon decay products. (orig./CB) [Deutsch] Eines der groessten Probleme des Strahlenschutzes ist der Schutz der Bevoelkerung vor einer Strahlenexposition durch Radon und seine Folgeprodukte. Die Quantifizierung des Lungenkrebsrisikos, das durch Radonexpositionen in Wohnungen und an Arbeitsplaetzen verursacht wird, ist ein grosses Problem, weil epidemiologische Studien ein anderes Ergebnis liefern, als die indirekte Methode der Abschaetzung mit dosimetrischen Atemtrakt-Modellen. Eine wichtige Aufgabe der vorliegenden Arbeit war es, unterschiedliche Expositionsbedingungen zu charakterisieren und die Unsicherheiten zu quantifizieren, die sich aus der

  17. Mathematical modelling of transport of gaseous and liquid substances induced by pyrite oxidation in spoil banks of lignite mines; Mathematische Modellierung der durch Pyritoxidation induzierten Stofftransporte in Braunkohleabraumkippen in gasfoermiger und fluessiger Phase

    Energy Technology Data Exchange (ETDEWEB)

    Ludwig, R.

    2001-07-01

    Pyrite (FeS{sub 2}) oxidation due to open-pit lignite mining activities may result in acid mine drainage and dissolved metals in the soil and ground water of the overburden spoil piles. The pyrite oxidation takes place firstly during the mining process and at the temporary surfaces of the mine, secondly in deep zones of the overburden spoil pile as a result of gas transport through the unsaturated zone. The second process continues after mine closure possibly over several decades and therefore contaminates the environment for a long time. Whereas some studies deal with a minimisation by geochemical means, this research focuses on a minimisation by impacting the physical boundary conditions. Special attention is given to the transport of oxygen from the soil surface to the pyrite oxidation zone. Soil column experiments with columns of 2.90 m height yield experimental data concerning the pyrite oxidation and the related transport processes in the unsaturated zone. Experimental data are compared to simulation results obtained with the model MUSIC; it calculates coupled reaction and transport processes in a one-dimensional soil profile using the finite volume method. Pyrite oxidation is described by means of a first order kinetics, the gas transport takes place by diffusion as well as convection. The transport of solutes in the soil water is described by the convection-dispersion equation (Cl{sup -}, Fe{sup 2+} and SO{sub 4}{sup 2-}). The simulations are able to reproduce the measured time series of oxygen concentrations in the soil profile. (orig.) [German] Die durch Braunkohlegewinnung im Tagebau hervorgerufene Pyritoxidation (Pyrit: FeS{sub 2}) kann zu Versauerung, Schwermetallfreisetzung und Aufmineralisierung des Boden- und Grundwassers in den Abraumkippen fuehren. Die Pyritoxidation findet zum einen waehrend des Abbaubetriebs und an den temporaeren Oberflaechen des Tagebaus statt, zum anderen in tieferen Bereichen der Abraumkippe durch Gastransport durch die

  18. Rezension von: Ulf Gebken, Söhnke Vosgerau (Hg.: Fußball ohne Abseits. Ergebnisse und Perspektiven des Projekts ‚Soziale Integration von Mädchen durch Fußball‘. Wiesbaden: Springer VS 2014.

    Directory of Open Access Journals (Sweden)

    Robert Claus

    2014-12-01

    Full Text Available Seit 2006 wurden im Rahmen des vom Deutschen Fußball-Bund durchgeführten Modellprojektes „Soziale Integration von Mädchen durch Fußball“ an über 200 Standorten Schul-AGs in sogenannten Brennpunktbezirken aufgebaut. Im vorliegenden Sammelband beleuchten die Autor/-innen ausführlich die Funktion von Sport für die pädagogische Kompetenzvermittlung. Zudem erbringen sie einen umfassenden Projektbericht und leisten ein Plädoyer für die Modernisierung des Verhältnisses zwischen Schule und Vereinen, Lehrplan und Ehrenamt. Somit stellt das Buch, wie auch das Projekt, einen enorm wichtigen Beitrag zur Geschlechtergerechtigkeit im Sport dar. Gleichzeitig jedoch liest sich eine Reihe an Texten etwas zu sperrig für den Bericht einer Praxisforschung, und Begriffe im Feld der ‚Integration’ bleiben schwammig.

  19. Superconductors for the medium-voltage grid. A superconducting power cable running through the inner city of Essen passes a two-year field test; Supraleiter fuer das Mittelspannungsnetz. Ein supraleitendes Stromkabel quer durch die Essener Innenstadt besteht zweijaehrigen Feldtest

    Energy Technology Data Exchange (ETDEWEB)

    Meyer, Franz

    2017-04-01

    Scientists are testing the longest high-temperature superconducting cable in the world under real conditions in Essen. One kilometre long, it connects two substations in the inner city. It replaces a conventional 110 kV line and renders one substation in the inner city obsolete. After two years of testing, it has passed the field test. It could be a blueprint for the future power supply system in urban areas. [German] Wissenschaftler testen in Essen das laengste Hochtemperatur-Supraleiterkabel der Welt unter realen Bedingungen. Mit einer Laenge von einem Kilometer verbindet es zwei Umspannstationen quer durch die Innenstadt. Es ersetzt eine konventionelle 110-kV-Leitung und macht eine Umspannanlage im Stadtzentrum ueberfluessig. In einer zweijaehrigen Erprobung hat es den Praxistest bestanden. Es koennte eine Blaupause fuer die kuenftige Stromversorgung in Ballungsraeumen sein.

  20. Tests in excess sludge minimization through cell membrane break-up by means of ozone at a municipal sewage treatment plant; Versuche zur Ueberschussschlamm-Minimierung durch Zellaufschluss mit Ozon auf einer kommunalen Klaeranlage

    Energy Technology Data Exchange (ETDEWEB)

    Ried, A.; Peters, B. [WEDECO Umweltdienstleistungen GmbH, Herford (Germany)

    1999-07-01

    Disposing of sewage sludge involves high cost. Therfore, processes to reduce sewage sludge are more and more in demand. One such process is the treatment with ozone. The company WEDESCO GmbH is also concerned with ozonification of sewage sludge and carries out tests on a technical scale at a municipal sewage treatment plant. The objective is to reduce the amount of sewage sludge by approximately 50 %, corresponding, in the present case, to the organic sludge portion. (orig.) [German] Da die Entsorgung dieses Klaerschlamms hohe Kosten verursacht, gewinnen Verfahren zur Klaerschlammreduzierung zunehmend an Bedeutung. Eine Moeglichkeit der Reduzierung des Klaerschlamms besteht in der Behandlung mit Ozon. Auch die WEDECO GmbH befasst sich mit der Ozonung von Klaerschlamm und fuehrt Versuche im grosstechnischen Massstab auf einer kommunalen Klaeranlage durch. Ziel dieser Versuche ist es, den anfallenden Klaerschlamm um ca. 50% zu reduzieren, was in diesem Anwendungsfall dem organischen Anteil des Schlamms entspricht. (orig.)

  1. Water pollution potential of mineral oils with high content of polycyclic aromatic hydrocarbons (heavy fuel oil and neutral oil extracts); Untersuchungen zur Wassergefaehrdung durch Mineraloele mit hohen Gehalten an polycyclischen aromatischen Kohlenwasserstoffen (Heizoel Schwer und Extrakte)

    Energy Technology Data Exchange (ETDEWEB)

    Albers, G. [Mobil Schmierstoff GmbH, Hamburg (Germany)

    1999-01-01

    A data base on highly aromatic mineral oils has been compiled to classify mineral oil products according to their water-pollution potential (water hazard class or Wassergefaehrdungsklasse, WGK). This activity has been undertaken through the Commission for Water Hazardous Materials (Kommission Bewertung Wassergefaehrdender Stoffe, KBwS). In this special case, highly aromatic mineral oils containing a high concentration of polycyclic aromatic hydrocarbons (Polyaromatische Kohlenwasserstoffe, PAK) were evaluated. A test method for measuring the elution potential of PAK into water was developed on petroleum products with high viscosity and high freeze point. This method was applied to determine the solubility of 23 PAK (including 16 PAK according to EPA 610 and 6 PAK according to the German drinking water regulation (Trinkwasserverordnung, TVO)) from heavy fuel oil and neutral oil extract in the aqueous phase. For the 6 PAK, according to TVO, a sum limit of 0,2 {mu}g/l in drinking water is permitted by German legislation. This limit was not exceeded in any of the water phases examined. (orig.) [Deutsch] Fuer die Einstufung von Mineraloelprodukten in die Wassergefaehrdungsklassen (WGK) durch die Kommission Bewertung Wassergefaehrdender Stoffe ist es notwendig, Basisdaten zur Verfuegung zu stellen. Im speziellen Fall handelt es sich um die Bewertung von Mineraloelen, die sich durch einen hohen Gehalt an polycyclischen aromatischen Kohlenwasserstoffen (PAK) auszeichnen. Zur Eluierbarkeit von PAK`s aus Produkten mit hoher Viskosiaet bzw. mit hohem Stockpunkt wurde eine Pruefmethode entwickelt. Diese Methode wurde zur Bestimmung der Loeslichkeit von 23 PAK`s (16 PAK`s nach EPA-Liste incl. 6 PAK`s der TVO) aus den Mineraloelen Heizoel Schwer und Neutralextrakt in der Wasserphase eingesetzt. Fuer die PAK der TVO ist in der TVO ein Summengrenzwert von 0,2 {mu}g/l Trinkwasser angegeben. Dieser Grenzwert wurde in keiner der untersuchten Wasserphasen ueberschritten. (orig.)

  2. Radiation exposure to the patient caused by single-photon transmission measurement for 3D whole-body PET; Die Strahlenexposition des Patienten durch die Einzelphotonen-Transmissionsmessung bei der PET

    Energy Technology Data Exchange (ETDEWEB)

    Schaefer, A.; Donsch, P.; Kirsch, C.M. [Universitaet des Saarlandes, Homburg/Saar (Germany). Abt. fuer Nuklearmedizin; Seifert, H. [Universitaet des Saarlandes, Homburg/Saar (Germany). Abt. Strahlentherapie der Radiologischen Klinik

    2000-11-01

    Patienten durch die Transmissionsmessung mittels Einzelphotonenquellen bei der PET. Material und Methode: Zwei Cs-137-Punktquellen (E{gamma}=662 keV, A=614 MBq) werden zur Transmissionsmessung im Einzelphotonenmodus an einem 3D-Scanner (ECAT ART) eingesetzt. Bei der Simulation einer Ganzkoerper-Transmission (axiale Laenge: 75 cm, 6 ueberlappende Bettpositionen), werden Dosismessungen mit Thermolumineszenzdosimetern unter Verwendung eines Thorax- und eines Abdomenphantoms durchgefuehrt. Aus den Messwerten wurde in Anlehnung an den Report Nr. 60 der ICRP die effektive Dosis fuer die Transmissionsmessung abgeschaetzt. Ergebnisse: Bei einer Gesamtaufnahmedauer von 360 min (60 min pro Bettposition) ergaben sich folgende Energiedosen: Oberflaeche (Xyphoid) 189 {mu}Gy, Herz 196 {mu}Gy, Lunge 234 {mu}Gy, BWS 240 {mu}Gy, Niere 207 {mu}Gy, Leber 204 {mu}Gy, Gonaden 205 {mu}Gy, Schilddruese 249 {mu}Gy und Blase 185 {mu}Gy, aus denen sich ein Konversionsfaktor von 1,7*10{sup -4} mSv/(h*MBq) errechnete. Die Abschaetzung der effektiven Dosis fuer den Patienten aufgrund einer Transmissionsmessung (Akquisitionszeit von 3,2 min pro Bettposition) ergab einen Wert von 11 {mu}Sv. Die Abschaetzung des Verhaeltnisses der Konversionsfaktoren durch Transmissionsmessung im Einzelphotonen- und im Koinzidenzmodus (zwei Ge-68/Ga-68-Linienquellen mit jeweils 40 MBq) ergab einen Wert von 0,18. Der Vergleich zwischen den effektiven Dosen durch die Transmission im Einzelphotonen-Modus und die Emission (bei Injektion von 250 MBq FDG) ergab ein Verhaeltnis von 2,3*10{sup -3}. Schlussfolgerung: Die Strahlenexposition der Patienten durch die Transmissionsmessung in der 3D-PET ist vernachlaessigbar gering. Sie wird durch die Verwendung der Einzelphotonenmethode mit kollimierten Punktquellen relativ hoher Aktivitaet im Vergleich zur Koinzidenzmethode mit nicht-kollimierten Linienquellen relativ niedriger Aktivitaet weiter reduziert. (orig.)

  3. Improved patient repositioning accuracy by integrating an additional jaw fixation into a high precision face mask system in stereotactic radiotherapy of the head; Verbesserte lagerungsreproduzierbarkeit eines nichtinvasiven hochpraezisionsmaskensystems in der stereotaktischen Radiotherapie durch eine integrierte kieferfixierung

    Energy Technology Data Exchange (ETDEWEB)

    Lopatta, E.; Liesenfeld, S.M.; Bank, P.; Guenther, R.; Wiezorek, T.; Wendt, T.G. [Klinik fuer Radiologie, Abt. fuer Strahlentherapie, Friedrich-Schiller-Univ. Jena (Germany); Wurm, R. [Campus Charite Mitte, Klinik fuer Strahlentherapie, Berlin (Germany)

    2003-08-01

    Strahlentherapie. Material und Methoden: 29 Patienten wurden unter stereotaktischen Bedingungen fraktioniert bestrahlt. Jeder Patient erhielt das individuell angepasste Zwei-Halbschalen-Maskensystem (BrainLab trademark). Bei 18 dieser Patienten kam eine zusaetzliche Kieferfixierung entweder als Oberkieferfixierung (OKF) oder als zusaetzliche Unterkieferfixierung (UKF) zum Einsatz. Die Reproduzierbarkeit der Lagerung wurde durch Ausmessung von Verschiebungen anatomischer Strukturen auf Filmebene in 0 und 90 bestimmt. Vor den Aufnahmen in Gantryposition 0 und 90 erfolgte die Feinjustierung des Simulators ueber ein optisches Ringsystem. Insgesamt wurden waehrend der 2- bis 7-woechigen Therapie 844 Messungen an einem digitalen Bildverarbeitungssystem erhoben. Ergebnisse: Im Vergleich der Standardabweichungen der Messergebnisse ergibt sich unter Verwendung einer zusaetzlichen Kieferfixierung eine signifikante Verbesserung der Lagerungsreproduzierbarkeit in den drei Freiheitsgraden: Lateralverschiebung 0,6 mm mit Kieferfixierung vs. 0,7 mm ohne Fixierung (p < 0,001); Longitudinalverschiebung in 0 Aufnahme gemessen 0,5 vs. 1,3 mm (p < 0,001), Longitudinalverschiebung in 90 -Aufnahme gemessen 0,5 mm vs. 1,5 mm (p < 0,001), Vertikalverschiebung 0,6 vs. 0,9 mm (p = 0,001). Kein signifikanter Unterschied der Abweichungen ergibt sich im Vergleich zwischen OKF und UKF. Schlussfolgerung: Diese Untersuchung konnte eine signifikante Verbesserung der Lagerungspraezision durch die Verwendung einer zusaetzlichen, individuell geformten Kieferfixierung mit dem BrainLab trademark -Maskensystem nachweisen. Die Lagerungsvariabilitaet betraegt in allen Richtungen weniger als 2 mm. Somit kann der Sicherheitssaum um das klinische Zielvolumen insbesondere bei benignen Tumoren durch verbesserte Fixierung entscheidend verkleinert werden. (orig.)

  4. Formation of formaldehyde in biogas-engines and methods for reducing these emissions by exhaust-gas after-treatment; Entstehung von Formaldehydemissionen in Biogasmotoren und deren Verminderung durch inner- und nachmotorische Massnahmen

    Energy Technology Data Exchange (ETDEWEB)

    Bauer, Markus; Wachtmeister, Georg; Prager, Maximilian [TU Muenchen (Germany). Lehrstuhl fuer Verbrennungskraftmaschinen

    2011-07-01

    (BMU) following a resolution by the German Federal Parliament and attended by a Working Group of the Forschungsvereinigung Verbrennungskraftmaschinen e.V (FVV, Research Association for Combustion Engines). (orig.) [German] In der Vergangenheit wurden an Biogasmotoren immer wieder Grenzwertueberschreitungen der in der Technischen Anweisung zur Reinhaltung der Luft (TA Luft) limitierten Formaldehydemissionen festgestellt. Fuer die zukuenftige Einhaltung dieses Grenzwertes an bestehenden und neuen Anlagen wurden am Lehrstuhl fuer Verbrennungskraftmaschinen der Technischen Universitaet Muenchen im Rahmen des FVV-Forschungsvorhabens 918 die Ursachen und die Moeglichkeiten zur innermotorischen Verminderung dieser Emissionen untersucht. Dabei zeigte sich, dass die Formaldehydemissionen nur sehr eingeschraenkt durch innermotorische Massnahmen verringert werden koennen, ohne Wirkungsgrad und Stickoxidemissionen negativ zu beeinflussen. Dies und eine zusaetzliche Verschaerfung der Grenzwerte im Januar 2009 durch LAI-Beschluss machen den Einsatz von Abgasnachbehandlungstechniken notwendig. Wegen der fehlenden Datenbasis ueber das Langzeitverhalten solcher Systeme im Biogasbetrieb wurden deshalb in einem weiteren Vorhaben zwei Modellanlagen mit unterschiedlichen Technologien zur Abgasnachbehandlung ueber sechs Monate hinweg hinsichtlich ihrer Formaldehydemissionen ueberwacht. Im Hinblick auf die aktuelle Klimadebatte und die Klimawirksamkeit von Methan, die eine zukuenftige Begrenzung dieser Emissionen erwarten laesst, wurden darueber hinaus auch die Methanemissionen dieser Anlagen untersucht. Die Untersuchungen zeigten, dass beide betrachteten Abgasnachbehandlungstechnologien, Regenerative Thermische Oxidation (RTO) und Oxidationskatalysator (Oxi-Kat) grundsaetzlich geeignet sind, die geltenden Formaldehydgrenzwerte sicher zu unterschreiten. Es wurde jedoch auch klar, dass weiterer Forschungsbedarf hinsichtlich der Dauerhaltbarkeit des Oxi-Kats und dem Instationaerbetrieb des RTO

  5. Inhibitor efficiency in long-time protection of steel tanks for the chemical surface preparation against local corrosion by process solutions containing hydrochloric acid; Inhibitorwirksamkeit beim Langzeitschutz von Stahlbehaeltern fuer die chemische Oberflaechenvorbereitung gegen oertliche Korrosion durch salzsaeurehaltige Prozessloesungen

    Energy Technology Data Exchange (ETDEWEB)

    Stieglitz, U.; Schulz, W.D. [Institut fuer Korrosionsschutz Dresden GmbH, Gostritzer Str. 61-63, D-01217 Dresden (Germany)

    2004-02-01

    The efficiency of prevailing acid inhibitors is examined by age hardening heavy tank-steel plates in technically usual hot-galvanizing solutions for 1000 hours. With acid inhibitors local corrosion emerged as shallow pit formation first and foremost in hydrochlorid acid pickles (20 g/l HCl) at ambient temperature as well as in cleaners containing hydrochloric acid (10-30 g/l HCl) at 40 C when other conditions also applied. Above all, local corrosion was produced if the inhibitor concentration became too low (0.2 g/l) in connection with a minimum hydrochloric acid concentration (10-30 g/l). However, oxidizing agents like iron(III)-ions (5-10 g/l), atmospheric oxygen and free chlorine (100-1000 mg/l) lead to local corrosion, too. Local corrosion did not emerge in rinse baths (2-10 g/l HCl) and fluxing material solutions of zinc chloride and ammonium chloride (pH value: 2.0-5.5). Here uniform corrosion developed. Acid inhibitors turned out to be very effective against uniform corrosion in the examined long-time period (inhibiting values up to 99%). (Abstract Copyright [2004], Wiley Periodicals, Inc.) [German] Die Wirksamkeit handelsueblicher Saeureinhibitoren wird durch eine Auslagerung von Grobblechen aus Behaelterstahl ueber 1000 Stunden in technisch gebraeuchlichen Loesungen der Feuerverzinkung untersucht. Oertliche Korrosion ist als Muldenkorrosion in Gegenwart von Saeureinhibitoren vor allem in Salzsaeurebeizen (20 g/l HCl) bei Raumtemperatur und in salzsaeurehaltigen Reinigern (10-30 g/l HCl) bei 40 C aufgetreten, wenn Zusatzbedingungen erfuellt sind. Oertliche Korrosion wird vorwiegend durch eine Unterschreitung der Inhibitorkonzentration (0,2 g/l) in Verbindung mit einer minimalen Salzsaeurekonzentration (10-30 g/l) ausgeloest. Aber auch Oxidationsmittel wie Eisen(III)-Ionen (5-10 g/l), Luftsauerstoff und freies Chlor (100-1000 mg/l) fuehren zu oertlicher Korrosion. In Spuelbaedern (2-10 g/l HCl) und Flussmittelloesungen aus Zinkchlorid und Ammoniumchlorid (p

  6. The production of wear protection coatings reinforced with tungsten carbide by temperature-controlled welding with the CO{sub 2} laser; Herstellung wolframkarbidverstaerkter Verschleissschutzschichten durch temperaturgeregeltes Auftragschweissen mit dem CO{sub 2}-Laser

    Energy Technology Data Exchange (ETDEWEB)

    Nowotny, S.; Boddin, G.C.; Luft, A.; Techel, A. [Fraunhofer-Inst. fuer Werkstoffphysik und Schichttechnologie, Dresden (Germany); Uelze, A. [Hochschule fuer Technik und Wirtschaft Dresden (Germany)

    1995-12-31

    Protective coatings can be produced by laser coating with metal alloys reinforced by carbide, whose resistance to abrasive wear with a content of 40 to 50% by volume of hard material is comparable to sintered TC-Co hard metal. Due to the remaining ductile material behaviour and the metallurgical binding to the substrate, the coatings have high impact, fatigue and adhesion strengths. The use of process control leads to a stable coating process and to increased safety and reproduceability when working in narrow parameter areas. (orig./RHM) [Deutsch] Durch das Laserbeschichten mit karbidverstaerkten Metallegierungen koennen Schutzschichten erzeugt werden, deren Widerstand gegen Abrasivverschleiss bereits bei einem Hartstoff-Volumengehalt von 40 bis 50% gesintertem WC-Co-Hartmetall vergleichbar ist. Aufgrund des verbleibenden duktilen Werkstoffverhaltens und der metallurgischen Bindung zum Substrat verfuegen die Schichten ueber hohe Schlag-, Ermuedungs- und Haftfestigkeiten. Der Einsatz der Prozessregelung fuehrt zu einem stabilen Beschichtungsvorgang und zu einer erhoehten Sicherheit und Reproduzierbarkeit beim Arbeiten in eng begrenzten Parameterbereichen. (orig./RHM)

  7. New epoxide polymers generated by metal organic catalysts (chelates) and their application in composite structures. Pt. 2. Final report; Neue Epoxidpolymere durch Metallorgano-Katalysatoren und ihr Einsatz in Faserverbundstrukturen. T. 2. Abschlussbericht

    Energy Technology Data Exchange (ETDEWEB)

    Merz, T.; Raeckers, B.

    1999-08-01

    Epoxy resins cured by catalysts based on chelate compound can offer an additional potential concerning storage and heat stability, toughness and curing characteristic. To prove these advantages and to prepare a serial application was target of the project, by which physico-chemical investigations, determination of mechanical properties and component tests were used. Besides an improvement of storage time and a minimized curing cycle a satisfactory processing behaviour and mechanical properties approaching currently used aircraft materials became evident. Serial production of fibre reinforced components for automotive industry is basically possible, because all requirements concerning costs, performance and station time were met. The results can also be used for new applications in other technical fields like apparatus construction or sporting goods industry. (orig.) [German] Mittels Metallorganokatalysatoren gehaertete Epoxidharze versprechen gegenueber herkoemmlichen Systemen zusaetzliche Potentiale hinsichtlich Lager- und Waermestabilitaet sowie Zaehigkeit und Haertungscharakteristik. Diese nachzuweisen und eine zukuenftige Serienanwendung vorzubereiten war Ziel des Projektes, wozu physico-chemische Untersuchungen, mechanische Kennwertermittlungen und Bauteilversuche dienten. Neben verbesserter Lagerstabilitaet und minimierten Haertungszyklen konnten gute Verarbeitungseingeschaften und ein Leistungsprofil nachgewiesen werden, das nahe an das heutiger Luftfahrtwerkstoffe heranreicht. Die Serienherstellung von Faserverbundbauteilen im Automobilbau ist prinzipiell moeglich, da durch die entwickelten Katalysatoren alle Vorgaben hinsichtlich Kosten, Leistungsfaehigkeit und Taktzeiten erreicht werden konnten. Hierdurch koennen sich auch fuer andere Bereiche (z.B. Geraetebau, Sportartikelindustrie) neue Anwendungsmoeglichkeiten eroeffnen. (orig.)

  8. Enhancing the dewatering properties of sludge through aimed building-up of floc structures on the basis of detailed morphological analyses; Verbesserung der Entwaesserungseigenschaften von Schlaemmen durch den gezielten Aufbau von Flockenstrukturen auf der Basis detaillierter morphologischer Analysen

    Energy Technology Data Exchange (ETDEWEB)

    Nagel, M.; Ay, P. [Brandenburgische Technische Univ. Cottbus (Germany). Lehrstuhl Aufbereitungstechnik

    1999-07-01

    Aimed building-up of aggregates as they originate in flocculation processes, for instance in sewage and sludge treatment, have especially lately been meeting with increasing resonance: they permit to influence, inter alia, important properties (e.g., the dewatering properties) of such systems. As conventional mathematical methods for the characterization of flocs - as a basis for process optimization - are inadequate or flawed, a concept for the effective characterization of the inner getup of such structures needs to be sought. One approach is cluster analysis, which is demonstrated and discussed in the present paper by means of the evaluation of sectional views of floc structures. (orig.) [German] Der gezielte Aufbau von Aggregaten, wie sie bei Flockungsprozessen z.B. in der Abwasser- und Schlammbehandlung entstehen, findet besonders in juengerer Zeit zunehmend Beachtung, da sich damit unter anderem wichtige Eigenschaften (z.B. die Entwaesserungseigenschaften) dieser Systeme beeinflussen lassen. Da herkoemmliche mathematische Methoden zur Charakterisierung von Flocken - als Basis fuer eine Prozessoptimierung - nur unzureichend bzw. fehlerbehaftet sind, ergibt sich daraus die Notwendigkeit, nach einem Konzept zur effektiven Charakterisierung des inneren Aufbaus solcher Strukturen zu suchen. Ein Ansatz ist die Clusteranalyse, die im Beitrag durch die Auswertung von Schnittbildern von Flockenstrukturen vorgestellt und diskutiert wird. (orig.)

  9. New epoxide polymers generated by metal organic catalysts (chelates) and their application in composite structures. Pt. 1. Final report; Neue Epoxidpolymere durch Metallorgano-Katalysatoren und ihr Einsatz in Faserverbundstrukturen. T. 1. Abschlussbericht

    Energy Technology Data Exchange (ETDEWEB)

    Merz, T.; Raeckers, B.; Boettcher, A.; Haessler, R.; Renner, M.; Schmidtke, K.

    1999-08-01

    Epoxy resins cured by catalysts based on chelate compound can offer an additional potential concerning storage and heat stability, toughness and curing characteristic. To prove these advantages and to prepare a serial application was target of the project, by which physico-chemical investigations, determination of mechanical properties and component tests were used. Besides an improvement of storage time and a minimized curing cycle a satisfactory processing behaviour and mechanical properties approaching currently used aircraft materials became evident. Serial production of fibre reinforced components for automotive industry is basically possible, because all requirements concerning costs, performance and station time were met. The results can also be used for new applications in other technical fields like apparatus construction or sporting goods industry. (orig.) [German] Mittels Metallorganokatalysatoren gehaertete Epoxidharze versprechen gegenueber herkoemmlichen Systemen zusaetzliche Potentiale hinsichtlich Lager- und Waermestabilitaet sowie Zaehigkeit und Haertungscharakteristik. Diese nachzuweisen und eine zukuenftige Serienanwendung vorzubereiten war Ziel des Projektes, wozu physico-chemische Untersuchungen, mechanische Kennwertermittlungen und Bauteilversuche dienten. Neben verbesserter Lagerstabilitaet und minimierten Haertungszyklen konnten gute Verarbeitungseingeschaften und ein Leistungsprofil nachgewiesen werden, das nahe an das heutiger Luftfahrtwerkstoffe heranreicht. Die Serienherstellung von Faserverbundbauteilen im Automobilbau ist prinzipiell moeglich, da durch die entwickelten Katalysatoren alle Vorgaben hinsichtlich Kosten, Leistungsfaehigkeit und Taktzeiten erreicht werden konnten. Hierdurch koennen sich auch fuer andere Bereiche (z.B. Geraetebau, Sportartikelindustrie) neue Anwendungsmoeglichkeiten eroeffnen. (orig.)

  10. Optimisation of the energy potential of low-CO2 gas turbines by using large monocrystal turbine blades. Final report; Optimierung des Energiepotentials fuer CO{sub 2}-arme Gasturbinen durch grosse Einkristall-Turbinenschaufeln. Abschlussbericht

    Energy Technology Data Exchange (ETDEWEB)

    Grossmann, J.

    2002-07-01

    Apart from the experimental identification and assessment of process characteristics during industrial-scale application of the so-called liquid metal cooling (LPC) process, the project focused on the characterisation of monocrystalline, directionally solidified materials and components. This involved the construction and commissioning of appropriate production and test aggregates, i.e. the LMC casting system and a Laue orientation testing unit, as well as the modification of a vacuum heat treatment furnace to meet the specific requirement of glow annealing of monocrystalline, directionally solidified turbine blades. [German] Das Ziel des Forschungsvorhabens (Laufzeit: 01. Juli 1997 bis 31. Dezember 2001) 'Optimierung des Energiepotentials fuer CO{sub 2}-arme Gasturbinen durch grosse Einkristall-Turbinenschaufeln' lag neben der experimentellen Bestimmung und Bewertung von Verfahrens- und Prozesskennwerten bei der industriellen Umsetzung des sogenannten Liquid-Metal-Cooling-Verfahrens (LMC) in der Eigenschaftscharakterisierung von einkristallin-gerichtet erstarrten Proben und Bauteilen, die mittels dieser neuartigen Giesstechnologie dargestellt wurden. Grundvoraussetzung fuer die umfassende Bearbeitung der o.g. Arbeitsinhalte war die Konstruktion und Inbetriebnahme der notwendigen Fertigungs- und Pruefaggregate, d.h. der LMC-Giessanlage und einer Laue-Orientierungspruefeinrichtung bzw. der Abstimmung eines Vakuum-Waermebehandlungsofens auf die spezifischen Anforderungen der Loesungsgluehung einkristallin-gerichtet erstarrter Turbinenlaufschaufeln. (orig.)

  11. Engine 3E. NO{sub x} reduction by means of homogenisation of mixtures inside combustion chambers. Final report; Engine 3E. NO{sub x}-Reduktion durch Homogenisierung des Gemisches in Brennkammern. Abschlussbericht

    Energy Technology Data Exchange (ETDEWEB)

    Zarzalis, N.; Homann; Schubert

    1999-11-05

    This is the final report of the Technology Project 'NO{sub x} reduction by means of homogenisation of mixtures inside combustion chambers', which is part of the Engine 3E 2010 programme of the BMBF, which was to promote research in aircraft engineering. In this project, technologies were developed to achieve a 60% reduction of NO{sub x} emissions as compared to ICAO '95 in an annular combustion chamber in realistic operating conditions where the emissions of substances oher than NO{sub x} were to be of the same level as the emissions of modern jet drives. Further, the design of the new combustion chamber was to be conventional in order to retain the possibility of converting existing propulsion systems to the new technology. [German] Diese Notiz enthaelt den Abschlussbericht des Technologievorhabens 'NO{sub x}-Reduktion durch Homogenisierung des Gemisches in Brennkammern'. Das Vorhaben ist Teil des Luftfahrtfoerderprogramms Engine 3E 2010 der Bundesregierung und wird vom Bundesministerium fuer Bildung, Wissenschaft, Forschung und Technologie (BMBF) unter dem Foerderkennzeichen 20T9540 gefoerdert. Das Programm wurde am 01. Juli 1995 begonnen und endete am 30. Juni 1999. Entsprechend dem Foerderantrag wurden in dem Vorhaben Einzeltechnologien erarbeitet, die erforderlich sind, um eine 60% Reduktion der NO{sub x}-Emissionen gegenueber ICAO '95 in einer Ringbrennkammer unter realistischen Betriebsbedingungen zu demonstrieren, wobei die restlichen Emissionen das Emissionsniveau moderner Triebwerke nicht ueberschreiten sollten. Darueber hinaus sollte das aeussere Design der zu entwickelnden Brennkammer sind von konventionellen Brennkammern nicht unterscheiden, um die Moeglichkeit der Umruestung von alten Triebwerken mit der Brennkammern der neuen Technologie offen zu halten. (orig.)

  12. Reduction of construction cost and carbon dioxide emissions by heat contracting. Obstacles and solutions. Final report; Baukostensenkung und CO{sub 2}-Minderung durch Waerme-Contracting. Hemmnisse und Loesungswege. Abschlussbericht

    Energy Technology Data Exchange (ETDEWEB)

    Ebert, V.; Liebernickel, T.; Froemel, T.; Kues, H.

    2000-11-01

    The poor condition of many heating systems is caused by a conflict of interest between investors and users. Landlords tended to opt for low investment cost, while the accompanying higher consumption cost was paid by their tenants. The only thing that has changed here is the fact that the 'secondary cost' has become a criterion for new tenants' decision to rent an apartment. Heat contracting may be a way out of the problem as contractors are interested in high-efficiency heating systems and optimally controlled operation. Heat contracting is a service concept of private and communal organisations that involves payment, construction and operation of a heating system by the contractor depending on the contracting model used. [German] Die relativ schlechte und veraltete heizungstechnische Ausruestung der Wohngebaeude in Deutschland ist auf den lange Jahre bestehenden Interessenkonflikt zwischen Investor und Nutzer im Mietwohnungsbau zurueckzufuehren. Durch die Umlagefaehigkeit der Heizkosten auf die Nutzer (Mieter) war der Gebaeudeeigentuemer i.d.R. bestrebt, eine Anlage zu guenstigen Investitionskosten zu erwerben. Die daraus resultierenden, relativ hoeheren Verbrauchskosten waren als Betriebskosten auf die Mieter umlegbar und belasteten den Vermieter nicht. An dieser Situation hat sich bis heute prinzipiell nichts geaendert; allerdings sind die Nebenkosten mit der Hauptkostenposition 'Heizkosten' zu einem Kriterium der Vermietbarkeit geworden, so dass der Vermieter heute die Kosten moeglichst niedrig halten muss. Ein Ausweg aus dem Interessenkonflikt und der neuen Vermietsituation koennte das Waerme-Contracting sein. Seitens des Contractors ist der Einsatz hocheffizienter Anlagentechnik und optimale, d.h. ueberwachte Betriebsbedingungen fuer einen wirtschaftlichen Erfolg unabdingbar. Waerme-Contracting ist ein Dienstleistungskonzept von privatwirtschaftlichen und kommunalen Unternehmen, die - je nach Contracting

  13. Stabilization of the cleaning of anaerobic waste water with the aid of activated sludge following receipts of hydrogen peroxide; Stabilisierung der anaeroben Abwasserreinigung durch Belebtschlamm nach Eintrag von Wasserstoffperoxid

    Energy Technology Data Exchange (ETDEWEB)

    Stupperich, E. [Ulm Univ. (Germany). Abt. Angewandte Mikrobiologie; Gerstmeir, R. [Ulm Univ. (Germany). Abt. Angewandte Mikrobiologie; Marqua, J. [Ulm Univ. (Germany). Abt. Angewandte Mikrobiologie; Rothfuss, A. [Ulm Univ. (Germany). Abt. Angewandte Mikrobiologie

    1996-12-31

    Some municipal and industrial sewage treatment plants comprise an aerobic and an anaerobic unit. However, discharge conditions may be such as to cause strong oxidants like hydrogen peroxide (H{sub 2}O{sub 2}) to enter the anaerobic unit. As measurements of the reduction-oxidation potential in an acidification stage showed, small concentrations of H{sub 2}O{sub 2}, already, may cause irreversible damage to the anaerobic bacterial strains living there. Adding activated sludge from the aerobic unit to such a system can prevent the damage. Probably, the enzyme catalase protects the anaerobic system against the oxydizing effect of hydrogen peroxide: this enzyme from aerobic bacteria and optionally aerobic bacteria causes the ecologically compatible decomposition of hydrogen peroxide into water and oxygen, which is substantially less reactive. Optionally aerobic bacteria, which are also added, protect the anaerobic system further by consuming this oxygen. (orig.) [Deutsch] Manche kommunalen und industriellen Klaeranlagen bestehen aus einer Aerobie und einer Anaerobie. Verschiedene Einleitungsbedingungen koennen aber dazu fuehren, dass in die Anaerobie starke Oxidationsmittel wie Wasserstoffperoxid (H{sub 2}O{sub 2}) gelangen. Messungen des Redoxpotentials in einer Versaeuerungsstufe zeigen, dass bereits geringe Konzentrationen an H{sub 2}O{sub 2} die dort lebenden anaeroben Bakterienkulturen irreversibel schaedigen. Wird aber einem solchen System Belebtschlamm aus der Aerobie zudosiert, so kann diese Schaedigung verhindert werden. Wahrscheinlich schuetzt das Enzym Katalase die Anaerobie vor der oxidierenden Wirkung des Wasserstoffperoxids. Dieses Enzym aus aeroben und fakultativ aeroben Bakterien zersetzt naemlich Wasserstoffperoxid oekologisch vertraeglich in Wasser und den bedeutend weniger reaktiven Sauerstoff. Zum Schutz der Anaerobie wird auch dieser Sauerstoff durch die zudosierten fakultativ aeroben Bakterien verbraucht. (orig.)

  14. If science does create more than knowledge. A congress is asking for 'education by science'; Wenn Wissenschaft mehr als Wissen schafft. Ein Kongress fragt nach 'Bildung durch Wissenschaft'

    Energy Technology Data Exchange (ETDEWEB)

    Nuissl, E. (ed.)

    2002-07-01

    The role of science in the development of the so-called 'knowledge society' was investigated at this interdisciplinary congress. Three problem areas were identified: 1. Science itself must constantly review its own ethical fundamentals and investigate and extend its ability to keep a dialogue running. 2. Society is asked to provide an ethical and moral orientation for dealing with newly acquired knowledge and to define the social standing of science. 3. Each and every individual must work on maintaining and extending his or her level of knowledge in order to cope with everyday life and perform social functions. [German] Ziel des Kongresses ''Bildung durch Wissenschaft'' war es, im interdisziplinaeren Austausch die Rolle der Wissenschaft bei der Entwicklung der so genannten ''Wissensgesellschaft'' zu eroertern. Der enorme Wissenszuwachs des vergangenen Jahrhunderts bedeutet eine Zunahme des ''Machbaren'', von dessen positiven wie negativen Folgen die Gesellschaft und der Einzelne gleichermassen betroffen ist. Das gilt gerade fuer diejenigen Technologien und Wissensbestaende, die im Alltag von Bedeutung sind. Der Kongress beschaeftigte sich mit diesen Entwicklungen und mit den Problemen, die sich daraus ergeben. Der erste Problemkreis betrifft die Wissenschaft selbst: Sie muss sich ihrer eigenen ethischen Grundlagen wieder neu vergewissern, ihre Dialogfaehigkeit ueberpruefen und erweitern. Ein zweiter Problemkreis ist auf Seiten der Oeffentlichkeit auszumachen: Die Gesellschaft wird ethische und moralische Orientierungen fuer den Umgang mit dem neu erworbenen Wissen schaffen und grundsaetzlich den gesellschaftlichen Stellenwert der Wissenschaft bestimmen muessen. Der dritte Problemkreis stellt sich dem Einzelnen: Jeder ist gefordert, kontinuierlich sein Wissensniveau zu erhalten und zu erweitern, um den Alltag bewaeltigen und gesellschaftliche Aufgaben wahrnehmen zu koennen. (orig.)

  15. Characteristics of purple nonsulfur bacteria grown under Stevia residue extractions.

    Science.gov (United States)

    Xu, J; Feng, Y; Wang, Y; Lin, X

    2013-11-01

    As a consequence of the large-scale cultivation of Stevia plants, releases of plant residues, the byproduct after sweetener extraction, to the environment are inevitable. Stevia residue and its effluent after batching up contain large amounts of organic matters with small molecular weight, which therefore are a potential pollution source. Meanwhile, they are favourite substrates for micro-organism growths. This investigation was aimed to utilize the simulated effluent of Stevia residue to enrich the representative purple nonsulfur bacterium (PNSB), Rhodopseudomonas palustris (Rps. palustris), which has important economic values. The growth profile and quality of Rps. palustris were characterized by spectrophotometry, compared to those grown in common PNSB mineral synthetic medium. Our results revealed that the simulated effluent of Stevia residue not only stimulated Rps. palustris growth to a greater extent, but also increased its physiologically active cytochrome concentrations and excreted indole-3-acetic acid (IAA) content. This variation in phenotype of Rps. palustris could result from the shift in its genotype, further revealed by the repetitive sequence-based PCR (rep-PCR) fingerprinting analysis. Our results showed that the effluent of Stevia residue was a promising substrate for microbial growth. © 2013 The Society for Applied Microbiology.

  16. Optimised utilisation of existing incinerators by installation of upstream reactors for treatment of waste with high calorifica value - HYBRID waste treatment plants; Optimierte Nutzung bestehender Abfallverbrennungsanlagen durch Errichtung vorgeschalteter Reaktoren zur Behandlung heizwertreicher Abfaelle - HYBRID-Abfallbehandlungsanlagen

    Energy Technology Data Exchange (ETDEWEB)

    El Labani, M

    2000-07-01

    Abfallverbrennungsanlagen nachtraeglich um leistungsfaehige Rauchgasreinigungssysteme ergaenzt werden. Dies fuehrte zu einem erheblichen Anstieg der Kosten und Behandlungsgebuehren mit dem entsprechenden Druck zur optimierten Nutzung. Zusaetzliche Behandlungskapazitaeten werden benoetigt fuer heizwertreiche Abfaelle. Sie koennen zwar in konventionellen Abfallverbrennungsanlagen fuer Hausmuell behandelt werden, bedingen aber aufgrund des hoeheren Heizwertes eine Durchsatzreduzierung was die Kostensituation weiter negativ beeinflusst. Daher favorisieren aktuelle Konzepte die Behandlung heizwertreicher Abfaelle in spezifischen, dezentralen Anlagen. Die ueblicherweise kleinen Anlagen gehen einher mit hohen Nebenkosten der Errichtung. Zur Abschaetzung des Optimierungspotentials bestehender Abfallverbrennungsanlagen wurde deren Auslastungssituation untersucht. Bei umfangreichen Messkampagnen am MHKW Darmstadt konnte selbst bei 100%iger Auslastung der Verbrennungseinheit in der Rauchgasreinigungsanlage eine Luecke aufgezeigt werden, die durch eine entsprechend angepasste Vorschaltanlage aufgefuellt werden koennte. Eine solche Vorschaltanlage definiert zusammen mit der bestehenden Abfallverbrennungsanlage eine HYBRID-Abfallbehandlungsanlage. Die Bereitstellung eines Instrumentariums zur Unterstuetzung der Entscheidungsfindung bei der Konzeption solcher Anlagen ist Gegenstand dieser Arbeit. (orig.)

  17. Durch Kooperation und Vernetzung zu neuen Aufgabenfeldern – Serviceentwicklung in der Bibliothek der Medizinischen Fakultät Mannheim [Opening up new tasks through cooperation and networking – service development in the Library for the Medical Faculty of Mannheim

    Directory of Open Access Journals (Sweden)

    Semmler-Schmetz, Martina

    2013-09-01

    Full Text Available [english] The Library for the Medical Faculty of Mannheim of the University of Heidelberg supplies literature and information for research, teaching and further education purposes at the “Universitätsmedizin Mannheim”. Cooperation and networking with the central facilities, departments, working groups, and information multipliers result in new, future-oriented areas of work that go beyond traditional library tasks. New services for students focus primarily on academic research and writing skills, while information and consulting services which are flexible in terms of time and location are being developed for staff members of the clinical departments and institutes. The recent cooperation with actors in the field of evidence-based medicine has yielded the innovative service “systematic literature search” which is designed to support doctors and scientists in the preparation of grant proposals for clinical trials, systematic reviews, and guidelines. Currently, the library is widening access to its new services to include doctors, scientists, and other health practitioners in the region, and evaluating chargeable services for these user groups.[german] Die Bibliothek der Medizinischen Fakultät Mannheim der Universität Heidelberg dient der Literatur- und Informationsversorgung für Forschung, Lehre, Fort- und Weiterbildung an der Universitätsmedizin Mannheim. Neue, zukunftsorientierte Aufgabenfelder, die über die klassischen bibliothekarischen Arbeitsschwerpunkte hinausgehen, erschließt sich die Bibliothek durch enge Kooperation und Vernetzung mit den zentralen Einrichtungen und Abteilungen, Arbeitskreisen und Multiplikatoren innerhalb der Universitätsmedizin Mannheim. Neue Services für die Zielgruppe der Studierenden richten sich vor allem auf den Bereich des wissenschaftlichen Arbeitens, während für Mitarbeiter in den Einrichtungen, Kliniken und Instituten der Universitätsmedizin zeitlich und räumlich flexible Informations

  18. Identification and growth conditions of purple non-sulfur photosynthetic bacteria isolated from palm oil mill effluent

    International Nuclear Information System (INIS)

    Radziah Ariffin

    2004-01-01

    An indigenous strain of the purple non-sulphur photosynthetic bacterium, isolated from palm oil mill effluent was presumably identified as species of Rhodopseudomonas palustris. Cultivation in synthetic medium under different conditions indicated that it gave maximum carotenoid and bacteriophyll synthesis under anaerobic conditions in the light with values of 12.6 and 108.1 mg/g dry cell weight respectively. These values were significantly higher than the pigment content obtained from aerobic cultivation. The specific growth rates in anaerobic was twice those in aerobic conditions in the light. Growth was not occurred in anaerobic or aerobic conditions in the dark. (Author)

  19. Internationale Wachstumsstrategien produzierender Familienunternehmen durch Mergers & Acquisitions

    NARCIS (Netherlands)

    Sachs, Andreas Fabian Constantin Johannes

    2007-01-01

    Family businesses are experiencing a revival in the German economy. In the face of the challenges of globalization and the ongoing relocation of production facilities, “home base oriented” enterprises meet with increasing attention and gain in importance. Family-owned enterprises have indeed been

  20. Wolframcarbid/Silber-Kontaktwerkstoffe durch Gasdruckinfiltration

    OpenAIRE

    Stadler, Thomas

    2017-01-01

    von Thomas Stadler Arbeit an der Bibliothek noch nicht eingelangt - Daten nicht geprueft Abweichender Titel nach Übersetzung der Verfasserin/des Verfassers Technische Universität Wien, Univ., Diplomarbeit, 2017

  1. Erkenntnisgewinnn durch Virtuelle Realitäten

    Directory of Open Access Journals (Sweden)

    Breiner, Tobias

    2009-11-01

    Full Text Available Virtual reality will gain a more and more important role in our everyday life. So it is very important to understand fully the impact and influence virtual reality will have on or view of the world. This article reveals that the interdependencies between the real space and the virtual space are much more subtle and profound then on first sight. Especially the value of several mathematical, physical and biological models and simulation methodologies will be reestimated by the use of virtual reality in the long term. As an example the article describes the historical chain from quaternions to quaoaring and how this may lead to a paradigm change in biology.

  2. Safety by simulation; Sicherheit durch Simulation

    Energy Technology Data Exchange (ETDEWEB)

    Hoffmann, Eberhard [KSG Kraftwerks-Simulator-Gesellschaft mbH, Essen (Germany); GfS Gesellschaft fuer Simulatorschulung mbH, Essen (Germany)

    2009-06-15

    Simulator training is a key component in achieving and preserving on the long term the necessary expertise of plant personnel also required by the authorities. In this way, it makes an important contribution to the safe operation of nuclear power plants. Simulators are a component in the training of operating personnel of nuclear power plants which allows nuclear power plant operators to be prepared in a focused and practice-oriented way for their activity in everyday plant operation and for possible accident simulation. The simulator center is supported by 5 nuclear power plant operators: the German E.ON Kernkraft GmbH, RWE Power AG, EnBW Kraftwerke AG, and Vattenfall Europe Nuclear Energy GmbH companies as well as the Netherlands N.V. Electriciteits-Produktiemaatschappij Zuid-Nederland. They established a joint enterprise in Essen which performs in one central place the duty of simulator training incumbent upon all nuclear power plants. (orig.)

  3. Health injuries by noise; Gesundheitsgefahren durch Laerm

    Energy Technology Data Exchange (ETDEWEB)

    Plath, P [Klinik fuer Hals-Nasen-Ohren-Heilkunde, Kopf- und Hals-Chirurgie, Bochum Univ., Prosper-Hospital, Recklinghausen (Germany)

    1995-07-01

    Within the civilized world, noise is a common danger for health. There is not only the well known hearing loss by occupational noise, but there are also a lot of noise induced hearing losses by noise injuries in private life which are comparable to the occupational ones. The sources of these injuries within private life mostly are unknown and can be found in household goods as well as from listening to loud music. Also the danger from loud cracks mostly is underestimated, so as the cracks from children toys often reach more than 150 dB(Al). Alladay`s noise levels, e.g. in public trafic, also reach dangerous levels, and the sum of all these noise injuries results in a lesion of the cilias of the outer hair cells in the Corti`s organ. The resulting hearing loss is called `sociacusis` and increases the effect of physiological presbyacusis to an amount that results in the fact, that more than 10% of all adults in civilized countries have a severe, handicapping deafness. The immediate effect of noise in this regard is intensified by the effects of disturbing noise onto the psychovegetative and hormonal regulations by chronical stress. So people in civilized countries are going to become a society of hard hearing subjects, and deafness will become a common peoples` disease. (orig.) [Deutsch] Laerm ist in der zivilisierten Welt ein allgemeines Gesundheitsproblem. Es gibt nicht nur die berufliche Laermschwerhoerigkeit, die gut erforscht ist, sondern schaedlicher Laerm tritt sehr oft auch im Privatleben auf und verursacht Gehoerschaeden, die der beruflich bedingten Laermschwerhoerigkeit vergleichbar sind. Die Gehoergefaehrdung im Privatleben ist oft unbekannt und betrifft neben lauten Geraeten im Haushalt und dem Hoeren zu lauter Musik auch die oft in ihrer Gefaehrlichkeit unterschaetzten Knalle, die selbst bei Kinderspielzeug Spitzenwerte der Pegel von ueber 150 dB(Al) erreichen. Die allgemeine zivilisatorische Laermbelastung, z.B. im oeffentlichen Verkehr, die oft schaedigende Ausmasse erreicht, im Beurteilungspegel aber unter den Grenzwerten bleibt, bewirkt im Laufe der Jahre ebenfalls bleibende Schaeden an der Zilien der aeusseren Haarzellen des Corti-Organs, die eine ueber die physiologische Alterung hinausgehende `Soziakusis` bewirken. Schliesslich haben die staendigen Geraeusch- und Laermbelaestigungen und -stoerungen des Alltagslebens deutliche Effekte auf die neurovegetativen und hormonellen Regulationen des Organismus und verursachen somit mittelbar ueber Stressreaktionen ebenfalls Hoerstoerungen in Form von Hoerstuerzen und Tinnitus. Der alltaegliche Laerm, dem zu wenig Bedeutung zugemessen wird, droht Schwerhoerigkeit, von der mehr als 10% aller Erwachsenen betroffen sind, zur Volkskrankheit werden zu lassen. (orig.)

  4. "Fine-tuning" durch interkulturelles Coaching

    OpenAIRE

    Steixner, Margret

    2009-01-01

    Margret Steixner plädiert in ihrem Beitrag für eine Integration des interkulturellen Coachings in andere Bereiche des Coachings. Basierend auf einer Coaching-Fallstudie entwickelt die Autorin einen hilfreichen Fragenkatalog für das interkulturelle Coaching. Intercultural Coaching identifies and develops intercultural competence as a key to success in the international and globalised work environment. Coaching in general has gained recognition as a very suitable method for competence develo...

  5. Carbon Dynamics of Pinus palustris Ecosystems Following Drought

    Directory of Open Access Journals (Sweden)

    Gregory Starr

    2016-04-01

    Full Text Available Drought can affect forest structure and function at various spatial and temporal scales. Forest response and recovery from drought may be a result of position within landscape. Longleaf pine forests in the United States have been observed to reduce their carbon sequestration capacity during drought. We collected eddy covariance data at the ends of an edaphic longleaf pine gradient (xeric and mesic sites over seven years; two years of normal rainfall were followed by 2.5 years of drought, then 2.5 years of normal or slightly above-average rainfall. Drought played a significant role in reducing the physiological capacity of the sites and was compounded when prescribed fire occurred during the same periods. The mesic site has a 40% greater basal area then the xeric site, which accounts for its larger sequestration capacity; however, both sites show the same range of variance in fluxes over the course of the study. Following drought, both sites became carbon sinks. However, the xeric site had a longer carry-over effect and never returned to pre-drought function. Although this study encompassed seven years, we argue that longer studies with greater spatial variance must be undertaken to develop a more comprehensive understanding of forest response to changing climate.

  6. Adiciones a las haloragaceae de Colombia: Proserpinaca palustris

    Directory of Open Access Journals (Sweden)

    Schmidt Mumm Udo

    2000-07-01

    Full Text Available Las especies colombianas de la familia Haloragaceae se han asignado a dos subfamilias y tres géneros. Según Mora-Osejo (1984, quién comparte la opinión de Schindler (1905 en incluir el género Gunnera L. en la sub familia terrestre Gunneroideae, la sub familia Haloragoideae distingue las plantas acuáticas y semiacuáticas de tallos herbáceos, raras veces subleñosos, hojas opuestas o verticiladas e inflorescencias terminales. Inicialmente se designaron dos especies del género Myriophyllum L. a esta subfamilia y poco después se señaló también el hallazgo del género Laurembergia Berg. (Mora-Osejo et al. 1988. En la actualidad, sin embargo, se ha generalizado la tendencia a considerar el género Gunnera separadamente en la familia Gunneraceae (Cronquist 1988, L. E. Mora-Osejo, como pers., con lo cual las Haloragaceae de Colombia se encuentran representadas por tres especies de los géneros Myriophyllum y Laurembergia.

  7. Adiciones a las haloragaceae de Colombia: Proserpinaca palustris

    OpenAIRE

    Schmidt Mumm Udo; Posada José Andrés

    2000-01-01

    Las especies colombianas de la familia Haloragaceae se han asignado a dos subfamilias y tres géneros. Según Mora-Osejo (1984), quién comparte la opinión de Schindler (1905) en incluir el género Gunnera L. en la sub familia terrestre Gunneroideae, la sub familia Haloragoideae distingue las plantas acuáticas y semiacuáticas de tallos herbáceos, raras veces subleñosos, hojas opuestas o verticiladas e inflorescencias terminales. Inicialmente se designaron dos especies del género Myriophyllum L. a...

  8. „Wir verbrachten mehr als 24 Stunden, ohne etwas anderes als Schokolade und Limonade zu uns zu nehmen“. Hinweise in Alexander von Humboldts Tagebuchaufzeichnungen zu Fragen der Verpflegung auf der Forschungsreise durch Spanisch-Amerika

    Directory of Open Access Journals (Sweden)

    Ursula Thiemer-Sachse

    2013-12-01

    Full Text Available Zusammenfassung In Alexander von Humboldts Tagebüchern seiner berühmten Forschungsreise durch Spanisch-Amerika finden sich Bemerkungen und Hinweise für künftige Leser seiner Reisedarstellungen zu Problemen der Verpflegung. Zumeist werden Engpässe und Missstände erwähnt sowie Fragen soziopolitischer Situation verdeutlicht. Sie beziehen sich auf Extrembedingungen in stadtfernen Gebieten und im Kontakt mit den indigenen Trägern und Helfern während der einzelnen Exkursionen. Die Darstellungen der alltäglichen Gegebenheiten sind zugleich eine interessante Quelle für Verhaltensmuster der verschiedenen Schichten der spanischkolonialen Gesellschaft wie der Forschungsreisenden, die mit den Schwierigkeiten umzugehen hatten, sich anzupassen verstanden oder ihre eigenen Verhaltensmuster entwickelt haben. Damit ermöglichen Humboldts Aufzeichnungen zugleich auch auf diesem Gebiet manchen Blick auf den seither erfolgten Kulturwandel. Resumen En los diarios del famoso viaje de estudios de Alejandro de Humboldt por la América española se encuentran observaciones y notas sobre problemas de aprovisionamiento, en favor de lectores futuros de sus relaciones de viaje. En la mayoría de los casos Humboldt menciona situaciones precarias o ilustra cuestiones de carácter sociopolítico. Frecuentemente, sus apuntes se refieren a condiciones extremas en regiones remotas y en contacto con los cargadores y ayudantes indígenas durante las diferentes excursiones. Las descripciones de los acontecimientos cotidianos al mismo tiempo son una fuente interesante sobre los modos de proceder de las diferentes capas de la sociedad colonial española así como de los viajeros científicos que tuvieron que enfrentar dificultades a las cuales había que adaptarse o desarrollar modelos propios de comportamiento. Por esto al mismo tiempo las noticias de Humboldt también en este asunto posibilitan más de una vez la atención al cambio cultural que se ha realizado hasta hoy

  9. Der Einfluss von Anonymität in der Lehrevaluation durch Studierende [The Effects of Anonymity on Student Ratings of Teaching and Course Quality in a Bachelor Degree Programme

    Directory of Open Access Journals (Sweden)

    Schaffner, Noemi

    2013-08-01

    is being taken seriously; consequently, they feel able to provide a constructive and honest evaluation.[german] Zielsetzung und Fragestellung: Unterscheiden sich die Ergebnisse anonymisierter und personalisierter Evaluationen? Methodik: Während zweier Jahre wurden bei jeder Modulevaluation alle Studierenden randomisiert den Halbgruppen „anonym“ und „personalisiert“ zugeteilt. Die Qualität des Moduls in seinen relevanten Aspekten wurde mit einem standardisierten Fragebogen erhoben. Zusätzlich konnten optionale Textantworten formuliert werden. Drei unabhängige Personen bewerteten die Aussagequalität der Antworten gemäss einem Leitfaden. Dieser beinhaltete die fünf Dimensionen positiv-negativ, differenziert-absolut, Nennung einer Person-allgemein, Befehl enthaltend-neutral und optisch akzentuiert-blank. Der Datensatz bestand aus 615 Fragebogen, davon waren 306 in anonymer Form. Mit einer multivariaten Varianzanalyse wurde überprüft, ob sich zwischen anonym und personalisiert erhobenen Daten ein Unterschied sowohl bei den durch Skalen bewerteten Aspekten als auch bei der Qualität der optionalen Textantworten zeigte. Zusätzlich wurde untersucht, ob sich die Häufigkeit der optionalen Textantworten unterschied.Ergebnisse: In der Aussagequalität liess sich kein signifikanter Unterschied zwischen anonym und personalisiert erhobenen Daten nachweisen. Hingegen haben Studierende aus der personalisierten Gruppe tendenziell häufiger optionale Textantworten geliefert.Schlussfolgerung: Personalisierte Evaluationen generieren dann keine verfälschten Resultate im Sinne der sozialen Erwünschtheit, wenn der Evaluationszirkel geschlossen und transparent ist: Die Verantwortlichen melden den Studierenden die Evaluationsergebnisse konsequent zurück und Änderungs-, Optimierungswünsche und Umsetzungsmöglichkeiten werden mit ihnen diskutiert. Die Studierenden erfahren so, dass ihre Rückmeldungen ernst genommen werden. So können sie sich echte Kritik erlauben.

  10. Parameters for characterisation of the ecochemical soil status and the potential hazards of acidification and nitrogen saturation in level II forest sites; Kennwerte zur Charakterisierung des oekochemischen Bodenzustandes und des Gefaehrdungspotentials durch Bodenversauerung und Stickstoffsaettigung an Level II-Waldoekosystem-Dauerbeobachtungsflaechen

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    2000-07-01

    The ad hoc working group on soil acidification and nitrogen saturation of the Federal Government/Laender Working Group level II primarily aimed at drafting a manual for the interpretation of soil data (soil solid phase, soil solution) acquired on Level II plots. The manual contains parameters and proposals for evaluating the acid/base-status of forest soils, the nutrient supply and nitrogen status as well as for assessing the risks caused by aluminium, acid and heavy metal stress. Further parameters and proposals for evaluation concern the risks for spring and ground water quality through acidification and elevated nitrate concentrations. All parameters are described in detail, their informative value is discussed and examples are given for their use. A distinction is made between indicators to show the current ecochemical situation and to describe future risks, e.g. through progressive soil acidification, nutrient depletion and increasing nitrogen saturation. The manual thus fits in right with the overall objectives of the Level II Programme to reveal cause-effect relations in the forest damage situation and to give advice on timely counteraction via forecasts of the future development. (orig.) [German] Das vorrangige Ziel des Arbeitskreises 'Bodenversauerung und Stickstoffsaettigung' der Bundes-Laender-Arbeitsgruppe Level II war die Erarbeitung eines Auswerteleitfadens fuer die Bodendaten (Bodenfestphase, Sickerwasser) der Level II-Flaechen. Der Leitfaden enthaelt Kennwerte und Bewertungsvorschlaege zum Saeure-Base-Zustand des Waldbodens, zur Naehrstoffbereitstellung, zum Stickstoffstatus, zur Abschaetzung von Risiken durch Aluminium-, Saeure- und Schwermetallstress und zur Gefaehrdung des Quell- und Grundwassers durch Versauerung und steigende Nitratgehalte. Alle Kennwerte werden eingehend beschrieben, ihre Aussagekraft diskutiert und ihre Anwendung an Beispielen dargestellt. Unterschieden wird zwischen Indikatoren zur Darstellung der aktuellen

  11. Reduction of {sup 137}caesium contamination in wild boars by supplementing offered food with ammonium-iron-hexa-cyanoferrate; Reduktion der {sup 137}Caesium-Aktivitaet in Wildschweinen durch Zusatz von Ammonium-Eisen-Hexacyanoferrat (''Berliner Blau'') zum Kirrfutter

    Energy Technology Data Exchange (ETDEWEB)

    Morfeld, P. [Evonik Industries AG, Essen (Germany). Inst. fuer Epidemiologie und Risikobewertung in der Arbeitswelt (IERA); Koeln Univ. (Germany). Inst. und Poliklinik fuer Arbeitsmedizin, Umweltmedizin und Praeventionsforschung; Reddemann, J.; Schungel, P. [Landesjagdverband Bayern e.V., Feldkirchen (Germany); Kienzle, E. [Muenchen Univ., Oberschleissheim (Germany). Lehrstuhl fuer Tierernaehrung und Diaetetik

    2014-06-15

    This replication study investigated whether the {sup 137}caesium ({sup 137}Cs) contamination of wild boars could be relevantly reduced under field conditions by adding ammonium-iron-hexa-cyanoferrate (AFCF; Prussian blue) to the food. In 285 wild boars that had been shot in six Bavarian hunting territories during the season (November until May) between 01 November 2010 and 10 December 2011 {sup 137}Cs contamination was analysed. Thirty-five animals originated from two hunting territories in which offered food had been supplemented with 1250 mg AFCF per kilogram food. The control animals showed a mean {sup 137}Cs contamination of 522 Bq/kg lean skeletal muscle meat. Direct (univariable) comparisons of the two experimental territories with the four control territories yielded a mean reduction in {sup 137}Cs contamination due to Prussian bluefeeding by -211 Bq/kg (p < 0.001). Multivariable mo dels that took potential confounders into account (age, weight, sex, hunting date, territory) estimated the effect to be -344 Bq/kg (p < 0.05). This replication study confirmed the finding of Kienzle et al. (12) who described a statistically significant reduction in {sup 137}Cs contamination by -380 Bq/kg due to the feeding of Prussian blue in other territories. [German] Gegenstand und Ziel: Diese Replikationsstudie pruefte, ob unter Feldbedingungen die Kontamination von Wildschweinen mit {sup 137}Caesium ({sup 137}Cs) durch Zugabe vn Ammonium-Eisen-Hexacyanoferrat (AFCF, ''Berliner Blau'') zum ausgelegten Futter relevant verringert werden kann. Material und Methoden: Bei 285 Wildschweinen, die zwischen dem 01.11.2010 und dem 10.12.2011 waehrend der Jagdsaison (November bis Mai) in sechs bayerischen Jagdrevieren erlegt worden waren, erfolgte eine Analyse der {sup 137}Cs-Aktivitaet. Von diesen Tieren stammten 35 aus zwei Revieren, in denen das ausgelegte Futter mit 1250 mg AFCF/kg Futter supplementiert worden war. Ergebnisse: Die Kontrolltiere wiesen eine

  12. The bioenergy village - preconditions and consequences of autonomous heat and power supply on the basis of biomass for agricultrue, ecology and lifestyle in rural regions. Final report phase I; Das Bioenergiedorf - Voraussetzungen und Folgen einer eigenstaendigen Waerme- und Stromversorgung durch Biomasse fuer Landwirtschaft, Oekologie und Lebenskultur im laendlichen Raum. Endbericht Phase I

    Energy Technology Data Exchange (ETDEWEB)

    Ruppert, H.; Ahl, C.; Girschner, W.; Krumbein, W.; Marggraf, R.; Scheffer, K.; Schmuck, P. (eds.)

    2003-07-01

    With support from the Federal Minister of Consumer Protection, Nutrition and Agriculture through the Fachagentur Nachwachsende Rohstoffe e.V. (Renewable Fuels Agency), a project group of Goettingen University was able to demonstrate how complete conversion to biomass of heat and power supply can be achieved for a whole village with maximum social acceptance, environmental compatibility, and economic and technical efficiency. This and further projects will provide flexible, generally applicable concepts for wider use and are expected to give new impetus to bioenergy and help reduce CO2 emissions. This documentation presents the results of the first project phase, which lasted from October 2000 through November 2002. After describing the criteria for which the model village was selected, the work carried out by the various scientific disciplines cooperating in the project (environmental geoscience, crop research, soil research, agricultural economy, psychology, sociology and political science) is described, and the current project status is outlined. (orig.) [German] Mit Unterstuetzung des Bundesministeriums fuer Verbraucherschutz, Ernaehrung und Landwirtschaft durch die Fachagentur Nachwachsende Rohstoffe e.V. konnte die Projektgruppe der Universitaet damit beginnen, beispielhaft in einem Dorf zu demonstrieren, wie eine komplette Umstellung der Strom- und Waermeversorgung auf den Energietraeger Biomasse sozial, umweltvertraeglich, wirtschaftlich und technisch erfolgen kann. Auf der Basis dieser konkreten Umstellugsarbeiten und Erfahrungen aus anderen aehnlichen Projekten sollen uebertragbare, flexible Konzepte erarbeitet werden, die der Nutzung der Bioenergie einen deutlichen Auftrieb geben und dadurch auch erhebliche Kohlendioxid-Einsparpotentiale erschliessen koennen. In dieser Dokumentation sind die Ergebnisse der ersten Phase des Projektes 'Das Bioenergiedorf' vom Oktober 2000 bis November 2002 niedergelegt. Es wird zunaechst in einem Ueberblick

  13. German RPV safety assessment. Underpinning of the procedure by complementary test results measured in the hot cells; Der deutsche RDB-Sicherheitsnachweis. Untermauerung der Vorgehensweise durch ergaenzende Kennwertermittlung in den Heissen Zellen

    Energy Technology Data Exchange (ETDEWEB)

    Keim, Elisabeth; Hein, Hieronymus; Gundermann, Arnulf [AREVA NP GmbH (Germany); Hoffmann, Harald [VGB (Germany); Koenig, Guenter; Ilg, Ulf [EnBW (Germany); Nagel, Gerhard [e-on Kernkraft (Germany); Widera, Martin [RWE (Germany); Rebsamen, Daniel [KKW Goesgen (Germany)

    2008-07-01

    , um beide Konzepte miteinander vergleichen zu koennen. Die Auswertung der generierten Datenbasis fuehrte zu folgenden wesentlichen Ergebnissen des Vorhabens: -Die ''lower bound'' ASME K{sub Ic}-Kurve fuer Rissinitiierung (Sprodbruchversagen) konnte durch die gemessenen Bruchzaehigkeitswerte fuer den bestrahlten Werkstoffzustand bestaetigt werden. -Der signifikante Einfluss der Legierungselemente Kupfer und Nickel auf das Bestrahlungsverhalten von RDB-Werkstoffen wurde mit beiden Konzepten bestaetigt. -Die Uebergangstemperaturverschiebungen beider Konzepte {delta}T{sub 41} und {delta}T{sub 0} korrelieren relativ gut miteinander. -Bruchmechanikproben vom Typ SE(B) 10 mm x 10 mm sind fuer die T{sub 0}-Bestimmung geeignet und ergeben tendenziell etwas niedrigere T{sub 0}-Werte als Kompakt-Proben. -Die gemessenen Crack Arrest Zaehigkeitswerte werden weitestgehend von der ''lower bound'' ASME K{sub Ia}-Kurve eingehuellt. (orig.)

  14. Reduction of radiation exposure in PET examinations by data acquisition in the 3D mode; Reduktion der Strahlenexposition bei PET-Untersuchungen durch Datenakquisition im 3D-Modus

    Energy Technology Data Exchange (ETDEWEB)

    Brix, G. [Bundesamt fuer Strahlenschutz, Neuherberg (Germany). Inst. fuer Strahlenhygiene]|[Deutsches Krebsforschungszentrum (DKFZ), Heidelberg (Germany). Forschungsschwerpunkt Radiologische Diagnostik und Therapie; Adam, L.E. [Department of Radiology, Philadelphia, PA (United States). Div. of Nuclear Medicine; Zaers, J.; Trojan, H.; Doll, J. [Deutsches Krebsforschungszentrum (DKFZ), Heidelberg (Germany). Forschungsschwerpunkt Radiologische Diagnostik und Therapie; Bellemann, M.E. [Deutsches Krebsforschungszentrum (DKFZ), Heidelberg (Germany). Forschungsschwerpunkt Radiologische Diagnostik und Therapie]|[Fachhochschule Jena (Germany). Fachbereich Medizintechnik; Nosske, D. [Bundesamt fuer Strahlenschutz, Neuherberg (Germany). Inst. fuer Strahlenhygiene

    1999-04-01

    , auf die abschirmende Wirkung von Septen zwischen den einzelnen Detektorringen (2D-Modus) zu verzichten, so dass auch koinzidente Ereignisse zwischen Detektoren auf weiter entfernt liegenden Ringen erfasst werden koennen (3D-Modus). Ziel der vorliegenden Arbeit war es, das Zaehlratenverhalten eines PET-Scanners der neuesten Generation im 2D- und im 3D-Modus anhand von Phantommessungen zu untersuchen und die sich daraus ergebenden Konsequenzen fuer die Strahlenhygiene bei PET-Untersuchungen mit 2-[F-18]-Fluor-2-Desoxyglukose (F-18-FDG) zu diskutieren. Methoden: Alle Messungen wurden am Ganzkoerper-PET-System ECAT EXACT HR{sup +} durchgefuehrt. Fuer die 2D-Messungen wurde ein Kollimator aus duennen Wolframlamellen in das Gesichtsfeld eingebracht. Das Zaehlratenverhalten des Scanners wurde dem NEMA-Protokoll folgend ueber einen weiten Bereich von F-18-Aktivitaetskonzentrationen untersucht. Darueber hinaus wurden PET-Aufnahmen des EEC-Ganzkoerperphantoms mit verschiedenen Einsaetzen im 2D- und im 3D-Modus jeweils ueber 15 min akquiriert, wobei die F-18-Aktivitaetskonzentrationen bei der 3D-Messung halb so hoch waren wie bei der 2D-Messung. Ergebnisse: Fuer das zylinderfoermige NEMA-Phantom (Durchmesser=19,4 cm, Laenge=19,0 cm) ergab sich im 3D-Modus eine im Vergleich zur 2D-Akquisition etwa fuenffach hoehere Systemsensitivitaet (27,7 statt 5,7 cps/Bq/ml). Die Auswertung der rekonstruierten Aktivitaetsverteilungen des EEC-Phantoms ergab, dass die Qualitaet der aus dem 3D-Projektionsdatensatz berechneten PET-Aufnahmen besser war als die der korrespondierenden 2D-Aufnahmen, obwohl die Aktivitaetskonzentrationen nur halb so hoch waren. Schlussfolgerungen: Durch die Datenakquisition im 3D-Modus kann die zu applizierende Aktivitaetsmenge bei gleichzeitiger Verbesserung der Bildqualitaet erheblich reduziert werden. Fuer Patientenuntersuchungen mit F-18-FDG im Ganzkoerperbereich reicht es unserer Erfahrung nach aus, eine Aktivitaet zwischen 150 und 200 MBq zu applizieren. Dies

  15. Design criteria for crankshafts - axial slide bearing in Otto and diesel engines by means of computer-based simulations and experimental investigations. Axial slide bearing design - final report; Auslegungskriterien fuer Kurbelwellen - Axialgleitlager in Otto- und Dieselmotoren durch rechnergestuetzte Simulation und experimentelle Untersuchungen. Axialgleitlagerauslegung - Abschlussbericht

    Energy Technology Data Exchange (ETDEWEB)

    Backhaus, K. [Univ. GH Kassel (Germany). Inst. fuer Maschinenelemente und Konstruktionstechnik; Hunsicker, W. [Fachhochschule Mannheim (Germany). Inst. fuer Tribologie; Schubert, W. [KS Gleitlager GmbH, St. Leon-Rot (Germany)

    2003-07-01

    In the frame of this research project a simulation program has been developed in order to investigate suspension pressure build-up in crankshaft axial bearings taking into account mixed friction conditions. The investigated system is performing in a dynamic way taking into account the engine dynamics. Based upon the high engineering state of radial slide bearings, axial bearings as well as conical slide faces with any conical angle can be simulated in the same way. The solid body contact share in the system to be investigated is taken into account by the integral effect of the real microscopic surface structure on microhydrodynamics and contact pressure build-up. The influence of individual parameters, as e.g. macro-geometric bearing surface design can be investigated by means of simulation results. Wavy stopping faces and bearing surfaces with Rayleigh-steps are characterised by high hydrodynamic supporting pressure magnitudes in terms of macrogeometry. Elasto-hydrodynamic investigations at one stop collar and under engine-specific load on stop disks of a base bearing show the influence of structure elasticity and prove the necessity to consider them when the individual systems are analysed. (orig.) [German] Im Rahmen des durchgefuehrten Forschungsvorhabens wurde ein Simulationsprogramm zur Untersuchung des Tragdruckaufbaus in Kurbelwellen-Axiallagern unter Beruecksichtigung von Mischreibungszustaenden entwickelt. Das untersuchte System verhaelt sich dabei unter Beruecksichtigung der Motordynamik dynamisch. Ausgehend von dem hohen Entwicklungsstand von Radialgleitlagern koennen Axiallager sowie kegelfoermige Gleitflaechen mit beliebigen Kegelwinkeln in gleicher Weise simuliert werden. Dem hohen Festkoerperkontaktanteil in dem zu untersuchenden System wird durch die Beruecksichtigung der integralen Wirkung der realen mikroskopischen Oberflaechenstruktur auf Mikrohydrodynamik und Kontaktdruckaufbau Rechnung getragen. Anhand von Simulationsergebnissen kann der

  16. Risks and opportunities of the liberalized electricity market. Partial project: BoFiT, an integrated decision support system for retaining the competitiveness of the cogeneration technology. Final report; Risiken und Chancen des liberalisierten Strommarktes. Teilprojekt: Integrierte Entscheidungsunterstuetzung durch BoFiT zur Erhaltung der Wettbewerbsfaehigkeit der Kraft-Waerme-Kopplung. Abschlussbericht

    Energy Technology Data Exchange (ETDEWEB)

    Stock, G.; Scheidt, M.

    2002-06-04

    The energy management system called BoFiT and specific new applications are explained which have been developed as one project task of the coordinated research project sponsored by the German ministry of economics,(BMWi), entitled ''Risks and opportunities of the liberalized electricity market''. The major objective of the project is: Finding efficient strategies to ensure the competitiveness of the cogeneration technology in the deregulated power and gas markets, in particular for the purpose of enhancing the penetration of the ecologically beneficial, cogenerated district heating supply in those markets. The focus of this report is on a specific application of the integrated BoFiT decision support system, for which the ''model for microsimulation of spot transactions at the Power Exchange based on a multi-agent system'' has been developed and is explained in great detail. (orig./CB) [German] Mit dem Energiemanagementsystem BoFiT soll den Unternehmen eine effektive und operativ nutzbare Entscheidungsunterstuetzung angeboten werden. Wesentliche Ziele des Verbundprojektes des BMWi sind: Unterstuetzung der KWK und speziell der darauf basierenden oekologisch sinnvollen Fernwaermeversorgung durch Anpassung von Arbeitsablaeufen und Werkzeugen zur Findung betriebswirtschaftlich optimaler Einsatz- und Betriebsstrategien; Kostenoptimierung der Kraftwerke, Vertraege und Stromhandelsaktivitaeten unter den Randbedingungen der deregulierten Strom- und Gasmaerkte. Als Beispiel einer solchen integrierten Entscheidungsunterstuetzung wird das ''Modell zur Mikrosimulation des Spothandels von Strom auf der Basis eines Multi-Agenten-Systems'' ausfuehrlich beschrieben. (orig./CB)

  17. Enhanced photo-H2 production by Rhodopseudomonas faecalis RLD-53 immobilization on activated carbon fibers

    International Nuclear Information System (INIS)

    Xie, Guo-Jun; Liu, Bing-Feng; Ding, Jie; Xing, De-Feng; Ren, Hong-Yu; Guo, Wan-Qian; Ren, Nan-Qi

    2012-01-01

    Activated carbon fibers (ACFs) were firstly applied as fluidized solid carrier to immobilize photo-fermentative bacteria (PFB) for H 2 production in batch culture. The observations by scanning electronic microscopy (SEM) demonstrated the close interaction between ACFs and PFB. The amount of immobilized bacteria and the performance of H 2 production were strongly affected by specific surface area, length and amount of ACFs, respectively. Large specific surface area provided more surface attachment sites and more PFB were immobilized. ACFs with proper length avoided intertwining with each other and better fluidized during reactor operation. Excessive amount of ACFs not only limited the light conversion efficiency, but also increased biofilm detachment, resulting in low H 2 yield. The maximum yield (3.08 mol H 2 mol −1 acetate) and rate (32.85 ml l −1 h −1 ) of H 2 production were obtained, using specific surface area (1500 m 2 g −1 ), length (1 mm) and amount (0.8 g l −1 ) of ACFs. Compared with the conventional solid carriers, ACFs were effective solid carriers to immobilize PFB for improving H 2 production, due to bacteria immobilized on the external surface of fluidized ACFs and formed a layer of dense biofilm. -- Highlights: ► ACFs were firstly used to immobilize photo-fermentative bacteria for H 2 production. ► ACFs were fluidized in the reactor during the operation. ► Bacteria covered on the external surface of ACFs and formed dense biofilm. ► Each bacterium on the ACFs could absorb the light and convert substrate into H 2 .

  18. AFM imaging of bacteria in liquid media immobilized on gelatin coated mica surfaces

    Energy Technology Data Exchange (ETDEWEB)

    Doktycz, M.J.; Sullivan, C.J.; Hoyt, P.R.; Pelletier, D.A.; Wu, S.; Allison, D.P

    2003-10-15

    Immobilization of particulates, especially biomolecules and cells, onto surfaces is critical for imaging with the atomic force microscope (AFM). In this paper, gelatin coated mica surfaces are shown to be suitable for immobilizing and imaging both gram positive, Staphylococcus aureus, and gram negative, Escherichia coli, bacteria in both air and liquid environments. Gelatin coated surfaces are shown to be superior to poly-L-lysine coated surfaces that are commonly used for the immobilization of cells. This cell immobilization technique is being developed primarily for live cell imaging of Rhodopseudomonas palustris. The genome of R. palustris has been sequenced and the organism is the target of intensive studies aimed at understanding genome function. Images of R. palustris grown both aerobically and anaerobically in liquid media are presented. Images in liquid media show the bacteria is rod shaped and smooth while images in air show marked irregularity and folding of the surface. Significant differences in the vertical dimension are also apparent with the height of the bacteria in liquid being substantially greater than images taken in air. In air immobilized bacterial flagella are clearly seen while in liquid this structure is not visible. Additionally, significant morphological differences are observed that depend on the method of bacterial growth.

  19. Towards understanding the biological function of hopanoids (Invited)

    Science.gov (United States)

    Doughty, D. M.; Hunter, R.; Summons, R. E.; Newman, D. K.

    2010-12-01

    Rhodopseudomonas palustris TIE-1 expresses bacterial hopanoid lipids that are structurally similar and evolutionarily related to eukaryotic sterols. The genome of R. palustris TIE-1 contains two copies of the hpnN gene (hpnN1 and hpnN2) that are orthologs of genes encoding eukaryotic sterol and lipid transporters. Hopanoid localization to the outer membrane was found to be dependent upon hpnN1. Since the cell cycle of R. palustris TIE-1 is obligately bimodal with each cell division resulting in the generation of one mother and one swarmer cell, evidence was obtained that hopanoids where specifically localized to the outer membrane of mother cells. The sequestration of hopanoids to the mother cells was also disrupted by the deletion of the hpnN1 gene. Mutants lacking the hopanoid transporters were able to grow normally at 30 °C but showed decreased growth at 38 °C. The hopanoid transporter mutant formed cellular filaments when grown at elevated temperature. Because sedimentary steranes and hopanes comprise some of the earliest evidence for the emergence of distinct bacteria and eukaryotic phyla, a better appreciation of the function of hopanoids will improve our ability to interpret the evolution of life on Earth.

  20. Quantification of the magnetization-transfer contrast effect: can it yield additional information in differentiation of musculoskeletal lesions particularly in separation of benign from malignant lesions; Quantifizierung des Magnetization Transfer Contrast (MTC) Effektes durch Berechnung von MT-Quotienten: Ergeben sich Zusatzinformationen fuer die Differenzierung benigner und maligner Erkrankungen des Bewegungsapparates?

    Energy Technology Data Exchange (ETDEWEB)

    Vahlensieck, M.; Traeber, F.; Schild, H. [Radiologische Universitaetsklinik Bonn (Germany); Gieseke, J. [Philips Medizinsysteme (Germany)

    1999-12-01

    Purpose: To investigate the potential information of the amount of magnetization-transfer effect in musculoskeletal lesions and to compare MT ratios from benign and malignant musculoskeletal lesions. Material and Method: 49 patients with malignant tumors (3 osteosarcoma, 3 malignant fibrous histiocytoma, 4 chondrosarcoma, 2 Ewing sarcomas) and benign lesions (8 chondroma, 2 fibrous dysplasia, 3 osteoid-osteoma, 6 ganglion cyst, 3 cyst, 3 osteomyelitis, 4 tendinitis, 3 rotator cuff tear, 5 scar tissue) were scanned using routine MRI protocols including T{sub 1}- and T{sub 2}-weighted spin echo as well as T{sub 2}*-weighted gradient echo (FFE) sequences at 1.5 Tesla (ACS II, Philips Medical). Additionally MTC images were generated by combining the FFE sequence and the off-resonance MT technique (-1500 Hz off-resonance frequency, 1770 flip angle and 50 ms pulse duration). MT ratios were calculated as SI{sub o}-SI{sub m}/SI{sub o}. Results: The MT ratio of benign lesions was 26{+-}15%, that of malignant lesions was 22{+-}6%. The difference was statistically not significant. As expected muscle showed a high MT ratio of 50{+-}8%. Scar tissue demonstrated an MT ratio of 39{+-}16% which was significantly higher than the tumor MT ratios. Conclusion: MTC (MT ratios) failed to show significant differences between benign and malignant lesions as was expected due to basic differences in cellularity, rate of mitosis and chromatin content. MTC might however gain more importance in separating scar tissue from recurrent tumor in the future. (orig.) [German] Zielsetzung: Durch die Quantifizierung des Magnetization Transfer Contrastes sollte untersucht werden, ob sich Zusatzinformationen in der Magnetresonanztomographie des Stuetz- und Bewegungsapparates ergeben. Insbesondere sollte ermittelt werden, ob gut- und boesartige Laesionen unterschiedliche MT-Quotienten aufweisen. Material und Methode: 49 Patienten mit boesartigen Tumoren (3 Osteosarkom, 4 Chondrosarkom, 3 Malignes

  1. High-productivity laser deposition welding using powder and wire. Final report of the project 'Higher efficiency of thermal coating plants by a combination of energy sources'; Hochproduktives Laser-Auftragschweissen mit Pulver und Draht. Ergebnisbericht zum Verbundvorhaben ''Wirkungsgradsteigerung thermischer Beschichtungsanlagen durch Energiequellenkombination''. SPRAYNERGY

    Energy Technology Data Exchange (ETDEWEB)

    Nowotny, Steffen (ed.)

    2013-05-01

    Excellent precision, maximum mechanical strength and selective properties of the generated coatings and 3D structures caused a breakthrough of laser deposition welding in industrial production. However, the technology is limited by its low deposition rates in those cases where large-surface components are to be coated while laser-typical corrosion and wear resistance characteristics are to be achieved. Examples are, e.g. hydraulic cylinders for offshore applications, tools for petroleum or gas production and mining, or large-scale conveyors. In these cases, modern laser hybrid technologies open up new applications. By effectively combining the laser energy with other energy sources, e.g. inductive heating, autogenic flames or electric resistance, high deposition rates are achieved with excellent coating qualities, which makes the laser process competitive also in the case of large-surface coatings. (orig./AKB) [German] Exzellente Praezision, hoechste mechanische Festigkeit und massgeschneiderte Eigenschaften von Oberflaechenschichten wie auch generativ erzeugten 3D-Strukturen: diese Merkmale haben dem Auftragschweissen mit Laserstrahlen zum Durchbruch in der industriellen Produktion verholfen. Die geringen Auftragraten setzen der Technologie jedoch in jenen Faellen Grenzen, wo es um Flaechenbeschichtungen grosser Bauteile geht, deren Einsatz aber dennoch die lasertypischen Schichteigenschaften hinsichtlich Korrosions- oder Verschleissbestaendigkeit erfordert. Beispiele sind lange Hydraulikzylinder im Offshore-Bereich, Werkzeuge der Oel- und Gasfoerderung und des Bergbaus sowie grosse Foerderschnecken. Hier erweitern moderne Laser-Hybridtechnologien wirkungsvoll die Einsatzmoeglichkeiten. Durch effiziente Kombination der Laserenergie mit anderen Energiequellen in Form induktiver Erwaermung, autogener Flammen oder elektrischem Widerstand werden hohe Auftragraten bei gleichzeitigem Erhalt der besonderen Schichtqualitaet erreicht, die das Laserverfahren auch bei

  2. Development of an early warning system for strong environmental pollution by measuring the activation of defined universally existing stress genes. Final report; Das Auftreten spezifischer Stressproteine bei Umweltbelastung in Chironomiden: Entwicklung eines neuen Fruehwarnsystems fuer starke Umweltbelastung durch Messung der Aktivierung definierter, universell vorkommender Stressgene bei ausgewaehlten Indikatororganismen. Abschlussbericht

    Energy Technology Data Exchange (ETDEWEB)

    Kloetzel, P.M.; Mueller, W.

    1991-12-31

    In the present pilot study we established an ELISA based detection system which allows sensitive monitoring of stress induction as a result of heavy metal pollution. The system is based on the immunological detection of the stress induced hsp70 in larvae of Chironomidae. Using this system it is possible to detect environmental pollution by heavy metals far beyond lethal toxicity values. Since only very few animals are needed the system can also be used in field tests. For poluted isopodes as Oniscus asellus for example a single animal turned out be sufficient to monitor stress induction by Pb{sup +}. The established system ought to serve as basis for a more extended study in which different animals are collected from various polluted environments and tested with respect to already induced hsp synthesis. (orig.) [Deutsch] In der vorliegenden Pilotstudie konnte ein sensitives Nachweissystem fuer die Induktion des ubiquitaeren Stresssystem durch Schwermetalle auf der Basis der immunologischen Detektion von HSP70 etabliert werden. Dieses, auf ELISA Basis arbeitende Testverfahren ermoeglicht es Schwermetallbelastungen weit unterhalb der Toxizitaetsgrenze ueber die Induktion der HSP70 Synthese in Chironomidenlarven nachzuweisen. Die Tatsache, dass nur wenige Tiere fuer eine statistische Aussage benoetigt werden laesst eine Anwendungsmoeglichkeit auch auf Freilandtiere erwarten. So reicht fuer bleibelastete Freiland-Asseln ein einziges Tier zum immunologischen Belastungsnachweis aus. Damit sind die Grundlagen fuer die zweite Phase, die Freilandphase, in welcher sowohl Freilandtiere als auch Gewaesser- und Sedimentproben von verschiedenen Standorten in die Untersuchungen miteinbezogen werden sollen; geschaffen. Es koennen jetzt Tiere aus belasteten Gewaessern bezueglich bereits erfolgter Stressproteinproduktion aber auch auf eine Neuinduzierbarkeit nach zusaetzlicher Laborbelastung untersucht werden. Ebenso koennen Labortiere auf ihre Reaktion gegenueber belasteten

  3. Harmful loading of water courses caused by precipitation. Phase 2. Part project 8: Loading of harmful substances by precipitation. Pt. A, B, and C. Pt. A: Harmful substances introduced by atmospheric deposition dust.Pt. B: Sources and mobility of harmful substances. Pt. C: Load of harmful substances from roof and road surfaces; NIEDERschlagsbedingte SCHadstoffbeLAstung der Gewaesser - Phase 2. Teilprojekt 8: Schadstoffbelastung durch Niederschlag. T. A, B und C. T. A: Schadstoffeintrag durch atmosphaerische Staubdeposition. T. B: Quellen und Mobilitaet von Schadstoffen. T. C: Schadstofffrachten von Dach- und Strassenflaechen. Abschlussbericht

    Energy Technology Data Exchange (ETDEWEB)

    Luetzner, K.; Grothkopp, H.; Gebhard, V.; Rennert, S.; Huth, B.

    1997-02-28

    Stadtgebieten ist die Belastung der Oberflaechenabfluesse nicht allein von der Verkehrsdichte abhaengig. Dies gilt hoechstens ueber die Partikelbeladung hinsichtlich einiger Elemente. Das Fahrverhalten, z.B. haeufiges Anfahren und Bremsen, ist hier ebenso von Bedeutung. Weiterhin beeinflussen die Hintergrundbelastung, Abspuelungen von unbefestigten Flaechen sowie weitere Aktivitaeten (z.B. intensive Bautaetigkeit) die Belastung von Nebenstrassen. Im Verlauf der untersuchten Niederschlagsereignisse war nach ca. 6 mm Niederschlag die Auswaschung der bodennahen Luftschicht beendet. Nach einem gefallenen Niederschlag von jeweils 15 mm konnte bei zwei Ereignissen die nahezu vollstaendige Abspuelung der partikulaeren Fracht festgestellt werden. Rund 80% der Schwermetallbelastung (bei Cu nur ca. 50%) des Einzugsgebietes werden durch die Emissionen des Strassenverkehrs verursacht. Kupferdaecher emittieren rund 40% der Cu-Fracht. Die Schwermetallfracht der Dachabfluessen ist ueberwiegend in der fluessigen Phase enthalten (ausser Pb, Fe), dagegen ist die Fracht der Strassenabfluesse zu ueber 90% partikulaer gebunden. Ein Rueckhalt dieser Schwermetallfracht koennte somit ueber den AFS-Rueckhalt geschehen. Entsprechend der durchgefuehrten Berechnung auf Grundlage bekannter Mittelwerte entfernt die Stadtreinigung Dresden gegenwaertig etwa die Haelfte der Fe- und Ni-Gesamtfracht sowie rund 40% der Cu-, Pb- und Zn-Gesamtfracht des Einzugsgebietes. (orig./AJ)

  4. Investigations performed on the compost worm Eisenia fetida and selected species of earthworms concerning the intake of HCB and pyrene with the goal of deriving a bioaccumulation test; Untersuchungen zur Aufnahme von HCB und Pyren durch den Kompostwurm Eisenia fetida und ausgewaehlte Regenwurmwildarten. Ableitung eines Bioakkumulationstests

    Energy Technology Data Exchange (ETDEWEB)

    Vespermann, A.; Riepert, F.; Pflugmacher, J. [Biologische Bundesanstalt fuer Land- und Forstwirtschaft, Inst. fuer Oekotoxikologie im Pflanzenschutz, Berlin (Germany)

    2003-07-01

    . Die Expositionszeit der Regenwuermer betrug 4 Wochen bei woechentlicher Bestimmung der Konzentrationen der Testsubstanzen in den Wuermern und Boeden. Die fuer E. fetida sowie die Wildarten errechneten Anreicherungsfaktoren (AF) beliefen sich bei HCB in Abhaengigkeit des verwendeten Bodens auf Werte zwischen 10 und 17 und bei Pyren auf Werte zwischen 0,9 und 1,7. Durch Umrechnung der Bodenkonzentrationen auf Gehalte in der Wasserphase und Ableitung der entsprechenden Anreicherungsfaktoren kann ein Vergleich mit BCF-Werten, die aus QSAR'S anderer Regenwurmarten und Fischen berechnet wurden, hergestellt werden. Die Ergebnisse lassen den Schluss zu, dass der Regenwurmtest mit E. fetida (OECD 1984, ISO 1998) fuer die Untersuchung der Bioakkumulation geeignet ist. (orig.)

  5. Contactless detection of the structure and selected parameters of a two-phase-flow by pattern recognition based ultrasonic techniques. Final report; Beruehrungslose Detektion der Struktur und Messung ausgewaehlter Parameter von Zweiphasenstroemungen durch Mustererkennungsverfahren unter Verwendung von Ultraschall als Messsonde. Abschlussbericht

    Energy Technology Data Exchange (ETDEWEB)

    Prasser, H.M.; Schuetz, P.; Kossok, N.

    1997-11-01

    , wenn die thermodynamischen und geometrischen Randbedingungen nahezu konstant bleiben. Durch die Erweiterung der Trainingsmatrizen um einen, die thermodynamischen Eigenschaften determinierenden Parameter (z.B. Temperatur, Druck) kann das Klassifizierungsverfahren auch auf Faelle mit veraenderlichen Stoffwerten angewandt werden. Das Mustererkennungsverfahren und die Ultraschalltechnik wurden experimentell optimiert und erprobt. Die Ultraschallsignale wurden ausserdem mit Hilfe der Methode des unueberwachten Lernens klassifiziert. Die gefundenen Gruppen von Signalmustern weisen eine deutliche Aehnlichkeit zu bekannten Stroemungskarten auf. Es wird gezeigt, dass das Verfahren des unueberwachten Lernens sich fuer die objektive Aufstellung von Stroemungskarten eignet. In einem speziellen Kapitel werden die Ergebnisse von Tests zur Fuellstandsmessung in einem Segment der Hauptumwaelzleitung von Druckwasserreaktoren vorgestellt. (orig.)

  6. MR-Imaging optimisation of the articular hip cartilage by using a T{sub 1}-weighted 3-dimensional gradient-echo sequence and the application of a hip joint traction; Magnetresonanztomographische Optimierung der Hueftknorpeldarstellung durch die Wahl einer T{sub 1}-Volumen-Gradienten-Echo-Sequenz und die Anwendung einer Hueftgelenkstraktion

    Energy Technology Data Exchange (ETDEWEB)

    Rosenberg, R. [Heidelberg Univ. (Germany). Orthopaedische Klinik und Poliklinik; Bernd, L. [Heidelberg Univ. (Germany). Orthopaedische Klinik und Poliklinik; Wrazidlo, W. [ATOS-Praxisklinik, Heidelberg (Germany). Radiologische Gemeinschaftspraxis Drs. Lederer, Schneider und Wrazidlo; Lederer, W. [ATOS-Praxisklinik, Heidelberg (Germany). Radiologische Gemeinschaftspraxis Drs. Lederer, Schneider und Wrazidlo; Schneider, S. [ATOS-Praxisklinik, Heidelberg (Germany). Radiologische Gemeinschaftspraxis Drs. Lederer, Schneider und Wrazidlo

    1995-10-01

    Images of three animal cadaver hips, 8 dissected patient femoral heads and 18 hip joints of human corpses, all either with arthrosis stage I-III or artificial cartilage defects, were compared with their corresponding anatomic sections. Additional histomorphologic examinations of the arthrotic cartilages were conducted, and MR-Imaging of 20 healthy and 21 arthrotic patient hips was performed using a specific traction method. Using a T{sub 1}-weighted 3-dimensional gradient-echo sequence and a traction of the hip joint, it was possible due to the low-signal imaging of the joint space to separate in vivo the high-signal femoral head cartilage from the high-signal acetabular cartilage. In horizontal position of the phase-encoding parameter, minimisation of the chemical-shift artifact, mainly in the ventro-lateral areas, was accomplished. MRI measurements of the articular cartilage widths showed significant correlations (p < 0.001) with the corresponding anatomic sections. At the same time the T{sub 1} 3-dimensional gradient-echo sequence of the lateral femoral head with r = 0.94 showed the lowest deviations of the measurements. It was possible with MR-Imaging to distinguish four cartilage qualities. (orig./MG) [Deutsch] Im experimentellen Teil der Studie wurden den MRT-Bildern von drei Kadavertierhueften, 8 resezierten Patientenhueftkoepfen und 18 Leichenhueftgelenken, an denen entweder artifizielle Knorpeldefekte gesetzt wurden oder die ein Koxarthrose-Stadium I-III aufwiesen, die korrespondierenden makroskopischen Kryomikrotomschnitte zugeordnet. Bei den Koxarthrosen erfolgten zusaetzliche histomorphologische Knorpeluntersuchungen. Im klinischen Teil der Studie wurden 20 gesunde und 21 arthrotische Probandenhueftgelenke mit einem speziellen Traktionsverfahren untersucht. Unter Anwendung einer T{sub 1}-Volumen-Gradienten-Echo-Sequenz und einer Traktion am zu untersuchenden Hueftgelenk konnte in vivo durch die signalarme Darstellung des Gelenkspaltes der

  7. CNS metabolism in high-risk drug abuse, German version. Insights gained from {sup 1}H- and {sup 31}P MRS and PET; ZNS-Stoffwechsel bei Missbrauch von Hochrisikodrogen. Erkenntnisse durch {sup 1}H- und {sup 31}P-MRS sowie PET

    Energy Technology Data Exchange (ETDEWEB)

    Bodea, S.V. [Klinik fuer Diagnostische und Interventionelle Neuroradiologie, Universitaetsklinikum des Saarlandes, Homburg/Saar (Germany)

    2017-06-15

    Methamphetamin-, Kokain- und Heroinkonsumenten bis Maerz 2017 wurde ueber PubMed-Recherchen erforscht. Suchbegriffe wie ''methamphetamine'', ''cocaine'', ''heroin'', ''MR spectroscopy'', ''PET'' wurden benutzt. MRT- und PET-Verfahren sind unerlaessliche Werkzeuge bei der Erforschung der zerebralen Reaktionen auf illegale Drogen. Zukuenftige Durchbrueche werden voraussichtlich durch die Untersuchung neuer Neurotransmittersysteme in der PET sowie die Abbildung von Phosphor- und Kohlenstoffmetaboliten in der MRT erfolgen. (orig.)

  8. Cost reduction through combined solutions?; Kostensenkung durch Kombinationsloesungen?

    Energy Technology Data Exchange (ETDEWEB)

    Bilitewski, B. [Technische Univ. Dresden (Germany). Inst. fuer Abfallwirtschaft und Altlasten

    1998-09-01

    The implementation of material-specific residue treatment processes requires reconstruction measures both in the case of mechanical-biological and in that of thermal treatment plants. Such measures involves great uncertainties and wide variation in cost prediction. The present paper deals with various factors that influence the costs of residual waste treatment. [Deutsch] Zur Umsetzung der stoffspezifischen Restabfallbehandlung sind Anpassungen sowohl der derzeit betriebenen mechanisch-biologischen als auch der thermischen Anlagen erforderlich, was zu Unsicherheiten und grossen Schwankungsbreiten bei den Kostenprognosen fuehrt. Der Bericht beleuchtet verschiedene Einflussgroessen auf die Kosten der Behandlung des Restabfalls. (orig./SR)

  9. Energy - achieving an optimum through information. Energie - optimal durch Information

    Energy Technology Data Exchange (ETDEWEB)

    Gitt, W.

    1986-01-01

    What have computer programs in common with everyday human behaviour. Or the birds' passage, or photosynthesis, or the chemical reactions in a cell. They all primarily are information-controlled processes. The book under review deals with 'information' and 'energy', two main concepts in today's technological world. 'Energy' during the last few years has become a significant criterion with regard to technological progress. 'Information' is not only a main term in informatics terminology, but also a central concept for example in biology, linguistics, and communication science. The author shows that every 'information' is the result of an intellectual and purposeful process. The concept of information is taken as the red thread leading the author's journey through manifold strata of modern life, asking questions, finding answers, discussing problems. The wide spectrum of aspects discussed, including for instance a new approach to the Bible, and the remarkable examples presented by the author, make this book a treasure of knowledge, and of faith.

  10. Energy transparency by business intelligence; Energietransparenz durch Business Intelligence

    Energy Technology Data Exchange (ETDEWEB)

    Flieder, Karl [Academia Nova, Schwechat (Austria). Business Process Management and Engineering

    2012-10-15

    The efficiency of energy is one of several key performance parameters, when it comes to the questions how innovative and economical a plant operates compared to its competitors. However, in order to evaluate energy saving potentials in the industry, we need transparency first: A clear picture of the energy consumption based on products and processes. This transparency can be accomplished through business intelligence (BI). This term encompasses analytical processes and tools that can help to transform enterprise data and information into applied knowledge. In this article, we focus on transparency of the energy consumption through a targeted analysis by making use of business intelligence.

  11. Rechtsmissbrauch durch „AGG-Hopping“ / Steffen Krieger

    Index Scriptorium Estoniae

    Krieger, Steffen

    2016-01-01

    Euroopa Kohtu otsusest, mis puudutab töökohale kandideerija staatust eesmärgiga esitada kahju hüvitamise nõudeid kui teda ei valita tööle ja sellise teguviisi käsitlemist õiguse kuritarvitamisena. Vt. ka lk. 699-700

  12. Safety - thanks to the freedom to decide; Sicherheit durch Entscheidungsfreiheit

    Energy Technology Data Exchange (ETDEWEB)

    Brandes, B. [Brandes GmbH, Eutin (Germany)

    1994-12-01

    The pipe manufacturers who are grouped together in the EuHP have reached agreement on offering bare copper wire as `their` compatible standard sensor. This is not a new decision: This always was the case, and was always sold as such if the customer did not express any particular wishes of their own in this respect when placing the order. The inspiration for this action is, rather, concern with some monitoring systems. These have become the subject of gossip over the past few years, and we too view this development with concern. Only the `Nordic system` and the resistance comparison measuring system process are unaffected by this. Against this background, attempts are also being made to have copper declared as the sole standard. This decision is in fact only a logical defence of interests, because compatibility between not only the pipe manufacturers but also between the laying processes is only available with the resistance wire - and that has always been the case. It is important not to treat the topic as an `article of faith`, but in such a way that the way is open to solutions which really are acceptable to all parties. (orig./KO) [Deutsch] Die im EuHP zusammengefassten Rohrhersteller haben sich nun darauf verstaendigt, kuenftig zwei Kupferadern als `ihren` Standardsensor anzubieten. Das ist keine neue Entscheidung, denn das war schon immer so und wurde immer dann verkauft, wenn der Kunde keine feste eigene Meinung in die Auftragsvergabe einbrachte. Neu ist, dass man kuenftig `keine stoerenden Komponenten` in den Rohren mehr will und dass man das `Kupfersystem` offensiv nach aussen traegt. Mit diesem Hintergrund ist es verstaendlich, dass manche bei dieser Gelegenheit gleich den Sensor, der ihnen als Rohrhersteller am angenehmsten ist, zum Standard erklaeren moechten. Dieser Beschluss ist konsequente Interessenwahrnehmung. Denn: Wirkliche Kompatibilitaet nicht nur zwischen den Verlegeverfahren, gibt es mit dem Widerstandsdraht schon seit ueber 20 Jahren. Ob der Vorstoss mehr Vor- als Nachteile bringt, muessen daher die entscheiden, die als Auftraggeber Nutzen aus der Fernheizleitung und Sicherheit fuer das investierte Geld aus dem Sicherheitssystem ziehen wollen. Eine Fehlentscheidung waere endgueltig und kritisch fuer die Fernwaerme. (orig./KO)

  13. Asymmetrische Alkensynthesen durch Kinetische Racematspaltungen von Aldehyden mit Chiralen Phosphonaten

    DEFF Research Database (Denmark)

    Kreuder, Reinhard; Bodmann, Kerstin; von Zezschwitz, Paultheo

    1998-01-01

    The article gives an overview of how synthetically useful chiral building blocks can be obtained by kinetic resolution of chiral, racemic aldehydes through the reaction with chiral phosphonate reagents....

  14. Verletzung der A. subscapularis durch Reposition einer vorderen Schulterluxation

    DEFF Research Database (Denmark)

    Schmal, H; Strohm, P C; Rosahl, S K

    2006-01-01

    report a case with rupture of the arteria subscapularis following reduction of an anterior shoulder dislocation with formation of an axillary hematoma and consecutive paresis of the plexus brachialis. Interdisciplinary operative revision was necessary to remove the hematoma, stop the hemorrhage...... and for neurolysis of the plexus brachialis. Treatment resulted in a speedy recovery of the patient. Gentle reduction of a dislocated shoulder is a prerequisite for a low complication rate. Contrast-enhanced computed tomography facilitated diagnosis of the hematoma and identification of the bleeding vessel....

  15. Erfahrbares Programmieren durch den zielgerichten Einsatz von Flugdrohnen im Informatikunterricht

    Directory of Open Access Journals (Sweden)

    Raphael Zender

    2015-11-01

    Full Text Available Today, teaching on fundamental programming skills is one of the essential IT-related topics in schools. This trend is brought forward by simple development environments like Scratch. Those abstract from detailed programming concepts in terms of graphical building blocks. Exotic runtime platforms like robots further increase the attractiveness. The solution “ScratchDrone” provides quadrocopters as an innovative new platform to run Scratch programs. The modular system architecture of ScratchDrone allows children to program on multiple layers of abstraction depending on their individual learning progress. The combination of a multi-layer didactical model, the movement in 3D space, as well as the natural human fascination for flying results in a high learning motivation for young programmers.

  16. Qualitätssicherung an Hochschulen durch Zulassungsverfahren

    OpenAIRE

    Hell, Benedikt

    2007-01-01

    Dieser Beitrag zeigt auf, dass Zulassungsverfahren einen wichtigen Beitrag zur Qualitätssicherung im tertiären Bildungsbereich leisten können. In Form eines Gedankenspiels wird das Portersehe Value Chain Framework herangezogen, um die besondere Stellung von Auswahlverfahren als Qualitätssicherungselement aufzuzeigen. Einen weiteren Schwerpunkt bildet die Analyse der prognostischen Aussagekraft und der Betrachtung des Nutzens von Auswahlverfahren. Hierzu werden Kennzahlen präsentiert, die durc...

  17. Product bundling as a customer loyalty strategy; Kundenbindung durch Produktbuendel

    Energy Technology Data Exchange (ETDEWEB)

    Wolf, H.G. [Arthur Andersen Business Consulting GmbH, Duesseldorf (Germany)

    2000-12-01

    In the deregulated market in electricity, all marketers and energy-related service providers are competing not only for new customers, but also for customer loyalty. The article sets out concepts and strategies developed by a business consulting firm, for maintaing or enhancing customer loyalty in the end-use market segment, focusing on customized product bundling. A four-tier approach for product bundle development and implementation is discussed. (orig./CB) [German] Fuer Energieversorger und -dienstleister ergibt sich neben der Neukundengewinnung der strategische Zwang zur Bindung bestehender Kunden. An praktischen Ansaetzen fuer Privatkunden stehen neben Value-Added-Services und Incentives (Kundenclub, -karte) nicht zuletzt Produktbuendel (Bundles) zur Verfuegung. Zur erfolgreichen Entwicklung und Implementierung von Produktbuendeln wird ein vierphasiges Vorgehensmodell erlaeutert. (orig./CB)

  18. Die Leben Einsteins eine Reise durch die Geschichte der Physik

    CERN Document Server

    Fiami

    2005-01-01

    Jeder kennt die Namen Einstein, Newton oder Galilei. aber was weiss man über sie? Hier ein Porträt Einsteins anhand von sechs Meilensteinen aus der Geschichte der Physik. Einstein tritt auf als Protagonist in verschiedenen Epochen und bei verschiedenen Entdeckungen, die die Welt verändert haben.

  19. Allergien durch Stiche und Bisse von Insekten und Spinnentieren

    DEFF Research Database (Denmark)

    Blank, S; Schiener, M; Ollert, M.

    2016-01-01

    Allergic reactions due to stings of Hymenoptera species, such as honeybees or yellow jackets, are well known as severe allergies with potentially fatal outcome. Much less common is that also bites of blood-sucking insects (mosquitos, horseflies, flies, bugs, lice and fleas) and arachnids (ticks...

  20. Verminderung der Prüfungsangst durch Modellernen im Klassenzimmer

    OpenAIRE

    Ellgring, Johann Heinrich; Elbing, Eberhard

    2010-01-01

    Die Wirksamkeit des Modellernens im Klassenzimmer zur Veränderung der Prüfungsangst wurde bei 152 Knaben und 164 Mädchen der Klassen 5-8 einer Hauptschule untersucht. Den Schülern wurden die Angst-Skalen (TASe und GASC) von Sarason vorgelegt. Anhand der Fragebogenergebnisse wurden die Kinder den Kategorien "hochängstlich" (HA), "mittelängstlich" (MA) und "niedrigängstlich" (NA) zugeordnet. Für 3,5 Monate wurden die folgenden Paarbildungen (Banknachbarn) beibehalten: HA neben HA, MA und NA, NA...

  1. [Construction and Characterization of B850-Only LH2 Energy Transfer System in Purple Bacteria].

    Science.gov (United States)

    Li, Kai; Zhao, Chun-gui; Yue, Hui-ying; Yang, Su-ping; Qu, Yin-bo; Jiao, Nian-zhi

    2015-04-01

    To seek microscopic molecular mechanism of energy transfer and complex reconstitution in the photosynthesis, the conditions for construction of B850-only peripheral light-harvesting complex (LH2) and their properties were investigated using absorption, fluorescence spectroscopy, molecular sieve chromatography, ultrafiltration and sodium dodecylsulfate polyacrylamide gel electrophoresis (SDS-PAGE) from the purple bacteria. The results indicated that bacteriochlorophylls (BChl) of B800 incubated in 10 mmo · L(-1) Tris-HCl (pH 8.0) buffer are selectively released from their binding sites of LH2 of Rhodobacter azotoformans (A-LH2) by 0.08% (W/V) SDS. B850-only A-LH2 was constructed after removing free BChl mixing with 10% methyl alcohol by ultrafiltration. B850 BChl was released after A-LH2 was incubated for 240 min in dark at room temperature (RT). While BChl of B800 incubated in pH 1.9 buffer were selectively released from their binding sites of LH2 of Rhodopseudomonas palustris (P-LH2). The authors acquired two components using molecular sieve chromatography. Free BChl of one component was not removed and self-assembled to P-LH2. The other removed free BChl and B850-only P-LH2 was constructed. B850 unchanged after P-LH2 was incubated. P-LH2 α and β subunits have different molecular weights, but those of A-LH2 are in the contrary. It is concluded that B850-only P-LH2 is more stable than A-LH2. The enigmatic split of the B800 absorption band was not observed in these LH2, but we acquired two kinds of B800-released LH2 from Rhodopseudomonas palustris. The authors' results may provide a new light to separate homogeneous Apoprotein LH2.

  2. Concept Mapping zur Unterstützung der differentialdiagnostischen Hypothesenbildung im fallbasierten Online-Lernsystem CASUS: Qualitative Verbesserung der Diagnosefindung durch ICD-10 Kodierung [Concept mapping for supporting the differential diagnostic generation of hypotheses in the case-based online learning system CASUS: Qualitative improvement of dagnostic performance through ICD-10 coding

    Directory of Open Access Journals (Sweden)

    Kernt, Marcus

    2008-08-01

    akzeptiert werden und zu einer vermehrten Hypothesenbildung beitragen. Es gibt bisher jedoch wenige Erkenntnisse über die Qualität der dabei vom Anwender erstellten Hypothesen. Die vorliegende Studie untersucht die Qualität der im Netzwerk-Tool im fallbasierten Lernsystem CASUS erstellten Hypothesen und inwieweit diese durch Kodierung mittels ICD10 präzisiert werden können. Methodik: Die Lernenden bearbeiteten zu zweit einen Computerlernfall zum Thema Malaria. Wir randomisierten 192 Teilnehmer der Studie aus dem 3. Studienjahr an der Universität München in zwei Gruppen: Gruppe A wurde gebeten, die erdachten Hypothesen vor der Eingabe in das Netzwerk-Tool mittels eines ICD10-Browsers zu kodieren. Gruppe B erstellte ihre Hypothesen ohne weitere Hilfsmittel. Die Netzwerke wurden quantitativ und qualitativ evaluiert und die Ergebnisse der beiden Gruppen verglichen. Als Referenz diente das von Experten erstellte Netzwerk. Ergebnisse: 87 differentialdiagnostische Netzwerke konnten ausgewertet werden. In Gruppe A mit ICD10-Kodierung der Hypothesen, konnten die Lernenden signifikant häufiger (p<0,005 die exakte Hauptdiagnose Malaria tropica stellen. In der Gruppe ohne ICD10 Kodierung wurde signifikant häufiger (p<0,005 die unpräzise Diagnose "Malaria" gestellt. Für die Nebendiagnosen ergaben sich qualitativ und quantitativ keine Unterschiede. Schlussfolgerungen: Die ICD10-Kodierung der Hypothesen im Netzwerk-Tool führte zu einer präziseren Diagnosestellung der Studierenden im klinischen Studienabschnitt. Die Integration eines ICD-Browsers zur Unterstützung der differentialdiagnostischen Hypothesenbildung in fallbasierten Lernsystemen ist sinnvoll.

  3. Reduzierbarkeit der Abbrecherquote im Humanmedizinstudium durch das Hamburger Auswahlverfahren für Medizinische Studiengänge - Naturwissenschaftsteil (HAM-Nat [Possible reduction of the medical school dropout number by the Hamburg Assessment test for Medicine - part Natural sciences (HAM-Nat

    Directory of Open Access Journals (Sweden)

    Harendza, Sigrid

    2008-05-01

    eines zukünftigen „guten Arztes“ zu entwickeln und zu validieren. Daher beschränkt sich das Auswahlverfahren in Hamburg auf das pragmatische Ziel die Studienabbrecherzahl zu reduzieren, damit möglichst viele Studienanfänger durch gute Lehre zu „guten Ärzten“ ausgebildet werden. Methodik: Zu diesem Zweck wurde der HAM-Nat (Hamburger Auswahlverfahren für Medizinische Studiengänge - Naturwissenschaftsteil mit 52 Multiple-choice Fragen auf Schulniveau über naturwissenschaftliche Kenntnisse und ihre Anwendung entwickelt, zunächst an 6 Schulen in 3 Bundesländern erprobt und dann mit 333 Studienanfängern im Oktober 2006 durchgeführt. Das Testergebnis und die Abiturnote wurden mit dem Studienerfolg in den ersten beiden Semestern korreliert. Als Studienerfolgsparameter wurde die Anzahl der bestandenen Leistungsnachweise verwendet. Ergebnisse: Das HAM-Nat-Ergebnis korreliert nach dem 2. Semester höher mit dem Studienerfolg als die Abiturnote, von der es relativ unabhängig ist. Insbesonders zeigt die Simulation eines Auswahlverfahrens unter Berücksichtigung von HAM-Nat-Ergebnis und Abiturnote eine deutliche Reduktion der Zahl der Studienabbrecher im Vergleich zur jetzigen Auswahl nur nach Abiturnote. Weitere abgefragte mögliche Studienauswahlparameter wie belegte naturwissenschaftliche Kurse oder eine abgeschlossene Berufsausbildung korrelieren nicht mit besserem Studienerfolg. Schlussfolgerung: Der HAM-Nat ist ein wertvolles zusätzliches Auswahlverfahren für Studienbewerber in der Medizin. Aufgrund dieser Ergebnisse hat die Medizinische Fakultät Hamburg beschlossen, den HAM-Nat für die Studienbewerberauswahl zum Wintersemester 2008/2009 einzuführen.

  4. The semidry acid-anhydrite process (the use of flue gas desulphurization (FGD) gypsum by development of a new process for the production of FGD anhydrite); Das quasitrockene Saeure-Anhydrit-Verfahren (Erweiterung der Verwendungsmoeglichkeiten von REA-Gips durch Entwicklung eines Verfahrens zur Herstellung von REA-Anhydrit aus REA-Gips)

    Energy Technology Data Exchange (ETDEWEB)

    Wirsching, F. [Gebr. Knauf, Westdeutsche Gipswerke, Iphofen (Germany); Hueller, R. [Gebr. Knauf, Westdeutsche Gipswerke, Iphofen (Germany); Limmer, B. [Gebr. Knauf, Westdeutsche Gipswerke, Iphofen (Germany)

    1994-10-01

    -Anhydrit untersucht. Die Reaktion erfolgt mit feuchtem, feinteiligem REA-Gips unter der katalytischen Wirkung kleiner Mengen Schwefelsaeure bei Temperaturen um 100 bis 200 C. Es wird wasserfreier REA-Anhydrit mit orthorhombischer Kristallstruktur erhalten. Die Umwandlung des Kristallgitters von Calciumsulfat-Dihydrat in Calciumsulfat-Anhydrit II vollzieht sich dabei direkt durch Mineralneubildung. Diese Umwandlung wird zu einem Verfahren entwickelt und als `Quasitrockenes Saeure-Anydrit-Verfahren` bezeichnet. Die Reaktion und ihr Mechanismus wurde zuerst in Laborversuchen untersucht. Als Ausgangsstoff ist jedes feinteilige Calciumsulfat-Dihydrat geeignet. Der bereits im Kraftwerk feinteilig-kristallin erzeugte REA-Gips mit 10% Restfeuchte ist besonders vorteilhaft, da er fuer diese Verwendung vorher nicht getrocknet und nicht gemahlen werden muss. Die Verfahrensentwicklung wurde bis in den halbtechnischen Massstab durchgefuehrt und Auslegungsgrundlagen fuer Grossanlagen an Kraftwerksstandorten erarbeitet. Als Reaktionsaggregat zeigte sich der direkt beheizte Drehrohrofen geeignet. Der REA-Anhydrit wird in diesem Verfahren als trockenes feinteiliges Produkt mit reproduzierbaren Teilchengroessen um 2 Mikron erhalten und besitzt neuartige technologische Eigenschaften. Seine Verwendungsmoeglichkeit wurde fuer die Zementindustrie sowie als Rohstoff zur Herstellung von Fuellstoffen untersucht. Fuer die Zementindustrie ist er grundsaetzlich geeignet. Der Einsatz als Fuellstoff ermoeglicht eine erweiterte Verwendung des REA-Gipses ausserhalb der traditionellen Bereiche der Gipsindustrie. Erste Versuche erlauben die Schlussfolgerung, dass der REA-Anhydrit nach einer Aufbereitung, die ebenfalls labormaessig neu entwickelt wurde, die fuer einen hochwertigen Fuellstoff notwendigen guten Eigenschaftsmerkmale hat. (orig.)

  5. MC-PELMO 3.0 - a computer model to estimate groundwater contamination caused by leaching of wood preservatives from storage sites of treated wood in Germany; Grundwassergefaehrdung durch Holzschutzmittel. MCPELMO 3.0 - ein mathematische Simulationsprogramm zur Abschaetzung der Grundwassergefaehrdung unter Holzlagerflaechen in Deutschland

    Energy Technology Data Exchange (ETDEWEB)

    Klein, M. [Fraunhofer-Inst. fuer Molekularbiologie und Angewandte Oekologie, Schmallenberg-Grafschaft (Germany); Herrmann, M. [Umweltbundesamt, Berlin (Germany)

    2004-07-01

    verarbeitet dabei 22 ausgewaehlte Versickerungsszenarien, die ihrerseits aus der Verknuepfung von Leitboeden aus 12 Bodenregionen und Wetterdaten von 9 Klimastationen abgeleitet wurden. Diese Szenarien werden gewichtet mit den Standortdaten von Holzimpraegnierbetrieben in Deutschland. Als Ergebnis der Simulationsrechnungen werden statistische Wahrscheinlichkeiten fuer die Konzentrationen im Sickerwasser unter Holzlagerplaetzen in den vom Anwender ausgewaehlten Regionen angegeben. Ergebnisse und Diskussion. Die Ergebnisprotokolle der Simulationsrechnungen beinhalten sowohl mittlere Sickerwasserkonzentrationen als auch frei waehlbare Perzentile (50-99), sowie die jeweils maximale Standortkonzentration. Die Ergebnisse koennen in Relation zur Gesamtflaeche der Bundesrepublik, den jeweiligen forstlich genutzten Flaechenanteilen, oder zur Dichte von Holzschutzmittel anwendenden Betrieben dargestellt werden. Neben der Konzentration der Ausgangssubstanz koennen auch fuer mehrere Abbauprodukte Konzentrationen in der Grundwasserneubildung berechnet werden. Schlussfolgerungen. Das beschriebene Modell ist insbesondere zum Vergleich der Grundwassergefaehrdung durch verschiedene Holzschutzmittel geeignet. Die vergleichende Bewertung stellt ein neues Element der EU-Politik zur Chemikaliensicherheit dar, das zum ersten Mal in der Biozidrichtlinie 98/8/EG festgeschrieben wurde. Die Ergebnisse der Modellrechnungen identifizieren aber auch besonders gefaehrdete Regionen in Deutschland, fuer die geeignete Risikominderungsmassnahmen ergriffen werden muessen um das dortige Grundwasser zu schuetzen. (orig.)

  6. Genes essential for phototrophic growth by a purple alphaproteobacterium: Genes for phototrophic growth

    Energy Technology Data Exchange (ETDEWEB)

    Yang, Jianming [Key Lab of Applied Mycology, College of Life Sciences, Qingdao Agricultural University, Qingdao Shandong Province People' s Republic of China; Department of Microbiology, University of Washington, Seattle WA USA; Yin, Liang [Department of Microbiology, University of Washington, Seattle WA USA; Lessner, Faith H. [Department of Biological Sciences, University of Arkansas, Fayetteville AR USA; Nakayasu, Ernesto S. [Biological Sciences Division, Pacific Northwest National Laboratory, Richland WA USA; Payne, Samuel H. [Biological Sciences Division, Pacific Northwest National Laboratory, Richland WA USA; Fixen, Kathryn R. [Department of Microbiology, University of Washington, Seattle WA USA; Gallagher, Larry [Department of Genome Sciences, University of Washington, Seattle WA USA; Harwood, Caroline S. [Department of Microbiology, University of Washington, Seattle WA USA

    2017-07-24

    Anoxygenic purple phototrophic bacteria have served as important models for studies of photophosphorylation. The pigment-protein complexes responsible for converting light energy to ATP are relatively simple and these bacteria can grow heterotrophically under aerobic conditions, thus allowing for the study of mutants defective in photophosphorylation. In the past, genes responsible for anoxygenic phototrophic growth have been identified in a number of different bacterial species. Here we systematically studied the genetic basis for this metabolism by using Tn-seq to identify genes essential for the anaerobic growth of the purple bacterium Rhodopseudomonas palustris on acetate in light. We identified 171 genes required for growth in this condition, 35 of which are annotated as photosynthesis genes. Among these are a few new genes not previously shown to be essential for phototrophic growth. We verified the essentiality of many of the genes we identified by analyzing the phenotypes of mutants we generated by Tn mutagenesis that had altered pigmentation. We used directed mutagenesis to verify that the R. palustris NADH:quinone oxidoreductase complex IE is essential for phototrophic growth. As a complement to the genetic data, we carried out proteomics experiments in which we found that 429 proteins were present in significantly higher amounts in cells grown anaerobically in light compared to aerobically. Among these were proteins encoded by subset of the phototrophic growth-essential genes.

  7. The ecological classification of coastal wet longleaf pine (pinus palustris) of Florida from reference conditions

    Science.gov (United States)

    George L. McCaskill; Jose. Shibu

    2012-01-01

    Tropical storms, fire, and urbanization have produced a heavily fragmented forested landscape along Florida’s Gulf coast. The longleaf pine forest, one of the most threatened ecosystems in the US, makes up a major part of this fragmented landscape. These three disturbance regimes have produced a mosaic of differently-aged pine patches of single or two cohort structures...

  8. Factors Affecting the Distribution of Wild Rice (Zizania palustris) and the Surrounding Macrophyte Community.

    Science.gov (United States)

    Pillsbury, R. W.; McGuire, M.

    2005-05-01

    A recent decline in wild rice wetlands is cause for concern due to its importance as a food source, refuge for wildlife, and cultural significance. Sixty wetlands in Wisconsin and Minnesota (USA) were sampled, with approximately equal numbers displaying dense, moderate and sparse wild rice production. Chemical, physical, and watershed parameters were measured as well as macrophyte densities. Data were analyzed using multivariate statistics (CCA). Moderate levels of phosphorus appear beneficial to the overall success of wild rice, while free-floating macrophytes show an overwhelming positive response to higher levels of P. The distribution of macrophytes bordering wild rice beds is correlated to pH,with Potamogeton robbinsii and filamentous green algae responding most strongly to its increase. Healthy stands of wild rice exhibit a narrow circum-neutral range of pH (6.1-8.0)which is significantly different from the greater range exhibited by sparse wild rice wetlands (6.5-8.5). This pattern was paralleled when considering depth which suggests that deeper wetlands may be more susceptible to wild rice loss. Management of existing wild rice wetlands should focus monitoring on pH, depth, phosphorus concentrations and shore development. We are currently using this data base to locate the best reintroduction sites for wild rice.

  9. Moulting and wintering grounds of Marsh Warblers Acrocephalus palustris: evidence from stable isotopes and ring recoveries

    Czech Academy of Sciences Publication Activity Database

    Procházka, Petr; Kralj, J.; Pearson, D. J.; Yohannes, E.

    2014-01-01

    Roč. 49, č. 2 (2014), s. 193-200 ISSN 0001-6454 R&D Projects: GA ČR GA13-06451S Institutional support: RVO:68081766 Keywords : bird migration * feather stable isotopes * ring recoveries * stopover * migratory connectivity * δ13C * δ15N Subject RIV: EG - Zoology Impact factor: 0.745, year: 2014

  10. Resprouting after disturbance in the short-lived herb Rorippa palustris (Brassicaceae): an experiment with juveniles

    Czech Academy of Sciences Publication Activity Database

    Martínková, Jana; Kočvarová, Marie; Klimešová, Jitka

    2004-01-01

    Roč. 25, č. 3 (2004), s. 143-150 ISSN 1146-609X R&D Projects: GA AV ČR KSK6005114; GA ČR GD206/03/H034; GA ČR GA206/01/1039 Institutional research plan: CEZ:AV0Z6005908 Keywords : root-sprouting * bud bank * disturbance Subject RIV: EF - Botanics Impact factor: 1.034, year: 2004

  11. Photosynthetic consequences of phenotypic plasticity in response to submergence: Rumex palustris as a case study

    NARCIS (Netherlands)

    Mommer, L.; Pons, T.L.; Visser, E.J.W.

    2006-01-01

    Survival and growth of terrestrial plants is negatively affected by complete submergence. This is mainly the result of hampered gas exchange between plants and their environment, since gas diffusion is severely reduced in water compared with air, resulting in O2 deficits which limit aerobic

  12. Time series analysis of forest carbon dynamics: recovery of Pinus palustris physiology following a prescribed fire

    Science.gov (United States)

    G. Starr; C. L. Staudhammer; H. W. Loescher; R. Mitchell; A. Whelan; J. K. Hiers; J. J. O’Brien

    2015-01-01

    Frequency and intensity of fire determines the structure and regulates the function of savanna ecosystems worldwide, yet our understanding of prescribed fire impacts on carbon in these systems is rudimentary. We combined eddy covariance (EC) techniques and fuel consumption plots to examine the short-term response of longleaf pine forest carbon dynamics to one...

  13. Spatial patterns of longleaf pine (Pinus palustris) seedling eastablishment on the croatan national forest, North Carolina

    Science.gov (United States)

    Chadwick R. Avery; Susan Cohen; Kathleen C. Parker; John S. Kush

    2004-01-01

    Ecological research aimed at determining optimal conditions for longleaf pine regeneration has become increasingly important in efforts @ restore the longleaf pine ecosystem. Numerous authors have concluded that a negative relationship exists between the occurrence of seedlings and the occurrence of mature trees; however, observed field conditions in several North...

  14. Spatial and Temporal Analyses of Environmental Affects on Zizania Palustris and Its Natural Cycles

    Science.gov (United States)

    Rickman, Douglas L.; Greensky, Wayne; Al-Hamdan, M. Z.; Estes, M. G.; Crosson, W. L.; Estes, Sue M.

    2017-01-01

    As part of a joint education and research effort funded by NASA, research studies were initiated involving students associated with the Ojibwe and researchers at Marshall Space Flight Center. Topics were chosen that satisfied the nature of the work proposed and were tractable, given the student's constraints (abilities, interests, and time). One of the studies, which spanned two summers, examined some potential environmental effects on northern wild rice in northern Wisconsin. The rice of interest is naturally occurring ('wild' wild rice), as opposed to cultivated wild rice ('paddy' wild rice).

  15. Differences in mycorrhizal communities between Epipactis palustris, E. helleborine and its presumed sister species E. neerlandica

    OpenAIRE

    Jacquemyn, Hans; Waud, Michael; Lievens, Bart; Brys, Rein

    2016-01-01

    Background and Aims In orchid species that have populations occurring in strongly contrasting habitats, mycorrhizal divergence and other habitat-specific adaptations may lead to the formation of reproductively isolated taxa and ultimately to species formation. However, little is known about the mycorrhizal communities associated with recently diverged sister taxa that occupy different habitats.

  16. Phosphoenolpyruvate-dependent fructose phosphotransferase system in Rhodopseudomonas sphaeroides : The coupling between transport and phosphorylation in inside-out vesicles

    NARCIS (Netherlands)

    Lolkema, Juke S.; Robillard, George T.

    The bacterial phosphotransferase systems are believed to catalyze the concomitant transport and phosphorylation of hexoses and hexitols. The transport is from the outside to the inside of the cell. An absolute coupling between transport and phosphorylation has however been questioned in the

  17. Fire Frequency Effects on Longleaf Pine (Pinus palustris P. Miller) Vegetation in South Carolina and Northeast Florida, USA

    Science.gov (United States)

    Jeff S. Glitzenstein; Donna R. Streng; Dale D. Wade

    2003-01-01

    Southeastern United States habitats dominated by longleaf pine (Pinus pulutris P. Miller) have declined precipitously in area and extent. Conservation of diverse ground-layer vegetation in these endangered habitats depends on prescribed fire. While the need for prescribed fire is now generally accepted, there is disagreement concerning the most...

  18. The effect of flooding and injury on vegetative regeneration from roots: a case study with Rorippa palustris

    Czech Academy of Sciences Publication Activity Database

    Sosnová, Monika; Klimešová, Jitka

    2013-01-01

    Roč. 214, č. 8 (2013), 999-1006 ISSN 1385-0237 R&D Projects: GA ČR GA526/09/0963 Institutional support: RVO:67985939 Keywords : root buds * submergence * disturbance Subject RIV: EH - Ecology, Behaviour Impact factor: 1.640, year: 2013

  19. LONG-TERM TRENDS IN GROWTH OF PINUS PALUSTRIS AND PINUS ELLIOTTII GROWING ALONG A HYDROLOGICAL GRADIENT IN CENTRAL FLORIDA

    Science.gov (United States)

    Land-use change and urbanization has led to changes in the hydrologic regime in wet central Florida, with a trend toward lowered water table levels. These hydrologic changes are having environmental consequences in wetlands, where shifts in species composition and fire frequency...

  20. Imputation of individual longleaf pine (Pinus palustris Mill.) tree attributes from field and LiDAR data

    Science.gov (United States)

    Carlos A. Silva; Andrew T. Hudak; Lee A. Vierling; E. Louise Loudermilk; Joseph J. O' Brien; J. Kevin Hiers; Steve B. Jack; Carlos Gonzalez-Benecke; Heezin Lee; Michael J. Falkowski; Anahita Khosravipour

    2016-01-01

    Light Detection and Ranging (LiDAR) has demonstrated potential for forest inventory at the individual-tree level. The aim in this study was to predict individual-tree height (Ht; m), basal area (BA; m2), and stem volume (V; m3...

  1. Study of Feasibility Integrated Agroindustry Development Unit Black Grass Jelly Powder (Mesona palustris in Province of East Java

    Directory of Open Access Journals (Sweden)

    Irvan Adhin Cholilie

    2017-01-01

    Full Text Available Potential of black grass jelly plant in Indonesia is very prospective. These plants grow in areas such as Malang East Java, Pacitan, Magetan and Ponorogo. In 2010 the production of dried black grass jelly of 568 tons with a total productivity of 8.6 tons / year.  Location selection of the plant with a score weighting method produces the highest value of 4,16 for the city of Surabaya, so the establishment of the plant will be held in Surabaya. Therefore, it is necessary the application of a suitable drying models for this factory that is tunnel dryer based on the results of research and with the highest value is 4,281. To ensure the availability of black grass jelly dried leaves as raw materials of black grass jelly powder it is necessary to establish a partnership between farmers and companies. The partnership pattern that works best for black grass jelly powder factory is a partnership “inti plasma”. It is based on research with the results of the assessment and weighting by using pairwise comparison and rating scale, the value of the highest weight in the “inti plasma” partnership with a value of 4,893. By implementing this partnership will allow the factory to obtain raw materials easily and is more economical and can always be available throughout the year for partnering with farmers.    Keywords: black grass jelly powder, drying method, financial feasibility analysis, partnership patterns

  2. Life-history variation in the short-lived herb Rorippa palustris: effects of germination date and injury timing

    Czech Academy of Sciences Publication Activity Database

    Klimešová, Jitka; Sosnová, Monika; Martínková, Jana

    2007-01-01

    Roč. 189, - (2007), s. 237-246 ISSN 1385-0237 R&D Projects: GA ČR GD206/03/H034 Institutional research plan: CEZ:AV0Z60050516 Keywords : Bud bank * Cohorts * Life history Subject RIV: EF - Botanics Impact factor: 1.236, year: 2007

  3. No evidence for memory interference across sessions in food hoarding marsh tits Poecile palustris under laboratory conditions.

    Science.gov (United States)

    Urhan, A Utku; Brodin, Anders

    2015-05-01

    Scatter hoarding birds are known for their accurate spatial memory. In a previous experiment, we tested the retrieval accuracy in marsh tits in a typical laboratory set-up for this species. We also tested the performance of humans in this experimental set-up. Somewhat unexpectedly, humans performed much better than marsh tits. In the first five attempts, humans relocated almost 90 % of the caches they had hidden 5 h earlier. Marsh tits only relocated 25 % in the first five attempts and just above 40 % in the first ten attempts. Typically, in this type of experiment, the birds will be caching and retrieving many times in the same sites in the same experimental room. This is very different from the conditions in nature where hoarding parids only cache once in a caching site. Hence, it is possible that memories from previous sessions will disturb the formation of new memories. If there is such proactive interference, the prediction is that success should decay over sessions. Here, we have designed an experiment to investigate whether there is such memory interference in this type of experiment. We allowed marsh tits and humans to cache and retrieve in three repeated sessions without prior experience of the arena. The performance did not change over sessions, and on average, marsh tits correctly visited around 25 % of the caches in the first five attempts. The corresponding success in humans was constant across sessions, and it was around 90 % on average. We conclude that the somewhat poor performance of the marsh tits did not depend on proactive memory interference. We also discuss other possible reasons for why marsh tits in general do not perform better in laboratory experiments.

  4. Adaptation of Rhodopseudomonas acidophila strain 7050 to growth at different light intensities: what are the benefits to changing the type of LH2?

    Science.gov (United States)

    Gardiner, A T; Niedzwiedzki, D M; Cogdell, R J

    2018-04-01

    Typical purple bacterial photosynthetic units consist of light harvesting one/reaction centre 'core' complexes surrounded by light harvesting two complexes. Factors such as the number and size of photosynthetic units per cell, as well as the type of light harvesting two complex that is produced, are controlled by environmental factors. In this paper, the change in the type of LH2 present in the Rhodopsuedomonas acidophila strain 7050 is described when cells are grown at a range of different light intensities. This species contains multiple pucBA genes that encode the apoproteins that form light-harvesting complex two, and a more complex mixture of spectroscopic forms of this complex has been found than was previously thought to be the case. Femto-second time resolved absorption has been used to investigate how the energy transfer properties in the membranes of high-light and low-light adapted cells change as the composition of the LH2 complexes varies.

  5. A pilot-scale study of biohydrogen production from distillery effluent using defined bacterial co-culture

    Energy Technology Data Exchange (ETDEWEB)

    Vatsala, T.M.; Raj, S. Mohan; Manimaran, A. (Shri AMM Murugappa Chettiar Research Centre, Photosynthesis and Energy Division, Tharamani, Chennai, India, 600)

    2008-10-15

    We evaluated the feasibility of improving the scale of hydrogen (H{sub 2}) production from sugar cane distillery effluent using co-cultures of Citrobacter freundii 01, Enterobacter aerogenes E10 and Rhodopseudomonas palustris P2 at 100 m{sup 3} scale. The culture conditions at 100 ml and 2 L scales were optimized in minimal medium and we observed that the co-culture of the above three strains enhanced H{sub 2} productivity significantly. Results at the 100 m{sup 3} scale revealed a maximum of 21.38 kg of H{sub 2}, corresponding to 10692.6 mol, which was obtained through batch method at 40 h from reducing sugar (3862.3 mol) as glucose. The average yield of H{sub 2} was 2.76 mol mol{sup -1} glucose, and the rate of H{sub 2} production was estimated as 0.53 kg/100 m{sup 3}/h. Our results demonstrate the utility of distillery effluent as a source of clean alternative energy and provide insights into treatment for industrial exploitation. (author)

  6. Effects of probiotics on the growth performance and intestinal micro flora of broiler chickens.

    Science.gov (United States)

    Li, Yin-bo; Xu, Qian-qian; Yang, Cun-jin; Yang, Xin; Lv, Le; Yin, Chun-hua; Liu, Xiao-lu; Yan, Hai

    2014-05-01

    Antibiotics have been used in poultry industry for decades to promote growth and protect animals from diseases, followed by various side effects. In efforts of searching for a better alternative, probiotic is of extensive attention. We investigated the effects of Bacillus subtitles, Rhodopseudomonas palustris, Candida utilis and Lactobacillus acidophilus as 0.1% (W/W) feed additives on broiler growth performance and intestinal microflora. The results showed the probiotics treatments significantly improved growth of broilers. Broilers supplemented with B. subtilis and L. acidophilus weighed 18.4% and 10.1% more than birds in control group at 42 days of age. Furthermore the feed conversion ratios of the birds in the two groups were also improved, decreasing 9.1% and 12.9%, respectively. Further study indicated a significant increase of cecal Lactobacilli concentration in briolers supplemented with probiotics, expecially in L. acidophilus treatment group. Meanwhile, the count of cecal Actinomyces in birds treated with probiotics was significantly lower compared with the control group. In conclusion, probiotics such as B. subtitles and L. acidophilus are good alternatives to antibiotics in promoting growth resulting from a beneficial modulation of the intestinal micro flora, which leads to increased efficiency of intestinal digestion in the host animal.

  7. Development of bacteria-based bioassays for arsenic detection in natural waters.

    Science.gov (United States)

    Diesel, Elizabeth; Schreiber, Madeline; van der Meer, Jan Roelof

    2009-06-01

    Arsenic contamination of natural waters is a worldwide concern, as the drinking water supplies for large populations can have high concentrations of arsenic. Traditional techniques to detect arsenic in natural water samples can be costly and time-consuming; therefore, robust and inexpensive methods to detect arsenic in water are highly desirable. Additionally, methods for detecting arsenic in the field have been greatly sought after. This article focuses on the use of bacteria-based assays as an emerging method that is both robust and inexpensive for the detection of arsenic in groundwater both in the field and in the laboratory. The arsenic detection elements in bacteria-based bioassays are biosensor-reporter strains; genetically modified strains of, e.g., Escherichia coli, Bacillus subtilis, Staphylococcus aureus, and Rhodopseudomonas palustris. In response to the presence of arsenic, such bacteria produce a reporter protein, the amount or activity of which is measured in the bioassay. Some of these bacterial biosensor-reporters have been successfully utilized for comparative in-field analyses through the use of simple solution-based assays, but future methods may concentrate on miniaturization using fiberoptics or microfluidics platforms. Additionally, there are other potential emerging bioassays for the detection of arsenic in natural waters including nematodes and clams.

  8. Bioaugmentation for Electricity Generation from Corn Stover Biomass Using Microbial Fuel Cells

    KAUST Repository

    Wang, Xin

    2009-08-01

    Corn stover is usually treated by an energy-intensive or expensive process to extract sugars for bioenergy production. However, it is possible to directly generate electricity from corn stover in microbial fuel cells (MFCs) through the addition of microbial consortia specifically acclimated for biomass breakdown. A mixed culture that was developed to have a high saccharification rate with corn stover was added to singlechamber, air-cathode MFCs acclimated for power production using glucose. The MFC produced a maximum power of 331 mW/ m 2 with the bioaugmented mixed culture and corn stover, compared to 510 mW/m2 using glucose. Denaturing gradient gel electrophoresis (DGGE) showed the communities continued to evolve on both the anode and corn stover biomass over 60 days, with several bacteria identified including Rhodopseudomonas palustris. The use of residual solids from the steam exploded corn stover produced 8% more power (406 mW/m2) than the raw corn stover. These results show that it is possible to directly generate electricity from waste corn stover in MFCs through bioaugmentation using naturally occurring bacteria. © 2009 American Chemical Society.

  9. Change in microbial communities in acetate- and glucose-fed microbial fuel cells in the presence of light

    KAUST Repository

    Xing, Defeng

    2009-09-01

    Power densities produced by microbial fuel cells (MFCs) in natural systems are changed by exposure to light through the enrichment of photosynthetic microorganisms. When MFCs with brush anodes were exposed to light (4000 lx), power densities increased by 8-10% for glucose-fed reactors, and 34% for acetate-fed reactors. Denaturing gradient gel electrophoresis (DGGE) profiles based on the 16S rRNA gene showed that exposure to high light levels changed the microbial communities on the anodes. Based on 16S rRNA gene clone libraries of light-exposed systems the anode communities using glucose were also significantly different than those fed acetate. Dominant bacteria that are known exoelectrogens were identified in the anode biofilm, including a purple nonsulfur (PNS) photosynthetic bacterium, Rhodopseudomonas palustris, and a dissimilatory iron-reducing bacterium, Geobacter sulfurreducens. Pure culture tests confirmed that PNS photosynthetic bacteria increased power production when exposed to high light intensities (4000 lx). These results demonstrate that power production and community composition are affected by light conditions as well as electron donors in single-chamber air-cathode MFCs. © 2009 Elsevier B.V. All rights reserved.

  10. Introducing capnophilic lactic fermentation in a combined dark-photo fermentation process: a route to unparalleled H2 yields.

    Science.gov (United States)

    Dipasquale, L; Adessi, A; d'Ippolito, G; Rossi, F; Fontana, A; De Philippis, R

    2015-01-01

    Two-stage process based on photofermentation of dark fermentation effluents is widely recognized as the most effective method for biological production of hydrogen from organic substrates. Recently, it was described an alternative mechanism, named capnophilic lactic fermentation, for sugar fermentation by the hyperthermophilic bacterium Thermotoga neapolitana in CO2-rich atmosphere. Here, we report the first application of this novel process to two-stage biological production of hydrogen. The microbial system based on T. neapolitana DSM 4359(T) and Rhodopseudomonas palustris 42OL gave 9.4 mol of hydrogen per mole of glucose consumed during the anaerobic process, which is the best production yield so far reported for conventional two-stage batch cultivations. The improvement of hydrogen yield correlates with the increase in lactic production during capnophilic lactic fermentation and takes also advantage of the introduction of original conditions for culturing both microorganisms in minimal media based on diluted sea water. The use of CO2 during the first step of the combined process establishes a novel strategy for biohydrogen technology. Moreover, this study opens the way to cost reduction and use of salt-rich waste as feedstock.

  11. Electron uptake by iron-oxidizing phototrophic bacteria

    Energy Technology Data Exchange (ETDEWEB)

    Bose, A; Gardel, EJ; Vidoudez, C; Parra, EA; Girguis, PR

    2014-02-26

    Oxidation-reduction reactions underlie energy generation in nearly all life forms. Although most organisms use soluble oxidants and reductants, some microbes can access solid-phase materials as electron-acceptors or -donors via extracellular electron transfer. Many studies have focused on the reduction of solid-phase oxidants. Far less is known about electron uptake via microbial extracellular electron transfer, and almost nothing is known about the associated mechanisms. Here we show that the iron-oxidizing photoautotroph Rhodopseudomonas palustris TIE-1 accepts electrons from a poised electrode, with carbon dioxide as the sole carbon source/electron acceptor. Both electron uptake and ruBisCo form I expression are stimulated by light. Electron uptake also occurs in the dark, uncoupled from photosynthesis. Notably, the pioABC operon, which encodes a protein system essential for photoautotrophic growth by ferrous iron oxidation, influences electron uptake. These data reveal a previously unknown metabolic versatility of photoferrotrophs to use extracellular electron transfer for electron uptake.

  12. Development of bacteria-based bioassays for arsenic detection in natural waters

    Energy Technology Data Exchange (ETDEWEB)

    Diesel, Elizabeth; Schreiber, Madeline [Virginia Tech, Department of Geosciences, Blacksburg, VA (United States); Meer, Jan Roelof van der [University of Lausanne, Department of Fundamental Microbiology, Lausanne (Switzerland)

    2009-06-15

    Arsenic contamination of natural waters is a worldwide concern, as the drinking water supplies for large populations can have high concentrations of arsenic. Traditional techniques to detect arsenic in natural water samples can be costly and time-consuming; therefore, robust and inexpensive methods to detect arsenic in water are highly desirable. Additionally, methods for detecting arsenic in the field have been greatly sought after. This article focuses on the use of bacteria-based assays as an emerging method that is both robust and inexpensive for the detection of arsenic in groundwater both in the field and in the laboratory. The arsenic detection elements in bacteria-based bioassays are biosensor-reporter strains; genetically modified strains of, e.g., Escherichia coli, Bacillus subtilis, Staphylococcus aureus, and Rhodopseudomonas palustris. In response to the presence of arsenic, such bacteria produce a reporter protein, the amount or activity of which is measured in the bioassay. Some of these bacterial biosensor-reporters have been successfully utilized for comparative in-field analyses through the use of simple solution-based assays, but future methods may concentrate on miniaturization using fiberoptics or microfluidics platforms. Additionally, there are other potential emerging bioassays for the detection of arsenic in natural waters including nematodes and clams. (orig.)

  13. Phylogenetic diversity of hpnP, the hopanoid methylase, and its implications for 2-methylhopanoids as biomarkers

    Science.gov (United States)

    Ricci, J. N.; Coleman, M. L.; Osburn, M. R.; Sessions, A. L.; Spear, J. R.; Newman, D. K.

    2011-12-01

    Hopanoids are a class of sterols produced by bacteria. Their hydrocarbon skeletons are resistant to degradation making their diagenetic products, hopanes, attractive biomarkers. Particular attention has been paid to 2-methylhopanes, which have been found at discrete times and locations in Earth history as far back as 2,500 Myr. Previously, they were inferred to be markers of oxygenic photosynthesis in cyanobacteria, but the discovery of an anoxygenic phototroph, Rhodopseudomonas palustris TIE-1, capable of producing significant quantities of 2-methylbacteriohopanetetrol, the parent molecule of the fossil 2-methylhopane, challenged this interpretation. In this study, we sought to determine the diversity and origin of the enzyme responsible for methylating hopanoids, HpnP. To accomplish this task, we surveyed a diversity of Yellowstone hot springs using degenerate PCR primers and searched publically available metagenomic databases for hpnP-like sequences. The Yellowstone hot spring samples were dominated by cyanobacterial-like hpnP sequences, while the metagenomic data contained many hpnP-like sequences from a diversity of environments that grouped with all known hpnP-containing phyla. With these additional hpnP sequences, we will report updated phylogenetic trees that attempt to determine the origin of hpnP. Understanding the distribution of 2-methylhopanoid production throughout the tree of life and its origin is important to be able to use 2-methylhopanes as biomarkers for any particular taxonomic group.

  14. Arsenic biotransformation and volatilization in transgenic rice

    Science.gov (United States)

    Meng, Xiang-Yan; Qin, Jie; Wang, Li-Hong; Duan, Gui-Lan; Sun, Guo-Xin; Wu, Hui-Lan; Chu, Cheng-Cai; Ling, Hong-Qing; Rosen, Barry P.; Zhu, Yong-Guan

    2011-01-01

    Summary Biotransformation of arsenic includes oxidation, reduction, methylation and conversion to more complex organic arsenicals. Members of the class of arsenite [As(III)] S-adenosylmethyltransferase enzymes catalyze As(III) methylation to a variety of mono-, di- and trimethylated species, some of which are less toxic than As(III) itself. However, no methyltransferase gene has been identified in plants. Here, an arsM gene from the soil bacterium Rhodopseudomonas palustris was expressed in Japonica rice (Oryza sativa L.) cultivar Nipponbare, and the transgenic rice produced methylated arsenic species, which were measured by inductively coupled plasma mass spectrometry (ICP-MS) and high performance liquid chromatography-inductively coupled plasma-mass spectrometry (HPLC-ICP-MS). Both monomethylarsenate [MAs(V)] and dimethylarsenate [DMAs(V)] were detected in the root and shoot of transgenic rice. After 12-d exposure to As(III), the transgenic rice gave off 10-fold more volatile arsenicals. The present study demonstrates that expression of an arsM gene in rice induces arsenic methylation and volatilization, providing a potential stratagem for phytoremediation theoretically. PMID:21517874

  15. Effect of light-dark cycles on hydrogen and poly-β-hydroxybutyrate production by a photoheterotrophic culture and Rhodobacter capsulatus using a dark fermentation effluent as substrate.

    Science.gov (United States)

    Montiel Corona, Virginia; Le Borgne, Sylvie; Revah, Sergio; Morales, Marcia

    2017-02-01

    A Rhodobacter capsulatus strain and a photoheterotrophic culture (IZT) were cultivated to produce hydrogen under different light-dark cycles. A dark fermentation effluent (DFE) was used as substrate. It was found that IZT culture had an average cumulative hydrogen production (Paccum H 2 ) of 1300±43mLH 2 L -1 under continuous illumination and light-dark cycles of 30 or 60min. In contrast, R. capsulatus reduced its Paccum H 2 by 20% under 30:30min light-dark cycles, but tripled its poly-β-hydroxybutyrate (PHB) content (308±2mgPHB gdw -1 ) compared to continuous illumination. The highest PHB content by IZT culture was 178±10mgPHB gdw -1 under 15:15min light-dark cycles. PCR-DGGE analysis revealed that the IZT culture was mainly composed of Rhodopseudomonas palustris identified with high nucleotide similarity (99%). The evaluated cultures might be used for hydrogen and PHB production. They might provide energy savings by using light-dark cycles and DFE valorization. Copyright © 2016 Elsevier Ltd. All rights reserved.

  16. Beneficial effects of Ectothiorhodospira shaposhnikovii WF on larval cultivation of Litopenaeus vannamei.

    Science.gov (United States)

    Wen, C Q; Xue, M; Liang, H F; Wu, Y; Li, X

    2015-01-01

    To develop high quality probiotics for shrimp larviculture, the effects of a photosynthetic purple sulphur bacterium WF identified as Ectothiorhodospira shaposhnikovii on survival and development of Litopenaeus vannamei larvae were evaluated in vivo. The larvae exhibited a better survival rate after administration of strain WF compared to the probiotic Rhodopseudomonas palustris. To investigate the effect of dose and dosing frequency, strain WF was added to larvae, stages nauplius 6 to zoea 3, at three different doses and dosing frequencies. Larval treatment with strain WF twice at 10(6) cfu/ml exhibited significantly higher survival compared to the other doses and dosing frequencies as well as the control. The effect on water quality was assessed by applying strain WF to larvae, stages nauplius 6 to postlarvae 1, under conditions of zero water exchange and one-third water exchange. The larvae exhibited higher survival and faster growth when treated under conditions of zero water exchange. No significant difference was detected in the levels of three water quality parameters and in vibrio counts between these two conditions. Therefore, E. shaposhnikovii WF acts both as a bioremediation agent and nutrient source and can benefit shrimp larvae if given at an appropriate dose and dosing frequency. Strain WF, a moderate halophile, shows great promise as a water additive in improving water quality and providing nutrition for shrimp larviculture.

  17. Change in microbial communities in acetate- and glucose-fed microbial fuel cells in the presence of light

    KAUST Repository

    Xing, Defeng; Cheng, Shaoan; Regan, John M.; Logan, Bruce E.

    2009-01-01

    Power densities produced by microbial fuel cells (MFCs) in natural systems are changed by exposure to light through the enrichment of photosynthetic microorganisms. When MFCs with brush anodes were exposed to light (4000 lx), power densities increased by 8-10% for glucose-fed reactors, and 34% for acetate-fed reactors. Denaturing gradient gel electrophoresis (DGGE) profiles based on the 16S rRNA gene showed that exposure to high light levels changed the microbial communities on the anodes. Based on 16S rRNA gene clone libraries of light-exposed systems the anode communities using glucose were also significantly different than those fed acetate. Dominant bacteria that are known exoelectrogens were identified in the anode biofilm, including a purple nonsulfur (PNS) photosynthetic bacterium, Rhodopseudomonas palustris, and a dissimilatory iron-reducing bacterium, Geobacter sulfurreducens. Pure culture tests confirmed that PNS photosynthetic bacteria increased power production when exposed to high light intensities (4000 lx). These results demonstrate that power production and community composition are affected by light conditions as well as electron donors in single-chamber air-cathode MFCs. © 2009 Elsevier B.V. All rights reserved.

  18. Performance, carotenoids yield and microbial population dynamics in a photobioreactor system treating acidic wastewater: Effect of hydraulic retention time (HRT) and organic loading rate (OLR).

    Science.gov (United States)

    Liu, Shuli; Zhang, Guangming; Zhang, Jie; Li, Xiangkun; Li, Jianzheng

    2016-01-01

    Effects of hydraulic retention time (HRT) and influent organic loading rate (OLR) were investigated in a photobioreactor containing PNSB (Rhodopseudomonas palustris)-chemoheterotrophic bacteria to treat volatile fatty acid wastewater. Pollutants removal, biomass production and carotenoids yield in different phases were investigated in together with functional microbial population dynamics. The results indicated that properly decreasing HRT and increasing OLR improved the nutrient removal performance as well as the biomass and carotenoids productions. 85.7% COD, 89.9% TN and 91.8% TP removals were achieved under the optimal HRT of 48h and OLR of 2.51g/L/d. Meanwhile, the highest biomass production and carotenoids yield were 2719.3mg/L and 3.91mg/g-biomass respectively. In addition, HRT and OLR have obvious impacts on PNSB and total bacteria dynamics. Statistical analyses indicated that the COD removal exhibited a positive relationship with OLR, biomass and carotenoids production. PNSB/total bacteria ratio had a positive correlation with the carotenoids yield. Copyright © 2015 Elsevier Ltd. All rights reserved.

  19. Recipient-Biased Competition for an Intracellularly Generated Cross-Fed Nutrient Is Required for Coexistence of Microbial Mutualists.

    Science.gov (United States)

    McCully, Alexandra L; LaSarre, Breah; McKinlay, James B

    2017-11-28

    Many mutualistic microbial relationships are based on nutrient cross-feeding. Traditionally, cross-feeding is viewed as being unidirectional, from the producer to the recipient. This is likely true when a producer's waste, such as a fermentation product, has value only for a recipient. However, in some cases the cross-fed nutrient holds value for both the producer and the recipient. In such cases, there is potential for nutrient reacquisition by producer cells in a population, leading to competition against recipients. Here, we investigated the consequences of interpartner competition for cross-fed nutrients on mutualism dynamics by using an anaerobic coculture pairing fermentative Escherichia coli and phototrophic Rhodopseudomonas palustris In this coculture, E. coli excretes waste organic acids that provide a carbon source for R. palustris In return, R. palustris cross-feeds E. coli ammonium (NH 4 + ), a compound that both species value. To explore the potential for interpartner competition, we first used a kinetic model to simulate cocultures with varied affinities for NH 4 + in each species. The model predicted that interpartner competition for NH 4 + could profoundly impact population dynamics. We then experimentally tested the predictions by culturing mutants lacking NH 4 + transporters in both NH 4 + competition assays and mutualistic cocultures. Both theoretical and experimental results indicated that the recipient must have a competitive advantage in acquiring cross-fed NH 4 + to sustain the mutualism. This recipient-biased competitive advantage is predicted to be crucial, particularly when the communally valuable nutrient is generated intracellularly. Thus, the very metabolites that form the basis for mutualistic cross-feeding can also be subject to competition between mutualistic partners. IMPORTANCE Mutualistic relationships, particularly those based on nutrient cross-feeding, promote stability of diverse ecosystems and drive global biogeochemical

  20. Biotechnologische Konversion von Nebenströmen der Lebensmittelindustrie zu hochwertigen Aromastoffen durch Basidiomyceten

    OpenAIRE

    Kunkel, Katrin

    2013-01-01

    29 Basidiomyceten wurden hinsichtlich der Bildung von natürlichen Aromastoffgemischen in Substrat-supplementierten Submerskulturen untersucht. Als Substrate dienten Karottenschalen, Blattspinat, Sellerietrester, Zwiebelschalen, Lauchtrester und Zitruspellets, die als Reststoffe in der lebensmittelverarbeitenden Industrie anfallen. Die Geruchseindrücke von 61 Biotransformationen wurden im Vergleich zu den Substrat- und Pilz-Blindwerten beurteilt und die Reproduzierbarkeit der ansprechendsten B...

  1. Erkennung, Modellierung und Vermeidung von Hubschrauberlärm durch Blatt-Wirbel-Interaktionen

    OpenAIRE

    Gläßel, Holger

    2010-01-01

    In dieser Arbeit wird ein System zur Erkennung und Vermeidung von impulsivem Hubschrauberlärm aufgrund Blatt-Wirbel-Interaktionen (blade-vortex interaction, BVI) entwickelt. Als Auslegungsbasis dient der Entwurf eines vereinfachten neuronalen und somit datengetriebenen Modells des Wirbelnachlaufs. Die Ergebnisse aus der Simulation des Nachlaufmodells führen zur logischen Ableitung einer sehr einfachen, allgemein gültigen Regelstrategie zur Kontrolle der Wirbelflugbahnen. Aufgrund der effizien...

  2. Potential fuel savings through electric camschaft adjustment; Moeglichkeiten zur Kraftstoffeinsparung durch elektrische Nockenwellenverstellung

    Energy Technology Data Exchange (ETDEWEB)

    Krebber-Hortmann, Karl; Koester, Andreas; Toennesmann, Andres; Brunetti, Costantino [Pierburg GmbH, Neuss (Germany). Abt. Vorentwicklung

    2013-11-01

    KSPG has developed an electric variable cam timing system. Using simulations and engine tests, KSPG demonstrates the potential reduction in fuel consumption that the system offers when combined with technologies such as fully variable valve gear in a gasoline engine. (orig.)

  3. Environmental pollution from working fluids of ORC processes; Umweltbelastung durch Arbeitsstoffe fuer organische Rankine-Prozesse

    Energy Technology Data Exchange (ETDEWEB)

    Hartmann, K.

    2006-07-01

    The contribution quantifies the negative environmental effects of the potential loss of working fluids and/or refrigerants and the positive environmental effect of power generation without working fluids. The TEWI (Total Equivalent Warming Impact)concept which is common in refrigeration and air conditioning was modified for ORc systems and was used for assessing the environmental effects of potential working fluids. (orig.)

  4. Climate protection by reducing cooling demands in buildings; Klimaschutz durch Reduzierung des Energiebedarfs fuer Gebaeudekuehlung

    Energy Technology Data Exchange (ETDEWEB)

    Bettgenhaeuser, Kjell; Boermans, Thomas; Offermann, Markus; Krechting, Anja; Becker, Daniel [Ecofys Germany GmbH, Koeln (Germany)

    2011-06-15

    The aim of this study is to conduct estimation on the potential reduction in electricity demand from cooling appliances in buildings in Germany. Current electricity demand and greenhouse-gas emissions will be investigated through desk research for residential and non-residential buildings. Based on building simulations, conventional, alternative and renewable technologies will be compared for different reference buildings. An economic and environmental assessment will evaluate the technologies per reference building in further detail. The main result will be an estimation of the potential energy demand reduction for the alternative/ regenerative technologies in the building stock. This will be based on the conditioned floor area and retrofit rates per system. Furthermore, the influence of cooling in buildings on energy demand will be annotated. Barriers in the reduction of energy demand will be described possible actions will be discussed along with types of policy instruments and consumer information. (orig.)

  5. Smart Metering. Synergies within medium voltage automation; Synergien durch Smart Metering. Automatisierung auf Mittelspannungsebene

    Energy Technology Data Exchange (ETDEWEB)

    Maas, Peter [IDS GmbH, Ettlingen (Germany)

    2010-11-15

    Transparent interdivisional system solutions are an indispensable and decisive precondition for the optimization of business processes. The implementation of a Smart Metering solution does not only provide data for billing purposes, but also renders important data for network operation. Synergies can be achieved through the use of a common infrastructure which covers both the needs of Smart Metering and network operation. An open architecture of the solution allows for the future integration of further services of the domains Smart Grid and Smart Home. (orig.)

  6. Teilflächenspezifisches Kartoffelpflanzen durch eine GPS-gestützte Pflanzgutablage

    Directory of Open Access Journals (Sweden)

    Yves Reckleben

    2014-08-01

    Full Text Available Precision management makes it possible to align cultivation intensity with demand and thus adjust expenses to the necessary level. The proportion of normal-sized, marketable commodity – i. e. size grade 40 to 60 mm – can thus be increased in potato growing too. Planting distances adapted to the soil properties seem to achieve this objective. Yields could be improved further, especially in intensive potato-growing regions where irrigation and fertilizing already contribute to a consistently high yield potential in the rather light soils. Different planting distances on individual soil plots were tested in the authors’ own trials. Planting distances of 31.50 cm in light soils, 24.50 cm in medium soils and 27.50 cm in heavy soils produced the best results. Both the overall yield and the proportion of marketable goods were improved.

  7. Begnadigungen durch die tschechischen Präsidenten - Inspiration in der Geschichte?

    Czech Academy of Sciences Publication Activity Database

    Lojek, Antonín; Adamová, K.

    2014-01-01

    Roč. 4, č. 1 (2014), s. 5-13. ISBN 978-3-7001-7698-5. ISSN 2221-8890 Institutional support: RVO:68378122 Keywords : mercyof the President * constitution * countersignature Subject RIV: AG - Legal Sciences

  8. Bone alterations by stress in athletes. Schaedigung des Knochens durch Ueberlastung bei Leistungssportlern

    Energy Technology Data Exchange (ETDEWEB)

    Doege, H. (Bezirkskrankenhaus ' Friedrich Wolf' , Abt. fuer Nuklearmedizin, Chemnitz (Germany))

    1990-01-01

    This report describes our experiences with the bone imaging in athletes. We studied 10 athletes and 10 other patients with spondylolisthesis of the lumbar spine and 16 athletes with suspicion of alterations of extremities. An increased uptake of this radiopharmaceutical was detected in six of 10 athletes with spondylolisthesis caused probably by stress fracture. Bone scans were negative in seven of 16 athletes with suspicion of lesion of extremities. In the remaining 9 patients scans were abnormal and showed periosteal injuries, epiphyseal alteration, joint abnormalities, tibial stress fractures and couvert fracture. It was also abnormal in bone injuries not evident in radiography. (orig.).

  9. Optimised plant process management; Wirtschaftlicher Erfolg durch operative Exzellenz bei der Anlagenprozessfuehrung

    Energy Technology Data Exchange (ETDEWEB)

    Bieder, Markus [RWE Power AG, Ludwigshafen (Germany); Cremer, Hans-Peter [Kraftwerksschule e.V., Essen (Germany)

    2011-07-01

    Events leading to generation outages are to be avoided. Besides, highly qualified generation teams offer the potential to avoid or control new failures. In order to make advantage of these potentials, Kraftwerksschule is improving the process management behaviour of control room personnel at the Ludwigshafen site of RWE. Workshops beyond the individual scope of work and the internal CIP (continuous improvement process) turned out to be very successful. (orig.)

  10. Durch intrinsische defekte induzierte uphill-diffusion von Ag und Cu in CdTe

    CERN Document Server

    Wagner, Frank

    In the framework of the present thesis, the diffusion of Ag in CdTe was investigated by the radiotracer $^{111}$Ag. Thereby the focus was on the possibility to create a Ag flux from regions of low Ag concentration to regions of high Ag concentration (uphill diffusion). The experimentally observed diffusion profiles are explained in the framework of a thermodynamic diffusion model, taking into account the defect charge state and the defect interaction. The distribution of the charged defects produces a electric field, which leads to a drift of the charged defects. The experimental data are well explained assuming that Ag is incorporated interstitially and ionized (Agi$^{+}$). The Agi$^{+}$ concentration then reflects the profile of the Fermi level, which again is determined by the intrinsic defect distribution or, more precisely, the deviation from stoichiometry. On the basis of the experimental data it is possible to gather information on the thermodynamic properties of extrinsic as well as intrinsic defects....

  11. Zweiwegintegration durch zweisprachige Bildung? Ergebnisse aus der Staatlichen Europa-Schule Berlin

    Science.gov (United States)

    Meier, Gabriela

    2012-06-01

    While there is no simple recipe of how to respond to the multitude of languages present in many European schools, this article presents a promising alternative to monolingual education. The focus is on Staatliche Europa-Schule Berlin (SESB), a two-way immersion (TWI) model that unites children whose mother tongue is German with children whose mother tongue is another locally spoken language in one class and teaches them together in two languages. Thus in this model, offered by 17 primary schools and 13 secondary schools in Berlin, pupils learn in two languages from and with each other. Based on a largely quantitative, quasi-experimental study with 603 students, evidence is provided that there are a number of peace-linguistic benefits that can promote two-way social integration, besides fostering personal and societal multilingualism. This suggests that TWI education as practised in Berlin could serve as an educational model for other multilingual parts of Europe.

  12. Vermögensmaximierung durch Stiftungen als Unternehmensträger? Eine Analyse der Steuerwirkungen

    OpenAIRE

    Franke, Günter; Herrmann, Markus

    1993-01-01

    Einige große deutsche Unternehmen werden von privaten gemeinnützigen Stiftungen getragen. Dies wirft die Frage auf, weshalb eine solche Lösung der üblichen Vorgehensweise, bei der natürliche Personen Gesellschafter eines Unternehmens sind, vorgezogen wird. In diesem Beitrag wird untersucht, ob und unter welchen Voraussetzungen der Hauptgesellschafter einer Kapitalgesellschaft das Vermögen seiner Erben erhöhen kann, indem er seine Gesellschaftsanteile einer gemeinnütziger Stiftung überträgt un...

  13. Multifunctional facades - design optimisation with CAD; Multifunktionale Fassaden - Effektive Auslegung durch CAD-Einsatz

    Energy Technology Data Exchange (ETDEWEB)

    Viotto, M. [Institut fuer Solare Energieversorgungstechnik (ISET), Kassel (Germany). Abt. fuer Anlagen- und Messtechnik

    1998-02-01

    The energetically optimal design of PV facades requires the consideration of many technical conditions (different elevations/orientations of modules; shading possibility; high and different module temperatures). It also requires the interface with architecture, civil and electrical engineering. To support this planning process, the software program PV-CAD was developed which rapidly calculates energy yield under conditions of inhomogeneous irradiance, shading, thermal behaviour of modules and electrical layout. PV-CAD is compatible with other civil and electrical engineering CAD programs and incorporates extensive databases (weather data; modules and inverter types). (orig.) [Deutsch] Fuer optimalen Energieertrag sind zahlreiche technische Randbedingungen bei der Auslegung einer Photovoltaik (PV)-Fassade zu beruecksichtigen (unterschiedliche Ausrichtungen/Neigungen der Module; moegliche Teilabschattung; hoehere und unterschiedliche Betriebstemperaturen). Installation und Betrieb einer PV-Fassade erfordern die Abstimmung zwischen Architektur, Bauwesen und Elektrotechnik. Zur Unterstuetzung der Planer wurde das Programm PV-CAD entwickelt, das den Energieertrag unter Beruecksichtigung von inhomogener Einstrahlung und Abschattung, Temperaturverhalten der Fassadenmodule sowie unterschiedlichen elektrischen Anlagenkonzepten schnell ermittelt; es fuegt sich nahtlos in CAD-Arbeitsumgebungen ein. (orig.)

  14. Herausforderungen und Perspektiven zur Ermöglichung dualer Karrieren durch den Einsatz digitaler Medien

    Directory of Open Access Journals (Sweden)

    Linda Heise

    2018-03-01

    Full Text Available An important challenge of higher educational institutions is the inclusion of non-traditional learners. The following paper presents a project, which researched the challenges and special needs of student top athletes. First the paper will present the results of a qualitative study about the challenges and conditions of their study programs and commitments of student top athletes at the University of Applied Science Mittweida. Based on this results a blended learning scenario in combination with the flipped classroom has been introduced and tested.

  15. Electromobility - using opportunities through value-generating business models; Elektromobilitaet. Chancen durch wertschoepfende Geschaeftsmodelle nutzen

    Energy Technology Data Exchange (ETDEWEB)

    Timm, Christian; Vierbauch, Christoph [Process Management Consulting GmbH, Muenchen (Germany)

    2011-03-15

    Since press reports on the first electrically powered vehicle covering 600 km without recharge, if not possibly before, discussions about what used to be the bottleneck of electromobility, namely range, have subsided more and more into the background. Now the industry has new challenges to face, in particular the question of how electromobility products should be positioned so as to win the end consumer's interest. According to a recent TUeV survey, 54% of all interviewees are willing to buy an electrically powered vehicle. However, consumers are still put off by the high level of prices, long charging times and the lack of market transparency.

  16. Optimum heating through self-learning methods. Optimales Heizen durch selbstlernende Verfahren

    Energy Technology Data Exchange (ETDEWEB)

    Giger, A. (Siemens-Albis AG, Zurich (Switzerland))

    1991-10-01

    In order of optimally heat a building, the required comfort conditions have to be fulfilled at the right time with possibly low energy expenditure. Control and regulation systems contribute essentially to this requirement. By means of stored program control with integrated direct digital control (SPS/DDC), complex control and regulation functions can be rather easily solved via the software. Data and conditions of different system components are interchanged or are monitored and changed if necessary through the operator by means of a service and observation system. This high capacity range of SPS/DDC facilitates the realization of functions which correspond to the latest trends of energy experts. (orig./BWI).

  17. Our concept of the world is changed by nuclear power. Veraenderung unseres Weltbildes durch die Kernenergie

    Energy Technology Data Exchange (ETDEWEB)

    Knizia, K. (Vereinigte Elektrizitaetswerke Westfalen AG (VEW), Dortmund (Germany). Vorstand)

    1993-01-01

    In the absence of a positive agreement on the use of nuclear power mankind will not be able to live in peace. Viability is endagered by worldwide battles for energy. In the long term, the peaceful utilization of nuclear power must be given priority because the reserves of fossil energy resources will have been consumed in a few generations' time and renewable energy sources do not produce a yield high enough to meet the demand for energy of a continuously increasing world population. Creativity and captial must ensure sufficient and sustainable supplies of energy and goods for everybody. Environmental protection is facilitated by the use of nuclear power, for nuclear power is a source of energy whose waste can be removed from the biosphere completely and safely. (orig.).

  18. Signatures of dynamics in charge transport through organic molecules; Dynamisches Verhalten beim Ladungstransport durch organische Molekuele

    Energy Technology Data Exchange (ETDEWEB)

    Secker, Daniel

    2008-06-03

    The aim of the thesis at hand was to investigate dynamical behaviour in charge transport through organic molecules experimentally with the help of the mechanically controlled break junction (MCBJ) technique. the thesis concentrates on the complex interaction between the molecular contact configuration and the electronic structure. it is shown that by variation of the electrode distance and so by a manipulation of the molecule and contact configuration the electronic structure as well as the coupling between the molecule and the electrodes is affected. The latter statement is an additional hint how closely I-V-characteristics depend on the molecular contact configuration. Depending on the applied voltage and so the electric field there are two different configurations preferred by the molecular contact. A potential barrier between these two states is the origin of the hysteresis. A central part of the thesis is dealing with measurements of the current noise. Finally it can be concluded that the detailed discussion reveals the strong effect of dynamical interactions between the atomic configuration of the molecular contact and the electronic structure on the charge transport in single molecule junctions. (orig.)

  19. Formation damage by frac-fluids; Traegerschaedigung durch Frac-Fluide

    Energy Technology Data Exchange (ETDEWEB)

    Meyn, V.; Sachs, W.

    2003-11-01

    The aim of the project was to study the extent of the formation damage caused by frac fluids under simulated reservoir conditions. The studies included the determination of the properties of filter cakes to describe the leak off behaviour. A commercial system provided by the Schlumberger GmbH was applied to core material with a permeability range of 2.10{sup -12} - 1.10{sup -20} m{sup 2}. The frac-gel used generates in the temperature range 120 - 150 C compressible filter cakes. The filtration behaviour can be described by a plausible physical model, which is based on a pressure dependant compressibility. The parameters of the derived function are valid for a large permeability range of at least 2.10{sup -12} - 4.10{sup -16} m{sup 2}. The assumption of a spurt loss is not necessary. A relevant invasion of the rock material by detrimental polymer gel-components does not occur. However, the high p{sub H}-value of the filtrate induces dissolution processes in the rock matrix and thus changes of the rock properties. The effect of the retention of gel-components at high temperatures on the permeability is low. (orig.)

  20. Vorbereitung der medizinstudenten auf den übergang zur postgraduatiertenausbildung durch wahlfächerrotation

    NARCIS (Netherlands)

    van den Broek, W. E.Sjoukje; Wijnen-Meijer, Marjo; Ten Cate, Olle; van Dijk, Marijke

    2017-01-01

    Objectives: This study adds to the ongoing discussion on how to ease the transition from undergraduate medical training to postgraduate training. In the Netherlands there is no central matching system for admission to residency. Medical school graduates just apply for a position in an open job

  1. Energy saving by smart metering with consumption feedback; Energieeinsparung durch Smart Metering mit Verbrauchs-Feedback

    Energy Technology Data Exchange (ETDEWEB)

    Hoffmann, Patrick [Institut fuer ZukunftsEnergieSysteme (IZES), Saarbruecken (Germany); Friedrich, Malte [Institut fuer Soziologische Meinungsforschung (IsoMe), Berlin (Germany); Kerber-Clasen, Stefan [Institut fuer Sozialforschung und Sozialwirtschaft e.V., Saarbruecken (Germany); Frey, Guenther

    2012-08-15

    While the German legislative, e.g. in the EnWG (Power Industry Act) assumes that electricity consumption metering will contribute to energy conservation in any case, many studies have arrived at a different contribution: Only a combination of consumption metering and direct feedback methods will result in significant energy savings. A recent research project (''Moderne Energiesparsysteme fuer Haushalte'') analysed an energy conservation system of this type. The findings will provide socio-economic insight into the background of successful energy conservation, and they will show how feedback methods can be optimised.

  2. Weathering the competition through cooperation at customer service level; Erfolgreich im Wettbewerb durch Kooperation im Kundenservice

    Energy Technology Data Exchange (ETDEWEB)

    Quante, Katrin [VISOS GmbH, Moers (Germany)

    2012-01-15

    Rising customer churn rates in the wake of stiffening competition are aggravating the cost pressure on energy supply companies. More and more energy suppliers are seeking cooperations as a means of countering the growing cost pressure, rapidity of change and growing complexity of their workflows. Especially small and medium-sized utilities see this as an appropriate means of holding their own against large energy suppliers. In other branches of industry inter-company cooperations at the economic or technical level are already established practice. Recent project experiences have shown that such cooperation models can be transferred with equal success to the energy sector at customer service level.

  3. Der Erwerb der Verbflexion durch thailändische Immigrantinnen in der Schweiz. Eine Bestandaufnahme.

    Directory of Open Access Journals (Sweden)

    Attaviriyanupap, Korakoch

    2006-01-01

    Full Text Available This article focuses on the acquisition of German verb inflection by native speakers of Thai, an isolated language which has no concept of inflection at all. The acquisition process of German verb morphology is analyzed based on all the verb inflectional affixes found in the corpus consisting of spontaneous utterances in Standard German produced by16 female immigrants living in German-speaking Switzerland. It aims to find out a systematic acquisition order of verb inflectional morphemes and the explanation to this sequence, especially to answer the following four questions: 1 What is the acquisition order of verb inflectional morphemes found in this group of informants 2 Are there any differences between the acquisition of finite and that of non-finite verbs? 3 Are there any differences in the verb morphology acquisition of different types of verbs? 4 Does the acquisition of verb inflection by these informants share more similiarities with the instructed or with the natural acquisition of German as a second language?

  4. Broadband piezoelectric energy harvesting using nonlinear magnetic forces; Bandbreitensteigerung von piezoelektrischen Energy Harvesting Systemen durch Magnetkraefte

    Energy Technology Data Exchange (ETDEWEB)

    Westermann, Henrik; Neubauer, Marcus; Wallaschek, Joerg [Hannover Univ. (Germany). Inst. fuer Dynamik und Schwingungen

    2012-07-15

    Using ambient energy by piezoelectric energy harvesting systems received much attention over the last years. Most vibration-based generators produce a sufficient power only if the transducer is excited in its resonance frequency. The use of magnetic forces suggests a promising strategy to increase the efficiency. This paper presents different ways for broadband piezoelectric energy harvesting using nonlinear magnetic forces. (orig.)

  5. Kompatibilisierung von Elastomerverschnitten durch Kautschukadditive mit maßgeschneiderten Oberflächeneigenschaften

    NARCIS (Netherlands)

    Tiwari, M.; Datta, Rabin; Guo, R.; Talma, Auke; van Ooij, W.J.; Dierkes, Wilma K.; Noordermeer, Jacobus W.M.

    2014-01-01

    Gummi ist ein herausforderndes Material, dessen Funktionalität stark von der Affinität seiner unterschiedlichen Bestand­teile und seiner Morphologie abhängt. Ein Weg, Polarität und Chemie der Füllstoffoberfläche maßzuschneidern, ist die Plasmabeschichtung. Werden Acetylen, Thiophen oder Pyrrol als

  6. The influence of environmental factors on male fertility; Beeintraechtigung der maennlichen Fertilitaet durch Umweltfaktoren

    Energy Technology Data Exchange (ETDEWEB)

    Jung, A.; Schill, W.B. [Giessen Univ. (DE). Hautklinik (Zentrum fuer Dermatologie und Andrologie); Schuppe, H.C. [Duesseldorf Univ. (Germany). Hautklinik; Koehn, F.M. [Muenchen Univ. (Germany). Dermatologische Klinik und Poliklinik

    2000-07-01

    It is of increasing importance to assess the relationship between impaired male fertility and environmental factors. Due to the complex development and regulation of spermatogenesis, a variety of sites may be affected by exogenous noxae such as coffee, tobacco, alcohol, pharmaceuticals, professional agents, environmental chemicals and also physical factors. However, reliable findings in humans are only available for a few noxae. Unfortunately, results from animal experimental studies cannot be simply transferred. In the andrological practice, detailed history taking is of utmost importance for early recognition of possible exposure risks. Thorough analysis of the ejaculate is a prerequisite for detection and differentiation especially of disturbed spermatogenesis. Under aspects of occupational and environmental medicine, systematic search for data according to standardized criteria in exposed and unexposed men is imperative to find out potential reproductive toxins. (orig.) [German] Die Erfassung von Zusammenhaengen zwischen Einschraenkungen der maennlichen Fertilitaet und Umweltfaktoren gewinnt zunehmend an Bedeutung. Aufgrund der komplexen Entwicklung und Regulation der Spermatogenese ergeben sich vielfaeltige Angriffsmoeglichkeiten fuer exogene Noxen wie Genussmittel, Pharmaka, Arbeitsstoffe, Umweltchemikalien und auch physikalische Faktoren. Gesicherte Erkenntnisse liegen jedoch beim Menschen nur fuer wenige Noxen vor. Leider lassen sich tierexperimentelle Befunde nur begrenzt uebertragen. In der andrologischen Praxis kommt einer ausfuehrlichen Anamnese ein wichtiger Stellenwert zu, um moegliche Expositionsrisiken fruehzeitig erfassen zu koennen. Detaillierte Ejakulatanalysen sind hier zur Erfassung und Differenzierung, insbesonders von Spermatogenesestoerungen, unerlaesslich. Unter arbeits- und umweltmedizinischen Gesichtspunkten sind systematische Datenerhebungen nach standardisierten Kriterien bei exponierten und nicht exponierten Maennern unerlaesslich, um potentielle Reproduktionstoxine fruehzeitig erfassen zu koennen. (orig.)

  7. Abscesses after appendectomy due to intraoperative loss of fecaliths; Abszesse nach Appendektomie durch intraoperativ verlorene Appendicolithen

    Energy Technology Data Exchange (ETDEWEB)

    Hoermann, M.; Kreuzer, S. [Universitaetsklinik fuer Radiodiagnostik, Vienna (Austria). Abt. chirurgische Faecher; Sacher, P. [UniversitaetsSpital Zuerich (Switzerland). Abt. Kinderchirurgie; Eich, G.F. [UniversitaetsSpital Zuerich (Switzerland). Inst. fuer Diagnostische Radiologie

    2001-08-01

    Objective: Fecaliths appear to predispose a patient to acute appendicitis, abscess formation, and perforation. The number of preoperative radiological evaluations is increasing, although children with suspected perforation still undergo surgery immediately. We report and discuss imaging findings and implications in children with acute appendicitis and fecalithis. Methods: Four children (3 girls, 1 boy; mean age 9 years) underwent surgery for acute appendicitis. Three children underwent sonography and plain radiography before surgery, 1 child was operated without radiological evaluation. After readmission, all 4 children underwent sonography and plain radiography before surgery. Results: In 3 patients a fecalith was diagnosed initially. After uneventful recovery all 4 patients had acute abdominal pain and readmission was necessary. In all 4 patients the escaped fecalith was demonstrated with sonography and plain radiography confirmed surgically. Conclusion: Discussion about the role of imaging in acute appendicitis has concentrated on the diagnostic yield of cross-section techniques. The importance of demonstrating a fecalith, prompting a more thorough intraoperative search has found little attention. The radiologist should also detect and localize a fecalith and should be aware of retained fecaliths as a cause of abscess formation after appendectomy. (orig.) [German] Ziel: Faekolithen praedisponieren Kinder zu akuter Appendizitis und fuehren vermehrt zu Perforation und Abszessen. Wir berichten und diskutieren die Bedeutung der Bildgebung bei Kindern mit Faekolithen und perforierter akuter Appendizitis. Methoden: 4 Kinder (drei Maedchen, ein Junge, Altersmeridian 9 Jahre) wurden wegen perforierter akuter Appendizitis operiert. Drei Kinder erhielten praeoperativ eine Ultraschalluntersuchung und ein Abdomen-Uebersichtsbild. Nach Neuaufnahme wurden nun bei allen Kindern eine Ultraschalluntersuchung und ein Abdomen-Uebersichtsbild angefertigt und neuerlich operiert. Ergebnisse: Bei drei Patienten konnte initial ein Faekolith diagnostiziert werden. Nach problemlosen-postoperativen Verlauf wurden alle 4 Kinder gesund entlassen. Neuaufnahme erfolgte wegen akuter Bauchschmerzen. Mit Ultraschall und AbdomenUebersichtsbild wurde in allen 4 Faellen der operativ verlorene Faekolith diagnostiziert und operativ bestaetigt. Schlussfolgerung: Die Diskussion ueber die Rolle der Bildgebung konzentriert sich auf die Diagnose der akuten Appendizitis, weniger auf den Nachweis und die Bedeutung eines Faekolithen. Der Radiologe sollte bei Patienten mit Postappendektomieabszessen an die Moeglichkeit eines verlorenen Faekolithen denken. (orig.)

  8. Mastoidberstung durch Schussverletzung - Therapie der traumatischen peripheren N. facialis-Läsion

    OpenAIRE

    Kostka, E; Koscielny, S; Wittekindt, C; Orlando, GL

    2007-01-01

    Entscheidend für die Prognose der traumatischen N. facialis-Läsion sind der Zeitpunkt des Auftretens nach der Schussverletzung, die Kenntnis über Schwere der Schädigung, die Beherrschung der operativen Erstversorgung sowie eine optimale Langzeittherapie.Das Geschoss zerschmetterte das Mastoid der 23-jährigen Patientin, zerstörte den N.facialis im mastoidalen Segment, passierte die A. carotis interna und Wirbelsäule und kam im Oropharynx zu liegen. Innerhalb von 24 Stunden erfolgte die Geschos...

  9. Drinking water disinfection by means of ultraviolet radiation. Desinfektion von Trinkwasser durch UV-Bestrahlung

    Energy Technology Data Exchange (ETDEWEB)

    Gelzhaeuser, P; Bewig, F; Holm, K; Kryschi, R; Reich, G; Steuer, W

    1985-01-01

    The book presents all lectures held during a course at Technical Academy Esslingen, on September 10, 1985, on the subject of 'Drinking water disinfection by means of ultraviolet radiation'. The methods hitherto used for disinfection are no longer suitable because of the increasing amounts of organic pollutants found in the untreated water, and because of the necessity to make drinking water disinfection less expensive, non-polluting and thus environmentally compatible. U.V. irradiation is a method allowing technically simple and safe disinfection of the water, and also does not have any effect on the natural taste of the drinking water. The lectures presented discuss all aspects of the method, the equipment, and the performance of irradiation systems in practice.

  10. Implementation of energy efficiency measures by municipal utilities; Umsetzung von Energieeffizienzmassnahmen durch Stadtwerke

    Energy Technology Data Exchange (ETDEWEB)

    Horst, Juri; Droeschel, Barbara [Institut fuer ZukunftsEnergieSysteme (IZES), Saarbruecken (Germany)

    2012-04-15

    Local players have a very special role to fill in the implementation of the German federal government's ambitious energy efficiency goals. In the past the contributions made by municipal utilities in the way of special offers or measures to develop efficiency potentials were only modest. Moreover there were specific impediments that discouraged a significant competition-driven efficiency services market from developing. However, there are other instruments available that could encourage municipal utilities to implement efficiency goals. A recent research project has shown how standardised efficiency programmes can be used to tap into existing efficiency potentials at a sufficient level of intensity and with macroeconomic benefit.

  11. Fulmar Litter EcoQO monitoring along Durch and North Sea coasts

    NARCIS (Netherlands)

    Franeker, van J.A.

    2011-01-01

    Wastes from ships are an important source of litter in the marine environment in the Southern North Sea and cause serious economic and ecological damage. Inadequacies in the ship to shore waste delivery procedures are considered a major factor in illegal discharges. The European Union addressed the

  12. Lean-Prinzipien für verbesserte Kosteneffizienz: Instandhaltungseffizienz durch Lean Maintenance

    OpenAIRE

    Bandow, G.; Schmidt, A.

    2008-01-01

    Die Bedeutung der Instandhaltung nimmt weiter zu. In einem Lean Umfeld mit einer immer verschwendungsärmeren Produktion stehen nicht nur die Kosteneffizienz und Verfügbarkeit der Produktionsmittel im Fokus. Unplanmäßige Stillstände kosten Geld und gefährden häufig auch Personal und Produkt. Lean Maintenance vermeidet Verschwendung und optimiert so die Effektivität und Effizienz der Instandhaltung. Das zielgerichtete Zusammenspiel von Menschen, Prozessen und Technik garantiert dabei den Erfolg...

  13. Visualisierung analoger Schaltungen durch 3-D Animation von transienten SPICE-Simulationen

    Directory of Open Access Journals (Sweden)

    J. Becker

    2007-06-01

    Full Text Available Für das Zeichnen analoger Schaltpläne wird oft versucht, die Potentialverteilung in der entsprechenden Schaltung auszunutzen, um eine Platzierung der Bauteile nach abfallendem Potential vorzunehmen. Mit Hilfe von Computerunterstützung gelingt es, eine verallgemeinerte dreidimensionale Platzierungsstrategie anzuwenden, die allein auf Grund der Potentialwerte einer Schaltung die automatische Generierung einer technisch exakten Potentialdarstellung erlaubt. Somit ist es möglich, die Ergebnisse von transienten SPICE-Simulationen in jedem Zeitschritt darzustellen und eine Animation des zeitlichen Verhaltens zu erzeugen. Die Umsetzung dieser Methode zur Einbettung in eine webbasierte Lern – und Arbeitsplattform wird im Folgenden erläutert.

  14. Visualisierung analoger Schaltungen durch 3-D Animation von transienten SPICE-Simulationen

    Science.gov (United States)

    Becker, J.; Manoli, Y.

    2007-06-01

    Für das Zeichnen analoger Schaltpläne wird oft versucht, die Potentialverteilung in der entsprechenden Schaltung auszunutzen, um eine Platzierung der Bauteile nach abfallendem Potential vorzunehmen. Mit Hilfe von Computerunterstützung gelingt es, eine verallgemeinerte dreidimensionale Platzierungsstrategie anzuwenden, die allein auf Grund der Potentialwerte einer Schaltung die automatische Generierung einer technisch exakten Potentialdarstellung erlaubt. Somit ist es möglich, die Ergebnisse von transienten SPICE-Simulationen in jedem Zeitschritt darzustellen und eine Animation des zeitlichen Verhaltens zu erzeugen. Die Umsetzung dieser Methode zur Einbettung in eine webbasierte Lern - und Arbeitsplattform wird im Folgenden erläutert.

  15. Environment conservation by way of official notice or recommendations. Umweltpflege durch behoerdliche Warnungen und Empfehlungen

    Energy Technology Data Exchange (ETDEWEB)

    Ossenbuehl, F

    1986-01-01

    Official notice or recommendations belong to the self-evident instruments of government authorities to fulfill their functions. According to their typical type of effect, in the system of powers to act, these instruments belong to the group of the simple administrative acts of state. They are thus not of direct legal interest, at first sight. However, the Chernobyl accident and its consequences have just been the latest opportunity to realise that official notice or recommendations issued by state authorities may have a far-reaching impact on the consumers' behaviour, and hence on the market situation. The book in hand discusses legal problems in connection with such impact, taking as an example the field of environment conservation and related precautionary activities. The main issues dealt with refer to the permissibility by law and the formal status of official notice warning of the use of environmentally harmful products, to legal protection in case of unlawful warnings or recommendations, and to possible liabilities. The book in hand developed from a legal expertise made on behalf of the German Federation of Toilet Articles and Detergents Producers is intended to show that the increasingly used informal administrative instruments of official notice or recommendations ought to be integrated into the system of administrative law.

  16. Energy management through building automation. Fundamentals - Technologies - Applications; Energiemanagement durch Gebaeudeautomation. Grundlagen - Technologien - Anwendungen

    Energy Technology Data Exchange (ETDEWEB)

    Aschendorf, Bernd [Fachhochschule Dortmund (Germany). Fachbereich Informations- und Elektrotechnik

    2014-02-01

    The books available in the market consider only the use of individual buildings bus systems, but not to compare with each other with respect to cost-benefit and applicability. In this book, a total of 40 different systems, such as radio bus systems, PEHA-PHC, EIB, LCN, LON, PLC systems, investigated for their possible use in the various categories of buildings. The comparison refers to all levels of the automation pyramid from fieldbus, to automation to the control level and considers in particular the usability for SmartMetering-based energy management. [German] Die am Markt vorhandenen Buecher betrachten lediglich den Einsatz einzelner Gebaeudebussysteme, nicht jedoch den Vergleich untereinander mit Bezug auf Kosten/Nutzen und Anwendbarkeit. In diesem Buch werden insgesamt 40 verschiedene Systeme, wie z.B. Funkbussysteme, PEHA-PHC, EIB-, LCN-, LON-, SPS-Systeme, auf deren Einsatzmoeglichkeit in den verschiedenen Gebaeudekategorien untersucht. Der Vergleich bezieht sich auf alle Ebenen der Automatisierungspyramide vom Feldbus ueber die Automatisierung bis zur Leitebene und betrachtet insbesondere auch die Verwendbarkeit fuer smartMetering-basiertes Energiemanagement.

  17. Zugang zu neuen FuE-Konzepten durch innovative Verfahren der Pflanzenphänotypisierung

    Directory of Open Access Journals (Sweden)

    Altmann, Thomas

    2011-10-01

    Full Text Available The development and use of automated procedures of non- or minimal invasive monitoring of plant traits and features opens new opportunities for the identification of genetic factors determining plant characteristics and performance parameters, for the investigation of environmental effects on trait expression, for the selection of individuals or lines with preferred features from large populations, for the optimization of plant production systems, and for the recognition of novel uses of plants. This is achieved through development and application of precise and unbiased measurement procedures (not influenced by human perception, which (ideally are amenable to high-throughput approaches. They enable more accurate and much larger scale investigations or screenings than hitherto possible, they allow the detection of features that previously could not be assessed, and they offer access to monitoring and quantification of dynamic processes through repeated measurements over time. To this end, (novel sensor and detection systems have to be developed and an implemented, automation procedures have to be adapted and established, corresponding facilities have to be constructed and installed, which support monitoring and/or simulation of certain environmental parameters (in addition to the measurement of plant features and effective data analysis tools have to be developed and implemented.

  18. Rising the exploitation of substrates by thermal digestate processing; Steigerung der Substratausnutzung durch thermische Gaerrestbehandlung

    Energy Technology Data Exchange (ETDEWEB)

    Seick, Ingolf; Gebhardt, Sebastian [Hochschule Magdeburg-Stendal (Germany). Fachbereich Wasser- und Kreislaufwirtschaft

    2013-10-01

    The paper introduces a new process for biogas plants to increase the utilization of substrate and to reduce the required feeding. By a thermal treatment of a partial flow of the digestate the gas yield is increased considerably, whereupon a recirculation is carried out into the fermentation process. The digestate taken from the secondary fermenter is separated to a liquid and a solid phase. The solid phase is treated thermally and led back into the main fermenter discontinuously. The discharge of a subset of the untreated digestate shall avoid accumulation of inert fractions. Batch fermentation tests with separated digestate of a typical biogas plant have shown an increase of the VS-specific gas and methane yields, e.g. of approx. 90% after a 10-minute treatment in a lab-scale high pressure autoclave at 170 C and 8 bar. Simulations point out that a long-term use of the process in biogas plants can be possible effectively. (orig.)

  19. Higher efficiency with cylinder-bank comprehensive exhaust manifold; Effizienzsteigerung durch Zylinderbank-uebergreifenden Kruemmer

    Energy Technology Data Exchange (ETDEWEB)

    Diez, Rainer; Kornherr, Heinz; Pirntke, Frank; Schmidt, Juergen [Friedrich Boysen GmbH und Co. KG, Altensteig (Germany)

    2010-05-15

    In close interdisciplinary cooperation with BMW Group, Boysen has developed an air-gap-insulated exhaust manifold that encompasses both banks of the 4.4 l V8 spark-ignition twin turbo engine of the BMW X5 M and BMW X6 M. The manifold merges the exhaust gas flow from the cylinders of the left-hand and right-hand cylinder banks in opposing pairs, thus optimising gas exchange. Due to improvements in response, torque and power characteristics of the engine, the cylinder-bank comprehensive exhaust manifold helps achieve high fuel efficiency. (orig.)

  20. Spinal trauma: first aid from cross-sectional imaging; Trauma der Wirbelsaeule: erste Hilfe durch Schnittbildverfahren

    Energy Technology Data Exchange (ETDEWEB)

    Schueller, G.; Schueller-Weidekamm, C. [Emergency Radiology Schueller, Neerach (Switzerland)

    2014-09-15

    The diagnosis of the traumatized spine is one of the key issues for trauma radiologists. The cross-sectional imaging procedures, computed tomography (CT) and magnetic resonance imaging (MRI) are the essential methods in spinal trauma radiology. These modalities are of great help in accurately assessing injury patterns and extent and in providing indications of patient outcome. In contrast to cross-sectional imaging, radiography has a role in the evaluation of minor spinal trauma only. It is generally accepted that trauma radiologists do not use typical classifications to evaluate the spine partly because such an ideal classification system does not yet exist. Not least because of this classification difficulty, eponyms and synonyms are widely used to describe traumatology of the spine as a high level of specific information is included in these various terms. The members of the trauma team should be aware of the strengths and limitations of the methods used in the assessment of the spine. This article provides a brief outline of fundamental knowledge about the diagnosis of spinal trauma. (orig.) [German] Die Beurteilung der verletzten Wirbelsaeule nimmt fuer Traumaradiologen eine zentrale Stellung ein. Die Schnittbildverfahren CT und MRT sind ihre wesentlichen Arbeitsmethoden. Sie helfen dabei, schnell und mit hoher Zuverlaessigkeit Aussagen ueber Art und Ausmass von Verletzungen zu treffen sowie Hinweise auf die Prognose der Patienten zu geben. Die Projektionsradiographie hat ihre Bedeutung lediglich in der Diagnostik des Bagatelltraumas und ist in ihrer Aussagekraft auch dort nicht unumstritten. Traumaradiologen bedienen sich nicht ausschliesslich typischer Klassifikationen des Wirbelsaeulentraumas, z. T. auch deshalb, da es die ideale Klassifikation aus heutiger Sicht nicht gibt. Vielmehr ist es wichtig, auch ueber Eponyme und Synonyme Bescheid zu wissen, da sie ein hohes Mass an spezifischen Informationen der spinalen Verletzungen verinnerlichen. Alle Mitglieder eines Traumateams sollen sich der Staerken und Schwaechen der verwendeten radiologischen Techniken bei der Beurteilung des Wirbelsaeulentraumas bewusst sein. Dieser Artikel gibt einen kurzen Abriss ueber die wesentlichen diagnostischen Kenntnisse der traumatisierten Wirbelsaeule. (orig.)

  1. Hazards to persons from electromagnetic fields. Gefaehrdung von Personen durch elektromagnetische Felder

    Energy Technology Data Exchange (ETDEWEB)

    Bernhardt, J H; Dahme, M; Rothe, F K

    1983-01-01

    The concept deals with the biophysical bases that led to the limit values given in VDE regulation 0848/2 (draft 2 with supplement A1) for the protection of persons against damage from electromagnetic fields for frequencies between 10 kHz and 3000 GHz. Two different concepts for the determination of the limits are applied and substantiated: - protection from direct excitation of nerve cells by electromagnetic fields, - protection from dangers arising from the thermal effects of electromagnetic fields. For frequencies below 30 kHz, the measure of the biologic effect is the electric current density produced in the body. The threshold values for the current density capable of stimulating nerve cells are known. The limits which are laid down for the electric and magnetic field strengths outside the body remain at least 20 times below the stimulation threshold values for the body electric current density. The concept described here can be used for frequencies below 10 kHz as well. For frequencies above 2 MHz the measure of the tolerable heat quantity, produced in this case by the effect of electromagnetic fields in the human body, is determined by comparison with the basal metabolism of the body. The limit values, which are laid down as a function of frequency, safeguard that the field strength acting on the body remains below the value corresponding to the basal metabolism even at unfavourable conditions of exposure. For the intermediate range the limit values remain below those threshold values that are obtained when applying either the thermal effect concept or the nerve excitation concept alone.

  2. Aufklärung des Europäischen Forschungsraums durch Geschlechterwissen?

    Directory of Open Access Journals (Sweden)

    Heike Kahlert

    2008-07-01

    Full Text Available Zentrales Verdienst der vorliegenden empirischen Studie ist es, anschaulich das Netzwerk von Wissenschaftlerinnen, Politikerinnen sowie Mitarbeiterinnen und Mitarbeitern der nationalen und insbesondere der europäischen Forschungsverwaltung zu beschreiben, das ermöglichte, Gender Mainstreaming im Sechsten Forschungsrahmenprogramm der EU zu implementieren. Außerdem wird die Verknüpfung aus formellen und informellen Politikstrukturen und Genderexpertise beschrieben.

  3. Photovoltaic energy conversion and wind power plants creating new jobs; Arbeitsplaetze durch Photovoltaik und Windenergie

    Energy Technology Data Exchange (ETDEWEB)

    Hille, G.; Hoffmann, V.U. [Fraunhofer ISE, Freiburg (Germany); Dienhart, H.; Langniss, O.; Nitsch, J. [DLR, Stuttgart (Germany)

    1997-12-01

    Experts are unanimous that opening up new markets through innovative technologies will be the successful strategy for reversing the upward trend of unemployment in Germany. This approach puts renewable energy sources into the foreground, as enhanced use of wind power and photovoltaic energy conversion will no doubt create new jobs. These technologies will, however, require favourable regulatory framework conditions in order to become a significant force in combatting unemployment. (orig./CB) [Deutsch] Es gilt unter Experten als sicher, dass eine Umkehr am Arbeitsmarkt nur dadurch zu schaffen ist, dass innovative Technologien genutzt und damit neue Maerkte erschlossen werden. Demnach koennte etwa dem Ausbau der regenerativen Energietraeger Wind und Photovoltaik zur Schaffung zukunftssicherer Arbeitsplaetze eine grosse Bedeutung zukommen. Einen ernstzunehmenden Beitrag im Kampf gegen die Arbeitslosigkeit koennen diese Technologien allerdings nur unter bestimmten Rahmenbedingungen leisten. (orig./RHM)

  4. Beeinflussung des Angebots im Lebensmitteleinzelhandel durch Konsumenteninformationen: Eine Anwendung auf Basis der Theory of Planned Behavior

    OpenAIRE

    Mecking, Rebecca-Ariane

    2015-01-01

    Von Informationen, die Konsumenten z. B. über Kundenkarten dem Lebensmitteleinzelhandel (LEH) mitteilen, können auch sie selber profitieren, indem das Angebot besser an ihre Bedürfnisse angepasst wird. Basierend auf der Theory of Planned Behavior untersucht diese Arbeit, welche Faktoren entscheidend dafür sind, ob ein Konsument dem LEH zum Zwecke der Einflussnahme Informationen mitteilen möchte. Wichtig sind das Bewusstsein um diese Chance und ihre positiven Folgen. Sorgen um die Privatsphäre...

  5. Natural background radiation at flight altitudes; Natuerliche Strahlenexposition in Flughoehen durch kosmische Strahlung

    Energy Technology Data Exchange (ETDEWEB)

    Wissmann, F. [Physikalisch-Technische Bundesanstalt, Berlin (Germany). FB Ionenbeschleuniger und Referenzstrahlungsfelder

    2006-12-15

    At sea level, the background radiation of about 40 nSv/h consists of about 80 percent of muons and electrons and about 0 percent of neutrons. The picture is different at an altitude of 10 km. Here, the background dose equivalent of about 5000 nSv/h (= 5 {mu}Sv/h) consists of about 60 percent of neutrons and about 25 percent of muons and electrons. Protons account for about 15 percent. This particle composition makes dosimetric measurements difficult. In addition, the energy emitted by the particles is far beyond the the measuring range of conventional radiation protection dosemeters. For these reasons, conventional dosemeters are not suited for applications in aeroplanes and such. The PTB method for measuring local dose rates uses a proportional counter whose wall consists of a tissue equivalent material and which is operated with tissue equivalent counting gas at very low pressure (about 40 hPa). (orig.)

  6. Erhöhung der Reproduzierbarkeit des Spritzgießprozesses durch verbesserte Plastifizierkonzepte

    OpenAIRE

    Liu, Jiqing

    2010-01-01

    Aufgrund des stets steigenden Wettbewerbs sind Spritzgießverarbeiter gezwungen, die Reproduzierbarkeit des Spritzgießprozesses kontinuierlich zu erhöhen. Im Rahmen dieser Arbeit werden zwei Ansätze zur Erhöhung der Reproduzierbarkeit des Spritzgießprozesses vorgestellt. Um die Schwankung der in das Plastifiziersystem zuzuführenden Energie zu minimieren, soll die Dissipationsenergie während der Plastifizierphase geregelt werden. Die Schneckenantriebsleistung und die Plastifizier...

  7. Horizontal and vertical wind power plant. Stromerzeugungsanlage durch Windkraft in waagerechter und senkrechter Konstruktion

    Energy Technology Data Exchange (ETDEWEB)

    Brodersen, K

    1976-10-05

    Wind power machines and associated generating equipment are exposed to the effects of the weather, which causes high maintenance and repair costs. The construction of the wind blades causes turbulence, which has an adverse effect of the efficiency of this plant. The purpose of the invention is therefore to make the construction of the generating equipment such that the protection of the unit and the armature against effects from the weather and greater efficiency are achieved with low plant, maintenance and repair costs. According to the invention, the problem is solved by having the wall of the central room, for pressure and guidance, reinforced at the top, where the guides also provide security against the tilting torque and ensure protection of the unit and armature against effects from the weather. In order to avoid turbulence on the wind blades, a seamless joint between the wind blades and the wind guide surface is provided above the centre of rotation, whereby the stability and free length of the wind blades are increased. The whole plant can be fabricated in a factory and can be transported to the site by helicopters.

  8. Zugriff auf medizinische Volltexte und Fachdatenbanken in Norwegen durch nationale Lizenzierung

    OpenAIRE

    Lein, Regina Küfner

    2015-01-01

    National licences are achieved for some major scientific journals and medical databases. Since 2006 these resources are accessible for both health personal, and citizens in Norway via the virtual Norwegian Electronic Health Library (NEHL). In addition, there are institutional licences to further databases and journals for members of the Norwegian Electronic Health Library. The establishing, the financial aspects and the content of the Norwegian Electronic Health Library are described shortly....

  9. Simulation of biogas production by adding biochar; Steigerung des Biogasertrages durch die Zugabe von Pflanzenkohle

    Energy Technology Data Exchange (ETDEWEB)

    Roedger, Jan-Markus; Ganagin, Waldemar; Krieg, Andreas; Roth, Christian; Loewen, Achim [HAWK Hildesheim/Holzminden/Goettingen, Goettingen (Germany). Fachgebiet Nachhaltige Energie- und Umwelttechnik (NEUTec)

    2013-09-15

    One instrument to withdraw carbon dioxide from the atmosphere is the so called Biochar. Through photosynthesis and a thermochemical biomass treatment (pyrolysis) the bound carbon will be stabilized and thereby stored permanently. The product (biochar) is intended to be mainly used as soil enhancer on arable land. Early analyses indicate no economic feasibility yet. Therefore new ways of utilization need to be identified along the agricultural value chain to generate additional earnings. One option is the application of biochar as an additive within the biogas process. Different international research institutes were able to measure an increase in biogas production due to the biochar addition. One reason might be accumulation of methanogenic bacteria as well as the increase of the surface area to improve the microbial functionality which leads to additional gas production. The study presented here investigated the optimal process stage within the fermentation process (main digester or secondary fermenter) to add the biochar and thereby improve the gas production. By adding biochar to the main digester an increase in gas production of approximately 9 % over a time span of 91 days was measured. To analyse the effect within the secondary fermenter two different approaches were tested. The effect of the surface area was assessed by comparing the influence of original biochar and large char particles. The original Biochar led to an increase of more than 13 % and the large particles even enhanced methane production by 24 % over 91 days. (orig.)

  10. The generation of molecular hydrogen by cyanobacteria. Die Gewinnung von molekularem Wasserstoff durch Cyanobakterien

    Energy Technology Data Exchange (ETDEWEB)

    Kentemich, T.; Haverkamp, G.; Bothe, H. (Koeln Univ. (Germany, F.R.). Botanisches Inst.)

    1990-01-01

    Currently there is renewed interest in projects on solar-energy conversion by microorganisms. Among all organisms, cyanobacteria are first choice for such projects. Hydrogen production by cyanobacteria is light-dependent and catalyzed by the enzyme complex nitrogenase which concomitantly catalyzes the reduction of N{sub 2} to ammonia. The cyanobacterium Anabaena variabilis can express an alternative, vanadium-containing nitrogenase which produces more hydrogen than the conventional, molybdenum-containing enzyme. In intact cells, most of the H{sub 2} produced by nitrogenase is immediatley reutilized by the hydrogenase enzymes. Maximal hydrogen production requires the genetic blockage of H{sub 2} utilization by the hydrogenases. (orig.).

  11. Förderung beruflicher Handlungskompetenz durch reflektiertes Erfahrungslernen mit digitalen Medien

    Directory of Open Access Journals (Sweden)

    Jan Hellriegel

    2017-02-01

    Full Text Available Eine gelingende Entwicklung beruflicher Handlungsfähigkeit in der dualen Berufsausbildung ist auf eine Kooperation von Lehrenden, Ausbildenden und Auszubildenden angewiesen. Häufig scheitert diese Zusammenarbeit jedoch an den spezifischen Lernkulturen und der räumlichen Trennung der verschiedenen Lernorte. Das BMBF-geförderte Forschungsprojekt KOLA: «Kompetenzorientiertes Lernen im Arbeitsprozess mit digitalen Medien» greift diese Problematik auf und verfolgt das Ziel, mithilfe digitaler Medien eine Lernortkooperation zu befördern. Erprobt wird das entwickelte System, bestehend aus einer App und einer Browser-basierten Plattform, in saarländischen Ausbildungsstätten des Elektrohandwerks im Untersuchungszeitraum von Oktober 2014 bis September 2017. Im Rahmen dieses Projektes wird ein lerntheoretischer Ansatz verfolgt, der sich im Kontext von Konstruktivismus und Pragmatismus verorten lässt. Der vorliegende Beitrag fokussiert dabei das didaktische Konzept des Projektes, welches einerseits die didaktischen Grundannahmen und andererseits das hieraus abgeleitete Nutzungsszenario darstellt.

  12. Safety margins and retrofit. The technical calculation perspective; Sicherheitsmargen durch Nachruestung aus Sicht der technischen Berechnung

    Energy Technology Data Exchange (ETDEWEB)

    Daichendt, Matthias [Kraftanlagen Heidelberg GmbH, Heidelberg (Germany). Systemtechnik - Technische Berechnungen

    2016-01-15

    Safety margins are an essential factor of the safety philosophy for nuclear power plants. They support to cover future requirements even today. The basic safety concept is one key topic as also aspects of process engineering, the dimensioning and mechanical analysis of systems and ageing management. Calculations with today's capabilities are an integral part of the determination of safety margins. They can be used to analyse and to assess retrofit measures.

  13. Successful energy transition in Germany by pumped storage expansion; Energiewende erfolgreich gestalten durch Pumpspeicherausbau

    Energy Technology Data Exchange (ETDEWEB)

    Krueger, Klaus [Voith Hydro Holding GmbH und Co. KG, Heidenheim (Germany). FuE; Rotering, Niklas [RWTH Aachen Univ. (Germany). Forschungsgruppe Versorgungsqualitaet und Regulierung

    2014-11-01

    Operational flexibility in electrical energy generation and consumption as well as the provision of reliable and available capacity are two major challenges of the German energy transition ('Energiewende'). The consistent deployment of cost-effective and proven pumped storage technology can provide significant contributions to meet both challenges. This paper shows that an expansion of pumped storage plants as part of the energy transition is a technically and macro-economically interesting option for Germany. Pumped storage plants compensate the volatility of renewables and enable gentle and economically efficient operation of the remaining thermal power plant fleet.

  14. Less mining-induced damage through slowed-down working. Geringe Bergbauschaeden durch langsamen Abbau

    Energy Technology Data Exchange (ETDEWEB)

    Kratzsch, H [Technische Univ. Berlin (Germany). Inst. fuer Bergbauwissenschaften

    1994-10-01

    Today's widely spread view that rapid deformation will enhance damage to buildings was not underpinned by major reasons of soil mechanics and building physics. It is true that a shower rise in deformation will favour grain relocation in the foundation soil and, as a result, will diminish the soil pressure on cellar walls or on pipes embedded in the ground in the pressurized zone and will reduce the floor-level pressure peak in the bending zone by subsequent settling of foundation components. However, damage will not be found to differ in degree if deformation had lasted for 50 days ([nu][sub A]=8 m/d) or 200 days ([nu][sub A]=2 m/d). It may be assumed to be hardly relevant for the degree of damage sustained if bending, shifting (friction), tearing (shearing) or pressing of a building part (e.g. wall, ceiling, pillar), or of a building element (e.g. brick, mortar injoints) or of a building composed of all these parts rise to their final levels within a period of 50 or 200 days. (orig./MSK)

  15. Verbesserung bei Patienten durch den Community Reinforcement Approach: Effekte auf Zufriedenheit und psychiatrische Symptome

    NARCIS (Netherlands)

    Roozen, H.G.; Greeven, P.G.J.; Dijkstra, B.A.G.; Bischof, G.

    2013-01-01

    Patienten mit Suchterkrankungen weisen ein eingeschränktes Wohlbefinden auf. Eine Querschnittsstudie mit einem Prä-Post-Behandlungsdesign wurde durchgeführt, um Behandlungs­effekte des Community Reinforcement Approach (CRA) hinsichtlich Zufriedenheit und psychia­trischer Symptome zu erfassen. Die

  16. Persistent environmental pollutants. Detoxification by means of fungi; Persistente Umweltschadstoffe. Detoxifizierung durch Pilze

    Energy Technology Data Exchange (ETDEWEB)

    Sietmann, Rabea; Schauer, Frieder [Ernst-Moritz-Arndt-Universitaet, Greifswald (Germany). Inst. fuer Mikrobiologie

    2010-01-15

    Microorganisms either may use environmental pollutants as a source of carbon or attack pollutants oxidatively in the presence of a growth substrate. Furthermore, accumulated toxic products partly can be removed from a cell and oxidized or mineralized by microorganisms. The structural chemical analysis of the accumulated metabolites is performed by means of high-performance liquid chromatography (HPLC), gas chromatography (GC), gas chromatography-mass spectrometry (GC-MS) and nuclear magnetic resonance spectroscopy (NMR). This analysis supplies information on the mechanism of degradation of the environmental pollutants. Under this aspect, the authors of the contribution under consideration report on the use of fungi (aspergillus, candida, cunninghamella, fusarium, mucor, paecilomyces, penicillium, pycnoporus, trametes, trichosporon) in the degradation of biphenyl and its derivatives. The following mechanisms of degradation are discussed: Primary oxidation, hydroxylation, ring scission, formation of conjugates, oligomerisation and dehalogenation.

  17. Frieden durch Ineffizienz? Die Reform der US Cyberwar Strategie nach den Snowden-Leaks

    OpenAIRE

    Schmetz, Martin

    2013-01-01

    Es tut sich etwas in Folge der Snowden-Leaks: In den USA werden Untersuchungsausschüsse eingesetzt, Vorstöße, die Macht der NSA einzuschränken bzw.transparenter zu gestalten werden stärker – vor allem aber wird es wohl institutionelle Änderungen geben. Und diese hängen an einer Person: Keith Alexander.

  18. Fuel savings through air management optimization; Kraftstoffeinsparung durch Optimierung der Drucklufterzeugung und -aufbereitung

    Energy Technology Data Exchange (ETDEWEB)

    Wilken, Christoph; Son, Frank van [WABCO, Hannover (Germany)

    2009-07-01

    Fuel prices, vehicles' total cost of ownership, CO2 reductions by further environmental regulations become more and more a major driver for the development of energy efficient products, operating in a commercial vehicle. By example for the delivery and management of compressed air in a commercial vehicle, a compressor and an electronic controlled air processing unit (WABCO E-APU) are able to contribute a significant impact on energy savings, once through the way of creating compressed air and secondly by intelligent control of the compressor and the pressure levels, through an E-APU. Starting with the generation of compressed air, WABCO offers different systems with varying influence on the vehicle's fuel consumption. Today's conventional compressor systems in Europe are mostly equipped with WABCO PR (Power Reduction) System, reducing the energy consumption of the compressor in its idle phases. Further reduction of energy consumption during compressor idling is given by the usage of clutch principles, where the energy consumption during theses idle phases is greatly reduced. Next step to reduce also the energy consumption during compressor on-load phases, was the development of the WABCO two stage compressors which are using, compared to conventional one stage compressors, a more energy efficient way of compressing the needed air. Most effective intelligent air management systems include a compressor, associated with an electronic controlled air processing system (WABCO E-APU). By performing intelligent regeneration and keeping the compressor line plus cartridge pressurized during compressor idling, it is possible to utilize shortest overrun phases for pumping compressed air into the system and herewith generate additional energy savings. In near future, more and more hybrid vehicles with high voltage systems will enter the market, the WABCO electronic driven compressor (e-comp) stands for the best choice. It runs at different speeds, independent of the vehicle's combustion engine and it can provide compressed air also during the fully electrical driving mode of the hybrid-vehicle. During the compressor idle phases this e-comp is not consuming any energy and also during compressor on-load phases it is running in the most energy effective speed range. Further improvements like: - automatic adaption of air delivery, to reduce the duty cycle, - ensuring high usage of the regenerated braking energy by running compressor at high speed in vehicle overrun phases, are possible with the e-comp. (orig.)

  19. Vom Terrorismus zum Wandel durch Annäherung: Houellebecqs ‚Soumission‘

    Directory of Open Access Journals (Sweden)

    Wolfgang Asholt

    2016-03-01

    Full Text Available Es handelt sich um den Text eines Vortrags beim von Ursula Hennigfeld und Elmar Schafroth organisierten Workshop „Zensur, Political Correctness und Terrorismus“  (Universität Düsseldorf, 30.6. – 2.7. 2015.

  20. Renewable energies supported by GIS and land management; Erneuerbare Energien unterstuetzt durch GIS und Landmanagement

    Energy Technology Data Exchange (ETDEWEB)

    Klaerle, Martina (ed.)

    2012-11-01

    The author of the book under consideration reports on the support of renewable energy sources by Geographical Information Systems (GIS) and land management. The first part of this book is addressed to actual land political and planning legal fundamentals of the energy policy turnaround as well as on future developments of the planning instruments. The second part of this book presents GIS based tools and concrete application examples which are very valuable for regional authorities in the implementation of the energy policy turnaround: solar plant cadastre, holistic potential analysis for all forms of renewable energy systems, visibility studies, flexible power grids and so forth.

  1. Surrogatvalidierung durch Korrelation und Surrogate Threshold Effect – Ergebnisse von Simulationsstudien

    Directory of Open Access Journals (Sweden)

    Gillhaus, Johanna

    2017-01-01

    Full Text Available Background: Progression-free survival (PFS is often used instead of the patient-relevant endpoint overall survival (OS in cancer clinical trials. In order for PFS to be accepted as a patient-relevant outcome within the benefit assessment of pharmaceuticals in accordance with the German Social Code, Book Five (SGB V, section 35a, it has to be validated as a surrogate endpoint for OS in the relevant indication. As part of a rapid report the Institute for Quality and Efficiency in Health Care (Institut für Qualität und Wirtschaftlichkeit im Gesundheitswesen – IQWiG presented methods for surrogate endpoints validation and recommendations for correlation-based procedures. These methods include the evaluation of the certainty of conclusion of study results and the correlation between estimates of surrogate outcome and patient-relevant outcome on trial-level. The correlation is estimated by sample Pearson correlation coefficient or coefficient of determination and respective confidence interval (CI. Requirements for surrogate validation are a high correlation and a high certainty of conclusion of the study results. In case of medium correlation IQWiG methods propose applying the concept of surrogate threshold effect (STE to determine thresholds for the estimate of the surrogate endpoint.Methods: In simulation studies we investigate the requirements for a successful surrogate validation when applying a correlation-based approach. Simulation parameters are the estimates of the surrogate and the patient-relevant outcome, the correlation between them, the number of patients and the number of studies. We analyzed different scenarios in order to figure out parameters contributing to high correlation. Furthermore, we investigate requirements of the STE method, allowing conclusions on patient-relevant endpoints by means of surrogate endpoints. Finally, in consideration of IQWiG methods we analyze the challenges of surrogate validation in practical use.Results: Both, simulations of the surrogate validation using correlation-based procedure as well as an analytical derivation show low statistical power despite a medium-sized number of studies and a high true correlation. The power for =5 studies and correlation =0.9 is below 6%. A very high true correlation of =0.95 in at least =25 studies would be required in order to preserve a power of 80%, however this scenario is considered implausible in practice. Further simulations investigating the power of the method of STE showed that only one fifth of the considered scenarios have power above 80%. However, these scenarios included parameter constellations with impractical values regarding number of studies, number of patients and effect estimate of OS. The correlation parameter as well as the parameter of the estimate of PFS barely have an impact on the power of the STE procedure.Conclusion: Our simulations show that in practical use it is quite unlikely to fulfill the condition of high correlation as defined in the rapid report of IQWiG, proposing the lower limit of confidence interval to be crucial. Despite setting the true correlation in the model to a high value, statistical power will be quite small as long as the number of studies remains low or medium which is a realistic assumption in validation of surrogate endpoints within the framework of early benefit assessment. Besides, recommendation to involve certainty of studies in the analysis remains problematic. On closer inspection of the density function of sample correlation coefficient and assuming a given true correlation we can conclude that sample correlation does not depend on the variance of the single estimates but only on sample size (representing the number of studies in the model. Therefore, patient number does not have an impact on the confidence interval of the correlation whether using weight vectors for studies or not. Application of the STE concept according to the requirements described in the rapid report appears to be rather complicated as well. We propose an alternative solution of comparing the value of STE with point estimate of the surrogate endpoint instead of its lower level of confidence interval showing low α-errors in realistic scenarios.

  2. No childhood leukemia by emissions from nuclear installations; Keine Kinderleukaemien durch Emissionen aus Kernanlagen

    Energy Technology Data Exchange (ETDEWEB)

    Niggli, Felix [Kinderspital Zuerich (Switzerland). Klinik fuer Onkologie; Zuerich Univ. (Switzerland). Medizinische Fakultaet; Voelkle, Hansruedi [Fribourg Univ. (Switzerland). Physikdept.; Schaedelin, Juerg

    2017-10-01

    Childhood leukemia in the vicinity of nuclear power plants has long been a hot discussion topic. For some, it was proved that the nuclear power stations are responsible, for others it could not be explained by the established dosimetric models. Today, with some years of distance, and after a thorough review by a renowned English expert team, the COMARE working group, there is now more clarity. The 17{sup th} report of this working group published in 2016 confirms the hypothesis that there is no causal link between childhood leukemia and the radioactivity released by nuclear plants in the UK. It is therefore necessary to look for other explanations for dose cases where a significant increase has been observed. The commission also does not see any reason to question the established principles and methods of dosimetry and radiation risk assessment.

  3. Reducing water losses via intelligent pressure management; Reduzierung von Wasserverlusten durch intelligentes Druckmanagement

    Energy Technology Data Exchange (ETDEWEB)

    Oppinger, Peter [VAG-Armaturen GmbH, Mannheim (Germany). Marketing

    2008-03-15

    Leaks in water pipes and leaking municipal water-transmission and piping systems, particularly in developing and threshold countries account for water-losses of up to 50% of the water supplied by the waterworks. This article examines three different solutions for effective pressure management on the basis of an intelligent control system, by means of which water-losses can be reduced to a stable and economically rational level. (orig.)

  4. Zielgerichtete Chemotherapie solider Tumoren durch thermosensitive Liposomen in Kombination mit Doxorubicin, Gemcitabin und Mitomycin C

    OpenAIRE

    Limmer, Simone

    2014-01-01

    Auf DPPG2 basierende thermosensitive Liposomen (TSL) mit Hyperthermie (HT) induzierter zielgerichteter Wirkstofffreisetzung sind eine viel-versprechende Behandlungsstrategie in der Krebstherapie. TSL können als Wirkstoffträgersysteme die Zirkulationszeit und Anreicherung von Wirkstoffen im Zielgewebe erhöhen. Die vielfältigen Krebserkrankungen zeigen unterschiedliches Tumoransprechen auf die routinemäßig eingesetzten Zytostatika. Daher wäre es vorteilhaft, verschiedene Wirkstoffe in TSL e...

  5. Videobasierte Rauchdetektion durch mehrfache Bewegungsschätzung und Anpassungen für geringe Rauchdichten

    OpenAIRE

    Stadler, Anton

    2017-01-01

    In dieser Arbeit wird untersucht, wie Rauch mit videobasierten Methoden erfasst werden kann. Die Bewegungsschätzung erweist sich als effektivstes Merkmal. Strömungsmessungen zeigen, dass das Aufstiegsverhalten von Rauch detailliert erfasst wird. Ein Rauchdetektionsverfahren wird vorgestellt und für geringe Bewegungsgeschwindigkeiten sowie für geringe Rauchdichten optimiert. Ein Verfahren mit mehrfacher Bewegungsschätzung stellt für verschiedene Entfernungen und Rauchdichten geeignete Konfigur...

  6. Damage analysis. Product improvement through damage analysis; Schadensanalyse. Produktverbesserung durch Schadensanalyse

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    2011-07-01

    Within the 37th VDI annual meeting from 19th to 20th May, 2011 in Wuerzburg (Federal Republic of Germany) the following lectures and posters were presented: (1) Malpractice of material processing and heat processing of large gear wheels (P. Sommer); (2) Damages by faulty heat treatment - Case studies: Glow testing at a heat exchanger and wheel breakage of a high-strength screw connection (A. Thomas); (3) Crack formation in pole end plates of high-performance generators of a pumped-storage power plant - Causes and possibilities of remedy (J. Kinder); (4) Grind burn inspection for damage prevention at wind turbine gearboxes - Use of different processes for the investigation of peripheral-zone properties of case-hardened components (T. Griggel); (5) Damage inspection in coal mines using products from the degradation process as an example - damage - inspection - solution: This is the working method of the certification body (C. Kleine-Hegermann); (6) Damages at the sealing rings - Causes of the failure at radial shaft rings (K. Marchetti); (7) Thermal analyses at faulty plastic components (O. Jacobs); (8) Application of the micro computer tomography at damages of fibre-reinforced materials (H. Dinnebier); (9) The significance of 'material defects' from the view of lay people, lawyers and engineers - 'Material defect' in the literature, set of rules and expert opinion (C. Klinger); (10) Material defects from a legal view (P. Henseler); (11) Significance of material defects from the view of an engineering insurer (C. Harden); (12) Wear analyses by means of RNT and non-destructive surface analytics (K. Poehlmann); (13) Damages by means of non-metallic inclusions using ICE 3 as an example - Significance and localisation of single non-metallic inclusions in large components (D. Bettge); (14) Cathodic corrosion protection of pipeline steels (H.-G. Schoeneich); (15) Non-destructive and destructive investigations when assessing damages of corrosion at a piping system (A. Zunkel); (16) Condition monitoring at metallic components in indoor swimming pools - Atmospheric loading and materials selection (M. Faller).

  7. Pyritoxidationsprozesse im cretazischen Emschermergel infolge von aeroben Bedingungen durch den Emscherumbau

    Science.gov (United States)

    Droste, Björn; Wisotzky, Frank

    2015-09-01

    Due to the restoration of the Emscher river system, large amounts of the Emschermergel, a Cretaceous sediment containing significant amounts of carbonate and pyrite, will be released from its anoxic state. The oxidation of pyrite results in the release of protons, iron and sulfate. In order to evaluate the impact of the reaction products, extensive laboratory investigations were carried out. The methodology can detect pyrite content in the range of magnitude of the Rhenish lignite mining area (average 0.21 wt.% Pyritic-S). The formation of a naturally-occurring weathering horizon could also be detected. Under laboratory conditions, further oxidation of the weathered laboratory samples could be observed. Column experiments show significant release of sulfate at high concentrations. Hydrochemical modelling and acid-base accounting show neutralization of the free protons by the effective carbonate buffer in the sediment.

  8. Institutionalisierung durch Imitation? Die Europäisierung des Parlamentarismus in Mittel- und Osteuropa / Aron Buzogany

    Index Scriptorium Estoniae

    Buzogany, Aron

    2015-01-01

    Artikli teemaks on parlamentarismi euroopastumine Kesk- ja Ida-Euroopa riikides (sh Eesti), püüdes leida vastus küsimusele, kuidas on rahvusriikide parlamendid suutnud institutsionaalselt euroopastumise väljakutsele vastata?

  9. Natural gas production by fracking in Germany; Erdgasgewinnung durch Fracking in Deutschland

    Energy Technology Data Exchange (ETDEWEB)

    Muehlendahl, Karl Ernst v; Otto, Matthias [Kinderumwelt gGmbH der Deutschen Akademie fuer Kinder- und Jugendmedizin, Osnabrueck (Germany)

    2012-11-01

    ExxonMobil is performing exploration tests in Lower Saxony concerning unconventional sources for natural gas production using hydraulic fracturing. The contribution is dealing with environmental policy related questions that affect public health and should be part of the information of physicians. The contribution covers information on the issues hydraulic fracturing, water consumption and application of chemicals, drilling accidents - blow-out, energy balance, legal questions, summarizing recommendations of neutral expert team, higher-ranking points of view with respect to environmental protection and compatibility. [German] Bei umweltpolitischen Fragen, die auch die Gesundheit der Bevoelkerung tangieren, sollten aerzte informiert sein, um ggf. sachkundig mitsprechen zu koennen. Der Bereitstellung einer notwendigen Basisinformation zu dem Thema Fracking, das in betroffenen Gebieten in Niedersachsen und im Muensterland viel diskutiert wird, dienen die nachfolgenden Ausfuehrungen.

  10. Increasing power distribution mains efficiency through new mains configurations; Effizienzsteigerung im Verteilnetz durch neue Netzkonfigurationen

    Energy Technology Data Exchange (ETDEWEB)

    Hoeckel, M.

    2005-07-01

    This final report for the Swiss Federal Office of Energy (SFOE) summarises the findings of a study that sought to find new approaches to minimise distribution losses in medium and low voltage power grids. Options examined included the optimisation of distribution-station density, increasing the nominal voltage of the low-voltage grid and the implementation of decentralised energy production. Data from real-life grids were used together with simulations to analyse possible solutions. The conclusions of these analyses are presented and discussed. In addition, qualitative and detailed examinations were made concerning grid quality factors such as availability and voltage stability.

  11. Decontamination of nuclear graphite by thermal processing; Dekontamination von Nukleargraphit durch thermische Behandlung

    Energy Technology Data Exchange (ETDEWEB)

    Florjan, Monika W.

    2010-04-15

    The main problem in view of the direct disposal of the nuclear graphite is its large volume. This waste contains long-lived and short-lived radionuclides which determine the waste strategy. The irradiated graphite possess high amount of the {sup 14}C isotope. The main object of the present work was the selective separation of {sup 14}C isotope from the isotope {sup 12}C by thermal treatment (pyrolysis, partial oxidation). A successful separation could reduce the radiotoxicity and offer a different disposal strategy. Three different graphite types were investigated. The samples originate from the reflector and from the flaking of spherical fuel elements of the high-temperature reactor (AVR) Juelich. The samples from the thermal column of the research reactor (Merlin, Juelich) were also investigated. The maximum tritium releases were obtained both in inert gas atmosphere (N{sub 2}) and under water vapour-oxidizing conditions at 1280 C and 900 C. Furthermore it could be shown that 28% of {sup 14}C could be released under inert gas conditions at a 1280 C. By additive of oxidizing agent such as water vapour and oxygen the {sup 14}C release could be increased. Under water vapour-oxidizing conditions at a temperature of 1280 C up to 93% of the {sup 14}C was separated from the graphite. The matrix corrosion of 5.4% was obtained. The selective separation of the {sup 14}C is possible, because a substantial part of the radiocarbon is bound near the grain boundary surfaces. (orig.)

  12. Calculation of piping loads due to filling procedures; Berechnung von Rohrleitungsbelastungen durch Fuellvorgaenge

    Energy Technology Data Exchange (ETDEWEB)

    Swidersky, Harald; Thiele, Thomas [TUeV Sued Industrie Service GmbH, Muenchen (Germany)

    2012-11-01

    Filling procedures in piping systems are usually not load cases that are studied by fluid dynamic and structure dynamic analyses with respect to the integrity of pipes and supports. Although, their frequency is higher than that of postulated accidental transients, therefore they have to be considered for fatigue analyses. The piping and support loads due to filling procedures are caused by the density differences if the transported fluids, for instance in flows with the transport of gas bubbles. The impact duration of the momentum forces is defined by the flow velocity and the length of discontinuities in the piping segments. Filling procedures end very often with a shock pressure, caused by the impact and decelerating of the fluid front at smaller cross sections. The suitability of the thermally hydraulics program RELAP/MOD3.3 for the calculation of realistic loads from filling procedures was studied, the results compared with experimental data. It is shown that dependent on the discretization level the loads are partial significantly underestimated.

  13. Energy efficiency high speed drives with magnetic bearings; Energieeffizienz durch schnell drehende, magnetgelagerte Antriebe

    Energy Technology Data Exchange (ETDEWEB)

    Kroll, Matthias [LEViTEC GmbH, Lahnau (Germany)

    2011-07-01

    In modern purification plans the contamination of the wastewater are biologically removed by supplying oxygen. The clarifier is ventilated by compressors around the clock and approximately 60% of the total energy consumption is used for that. It enables a great opportunity for saving energy. This contribution shows that the use of magnetic centrifugal compressors with high-speed drives leads to significant reduction of energy consumption. In addition, the drive is, due to contact free the magnetic bearings, practically wear- and maintenance-free. By the use of integrated sensors in the magnetic bearings a continuous monitoring of the compressor is implemented. Consequently this drive concept provides not only more efficiency and less energy consumption, but also leads to a higher plant availability. (orig.)

  14. Die Inhibition der Casein Kinase 2 durch DMAT als Therapieoption bei Pankreaskarzinom

    OpenAIRE

    Plötz, Katharina

    2011-01-01

    1.1.1 Hintergrund Das Pankreaskarzinom stellt mit einer Inzidenz von etwa 9-10 neuen Fällen pro Jahr eine nicht zu vernachlässigende Krebserkrankung der Zivilbevölkerung dar. Unter den verschiedenen Formen tritt das duktale Adenokarzinom am häufigsten auf. Als Auslöser werden heute sehr viele unterschiedliche Ursachen diskutiert. So schreibt man dem Rauchen beispielsweise nahezu 30 % aller Fälle des Pankreaskarzinoms zu. Genauso aber erhöhen bestimmte genetische Faktoren das Risiko, an Bauchs...

  15. Securing the future through occupational safety. A managerial task; Zukunftssicherung durch Arbeitssicherheit. Eine Managementaufgabe

    Energy Technology Data Exchange (ETDEWEB)

    Gaertner, Dieter [RWE Power AG, Bergheim (Germany). Opencast Mines Div.; Groener, Harald [RWE Power AG, Essen (Germany). Arbeitssicherheit; Obermeyer, Bjoern [RWE Power AG, Koeln (Germany). PHS-B Operativer Arbeitsschutz

    2010-05-15

    The significance of occupational safety has increased over recent years so that this topic is now an integral task of management. To be able to meet the tighter requirements, occupational safety has to be dealt with in the same way as other topics. Therefore, RWE Power has introduced an occupational health and safety management system (AMS) whose organizational and operational structures are described in the following. The consistent implementation of occupational safety requires issue- and target group-related programmes of emphasis to be carried out in addition to the AMS. Two of these occupational safety programmes of RWE Power, which have contributed to a successful reduction in accident numbers, are presented along with the steps involved. Further examples from several plants and mines show how occupational safety has been further developed. In a company, occupational safety can only be successful if the managerial tasks are accepted and if superiors, occupational safety officers, industrial physicians, works council members, and partners ''pull together'' and if all employees are actively involved. (orig.)

  16. Inhibition of hydrate formation by kinetic inhibitors. Literature study; Inhibierung von Erdgashydraten durch kinetische Inhibitoren. Literaturstudie

    Energy Technology Data Exchange (ETDEWEB)

    Eberhardt, E.; Meyn, V.; Rahimian, I. [Institut fuer Erdoel- und Erdgasforschung, Clausthal-Zellerfeld (Germany)

    2000-04-01

    The aim of this study was to represent the state-of-the art of the inhibition of gas hydrates. Corresponding to recent publications the kinetic inhibition was considered in particular. Special inhibitors were validated using a set of criteria derived from different experimental test methods. Best results were obtained by the application of terpolymer VC-713 especially in relation to nucleation and crystal growth, followed by PVCap (polyvinylcaprolactame) and THI (threshold hydrate inhibitor), the chemical structure of which is derived from the antifreeze glycopeptids of antarcitc winter flounder. (orig.) [German] Die vorliegende Literaturstudie gibt den derzeitigen Stand der Kenntnis zur Inhibierung von Gashydraten wieder. Entsprechend der neueren Literatur wird insbesondere auf die kinetische Inhibierung eingegangen. Zur Beurteilung der verschiedenen Inhibitoren werden Bewertungskriterien zur Validierung der mit unterschiedlichen Untersuchungsmethoden erzielten experimentellen Ergebnisse angegeben. Anhand dieser Vorgehensweise zeigte sich, dass mit dem Terpolymer VC-713 die besten Ergebnisse, insbesondere im Hinblick auf Keimbildung und Wachstum, erzielt werden konnten. Sehr gute Ergebnisse wurden auch mit dem Polyvinylcaprolactam (PVCap) und den aus den Antigefrierpeptiden der antarktischen Winterflunder abgeleiteten Threshold Hydrate Inhibitoren (THI) erhalten. (orig.)

  17. Von Whorf zu Malotki - Eine Reise durch Hopi-Raum und Hopi-Zeit

    DEFF Research Database (Denmark)

    Robering, Klaus

    2014-01-01

    The article investigates the views of Whorf on the linguistic representation of space and time and their reception in German linguistics in the 1960s. Its first part summarizes both Whorf’s general conception of the relationship between language and cognition and his semantic analysis of the way...... how the Hopi language represents temporal and spatial matters. The Hopi conception of space and time (as conceived by Whorf) is contrasted with the views of classical and relativistic physics. The third part is devoted to the reception of Whorf’s views in German linguistics in the 1960s. A brief...

  18. Emissions reduction in commercial vehicles via thermomanagement; Emissionssenkung bei Nutzfahrzeugen durch Thermomanagement

    Energy Technology Data Exchange (ETDEWEB)

    Flik, Markus; Edwards, Simon; Pantow, Eberhard [Behr GmbH und Co. KG, Stuttgart (Germany)

    2009-07-01

    The continuing need for emissions compliance and fuel efficiency drive the development of commercial vehicle engines. Through the combined use of exhaust gas recirculation and aftertreatment, significant advances in the compliance of such engines for future emissions standards whilst retaining good fuel economy have been achieved and reported recently. These advances and their consequences for the optimum future vehicle cooling system will be presented. However, in such future engine and aftertreatment concepts about half of the available fuel energy is still dissipated in the form of ''waste'' heat. In light of the issues of climate change and the role that road haulage plays in the economic prosperity of society, the aspect of energy recovery must be addressed further: here thermomanagement, in particular the vehicle cooling system design and its components, has a leading position. Consequently, in this paper the evaluation of potential methods of energy recovery, their impact on the vehicle cooling systems and their practical plus economic viability, will also be given. (orig.)

  19. Wie man Elementarteilchen entdeckt vom Zyklotron zum LHC : ein Streifzug durch die Welt der Teilchenbeschleuniger

    CERN Document Server

    Freytag, Carl

    2016-01-01

    Dieses Buch erklärt die physikalischen Grundlagen und die Technologien der Elementarteilchenforschung und beschreibt allgemeinverständlich Teilchenbeschleuniger und -detektoren sowie ihr Zusammenspiel. An einigen Meilensteinen der Forschung – von der Erzeugung von Transuranen über die Entdeckung exotischer Mesonen bis zum Higgs-Boson – zeigen die Autoren den Weg von der Theorie über das Experiment zum Forschungsergebnis auf. Gravitonen, Higgs-Teilchen, Neutrinos und Quarks – das Interesse an den kleinsten uns bekannten Teilchen ist seit Jahrzehnten ungebrochen und rückt damit auch die Laboratorien in den Blick, die an die Grenzen der Physik vorstoßen: Neben dem größten Experimentierfeld, das wir haben – dem Universum selbst - sind es die gigantischen Maschinen der Elementarteilchenphysik in Großforschungseinrichtungen wie dem CERN und dem DESY. Mit ihnen versuchen Forscher weltweit unter Einsatz extrem hoher Energien Zustände zu simulieren, wie sie zum Beginn unseres Universums kurz nach d...

  20. Degradation of PAH by white-rot fungi. Abbau von polyzyklischen aromatischen Kohlenwasserstoffen durch Weissfaeulepilze

    Energy Technology Data Exchange (ETDEWEB)

    Majcherczyk, A [Goettingen Univ. (Germany). Arbeitsgruppe Technische Mykologie; Zeddel, A [Goettingen Univ. (Germany). Arbeitsgruppe Technische Mykologie; Kelschebach, M [Goettingen Univ. (Germany). Arbeitsgruppe Technische Mykologie; Loske, D [Goettingen Univ. (Germany). Arbeitsgruppe Technische Mykologie; Huettermann, A [Goettingen Univ. (Germany). Arbeitsgruppe Technische Mykologie

    1993-04-01

    The reports on exciting good results on degradation of xenobiotic substances by Phanaerochaete chrysosporium obtained in the early eighties in liquid cultures were confirmed for a wide spectrum of white-rot fungi under soil conditions. The substance classes which were successfully degraded were: PAH, PCB and TNT. The results obtained in the laboratory could in the case of PAH be transfered to a larger scale. The addition of known inducers of lignolytic enzymes did not increase the rate of degradation of xenobiotics of the white-rot fungi. The most critical parameter is the oxygen supply. For improving the economics of the process, cheap methods of growing the fungi were developed, such as the treatment of the substrate with detergents or the supplementing with potato pulp. These treatments have the advantage that they do not require expensive thermal activation of the substrate. Both processes provide excellent growth of the fungi without additional treatments. The at present best process for bioremediation of soils with white-rot fungi includes the following steps: liquification of the soil to a slurry, addition of the fungi together with possibly other substances e.g. tensides, solidification of the slurry by the addition of a lignocellulosic substrate which converts the slurry to a crumbly solid which can be well areated. The mass is then transferred to a closed container and incubated under controlled aeration. The problems being unsolved are: upscaling to the cubic meter scale, the lack of bioavailability of the xenobiotics in many soils, the lack of information about the degradation products and the most suitable way of determining the residual toxicity of the treated soils. (orig.)

  1. Saving energy in ventilation cooling towers. Optimization by control; Energieeinsparung bei Ventilatorkuehltuermen. Optimierung durch Regelung

    Energy Technology Data Exchange (ETDEWEB)

    Schnell, Wolf-Dieter [Ingenieurbuero fuer Energietechnik, Langenargen/Bodensee (Germany)

    2009-07-01

    Industrial-scale users of cooling water use bigger and higher natural-draught cooling towers to improve recirculation cooling. Smaller and medium-sized consumers as a rule use ventilation cooling towers.The market offers a wide choice of efficient products. At the same time, competition enforces savings so that often these ventilation cooling towers have no control option. However, optimum operation in the winter season necessitates variable air supply which is also a cost factor that can help to compensate the higher cost incurred in other seasons. (orig.)

  2. Biogenic methane from hydrothermal gasification of biomass; Biogenes Methan durch hydrothermale Vergasung von Biomasse

    Energy Technology Data Exchange (ETDEWEB)

    Schubert, M.; Vogel, F.

    2007-09-15

    This final report for the Swiss Federal Office of Energy (SFOE) reports on work done in the area of gasification of biomass. The use of dung, manure and sewage sludge as sources of energy is described and discussed. Hydrothermal gasification is proposed as an alternative to conventional gas-phase processes. The aim of the project in this respect is discussed. Here, a catalytic process that demonstrates the gasification of wet biomass to synthetic natural gas (SNG) in a continuously operating plant on a laboratory scale is being looked at. Difficulties encountered in preliminary tests are discussed. Long-term catalyst stability and the installations for the demonstration of the process are discussed, and gasification tests with ethanol are commented on.

  3. Aneignung und Interpretation der monadologischen Metaphysik von Leibniz durch die Metaphysik des Daseins

    Directory of Open Access Journals (Sweden)

    Hardy Neumann

    2014-06-01

    Full Text Available The research of H.-G. Gadamer and F. Volpi have showed the intimate connection between Sein und Zeit and the philosophy of Aristotle, specially the Nicomachean Ethics. The influence of other thinkers on the hermeneutical phenomenology has received less attention. Amongst the thinkers, whose contributions have not been sufficiently highlighted figures Leibniz. In this context, some relations between Leibniz’s monadological thinking and the metaphysics of Heidegger’s Dasein are considered and interpreted in this paper. It is argued that, to certain extent, an appropriation of Monadology’s metaphysics takes place in Dasein’s metaphysics.

  4. Air conditioning using waste heat from fuel cells; Konzeptstudie: Klimatisierung durch Abwaermenutzung aus Brennstoffzellen - Schlussbericht

    Energy Technology Data Exchange (ETDEWEB)

    Gantenbein, P.; Luzzi, A.; Spirig, M. [Hochschule fuer Technik Rapperswil (HSR), Institut fuer Solartechnik (SPF), Rapperswil (Switzerland); Schuler, A.; Nerlich, V. [Hexis AG, Winterthur (Switzerland)

    2007-07-01

    This concept study for the Swiss Federal Office of Energy (SFOE) reports on work done at the University of Applied Sciences in Rapperswil, Switzerland on possibilities of using the waste heat from fuel cell stacks to provide heating and, in the summertime, cooling using an absorption refrigeration system. The study evaluates the technical, economical and market-relevant aspects of such systems. The methods used in making comparisons with conventional reference systems, including reviews of existing information and expert questioning, are discussed. The results obtained are presented and the results of sensitivity analyses are discussed. These include electricity feed-in tariffs and gas prices, pay-back times, capital interest rates, etc. Further, barriers encountered such as patents and other market hindrances are discussed. The report is completed with a comprehensive appendix.

  5. Soil nitrogen availability and in situ nitrogen uptake by Acer rubrum L. and Pinus palustris Mill. in the southeastern U.S. Coastal Plain

    Science.gov (United States)

    Plant uptake of soil organic N in addition to inorganic N could play an important role in ecosystem N cycling as well as plant nutrition. We measured in situ plant uptake of organic and inorganic N by the dominant canopy species in two contrasting temperate forest ecosystems (bottomland floodplain ...

  6. Comparison of Red-Cockaded Woodpecker (Piciodes borealis) Nestling Diet in Old-Growth and Old-Field Longleaf Pine (Pinus palustris)

    Energy Technology Data Exchange (ETDEWEB)

    Hanula, J.L.; Engstrom, R.T.

    1999-10-01

    Automatic cameras were used to record adult woodpecker diets in old-growth and old-field longleaf pine in the South. Roaches were the number one prey for the woodpeckers based on either biomass or numbers. The latter ranged from 37% to 57% of the prey numbers and 55%-73% of the biomass. Morisita's index of similarity between old-field and old growth varied from 0.89 to 0.95. The authors conclude that the prey base is similar in both conditions and that old-growth provides similar foraging habitat.

  7. Weeds that can do both tricks: vegetative versus generative regeneration of short-lived root-sprouting herbs Rorippa palustris and Barbarea vulgaris

    Czech Academy of Sciences Publication Activity Database

    Klimešová, Jitka; Kociánová, Alena; Martínková, Jana

    2008-01-01

    Roč. 48, č. 2 (2008), s. 131-135 ISSN 0043-1737 R&D Projects: GA ČR GD206/03/H034 Institutional research plan: CEZ:AV0Z60050516 Keywords : Adventitious sprouting * disturbance * Brassicaceae Subject RIV: EF - Botanics Impact factor: 1.793, year: 2008

  8. Effects of dormant and growing season burning on surface fuels and potential fire behavior in northern Florida longleaf pine (Pinus palustris) flatwoods

    Science.gov (United States)

    James B. Cronan; Clinton S. Wright; Maria Petrova

    2015-01-01

    Prescribed fire is widely used to manage fuels in high-frequency, low-severity fire regimes including pine flatwoods of the southeastern USA where prescribed burning during the growing season (the frost-free period during the calendar year) has become more common in recent decades. Growing season prescribed fires address ecological management objectives that focus on...

  9. Device for controlling the current by an electromagnetic load, particularly by an electromagnetic injection valve of an internal combustion engine. Einrichtung zum Steuern des Stromes durch einen elektromagnetischen Verbraucher, insbesondere durch ein elektromagnetisch betaetigbares Einspritzventil einer Brennkraftmaschine

    Energy Technology Data Exchange (ETDEWEB)

    Dilger, P; Hoenig, G; Kauff, H

    1980-07-24

    The invention refers to a device for controlling the current by an electromagnetic load, particularly the electromagnetically actuated injection valve of an internal combustion engine. A first electrical switching device and an ammeter are connected in series with the electromagnetic load between two voltage supply wires, with a free running circuit and a threshold switch together with the ammeter. The invention is characterised by the fact that the free running circuit has a series circuit consisting of a second electrical switching device and a second ammeter, and the first switching device is controlled, depending on time and depending on reaching the upper and lower limits of current flowing through the load and reaching the lower threshold value. The ammeter in the free running circuit has at least one threshold value switch, whose output is coupled to a time control circuit for one of the two switching devices. The time dependent flow control is carried out during the stopping phase of the electro-magnetic load by counting processes.

  10. Contrasting the microbiomes from forest rhizosphere and deeper bulk soil from an Amazon rainforest reserve.

    Science.gov (United States)

    Fonseca, Jose Pedro; Hoffmann, Luisa; Cabral, Bianca Catarina Azeredo; Dias, Victor Hugo Giordano; Miranda, Marcio Rodrigues; de Azevedo Martins, Allan Cezar; Boschiero, Clarissa; Bastos, Wanderley Rodrigues; Silva, Rosane

    2018-02-05

    Pristine forest ecosystems provide a unique perspective for the study of plant-associated microbiota since they host a great microbial diversity. Although the Amazon forest is one of the hotspots of biodiversity around the world, few metagenomic studies described its microbial community diversity thus far. Understanding the environmental factors that can cause shifts in microbial profiles is key to improving soil health and biogeochemical cycles. Here we report a taxonomic and functional characterization of the microbiome from the rhizosphere of Brosimum guianense (Snakewood), a native tree, and bulk soil samples from a pristine Brazilian Amazon forest reserve (Cuniã), for the first time by the shotgun approach. We identified several fungi and bacteria taxon significantly enriched in forest rhizosphere compared to bulk soil samples. For archaea, the trend was the opposite, with many archaeal phylum and families being considerably more enriched in bulk soil compared to forest rhizosphere. Several fungal and bacterial decomposers like Postia placenta and Catenulispora acidiphila which help maintain healthy forest ecosystems were found enriched in our samples. Other bacterial species involved in nitrogen (Nitrobacter hamburgensis and Rhodopseudomonas palustris) and carbon cycling (Oligotropha carboxidovorans) were overrepresented in our samples indicating the importance of these metabolic pathways for the Amazon rainforest reserve soil health. Hierarchical clustering based on taxonomic similar microbial profiles grouped the forest rhizosphere samples in a distinct clade separated from bulk soil samples. Principal coordinate analysis of our samples with publicly available metagenomes from the Amazon region showed grouping into specific rhizosphere and bulk soil clusters, further indicating distinct microbial community profiles. In this work, we reported significant shifts in microbial community structure between forest rhizosphere and bulk soil samples from an Amazon

  11. Energy transfer and clustering of photosynthetic light-harvesting complexes in reconstituted lipid membranes

    International Nuclear Information System (INIS)

    Dewa, Takehisa; Sumino, Ayumi; Watanabe, Natsuko; Noji, Tomoyasu; Nango, Mamoru

    2013-01-01

    Highlights: ► Photosynthetic light-harvesting complexes were reconstituted into lipid membranes. ► Energy transfers between light-harvesting complexes were examined. ► Atomic force microscopy indicated cluster formation of light-harvesting complexes. ► Efficient energy transfer was observed for the clustered complexes in the membranes. - Abstract: In purple photosynthetic bacteria, light-harvesting complex 2 (LH2) and light harvesting/reaction centre core complex (LH1-RC) play the key roles of capturing and transferring light energy and subsequent charge separation. These photosynthetic apparatuses form a supramolecular assembly; however, how the assembly influences the efficiency of energy conversion is not yet clear. We addressed this issue by evaluating the energy transfer in reconstituted photosynthetic protein complexes LH2 and LH1-RC and studying the structures and the membrane environment of the LH2/LH1-RC assemblies, which had been embedded into various lipid bilayers. Thus, LH2 and LH1-RC from Rhodopseudomonas palustris 2.1.6 were reconstituted in phosphatidylglycerol (PG), phosphatidylcholine (PC), and phosphatidylethanolamine (PE)/PG/cardiolipin (CL). Efficient energy transfer from LH2 to LH1-RC was observed in the PC and PE/PG/CL membranes. Atomic force microscopy revealed that LH2 and LH1-RC were heterogeneously distributed to form clusters in the PC and PE/PG/CL membranes. The results indicated that the phospholipid species influenced the cluster formation of LH2 and LH1-RC as well as the energy transfer efficiency

  12. Energy transfer and clustering of photosynthetic light-harvesting complexes in reconstituted lipid membranes

    Energy Technology Data Exchange (ETDEWEB)

    Dewa, Takehisa, E-mail: takedewa@nitech.ac.jp [Department of Frontier Materials, Graduate School of Engineering, Nagoya Institute of Technology, Gokiso-cho, Showa-ku, Nagoya 466-8555 (Japan); Japan Science and Technology, PRESTO, 4-1-8 Honcho Kawaguchi, Saitama 332-0012 (Japan); Sumino, Ayumi; Watanabe, Natsuko; Noji, Tomoyasu [Department of Frontier Materials, Graduate School of Engineering, Nagoya Institute of Technology, Gokiso-cho, Showa-ku, Nagoya 466-8555 (Japan); Nango, Mamoru, E-mail: nango@nitech.ac.jp [Department of Frontier Materials, Graduate School of Engineering, Nagoya Institute of Technology, Gokiso-cho, Showa-ku, Nagoya 466-8555 (Japan)

    2013-06-20

    Highlights: ► Photosynthetic light-harvesting complexes were reconstituted into lipid membranes. ► Energy transfers between light-harvesting complexes were examined. ► Atomic force microscopy indicated cluster formation of light-harvesting complexes. ► Efficient energy transfer was observed for the clustered complexes in the membranes. - Abstract: In purple photosynthetic bacteria, light-harvesting complex 2 (LH2) and light harvesting/reaction centre core complex (LH1-RC) play the key roles of capturing and transferring light energy and subsequent charge separation. These photosynthetic apparatuses form a supramolecular assembly; however, how the assembly influences the efficiency of energy conversion is not yet clear. We addressed this issue by evaluating the energy transfer in reconstituted photosynthetic protein complexes LH2 and LH1-RC and studying the structures and the membrane environment of the LH2/LH1-RC assemblies, which had been embedded into various lipid bilayers. Thus, LH2 and LH1-RC from Rhodopseudomonas palustris 2.1.6 were reconstituted in phosphatidylglycerol (PG), phosphatidylcholine (PC), and phosphatidylethanolamine (PE)/PG/cardiolipin (CL). Efficient energy transfer from LH2 to LH1-RC was observed in the PC and PE/PG/CL membranes. Atomic force microscopy revealed that LH2 and LH1-RC were heterogeneously distributed to form clusters in the PC and PE/PG/CL membranes. The results indicated that the phospholipid species influenced the cluster formation of LH2 and LH1-RC as well as the energy transfer efficiency.

  13. Helical Propensity Affects the Conformational Properties of the Denatured State of Cytochrome c'.

    Science.gov (United States)

    Danielson, Travis A; Bowler, Bruce E

    2018-01-23

    Changing the helical propensity of a polypeptide sequence might be expected to affect the conformational properties of the denatured state of a protein. To test this hypothesis, alanines at positions 83 and 87 near the center of helix 3 of cytochrome c' from Rhodopseudomonas palustris were mutated to serine to decrease the stability of this helix. A set of 13 single histidine variants in the A83S/A87S background were prepared to permit assessment of the conformational properties of the denatured state using histidine-loop formation in 3 M guanidine hydrochloride. The data are compared with previous histidine-heme loop formation data for wild-type cytochrome c'. As expected, destabilization of helix 3 decreases the global stabilities of the histidine variants in the A83S/A87S background relative to the wild-type background. Loop stability versus loop size data yields a scaling exponent of 2.1 ± 0.2, similar to the value of 2.3 ± 0.2 obtained for wild-type cytochrome c'. However, the stabilities of all histidine-heme loops, which contain the helix 3 sequence segment, are increased in the A83S/A87S background compared to the wild-type background. Rate constants for histidine-heme loop breakage are similar for the wild-type and A83S/A87S variants. However, for histidine-heme loops that contain the helix 3 sequence segment, the rate constants for loop formation increase in the A83S/A87S background compared to the wild-type background. Thus, residual helical structure appears to stiffen the polypeptide chain slowing loop formation in the denatured state. The implications of these results for protein folding mechanisms are discussed. Copyright © 2017 Biophysical Society. Published by Elsevier Inc. All rights reserved.

  14. Expressed Peptide Tags: An additional layer of data for genome annotation

    Energy Technology Data Exchange (ETDEWEB)

    Savidor, Alon [ORNL; Donahoo, Ryan S [ORNL; Hurtado-Gonzales, Oscar [University of Tennessee, Knoxville (UTK); Verberkmoes, Nathan C [ORNL; Shah, Manesh B [ORNL; Lamour, Kurt H [ORNL; McDonald, W Hayes [ORNL

    2006-01-01

    While genome sequencing is becoming ever more routine, genome annotation remains a challenging process. Identification of the coding sequences within the genomic milieu presents a tremendous challenge, especially for eukaryotes with their complex gene architectures. Here we present a method to assist the annotation process through the use of proteomic data and bioinformatics. Mass spectra of digested protein preparations of the organism of interest were acquired and searched against a protein database created by a six frame translation of the genome. The identified peptides were mapped back to the genome, compared to the current annotation, and then categorized as supporting or extending the current genome annotation. We named the classified peptides Expressed Peptide Tags (EPTs). The well annotated bacterium Rhodopseudomonas palustris was used as a control for the method and showed high degree of correlation between EPT mapping and the current annotation, with 86% of the EPTs confirming existing gene calls and less than 1% of the EPTs expanding on the current annotation. The eukaryotic plant pathogens Phytophthora ramorum and Phytophthora sojae, whose genomes have been recently sequenced and are much less well annotated, were also subjected to this method. A series of algorithmic steps were taken to increase the confidence of EPT identification for these organisms, including generation of smaller sub-databases to be searched against, and definition of EPT criteria that accommodates the more complex eukaryotic gene architecture. As expected, the analysis of the Phytophthora species showed less correlation between EPT mapping and their current annotation. While ~77% of Phytophthora EPTs supported the current annotation, a portion of them (7.2% and 12.6% for P. ramorum and P. sojae, respectively) suggested modification to current gene calls or identified novel genes that were missed by the current genome annotation of these organisms.

  15. Bioremediation of trace cobalt from simulated spent decontamination solutions of nuclear power reactors using E. coli expressing NiCoT genes

    International Nuclear Information System (INIS)

    Raghu, G.; Maruthi Mohan, P.; Balaji, V.; Venkateswaran, G.; Rodrigue, A.; Lyon 1 Univ., 69

    2008-01-01

    Removal of radioactive cobalt at trace levels (∼nM) in the presence of large excess (10 6 -fold) of corrosion product ions of complexed Fe, Cr, and Ni in spent chemical decontamination formulations (simulated effluent) of nuclear reactors is currently done by using synthetic organic ion exchangers. A large volume of solid waste is generated due to the nonspecific nature of ion sorption. Our earlier work using various fungi and bacteria, with the aim of nuclear waste volume reduction, realized up to 30% of Co removal with specific capacities calculated up to 1 μg/g in 6-24 h. In the present study using engineered Escherichia coli expressing NiCoT genes from Rhodopseudomonas palustris CGA009 (RP) and Novosphingobium aromaticivorans F-199 (NA), we report a significant increase in the specific capacity for Co removal (12 μg/g) in 1-h exposure to simulated effluent. About 85% of Co removal was achieved in a two-cycle treatment with the cloned bacteria. Expression of NiCoT genes in the E. coli knockout mutant of NiCoT efflux gene (rcnA) was more efficient as compared to expression in wild-type E. coli MC4100, JM109 and BL21 (DE3) hosts. The viability of the E. coli strains in the formulation as well as at different doses of gamma rays exposure and the effect of gamma dose on their cobalt removal capacity are determined. The potential application scheme of the above process of bioremediation of cobalt from nuclear power reactor chemical decontamination effluents is discussed. (orig.)

  16. Phylogenetic Analysis of Shewanella Strains by DNA Relatedness Derived from Whole Genome Microarray DNA-DNA Hybridization and Comparisons with Other Methods

    International Nuclear Information System (INIS)

    Wu, Liyou; Yi, T.Y.; Van Nostrand, Joy; Zhou, Jizhong

    2010-01-01

    Phylogenetic analyses were done for the Shewanella strains isolated from Baltic Sea (38 strains), US DOE Hanford Uranium bioremediation site (Hanford Reach of the Columbia River (HRCR), 11 strains), Pacific Ocean and Hawaiian sediments (8 strains), and strains from other resources (16 strains) with three out group strains, Rhodopseudomonas palustris, Clostridium cellulolyticum, and Thermoanaerobacter ethanolicus X514, using DNA relatedness derived from WCGA-based DNA-DNA hybridizations, sequence similarities of 16S rRNA gene and gyrB gene, and sequence similarities of 6 loci of Shewanella genome selected from a shared gene list of the Shewanella strains with whole genome sequenced based on the average nucleotide identity of them (ANI). The phylogenetic trees based on 16S rRNA and gyrB gene sequences, and DNA relatedness derived from WCGA hybridizations of the tested Shewanella strains share exactly the same sub-clusters with very few exceptions, in which the strains were basically grouped by species. However, the phylogenetic analysis based on DNA relatedness derived from WCGA hybridizations dramatically increased the differentiation resolution at species and strains level within Shewanella genus. When the tree based on DNA relatedness derived from WCGA hybridizations was compared to the tree based on the combined sequences of the selected functional genes (6 loci), we found that the resolutions of both methods are similar, but the clustering of the tree based on DNA relatedness derived from WMGA hybridizations was clearer. These results indicate that WCGA-based DNA-DNA hybridization is an idea alternative of conventional DNA-DNA hybridization methods and it is superior to the phylogenetics methods based on sequence similarities of single genes. Detailed analysis is being performed for the re-classification of the strains examined.

  17. Apo-bacteriophytochromes modulate bacterial photosynthesis in response to low light.

    Science.gov (United States)

    Fixen, Kathryn R; Baker, Anna W; Stojkovic, Emina A; Beatty, J Thomas; Harwood, Caroline S

    2014-01-14

    Bacteriophytochromes (BphPs) are light-sensing regulatory proteins encoded by photosynthetic and nonphotosynthetic bacteria. This protein class has been characterized structurally, but its biological activities remain relatively unexplored. Two BphPs in the anoxygenic photosynthetic bacterium Rhodopseudomonas palustris, designated regulatory proteins RpBphP2 and RpBphP3, are configured as light-regulated histidine kinases, which initiate a signal transduction system that controls expression of genes for the low light harvesting 4 (LH4) antenna complex. In vitro, RpBphP2 and RpBphP3 respond to light quality by reversible photoconversion, a property that requires the light-absorbing chromophore biliverdin. In vivo, RpBphP2 and RpBphP3 are both required for the expression of the LH4 antenna complex under anaerobic conditions, but biliverdin requires oxygen for its synthesis by heme oxygenase. On further investigation, we found that the apo-bacteriophytochrome forms of RpBphP2 and RpBphP3 are necessary and sufficient to control LH4 expression in response to light intensity in conjunction with other signal transduction proteins. One possibility is that the system senses a reduced quinone pool generated when light energy is absorbed by bacteriochlorophyll. The biliverdin-bound forms of the BphPs have the additional property of being able to fine-tune LH4 expression in response to light quality. These observations support the concept that some bacteriophytochromes can function with or without a chromophore and may be involved in regulating physiological processes not directly related to light sensing.

  18. Engineering strategies for the enhanced photo-H{sub 2} production using effluents of dark fermentation processes as substrate

    Energy Technology Data Exchange (ETDEWEB)

    Chen, Chun-Yen; Chang, Jo-Shu [Department of Chemical Engineering, National Cheng Kung University, Tainan (China); Sustainable Environment Research Center, National Cheng Kung University, Tainan (China); Yeh, Kuei-Ling; Lo, Yung-Chung [Department of Chemical Engineering, National Cheng Kung University, Tainan (China); Wang, Hui-Min [Department of Fragrance and Cosmetic Science, Kaohsiung Medical University, Kaohsiung (China)

    2010-12-15

    The major obstacle of combining dark and photo fermentation for high-yield biohydrogen production is substrate inhibition while using dark fermentation effluent as the sole substrate. To solve this problem, the dark fermentation broth was diluted with different dilution ratio to improve photo-H{sub 2} production performance of an indigenous purple nonsulfur bacterium Rhodopseudomonas palustris WP3-5. The best photo-H{sub 2} production performance occurred at a dilution ratio of 1:2, giving a highest overall H{sub 2} production rate of 10.72 ml/l/h and a higher overall H{sub 2} yield of 6.14 mol H{sub 2}/mol sucrose. The maximum H{sub 2} content was about 88.1% during the dilution ratio of 1:2. The photo-H{sub 2} production performance was further improved by supplying yeast extract and glutamic acid as the nutrient. The results indicate that the overall H{sub 2} production rate and H{sub 2} yield increased to 17.02 ml/l/h and 10.25 mol H{sub 2}/mol sucrose, respectively. Using a novel solar-energy-excited optical fiber photobioreactor (SEEOFP) with supplementing tungsten filament lamp (TL) irradiation, the overall H{sub 2} production rate was improved to 17.86 ml/l/h. Meanwhile, the power consumption by combining SEEOFP and TL was about 37.1% lower than using TL alone. This study demonstrates that using optimal light sources and proper dilution of dark fermentation effluent, the performance of photo-H{sub 2} production can be markedly enhanced along with a reduction of power consumption. (author)

  19. Phylogenetic Analysis of Shewanella Strains by DNA Relatedness Derived from Whole Genome Microarray DNA-DNA Hybridization and Comparison with Other Methods

    Energy Technology Data Exchange (ETDEWEB)

    Wu, Liyou; Yi, T. Y.; Van Nostrand, Joy; Zhou, Jizhong

    2010-05-17

    Phylogenetic analyses were done for the Shewanella strains isolated from Baltic Sea (38 strains), US DOE Hanford Uranium bioremediation site [Hanford Reach of the Columbia River (HRCR), 11 strains], Pacific Ocean and Hawaiian sediments (8 strains), and strains from other resources (16 strains) with three out group strains, Rhodopseudomonas palustris, Clostridium cellulolyticum, and Thermoanaerobacter ethanolicus X514, using DNA relatedness derived from WCGA-based DNA-DNA hybridizations, sequence similarities of 16S rRNA gene and gyrB gene, and sequence similarities of 6 loci of Shewanella genome selected from a shared gene list of the Shewanella strains with whole genome sequenced based on the average nucleotide identity of them (ANI). The phylogenetic trees based on 16S rRNA and gyrB gene sequences, and DNA relatedness derived from WCGA hybridizations of the tested Shewanella strains share exactly the same sub-clusters with very few exceptions, in which the strains were basically grouped by species. However, the phylogenetic analysis based on DNA relatedness derived from WCGA hybridizations dramatically increased the differentiation resolution at species and strains level within Shewanella genus. When the tree based on DNA relatedness derived from WCGA hybridizations was compared to the tree based on the combined sequences of the selected functional genes (6 loci), we found that the resolutions of both methods are similar, but the clustering of the tree based on DNA relatedness derived from WMGA hybridizations was clearer. These results indicate that WCGA-based DNA-DNA hybridization is an idea alternative of conventional DNA-DNA hybridization methods and it is superior to the phylogenetics methods based on sequence similarities of single genes. Detailed analysis is being performed for the re-classification of the strains examined.

  20. Redox thermodynamics of the native and alkaline forms of eukaryotic and bacterial class I cytochromes c.

    Science.gov (United States)

    Battistuzzi, G; Borsari, M; Sola, M; Francia, F

    1997-12-23

    The reduction potentials of beef heart cytochrome c and cytochromes c2 from Rhodopseudomonas palustris, Rhodobacter sphaeroides, and Rhodobacter capsulatus were measured through direct electrochemistry at a surface-modified gold electrode as a function of temperature in nonisothermal experiments carried out at neutral and alkaline pH values. The thermodynamic parameters for protein reduction (DeltaS degrees rc and DeltaH degrees rc) were determined for the native and alkaline conformers. Enthalpy and entropy terms underlying species-dependent differences in E degrees and pH- and temperature-induced E degrees changes for a given cytochrome were analyzed. The difference of about +0.1 V in E degrees between cytochromes c2 and the eukaryotic species can be separated into an enthalpic term (-DeltaDeltaH degrees rc/F) of +0.130 V and an entropic term (TDeltaDeltaS degrees rc/F) of -0.040 V. Hence, the higher potential of the bacterial species appears to be determined entirely by a greater enthalpic stabilization of the reduced state. Analogously, the much lower potential of the alkaline conformer(s) as compared to the native species is by far enthalpic in origin for both protein families, and is largely determined by the substitution of Met for Lys in axial heme ligation. Instead, the biphasic E degrees /temperature profile for the native cytochromes is due to a difference in reduction entropy between the conformers at low and high temperatures. Temperature-dependent 1H NMR experiments suggest that the temperature-induced transition also involves a change in orientation of the axial methionine ligand with respect to the heme plane.

  1. Characterizations of purple non-sulfur bacteria isolated from paddy fields, and identification of strains with potential for plant growth-promotion, greenhouse gas mitigation and heavy metal bioremediation.

    Science.gov (United States)

    Sakpirom, Jakkapan; Kantachote, Duangporn; Nunkaew, Tomorn; Khan, Eakalak

    2017-04-01

    This study was aimed at selecting purple non-sulfur bacteria (PNSB) isolated from various paddy fields, including Cd- and Zn-contaminated paddy fields, based on their biofertilizer properties. Among 235 PNSB isolates, strain TN110 was most effective in plant growth-promoting substance (PGPS) production, releasing 3.2 mg/L of [Formula: see text] , 4.11 mg/L of 5-aminolevulinic acid (ALA) and 3.62 mg/L of indole-3-acetic acid (IAA), and reducing methane emission up to 80%. This strain had nifH, vnfG and anfG, which are the Mo, V and Fe nitrogenase genes encoded for key enzymes in nitrogen fixation under different conditions. This strain provided 84% and 55% removal of Cd and Zn, respectively. Another isolate, TN414, not only produced PGPS (1.30 mg/L of [Formula: see text] , 0.94 mg/L of ALA and 0.65 mg/L of IAA), but was also efficient in removing both Cd and Zn at 72% and 74%, respectively. Based on 16S rDNA sequencing, strain TN110 was identified as Rhodopseudomonas palustris, while strain TN414 was Rubrivivax gelatinosus. A combination of TN110 and TN414 could potentially provide a biofertilizer, which is a greener alternative to commercial/chemical fertilizers and an agent for bioremediation of heavy metals and greenhouse gas mitigation in paddy fields. Copyright © 2016 Institut Pasteur. All rights reserved.

  2. Structural characterization of core-bradavidin in complex with biotin

    Science.gov (United States)

    Agrawal, Nitin; Määttä, Juha A. E.; Kulomaa, Markku S.; Hytönen, Vesa P.; Johnson, Mark S.; Airenne, Tomi T.

    2017-01-01

    Bradavidin is a tetrameric biotin-binding protein similar to chicken avidin and bacterial streptavidin, and was originally cloned from the nitrogen-fixing bacteria Bradyrhizobium diazoefficiens. We have previously reported the crystal structure of the full-length, wild-type (wt) bradavidin with 138 amino acids, where the C-terminal residues Gly129-Lys138 (“Brad-tag”) act as an intrinsic ligand (i.e. Gly129-Lys138 bind into the biotin-binding site of an adjacent subunit within the same tetramer) and has potential as an affinity tag for biotechnological purposes. Here, the X-ray structure of core-bradavidin lacking the C-terminal residues Gly114-Lys138, and hence missing the Brad-tag, was crystallized in complex with biotin at 1.60 Å resolution [PDB:4BBO]. We also report a homology model of rhodavidin, an avidin-like protein from Rhodopseudomonas palustris, and of an avidin-like protein from Bradyrhizobium sp. Ai1a-2, both of which have the Brad-tag sequence at their C-terminus. Moreover, core-bradavidin V1, an engineered variant of the original core-bradavidin, was also expressed at high levels in E. coli, as well as a double mutant (Cys39Ala and Cys69Ala) of core-bradavidin (CC mutant). Our data help us to further engineer the core-bradavidin–Brad-tag pair for biotechnological assays and chemical biology applications, and provide deeper insight into the biotin-binding mode of bradavidin. PMID:28426764

  3. CHAR ACTERIZA T ION OF THR EE BENZO A TE DEG RADING ANOX YGENIC PH OTOSYNTHETIC BA CTERI A ISO LA TED F RO M THE ENVIRONMENT

    Directory of Open Access Journals (Sweden)

    DWI SURYANTO

    2001-01-01

    Full Text Available Three anoxygenic photosyn thetic bacter ia, DS-1, DS-4 and Cas-13, have been exam in ated for their morphological and physiolog ical propert ies. All s trains were rod-sh ape ce lls with a swollen terminal end, Gram nega tive , motile, non-hal ophilic, non-alkal ophilic a n d non- acid ophilic , a nd capable of utilizing benzoate aerobically and photo-anaerobically. Sequ ence analysis of part of 16S rRNA genes showed that DS-1 and Cas- 13 we re cl osel y relate d to Rhodopseudomonas palustris Stra in 7 w ith a simila ri ty of 97%, where a s DS-4 ma y not be c losel y rela te d t o the former t wo str ai ns wit h a si milarit y of 78% based on t he constr ucte d phyloge nic tree . Sp ec tral anal ys is ind ica te d that the thr ee ba cter ia ha d ba cter io ch lorophyl a and norm al sp ir il loxa nthi n ser ies. Growth in med ium enriched with vitamin and supplemen ted with ben zoa te as their s ole C-s ources wa s bette r t han in me di um witho ut vita min. Benz oate deg ra dati on in me di u m with vita min was ac ce lerated. The ab ility to grow on benzoate withou t added vitam ins ind icated that the bacteria were able to s ynthesize th eir own vitamins.

  4. Study on improvement of continuous hydrogen production by photosynthetic biofilm in interior illuminant reactor.

    Science.gov (United States)

    Liu, Wenhui; Yuan, Linjiang; Wei, Bo

    2016-09-01

    In the present study, a new type of interior optical fiber illuminating reactor was developed for H2 production to solve the problem of luminous intensity attenuation at the center portion of a reactor, and an immobilization technique was used to enhance the stability of a continuous hydrogen production process with attached photosynthetic bacteria, using glucose as a sole carbon substrate for the indigenous photosynthetic bacteria (PSB) Rhodopseudomonas palustris SP-6. Results of the experiments showed that the interior optical fiber illuminating reactor produces H2 more efficiently and productively than the exterior light source reactor, with the cumulative H2 production, the maximum H2 production rate and H2 yield increased by 813ml, 11.3ml l-1 h-1 and 22.3%, respectively. The stability of the product of continuous hydrogen was realized by immobilizing PSB on the surface of powder active carbon(PAC). After adding the dosage of 2.0g l-1 PAC, the continuous steady operation of H2 production gave a high H2 yield of 1.398 mol H2 mol-1 glucose and an average H2 production rate of 35.1ml l-1 h-1 illuminating with a single interior optical fiber light source. Meanwhile, a higher H2 yield of 1.495 mol H2 mol-1 glucose and an average H2 production rate of 38.7ml l-1 h-1 were attained illuminating with a compound lamp in the continuous H2 production for 20 days.

  5. Structural characterization of core-bradavidin in complex with biotin.

    Directory of Open Access Journals (Sweden)

    Nitin Agrawal

    Full Text Available Bradavidin is a tetrameric biotin-binding protein similar to chicken avidin and bacterial streptavidin, and was originally cloned from the nitrogen-fixing bacteria Bradyrhizobium diazoefficiens. We have previously reported the crystal structure of the full-length, wild-type (wt bradavidin with 138 amino acids, where the C-terminal residues Gly129-Lys138 ("Brad-tag" act as an intrinsic ligand (i.e. Gly129-Lys138 bind into the biotin-binding site of an adjacent subunit within the same tetramer and has potential as an affinity tag for biotechnological purposes. Here, the X-ray structure of core-bradavidin lacking the C-terminal residues Gly114-Lys138, and hence missing the Brad-tag, was crystallized in complex with biotin at 1.60 Å resolution [PDB:4BBO]. We also report a homology model of rhodavidin, an avidin-like protein from Rhodopseudomonas palustris, and of an avidin-like protein from Bradyrhizobium sp. Ai1a-2, both of which have the Brad-tag sequence at their C-terminus. Moreover, core-bradavidin V1, an engineered variant of the original core-bradavidin, was also expressed at high levels in E. coli, as well as a double mutant (Cys39Ala and Cys69Ala of core-bradavidin (CC mutant. Our data help us to further engineer the core-bradavidin-Brad-tag pair for biotechnological assays and chemical biology applications, and provide deeper insight into the biotin-binding mode of bradavidin.

  6. Comparison normal composting with composting using effective microorganisms for poultry carcasses disposal in poultry farms

    Directory of Open Access Journals (Sweden)

    D. M. Taher

    2009-01-01

    Full Text Available Composting offers a convenient and environmentally acceptable safe, effective method for the disposal of carcasses as an alternative method to burning, burial and rendering. This study was conducted to evaluate the effects of a natural biological products containing an effective microorganisms namily; Lactic acid bacill (Lactobacillus plantarum; L. casei Streptococcus Lactis., Photosynthetic bacteria (Rhodopseudomonas palustris; Rhodobacter sphaeroides,Yeast (Saccharomyces cerevisiae; Candida utilis Toula, Pichia Jadinii, Actinomycetes (Streptomyces albus; S. griseus., and Fermenting fungi (Aspergillus oryzae; Mucor hiemalis in the composting activity of poultry carcasses. The composting stacks constitute multi alternative layers of wood shaves, hay, poultry carcasses and then wood shaves and so on. The layers have been bypassed with plastic tubes for oxygen supply. Moreover, a petri dishes of salmonella and E. coli colonies were introduced within poultry carcasses layer. After 8 days of the experimental period this study follows the physical properties of the composting process according to its odor intesity, color and pH level as well as the bacterial reisolation from the stored colonies. Results indicate that the biological products increase the temperature of the composting stack (66-68° C with a minimal odors as the pH meters recording 5.4 as compared to the control composting stack (52-64° C and pH 6.8 with offender odors. On the other hand ,the biological product inhibit the bacterial reisolation offers since the 10the day of the experiment, however, in the normal composting stack that periods will prolonged till the 17 days of the experiment. Interestingly, the biological product induce high and rapid digestable rate for the poultry carcasses which shown within 25 days of the experiment, in comparison to the normal composting stack which induce that effects in 60 days. In conclusion, the addition of effective microorganism to the

  7. Study of the impact of environmental bacteria ob uranium speciation in order to engage bioremediation process

    International Nuclear Information System (INIS)

    Untereiner, G.

    2008-11-01

    Uranium is both a radiological and a chemical toxic. Its concentration in the environment is low except when human activities have caused pollution. Uranium is a heavy reactive element, and thus it is easily complexed with soil component like minerals or organic molecules. These different complexes can be more or less bioavailable for microorganisms and plants, and then get in the human food chain. The knowledge and the understanding of transfer mechanisms and also the fate of toxic elements in the biosphere are a key issue to estimate health and ecological hazards. The knowledge of the speciation is very important for bioremediation processes. Here, we focused on the microorganisms effects onto uranium speciation in environment. Bacteria can accumulate and/or transform uranium depending on the initial form of the element. Thus, its bioavailability could be changed. The species used in this work are Cupriavidus metallidurans CH34, which is an environmental bacteria with a high resistance to heavy metal, Deinococcus radiodurans R1, which is known for his radiological resistance, and Rhodopseudomonas palustris, which is a purple photo-trophic bacteria capable of degrading aromatic compounds. Two forms of uranium were used with these bacteria, a mineral one, uranyl carbonate, and an organic one, uranyl citrate. In a first step, the growth media were modified in order to stabilize uranium complexes thanks to a simulation program. Then, the capacity of the bacteria to accumulate or transform uranium was studied. We saw a difference between minimal inhibition concentrations of these two speciation which is due to a difference between phosphate bioavailability. No accumulation was observed with environmental pH but uranium precipitation was observed with acidic pH (pH 1). Uranium speciation seemed to be well controlled in the growth media and the precipitates were uranyl phosphate. (author)

  8. Measurement of in-cylinder mixture formation by optical indication; Bestimmung der innermotorischen Gemischbildung durch optisches Indizieren

    Energy Technology Data Exchange (ETDEWEB)

    Berg, Thomas; Thiele, Olaf; Seefeldt, Stefan [LaVision GmbH, Goettingen (Germany); Vanhaelst, Robin [Ostfalia Hochschule fuer Angewandte Wissenschaften, Wolfsburg (Germany). Fakultaet Fahrzeugtechnik

    2013-06-01

    The company LaVision has developed an optical indication process that can be used to determine lambda, residual gas and temperature curves in the combustion chamber with high temporal resolution. The sensor system is able to provide crank angle-resolved, real-time measurements of the complete process of in-cylinder mixture formation over hundreds of single cycles. (orig.)

  9. Sichtbarkeit von Bibliotheken durch Non-Profit-Marketing / High-profile for libraries through non-profit-marketing

    Directory of Open Access Journals (Sweden)

    Buzinkay, Mark

    2007-07-01

    Full Text Available Tight budgets and an increasing competition in the information market force libraries to rethink their „awareness“ strategies. Therefore, Marketing iis an essential tool to address this topic. Tools from the Web 2.0 (blogs and others universe offer an efficient and effective way to approach such strategy.

  10. HALIPP. Photocatalysis of tropospheric chemistry by sea salt. Final report; HALIPP. Photokatalyse der Luftchemie durch Seesalz-Aerosole. Abschlussbericht

    Energy Technology Data Exchange (ETDEWEB)

    Zetzsch, C; Scheer, V; Krueger, H U; Behnke, W

    1994-12-31

    The reactions of gaseous NO{sub 2} and N{sub 2}O{sub 5} with humidified NaCl-aerosol and humidified mixed NaCl/NaNO{sub 3}- and NaCl/Na{sub 2}SO{sub 4} -aerosols and of gaseous O{sub 3} with humidified sea-salt aerosol were investigated. An upper limit of <10{sup 4} was estimated for the uptake coefficient of NO{sub 2} from our measurements, the uptake coefficient of N{sub 2}O{sub 5} was determined to be 0.032{+-}0.003 (stated error: {+-}2{sigma}). Instead of NOCl reported as a product from NaCl in the literature, HONO is formed from the reaction of NO{sub 2} with deliquescent NaCl aerosol. Gaseaous N{sub 2}O{sub 5} is converted to gaseous CINO{sub 2} below relative humidities of 94%. Only at much higher humidities the formation of 2 HNO{sub 3} increases. No precursors of atomic Cl are observed to be formed from gaseous ozone and pure NaCl-aerosol. Only in the presence of seal-salt aerosols a formation of Cl{sub 2} is found (although not yet quantified). (orig.) [Deutsch] Es wurde die Reaktion von gasfoermigem NO{sub 2} und N{sub 2}O{sub 5} mit feuchtem NaCl- und gemischtem NaCl/NaNO{sub 3}- und NaCl/Na{sub 2}SO{sub 4}- Aerosol sowie von gasfoermigem O{sub 3} mit feuchtem Seesalzaerosol untersucht. Der Uptake-Koeffizient von NO{sub 2} wurde mit kleiner 10{sup -4} abgeschaetzt, der von N{sub 2}O{sub 5} mit 0.032{+-}0.003 (2{sigma}-Fehler) bestimmt. In Gegenwart von NO{sub 2} bildet sich anstelle des in der Literatur angegebenen NOCl gasfoermigs HONO und in Gegenwart von N{sub 2}O{sub 5} unterhalb einer relativen Feuchte von 94% hauptsaechlich gasfoermiges ClNO{sub 2}. Erst in Gegenwart wesentlich hoeherer Feuchten nimmt die Bildung von 2HNO{sub 3} zu. In Gegenwart von Ozon und reinem NaCl-Aerosol bilden sich keine Chloratomvorlaeufer. Erst in Gegenwart von Seesalzaerosolen kommt es zur Bildung von Cl{sub 2}. Eine Quantifizierung dieser letzteren Ergebnisse wurde noch nicht durchgefuehrt. (orig.)

  11. Energy efficiency by maintenance. Research results and practical applications. Proceedings; Energieeffizienz durch Instandhaltung. Forschungsergebnisse und praktische Anwendungen. Tagungsband

    Energy Technology Data Exchange (ETDEWEB)

    Bandow, Gerhard (ed.)

    2009-07-01

    There is an increasing awareness of using our energy resources more efficiently which also leads to the finding of the importance of energy-efficient building services and operation. Unfortunately, we often restrict ourselves looking only at the costs of the investment itself instead of taking into account also the costs during the long time of building. This proceeding discusses the energy potentials of building and industry automation and control and how the potentials can be calculated and increased in industry and manufacturing. Further more, energy efficiency as a task for coaching people to change behaviour is shown taking into account measures to met understanding for energy saving problems. (orig./GL)

  12. Optimising the operation of hybrid coolers by means of efficient control equipment; Optimierung der Betriebsweise von Hybridkuehlern durch effiziente Steuerungstechnik

    Energy Technology Data Exchange (ETDEWEB)

    Odrich, T.; Koenig, H. [Jaeggi/Guentner (Schweiz) AG, Trimbach (Switzerland)

    2007-07-01

    Due to its functional principle and design, the hybrid dry cooler holds a high potential for saving water and energy. Purely convective heat discharge during dry operation in the case of a high annual rate of utilisation, evaporative cooling during the wetting cycle at peak load times or high ambient temperatures and infinitely adjustable fan speed in both operating modes permit a very substantial recooling performance at low operating costs and with little space requirement. However, the efficiency of hybrid dry coolers depends to a large degree on how intelligently the cooling functions are controlled and on the control strategy. The present article demonstrates that the control strategy contributes decisively to minimising water and energy consumption and costs. Besides describing the actual functions of a hybrid cooler control system it presents a control strategy for automatic lowering of the setpoint and hence optimisation of the refrigeration process. It discusses the option of operating multiple hybrid coolers by means of a hydraulic network and presents an optimised control concept for this purpose which is based on a master control unit. In conclusion the study shows that hybrid coolers need their own optimised control unit if maximum savings in energy and water are to be achieved.

  13. Aus der Krise lernen – Wirtschaftlichkeit durch Flexibilität und Wandlungsfähigkeit sichern

    OpenAIRE

    Schmidt, Jan

    2012-01-01

    Flexible und wandelbare Fabrikstrukturen sind von hoher Bedeutung, wenn Produktionsstätten in einem turbulenten Umfeld langfristig wettbewerbsfähig bleiben sollen; darin sind sich Forschung und Praxis einig. Während der jüngsten weltweiten Wirtschaftskrise wurden Experten aus dem Airline-Catering-Umfeld befragt, wie Betriebe dieser Branche auf starke Veränderungen vorbereitet sind. Vorgespräche und Analysen des Autors legten die Vermutung nahe, dass diese Dienstleistungsbranche besonderen...

  14. Hazards in air-, rail-, and road traffic arising from laserpointers; Gefaehrdungen des Luft-, Schienen- und Strassenverkehrs durch Laserpointer

    Energy Technology Data Exchange (ETDEWEB)

    Reidenbach, H.D. [Fachhochschule Koeln (Germany). Forschungsschwerpunkt Medizintechnik und Nichtionisierende Strahlung; Deutsch-Schweizerischer Fachverband fuer Strahlenschutz e.V., Garching (Germany). Arbeitskreis Nichtionisierende Strahlung (AKNIR)

    2012-07-01

    Visible laser radiation with sufficient irradiance or radiant exposure might result in permanent damage of the eyes especially in the retina. In order to prevent this exposure limit values have been established based on current scientific knowledge. In addition visible laser radiation might result in effects like temporary blinding at even much lower exposure values. In this case irritations, flash-blindness and afterimages appear whose extent might exceed the respective damage level while vision is temporarily compromised in critical visual tasks more or less. The easy accessibility of hand-held laser products (laser pointers) with relatively high power might result in a modification of the security situation especially in air traffic via thoughtless and careless use of such products or in terroristic acts. In addition an increasing number of incidents in rail and road traffic where not only temporary blinding might be anticipated but permanent damage of the eyes as a result of overexposure due to laser pointer irradiation cannot be excluded any longer. Using laser pointers, which are available on the market in the power range up to 1 watt and at different wavelengths new hazard scenarios and threats with serious consequences are possible. Here the radiation protection is in great demand. (orig.)

  15. Monitoring of geothermal fields by seismic networks. Guidelines and chances; Monitoring geothermaler Felder durch seismische Netzwerke. Vorgaben und Chancen

    Energy Technology Data Exchange (ETDEWEB)

    Barth, Andreas [Karlsruher Institut fuer Technologie (KIT), Karlsruhe (Germany). Geophysikalisches Inst.; Gaucher, Emmanuel [Karlsruher Institut fuer Technologie (KIT), Karlsruhe (Germany). Abt. Geothermie

    2012-07-01

    The monitoring of geothermal power plants requires seismic networks in order to quantify ground motions at the earth's surface in the case of a possible micro seismicity or to describe spatio-temporal seismicity distribution in the reservoir. The first case requires official needs. The second case may help to develop the reservoirs. An optimal configuration of the seismic network may adequate for both tasks. It also can be a chance for a long-term investment for the overall benefit.

  16. CBAS - efficient coal management for optimised operation and minimised cost; CBAS - Betriebsoptimierung und Kostenminimierung durch effizientes Kohlenmanagement

    Energy Technology Data Exchange (ETDEWEB)

    Pechtl, P.; Petek, J.; Shea, S.

    2000-07-01

    The 'Coal Bland Automation System' CBAS developed by Praxis Engineers, Inc. is a software application which simulates the path of coal from the dispatching station to the burners. The combustion characteristics of coal mixtures are predicted, and the fuel quality can be controlled hours before the coal arrives at the burners. Detailed modelling of the flow patterns in the mixing bunkers and grinding bunkers, time variations of the coal mixture properties at the bunker outlet can be predicted, and the coal mixture can be varied accordingly to account for load peaks. [German] Das von Praxis Engineers, Inc. entwickelte 'Coal Bland Automation System' CBAS ist eine online Softwareapplikation, die den Weg aller in einem Kraftwerk eingesetzten Kohlensorten vom Verladeplatz bis hin zu den Brennern mathematisch simuliert. Die Eigenschaften beliebiger Mischungen zwischen den Kohlen werden vorausgesagt und die Qualitaet des Brennstoffs an den Brennern kann geregelt werden, auch Stunden bevor die Kohlenmischung tatsaechlich an den Brennern ankommt. Aufgrund der detaillierten Modellierung des Fliessverhaltens in den Mischbunkern und den Bunkern der Kohlemuehlen ist es moeglich, die zeitliche Veraenderung der Eigenschaften der Kohlenmischung am Austritt aus den Bunkern vorherzusagen. Dadurch kann das Mischungsverhaeltnis der Kohlen rascher an die Lastanforderungen angepasst werden, was z.B. zum 'Einfangen' von lukrativen Lastspitzen genutzt werden kann. (orig.)

  17. Herstellung und Charakterisierung von Li-Schwefel-Kathoden durch in-situ XRD, Impedanzspektroskopie und AFM-Messungen

    OpenAIRE

    Wagner, Norbert; Canas, Natalia; Hiesgen, Renate; Pascucci, Brigitta; Friedrich, K. Andreas

    2013-01-01

    Derzeit ist das wissenschaftliche und kommerzielle Interesse an der Entwicklung von Lithium-Schwefel Batterien sehr groß. Besondere Eigenschaften dieser Batte-rien sind, unter anderem, die hohe theoretische Energiedichte (2600 Wh/kg bzw. 2800 Wh/l) und Kapazität des Schwefels (1675 mAh/g), sowie das geringe Gewicht und die gute Verfügbarkeit von Schwefel als Ausgangsstoff für die Batterieherstel-lung. Um diese Werte auch in der Praxis zu erreichen, wird an der Optimierung der Nutzung des Akti...

  18. Accurately fitting advanced training. Flexible simulator training by modular training course concepts; Passgenaue Weiterbildung. Flexibilitaet im Simulatortraining durch modulare Kurskonzepte

    Energy Technology Data Exchange (ETDEWEB)

    Sickora, Katrin; Cremer, Hans-Peter [Kraftwerksschule e.V., Essen (Germany)

    2010-07-01

    Every employee of a power plant contributes with his individual expertise to the success of the enterprise. Certainly personal skills of employees differ from each other as well as power plants are different. With respect to effective simulator training this means that no two simulator training courses can be identical. To exactly meet the requirements of our customers KWS has developed modules for simulation training courses. Each module represents either a technical subject or addresses a topic in the field of soft skills. An accurately fitting combination of several of these modules to the needs of our customers allows for most efficient simulator training courses. (orig.)

  19. Versuchter Totschlag durch Manipulation der Organzuteilung für Transplantationen? / Detlev Sternberg-Lieben, Irene Sternberg-Lieben

    Index Scriptorium Estoniae

    Sternberg-Lieben, Detlev

    2018-01-01

    Saksamaa kõrgema kohtu otsusest, mis puudutab Göttingeni haiglas toimunud juhtumit, kus maksasiirdamine tehti alkohili tarbivale patsiendile, Saksmaal kehtestatud seaduse kohaselt tohib maksasiirdamise teha vaid siis, kui organi saaja ei ole kuus kuud alkoholi tarbinud. Lahendit vaata lk. 46-52

  20. Microstructures of friction surfaced coatings. A TEM study; Gefuege durch Reibauftragschweissen aufgetragener Beschichtungen. Eine TEM-Untersuchung

    Energy Technology Data Exchange (ETDEWEB)

    Akram, Javed; Kalvala, Prasad Rao; Misra, Mano [Utah Univ., Salt Lake City, UT (United States). Dept. of Metallurgical Engineering; Dilip, J. John Samuel [Louisville Univ., KY (United States). Dept. of Industrial Engineering; Pal, Deepankar; Stucker, Brent [Louisville Univ., KY (United States). Dept. of Industrial Engineering; 3D Sim, Park City, UT (United States)

    2016-05-15

    The microstructures of dissimilar metal welds between 9Cr-1Mo (Modified) (P91) and austenitic stainless steel (AISI 304) with Ni-based alloy interlayers (Inconel 625, Inconel 600 and Inconel 800H) are reported. These interlayers were deposited by the friction surfacing method one over the other on P91 alloy, which was finally friction welded to AISI 304. In this paper, the results of microstructural evolution in the friction surfaced coated interlayers (Inconel 625, 600, 800H) are reported. For comparative purposes, the microstructures of consumable rods (Inconel 625, 600, 800H) and dissimilar metal base metals (P91 and AISI 304) were also reported. Friction surfaced coatings exhibited dynamic recrystallization. In friction surfaced coatings, the carbide particles were found to be finer and distributed uniformly throughout the matrix, compared to their rod counterparts.

  1. Defense against terroristic hazards and risk by building planning law; Abwehr terroristischer Gefahren und Risiken durch Bauplanungsrecht

    Energy Technology Data Exchange (ETDEWEB)

    Hopkins, Richard

    2012-07-01

    The book on defense against terroristic hazards and risk by building planning law includes the following issues: Introduction: civil engineering and safety. Risk, hazards and urban planning: historical and actual examples for the constructional danger prevention, terroristic threat and urban planning. Risk, hazards and terrorism: sociology and risk, law and risk, terrorism - risk or hazard? Answer to uncertainty - risk prevention, catastrophe law as link. Risk, hazard, terrorism and the public building and regional planning law: regional planning law as point of origin, building law and terrorism, possibility of control by the legal building regulations.

  2. Die Messung der Gluonpolarisation durch die Produktion von Hadronpaaren mit großen Transversalimpulsen in tiefinelastischer Myonstreuung am Nukleon

    CERN Document Server

    Hermann, Roman

    2009-01-01

    The spin structure of the nucleon is investigated at the COMPASS experiment at the CERN-SPS using polarized muons scattering off polarized nucleons. The contribution of the quarks to nucleon spin, as measured in the inclusive deep-inelastic scattering, is not sufficient to explain the spin of the nucleon. Thus it has to be clarified how the gluon polarization and the angular momenta of quarks and gluons contribute to the spin of the nucleon. Since the gluon polarization can only be estimated from the $Q^{2}$-dependence of inclusive deep inelastic asymmetries, a direct measurement of the gluon polarization is mandatory. The COMPASS collaboration determines the gluon polarization from cross section asymmetries in photon-gluon fusion processes using open charm production or the production of hadron pairs with large transverse momenta. This thesis presents a measurement of the gluon polarization using the COMPASS data of the years 2003 and 2004. The events with large virtuality, $Q^{2}>1$ $GeV^{2}/c^{2}$ and hadr...

  3. Flippige Online-PDFs - Webpublikationen mit Umblätter-Effekt durch das MegaZine3-Tool

    Directory of Open Access Journals (Sweden)

    Klaudia Mattern

    2013-03-01

    Full Text Available Webdokumente werden in letzter Zeit immer häufiger mit einem Umblätter–Effekt präsentiert. Beliebt ist dies vor allem für Onlineversionen von Printmagazinen, Produktkatalogen und die Postwurfflyer von Super- und Baumärkten. Diese Funktion des Umblätterns wird mit diversen Begriffen Flip Book, Pageflip, … bezeichnet – einige davon sind markenrechtlich geschützt – was es echt schwierig macht, sich googelnder Weise einen raschen Überblick zu solchen Tools zu verschaffen. Wer es dennoch schafft, findet schnell heraus, dass diese Funktion eher im professionellen, hochpreisigen Desktop- und Online-Publishing Bereich angesiedelt ist. Für medienpädagogisch motivierte Projektergebnisse gibt’s wenig Optionen[FN1], die die Eigenverantwortung bei der Onlinepublikation und Onlineverbreitung unterstützen. Daher war ich sehr erfreut, als ich mit MegaZine3 (MZ3 ein Tool gefunden hab, dass einerseits als Basisversion für alle NutzerInnen kostenlos ist (nichteinmal registrierungspflichtig, für Schulen und Unis eine kostenlose EDU–Lizenz ermöglicht (unbegrenzte Seitenanzahl bei Registrierung der Schule und es MZ3 auch als deutschsprachige Version gibt, weil die Entwicklungsfirma in München zu hause ist.

  4. Hybrid coupling of bioenergy and geothermal energy. Efficiency through synergy; Hybride Kopplung von Bioenergie und Geothermischer Energie. Effizienz durch Synergie

    Energy Technology Data Exchange (ETDEWEB)

    Giese, Lutz B. [Hochschule fuer Technik und Wirtschaft (HTW) Berlin (Germany). Fachbereich Ingenieurwissenschaften I; Seibt, Andrea [Boden Wasser Gesundheit (BWG) GbR, Neubrandenburg (Germany)

    2009-07-01

    Both forms of energy - geothermal energy and bioenergy - are distinguished by their storability and their capacity to provide base load electricity. In this way they can serve as an ideal supplement to other renewable energy resources, some of which are subject to considerable fluctuation. Both are readily usable for cogeneration, a form of energy production which has been accorded substantial weight in the 2050 scenario due to its high energy efficiency potential. In contrast to countries like Denmark, where cogeneration has a share of almost 50% in total energy production, its corresponding share in Germany is only just above 10%. And although the political goal is to raise the share of cogeneration to 25% by the year 2020, this will not be possible without politically painful cuts.

  5. Advanced energy-results for refrigerating plants by proceeding cycle; Energieeffizienzverbesserungen fuer die Kaeltetechnik durch innovative Prozessfuehrung

    Energy Technology Data Exchange (ETDEWEB)

    Foerster, Hans [IFM - Ingenieurbuero Dr.-Ing. H. Foerster, Magdeburg (Germany)

    2011-01-15

    This paper shows development-reserves of compression refrigeration units, they can need to save energy by process formation. It will be to handle the spring of betterment the consumption of energy with screw- and piston compressors. For the piston compressors it will be necessary a special attention to method of Vorhees. (orig.)

  6. Supply of wood-based bioenergy sources by means of agro-forestry systems; Bereitstellung von holzartigen Bioenergietraegern durch Agroforstsysteme

    Energy Technology Data Exchange (ETDEWEB)

    Boehm, Christian; Quinkenstein, Ansgar; Freese, Dirk [Brandenburgische Technische Univ. Cottbus (Germany). Lehrstuhl fuer Bodenschutz und Rekultivierung; Baerwolff, Manuela [Thueringer Landesanstalt fuer Landwirtschaft (Germany)

    2011-07-01

    Because of the initiated energy revolution and the associated increasing demand for woody biomass in Germany, the production of woody crops on agricultural sites is increasingly gaining in importance. In this context, agroforestry systems provide a promising option to cultivate simultaneously fast growing tree species and annual crops on the same field and to produce woody biomass and conventional products at the same time. Agroforestry systems in which hedgerows of fast growing tree species are established on agricultural sites in a regular pattern are called as alley cropping systems (ACS). These can be managed as low input systems and thus provide several ecological benefits. The cultivation of trees results in an enhanced humus accumulation in the soil and affects the quality of surface as well as percolating waters in a positive way. Additionally, ACS alter the microclimatic conditions at the site, from which the conventional crops cultivated in the alleys between the tree stripes benefit. However, from an economic point of view the production of woody crops with ACS is not generally preferable to conventional agriculture. The positive effects of ACS are most pronounced on marginal sites and, consequently, ACS are currently economically unfavorable compared to conventional agriculture on fertile soils. However, on unfertile, dry sites, such as can be found at a large scale in the Lusatian post-mining landscapes, ACS can be an ecologically and economically promising land-use alternative.

  7. Medical care for occupational exposed personnel by authorized physicians; Arbeitsmedizinische Betreuung beruflich strahlenexponierter Personen durch ermaechtigte Aerzte

    Energy Technology Data Exchange (ETDEWEB)

    List, Volker [KIT - Karlsruher Institut fuer Technologie Medizinische Dienste, Eggenstein-Leopoldshafen (Germany). Liaison Institute der Weltgesundheitsorganisation (WHO)

    2017-07-01

    Since 2009 new scientific results and respective publications few changes in the legal regulations concerning the medical care for exposed occupational personnel occurred. These changes include the careful attention of ethical aspects and the efficiency control of radiation protection measures. In Switzerland the medical surveillance of occupational exposed persons has been terminated.

  8. Refractive-index changes in lithium niobate crystals by radiation damages; Brechungsindexaenderungen in Lithiumniobat-Kristallen durch Strahlenschaeden

    Energy Technology Data Exchange (ETDEWEB)

    Zamani Meymian, Mohammad Reza

    2007-12-18

    For the study in this thesis {sup 3}He{sup 2+} ions with the energy of about 40 MeV were applied. The results of these studies show a timely very stable anisotrope refractive-index change in the range of some 10{sup -3}. The radiation damages caused by ions cause a decreasement of the ordinary refractive index n{sub o} and an increasement of the extra-ordinary refractive index n{sub e}. While the absolute values for {delta}n{sub o} and {delta}n{sub e} are nearly equal the birefringence of the material (n{sub e}-n{sub o}) smaller. The generated refractive-index change is dose dependent and the curve {delta}n has at increasing dose a strongly nonlinear slope with a characteristic stage at the radiation dose of about 2 x 10{sup 20} ions/m{sup 2}.

  9. Efficient industrial burner control of a flexible burner management system; Effiziente industrielle Brennertechnik durch Einsatz flexibler Feuerungsautomaten

    Energy Technology Data Exchange (ETDEWEB)

    Hofmann, Ulrich; Saenger, Peter [Siemens AG, Rastatt (Germany)

    2012-02-15

    Compactness and flexibility of a burner control system is a very important issue. With a few types a wide range in different industrial applications should be covered. This paper presents different applications of a new burner control system: heating of cooling lines in glass industry, steam generation and air heating for a pistachio roastery and in grain dryers. (orig.)

  10. Bundling for creating cross-selling potentials of energy supply companies; Cross-Selling-Potenziale bei Energieversorgungsunternehmen durch Bundling

    Energy Technology Data Exchange (ETDEWEB)

    Zinnbauer, M. [Ludwig-Maximilians-Universitaet Muenchen (Germany)

    2001-07-01

    As most of the electric utilities in Germany have decided by now to adopt the multi-utility strategy for sales promotion in the open electricity market, a questionnaire has been distributed to 1 000 households in order to find out whether product bundling or cross selling in combination with the low-interest product 'electricity' is a good strategy to enlarge the customer basis. EFOplan (Munic University) and the consulting firm Accenture have been in charge of the survey. The results show the current status of insight of household customers and their motives to change supplier, as well as the pattern of demand for product bundling. (orig./CB) [German] Da mittlerweile die meisten EVUs eine Multi-Utility-Strategie anstreben, wurde mittels einer schriftlichen Befragung von 1 000 deutschen Haushalten untersucht, ob die Vermarktung von Zusatz- bzw. Buendelprodukten in Kombination mit dem Low-Interest-Produkt Strom erfolgsversprechend ist. Die Befragung, die von EFOplan (Universitaet Muenchen) in Kooperation mit der Unternehmensberatung Accenture durchgefuehrt wurde, zeigt einerseits den aktuellen Status von Informationsstand und Wechselmotiven beim Stromkauf und andererseits die Bedarfsstruktur im Hinblick auf moegliche Buendelprodukte. (orig.)

  11. Fluchen und Flamen, um ein Mann zu sein? Die Verknüpfung von Geschlecht und Sprache durch Vorurteile

    Directory of Open Access Journals (Sweden)

    Nicola Döring

    2001-11-01

    Full Text Available Die hier besprochene Monographie der Linguistin Anja Gottburgsen beschäftigt sich theoretisch und empirisch mit sprachbezogenen Geschlechterstereotypen, also mit unseren Vorstellungen darüber, ob und wie Männer und Frauen jeweils in spezifischer und distinkter Weise sprachlich kommunizieren. Im Theorieteil der Arbeit wird der aktuelle Stand der soziolinguistischen und sozialpsychologischen Diskussion zu Geschlecht, Sprachverhalten und Stereotypisierung kritisch referiert und die Bedeutung von sprachbezogenen Geschlechterstereotypen erläutert. Im empirischen Teil berichtet die Autorin die Ergebnisse von drei Fragebogen-Studien mit deutschsprachigen Studierenden. Es zeigt sich, dass bei Studierenden unabhängig von Geschlecht und Geschlechtsrollenorientierung stereotype Vorstellungen über das sprachliche Verhalten von Männern und Frauen verbreitet sind.

  12. Influencing energy demand by organizational and institutional innovation. Final report. Beeinflussung der Energienachfrage durch organisatorische und institutionelle Innovation. Abschlussbericht

    Energy Technology Data Exchange (ETDEWEB)

    Hofer, P; Masuhr, K; Weidig, I; Wolff, H

    1983-01-01

    The aim of this study is to verify whether potentials for energy conservation can in principle be provided by organisational and institutional changes issuing at state level without these measures entailing cuts in well-being or setbacks to the running of our economic and social system. The investigation is restricted as main point of emphasis to organizational and institutional innovations that concern the state itself and can only be realized by the state. But it does not exclude those areas in which savings can be incited by the state in private households and business enterprises. Such measures include for instance quality standards as they are evolved in DIN regulations or measures to increase market transparency and utilize the market's potential of creativity. The investigation here presented has the character of a pilot or feasibility study.

  13. Measurements of transient electron density distributions by femtosecond X-ray diffraction; Messungen transienter Elektronendichteverteilungen durch Femtosekunden-Roentgenbeugung

    Energy Technology Data Exchange (ETDEWEB)

    Freyer, Benjamin

    2013-05-02

    This thesis concerns measurements of transient charge density maps by femtosecond X-ray diffraction. Different X-ray diffraction methods will be considered, particularly with regard to their application in femtosecond X-ray diffraction. The rotation method is commonly used in stationary X-ray diffraction. In the work in hand an X-ray diffraction experiment is demonstrated, which combines the method with ultrafast X-ray pulses. This experiment is the first implementation which makes use of the rotation method to map transient intensities of a multitude of Bragg reflections. As a prototype material Bismuth is used, which previously was studied frequently by femtosecond X-ray diffraction by measuring Bragg reflections successively. The experimental results of the present work are compared with the literature data. In the second part a powder-diffraction experiment will be presented, which is used to study the dynamics of the electron-density distribution on ultrafast time scales. The experiment investigates a transition metal complex after photoexcitation of the metal to ligand charge transfer state. Besides expected results, i. e. the change of the bond length between the metal and the ligand and the transfer of electronic charge from the metal to the ligand, a strong contribution of the anion to the charge transfer was found. Furthermore, the charge transfer has predominantly a cooperative character. That is, the excitation of a single complex causes an alteration of the charge density of several neighboring units. The results show that more than 30 transition-metal complexes and 60 anions contribute to the charge transfer. This collective response is a consequence of the strong coulomb interactions of the densely packed ions.

  14. Regenerative gases. Monitoring and control by means of the dispatching; Regenerative Gase. Ueberwachung und Steuerung durch das Dispatching

    Energy Technology Data Exchange (ETDEWEB)

    Langer, Uwe [EWE NETZ GmbH, Oldenburg (Germany)

    2012-10-15

    The increasing number of devices for the decentralized integration of gas from renewable energy sources presents new challenges in the dispatching of natural gas networks operators. In the future, beside the supply of biogas there also a supply of hydrogen and synthetic methane will exist. In addition to compliance with the technical regulations for the quality and accountability of these gases the focus is on the optimization of the processes.

  15. Environmental relief effects through nanotechnological processes and products; Entlastungseffekte fuer die Umwelt durch nanotechnische Verfahren und Produkte

    Energy Technology Data Exchange (ETDEWEB)

    Steinfeldt, Michael; Gleich, Armin von [Bremen Univ. (Germany). Fachgebiet Technikgestaltung und Technologieentwicklung, FB Produktionstechnik; Petschow, Ulrich; Pade, Christian; Sprenger, Rolf-Ulrich [Institut fuer oekologische Wirtschaftsforschung gGmbH, Berlin (Germany). FB Umweltoekonomie und -politik

    2010-06-15

    The top priority of the research project ''Environmental Relief Effects through Nanotechnological Processes and Products'' was to identify and quantify, to the extent possible and by means of selected examples, the environmental and sustainability opportunities and risks associated with this rapidly developing line of technology. Environmental relief potentials are understood here to include not only environmental engineering in the narrower sense (end-of-pipe technologies), but also and specifically process, production, and product-integrated environmental protection. The project consisted of four stages: 1. Analysis of products and processes already on the market or soon to be made available and application 2. Examination and initial qualitative assessment of each of the products and processes with respect to its potential for environmental relief (or burden, as the case may be) 3. In-depth life cycle analysis and assessment of four selected processes or products as compared to conventional processes or products (Manufacture of solderable surface finishes on printed circuit boards, MW carbon nanotube application for foils in the semiconductor industry, Lithium batteries for energy, storage, Ultradur {sup registered} High Speed plastic) 4. An appraisal of nanotechnology employment effects. (orig.)

  16. Dynamic loads caused by pressure blasts, steam explosions, and earth quakes; Dynamische Belastungen durch Druckstoesse, Dampfexplosionen und Erdbeben

    Energy Technology Data Exchange (ETDEWEB)

    Hofmann, H H [SDK Ingenieurunternehmen GmbH, Basel (Switzerland)

    1998-11-01

    The paper deals with description of structures and the relevant dynamic loads. As to the structures, gas, fluid, or solid structures are to be considered. They determine the characteristic vibrational behaviour of the structures in the interconnected system. The excitation type determines the component that will be induced to change characteristic vibrational behaviour of the structure, depending on the load increasing time and the period of excitation. Three examples are given to illustrate the processes. (Water tank subject to quasi-seismic conditions; pipeline affected by blow-down; shut-off valve for a pipe). (orig./CB) [Deutsch] In diesem Beitrag soll auf die Erfassung der Strukturen und die Erfassung der dynamischen Belastungen eingegangen werden. Zur Erfassung der Strukturen sind `Gas-, Fluid- und Festkoerper-Strukturen` zu beachten. Sie bestimmen das Eigenschwingverhalten im Verbund. Die Erregung bestimmt nun, welcher Bereich aus dem Eigen-Schwingverhalten der Struktur ueber die Lastanstiegs-Zeit und die Zeitdauer der Erregung anregbar ist. Drei Beispiele sollen die Aufgabenstellung erlaeutern (Wasserbehaelter unter erdbebenaehnlichen Bedingungen; Rohrleitung unter `Blow-down-Belastung`; Absperrklappe fuer eine Rohrleitung). (orig./MM)

  17. Assembly optimization realized by a die-cast magnesium construction; Montageverbesserungen verwirklicht durch eine Magnesium-Druckguss-Konstruktion

    Energy Technology Data Exchange (ETDEWEB)

    Tikal, F.; Vollmer, C.; Pippert, J.

    1996-11-01

    Vehicle development today cannot be envisaged without non-contact and slip free distance- and speed-measurement. As it is superior to contact methods in terms of reliability and accuracy, it has gained more and more acceptance in the past few years and now provides measurement results of the utmost precision. This is particularly necessary in the large application range of tyre and vehicle development to ensure high safety levels; moreover, it is required for future vehicle control systems, as they need precise speed information for ABS, ASC, or for navigation methods. In principle, optical acoustic and microwave sensors can be used for these applications. The microwave sensors can be used for these applications. The microwave-Doppler principle provides certain advantages over optical or ultrasound methods as it can be used under any weather conditions and provides a larger vertical operating range and a long lifespan. Datron-Messtechnik, market leader in the field of correlator optical speed sensors, has made use of this measurement principle and with its microwave sensor introduces a new development covering the great demands of speed measurement. (orig.) [Deutsch] Die Pkw-Tuer, ein Bestandteil der Karosserie, ist im Laufe der Automobilgeschichte nicht wesentlich veraendert worden. Jedoch mussten in den letzten Jahren Flankenschutz, Seitenairbag und andere neue Bauteile in die Tuer integriert werden. Diese Elemente der passiven Sicherheit sind vom Verbraucher gewuenschte Schutzmassnahmen. Mit dem gehobenen Sicherheitsimage bemuehen sich die Produzenten, den potentiellen Kaeufer zum Kauf ihres Produktes zu bewegen. Am Institut fuer Produktionstechnik und Logistik (IPL) der Universitaet Gesamthochschule Kassel (GhK) wurde eine Pkw-Tuer, basierend auf einem Magnesium-Druckgussrahmen, entwickelt. Zur Orientierung und Studienzwecken ist ein Holzmodell erstellt worden. Mit dem praxisnahen Modell konnte die Montage und der Einbau in das Automobil getestet werden. Das Gussverfahren ermoeglicht die hochintegrierte Bauweise. Der modulartige Aufbau und die Vorteile von Magnesium als Leichtbauwerkstoff erlauben neuartige Ansaetze im Vergleich zu konventionellen Konstruktionen. (orig.)

  18. Quality regulation will make the goals of asset management specific; Zielkonkretisierung des Asset Managements durch die Qualitaetsregulierung

    Energy Technology Data Exchange (ETDEWEB)

    Fritz, Wolfgang [Consentec Consulting fuer Energiewirtschaft und -technik GmbH, Aachen (Germany); Vennegeerts, Hendrik [Forschungsgemeinschaft fuer Elektrische Anlagen und Stromwirtschaft e.V. (FGH), Aachen (Germany)

    2009-12-15

    The asset management of a network operator is responsible for decisions concerning the design, upkeep, modernisation and operation of networks. These decisions have an impact on costs and various quality aspects. Due to the absence of stringent instructions in some of its areas, asset management holds a substantial optimisation potential for network operators. Creative leeway exists in particular with regard to network reliability. Nowadays the level of reliability of a network has no immediate impact on the operator's turnover. However, this will change with the introduction of quality regulation through the Incentive Regulation Ordinance. This article discusses basic models for the resulting concretisation of goals and outlines the current debate as to how quality regulation should be framed.

  19. MEGA. Higher energy-efficiency through systematic user information - Final report; MEGA. Mehr Energieeffizienz durch gezielte Anwenderinformationen - Schlussbericht

    Energy Technology Data Exchange (ETDEWEB)

    Fercu, M.; Kistler, R. [Hochschule Luzern Technik und Architektur, CEESAR - iHomeLab, Horw (Switzerland); Egli, A. [Hochschule Luzern Technik und Architektur, ISIS, Horw (Switzerland); Gallati, J. [Hochschule Luzern Technik und Architektur, Wirtschaft, Horw (Switzerland)

    2010-09-15

    Individuals are empowered to conserve energy and natural resources when provided with motivational and personalized information on its use. By presenting information about the energy consumption from the home's energy meters along with recommended actions, the residential customer becomes aware of how in/efficiently energy is consumed within his home and can decide on how to act to conserve. This information can provide an accurate metric of how effective a conservation action is even to inhabitants that are not yet knowledgeable about or self-motivated by the monetary and ecologic rewards of conserving. This project was designed to build knowledge on technically and economically feasible ways to create an awareness of energy (especially electricity) for the sake of conservation. Specifically, it implements an exemplar prototype of a highly effective energy feedback system that is an interactive, real-time, in-home display. Toward this goal, four system architecture configuration proposals, a set of system requirements, and ideal system features are synthesized; they are based on the results of the research that evaluates effectiveness of existing energy-efficiency and -conservation methods and studies related technologies. Three of the four systems proposed represent energy technologies expected to be available within the next decade. The fourth system proposal is a demonstration prototype designed for implementation in the iHomeLab. This prototype is an open, modular, robust, cross-platform software framework that collects data, processes, and presents it interactively and visually on hardware available in most households. The results of this project both indicate that the creation of such energy feedback systems appear beneficial and also provide guidelines for their design. However, further development of infrastructure and elaboration of design is foreseen as necessary for this system to be suitable for mass deployment. (author)

  20. Fermentation of straw and Co. by means of up flow hydrolysis; Vergaerung von Stroh and Co durch Aufstromhydrolyse

    Energy Technology Data Exchange (ETDEWEB)

    Lehmann, Thilo [LEHMANN Maschinenbau GmbH, Poehl (Germany)

    2013-10-01

    The sustainability of biogas production and biogas utilization is determined by the price trend of the substrate, the development of new substrates and the improvement of the energetic utilization ratio of the applied substrates. Up till now, highly lignocellulosic substrates/residues like straw were considered as ''not or limited usable'' for the biogas production. Reasons are the high lignin content, the distinct pith structure with cavities and layers of fat and, thereof, a quasi-hydrophobic consistency of these substrates. This is even after the crushing of the structures often demonstrated by the formation of floating layers and ''rope formation'' in the fermenter, which is often a co-criterion for their use. Substrates such as straw and the like accumulate annually in large quantities, and are often plough back as humus forming. The fact is: decomposition of these biomasses in the fields extracts nutrients from the cultivated crops. This leads either to considerable crop losses or expensive additional nutrient. In contrast, the use of straw in anaerobic digestion seems sensible. The nutrients and organic matter, which was not converted into biogas in the fermentation process, are available again as a high quality and metered digestate after fermentation for fertilization. (orig.)

  1. On new paths. Hitchhiker's guide through beryllium chemistry; Auf neuen Pfaden. Per Anhalter durch die Berylliumchemie

    Energy Technology Data Exchange (ETDEWEB)

    Naglav, Dominik; Bendt, Georg; Schulz, Stephan [Duisburg-Essen Univ., Essen (Germany). Fakultaet fuer Chemie; Buchner, Magnus R.; Kraus, Florian [Marburg Univ. (Germany). Anorganische Chemie, Fluorchemie

    2016-08-26

    This short essay is intended as an introduction to all less experienced people in the field of beryllium chemistry. Current research findings on the toxicity of the element and its compounds are reviewed and various basic and necessary orientation aids for safe and correct handling in modern chemical research laboratories are presented. Phenomenological observations concerning the uniqueness of the element and its chemistry are communicated and placed in the historical context. We summarize many contributions and experiences of passionate scientists in this field. It is a matter of heart for us that our fellow students critically question and rethink the reservations about beryllium and their connections built up over generations, thus initiating a new era of intensive research into this scorned element. Who in the world should be able to manage beryllium and its connections more safely and more expertly than we do chemists? [German] Dieser Kurzaufsatz soll eine Einfuehrung fuer alle weniger Erfahrenen auf dem Gebiet der Berylliumchemie darstellen. Aktuelle Forschungsergebnisse ueber die Giftigkeit des Elements und seiner Verbindungen werden rezensiert und diverse grundlegende und noetige Orientierungshilfen fuer die sichere und richtige Handhabung in modernen chemischen Forschungslaboren vorgestellt. Phaenomenologische Beobachtungen bezueglich der Einzigartigkeit des Elements und seiner Chemie werden mitgeteilt und in den historischen Kontext gestellt. Wir fassen viele Beitraege und Erfahrungen von auf diesem Gebiet leidenschaftlich taetigen Wissenschaftlern zusammen. Es ist uns ein Herzensanliegen, dass unsere Kommilitonen die ueber Generationen aufgebauten Vorbehalte gegenueber Beryllium und seinen Verbindungen kritisch hinterfragen und ueberdenken und so eine neue Aera intensiver Forschung zu diesem verschmaehten Element eingeleitet wird. Wer in aller Welt soll denn das Beryllium und seine Verbindungen sicherer und fachkundiger handhaben koennen als wir Chemiker?.

  2. Verfahren zur Herstellung von Bauteilen durch elektrochemisches Abscheiden: Verfahren zur freiformenden Herstellung von dreidimensionalen Bauteilen (A1)

    OpenAIRE

    Bolch, T.; Semrau, W.

    1998-01-01

    The description refers to a process and a device for the free-forming production of three-dimensional components. The invention is characterized by the fact that a metal, three-dimensional component of specified shape is directly produced by applying separate layers of metal. An electrochemical deposition process is used whereby electrically charged metal ions are applied in a controlled process.

  3. Veränderungen hämodynamischer Parameter durch akute und längerfristige Bewegungsinterventionen

    OpenAIRE

    Ketelhut, Sascha

    2017-01-01

    Background: Rising body of literature recommends assessing parameters of arterial stiffness (AS) for cardiovascular risk stratification. Therefore, the goal in the present work was to assess influences of physical activity on AS. The first part of the study investigates the correlation between aerobic capacity and hemodynamic parameters at rest and during a stress test. The second part deals with the question whether a high-intensity interval training (HIIT) exerts beneficial effect...

  4. Diurnally varying annoyance due to railway and road traffic noise; Laermbelaestigung durch Strassen- und Schienenverkehr zu unterschiedlichen Tageszeiten

    Energy Technology Data Exchange (ETDEWEB)

    Schreckenberg, D. [Zentrum fuer Angewandte Psychologie, Umwelt- und Sozialforschung (ZEUS GmbH), Bochum (Germany); Guski, R. [Ruhr-Univ. Bochum, Fakultaet fuer Psychologie, Bochum (Germany)

    2005-07-01

    One of the most prominent non-auditory effects of noise influencing the life quality of human beings is the disturbance of activities (i.e. communicating, relaxing, working, sleeping). The disturbance of activities results in noise annoyance, and in the long run may lead to further health effects. Due to the fact that activities vary diurnally it is plausible to assume that peoples'' responses to noise differ depending on the times of day. The aim of the study, which is part of the German research network ''Quiet Traffic'' is to provide empirical data of dose-response relationships for different times of day (excluding the night). 1110 residents from four areas with dominant road traffic noise (683 subjects) and from two areas with dominant railway noise (427 subjects) have been asked in a face-to-face interview for contentment with house and living environment and noise reactions. 131 persons of the total sample took part in an additional study (experience-sampling study) in which the hourly noise annoyance was measured for three consecutive days using a handheld computer. For each subject individual source-specific immission noise level for each hour of the day has been calculated. There is higher annoyance due to road traffic noise in the late afternoon/evening from 4 pm to 7 pm. For railway noise higher annoyance is reported in the evening from 6 pm to 10 am. The reported differences in noise annoyance depending on the times of day are higher with increasing noise level. (orig.)

  5. Wallfahrtsorte als Marken. Place Branding durch Volksfrömmigkeit in einer postsäkularen Gesellschaft

    Science.gov (United States)

    Hilpert, Markus

    2017-12-01

    Perhaps, pilgrimage sites are one of the oldest examples of controlled place branding, but they are still an interesting teaching tool for this subject because they are characterized by lower complexity and functionality compared to cities and regions. They are also smaller in size and they usually occupy very specific positions of popular piety. This makes the transferability of the branding concept easier than in other urban or rurality areas. Against this background, this essay examines the question how popular piety can still contribute to place branding of pilgrimages sites.

  6. Erfolgreiche Koordination durch Kultur? : Herrschaftsmythen der Frühen Neuzeit und die Organizational-Culture-These

    OpenAIRE

    Ewert, Ulf Christian

    1998-01-01

    Herrschaftsmythen können als spezifische Gestaltungselemente einer Organisationskultur interpretiert werden. Sie waren in den frühneuzeitlichen Systemen Mittel des politischen Zusammenwirkens, gerichtet auf Integration und Definition der jeweiligen Organisation. Gegenstand der Untersuchung sind neun frühneuzeitliche Mythen, darunter der Roi Soleil, Neues Israel und Wilhelm Tell. Hinterfragt wurden wahrgenommene Ähnlichkeiten zwischen den neun Mythen, deren integrative und revolutionäre Muster...

  7. New jobs - renewable energies. Congress. Proceedings; Neue Arbeitsplaetze durch Erneuerbare Energien. Kongress ueber die wirtschaftlichen Chancen der oekologischen Energiewende. Konferenzband

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    2001-07-01

    The number of jobs in the field of renewable energy sources is disproportionately high as compared to conventional energy sources. For example, the German wind industry has 30,000 jobs for a 3% share in power supply. According to the White Book on Renewable Energy Sources of the European Commission, the share of renewable energy sources is to be increased to 12% by 2010. This will mean 1.2 million new jobs. If the share is increased to 20%, 2 million new jobs will be created in the European Union according to an EUROSOLAR study. [German] Die erneuerbaren Energien haben im Verhaeltnis zu konventionellen Energietraegern ein ueberproportional hohes Arbeitsplatzangebot. So sind bereits heute in der deutschen Windenergiebranche, die zur Zeit etwa 3 Prozent des Stromverbrauchs deckt, 30000 Menschen beschaeftigt. Das Weissbuch der Europaeischen Kommission ueber erneuerbare Energien hat das Ziel formuliert, den Anteil der erneuerbaren Energien bis zum Jahr 2010 auf 12 Prozent zu steigern. Die Europaeische Kommission sieht damit die Schaffung von 1,2 Millionen Arbeitsplaetzen verbunden. Wenn der Anteil der erneuerbaren Energien in der Europaeischen Union auf 20 Prozent erhoeht wird, werden gemaess einer EUROSOLAR - Studie in der EU sogar 2 Millionen neue Arbeitsplaetze entstehen. (orig.)

  8. Versuchter Totschlag durch Manipulation der Organzuteilung für Transplantationen? / Detlev Sternberg-Lieben, Irene Sternberg-Lieben

    Index Scriptorium Estoniae

    Sternberg-Lieben, Detlev

    2018-01-01

    Saksamaa kõrgema kohtu otsusest, mis puudutab Göttingeni haiglas toimunud juhtumit, kus maksasiirdamine tehti alkoholi tarbivale patsiendile. Saksmaal kehtestatud seaduse kohaselt tohib maksasiirdamise teha vaid siis, kui organi saaja ei ole kuus kuud alkoholi tarbinud. Lahendit vt lk. 46-52

  9. Sustainable use of biogenic fuels resources through industrial synergies; Nachhaltige energetische Nutzung biogener Ressourcen durch industrielle Synergien

    Energy Technology Data Exchange (ETDEWEB)

    Schuech, Andrea [Rostock Univ. (Germany). Professur Abfall- und Stoffstromwirtschaft; Nelles, Michael [Rostock Univ. (Germany). Agrar- und Umweltwissenschaftliche Fakultaet; Nassour, Abdallah

    2017-08-01

    The term industrial symbiosis is used when traditionally separate companies and industries work together in a collective approach to physically exchange materials, energy, water and by-products with a mutual competitive advantage. Aim of the European project ''UBIS - Urban Baltic Industrial Symbiosis'' (INTERREG South-Baltic Programme) is to use biogenic resources as well as waste and residues sustainable in industrial symbiosis and to reduce emissions at the same time. Even if a lot has already been achieved in this area, there are still many unused material flows and there are possibilities to use them even more efficiently. In the project existing collaborations will be investigated as well as new ones identified and evaluated. This article introduces the UBIS project and provides an insight into the subject of industrial symbiosis as well examples described.

  10. Radionuclides in food and the radiation exposure due to ingestion; Radionuklide in Lebensmitteln und die Strahlenexposition durch Ingestion

    Energy Technology Data Exchange (ETDEWEB)

    Michel, Rolf

    2015-06-01

    As a consequence of the reactor accidents in Fukushima Daiichi high amounts of radioactive iodine and cesium isotopes were released into the terrestrial and marine Japanese environment. The largest release occurred on March 15, 2011 as a consequence of the containment failure of unit 2. Due to the meteorological conditions large area fallout occurred in the district of Fukushima. Other prefectures in the north of Japan were also contaminated. As a consequence of the high surface contamination the dose limits for drinking water, milk and milky products and food were increased to 200 Bq/kg.It turned out that the contamination of rice was marginal, the contamination of predatory fish higher than that of non-predatory fish. A systematic investigation of food samples could allow a better estimation of ingestion induced exposure.

  11. Optimized distribution network work management by grid services of a rapid loading infrastructure; Optimierte Verteilnetzbetriebsfuehrung durch Netzdienstleistungen einer Schnellladeinfrastruktur

    Energy Technology Data Exchange (ETDEWEB)

    Krasselt, P.; Uhrig, M.; Leibfried, T. [Karlsruher Institut fuer Technologie (KIT), Karlsruhe (Germany). Inst. fuer Elektroenergiesysteme und Hochspannungstechnik (IEH)

    2012-07-01

    The German Federal Government aims to reach one million electric vehicles in 2020 and up to five million by 2030 under its National Electromobility Development Plan. The integration of the necessary charging infrastructure in the distribution grid is considered in many research approaches by regarding charging time slots controlled by information and communications technology (ICT). In this approach, strategies for reactive power management and gridsupporting functions in medium voltage networks through the integration of large charging stations such as those in parking garages and public parking lots are considered. An urban distribution network in 2030 is modelled to evaluate different centralized and decentralized reactive power control schemes. (orig.)

  12. Climate hazards caused by thawing permafrost? Background information of the Federal Environmental Agency; Klimagefahr durch tauenden Permafrost? UBA-Hintergrundpapier

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    2006-08-15

    The thawing of permafrost regions is supposed to increase climatic change processes due to the released methane. During the last decades the temperature of permafrost soils has increased by several tenths of degree up to 2 deg C. It is supposed that 10 to 20% of the permafrost regions will thaw during the next 100 years. The southern boundary of the permafrost region will move several hundred kilometers toward the north. Besides the increased risk for the climate system there will also be disadvantageous consequences for the ecosystems. Negative economic consequences are already observed and will be enhanced in the futures with significant cost for the public.

  13. Unintentional exposure to radiation during pregnancy from nuclear medical diagnostic procedures; Unabsichtliche Strahlenexposition in der Schwangerschaft durch nuklearmedizinische Diagnostik

    Energy Technology Data Exchange (ETDEWEB)

    Moka, D. [Gemeinschaftspraxis fuer Radiologie und Nuklearmedizin, Essen (Germany)

    2005-12-01

    The administration of radiopharmaceuticals during pregnancy is contraindicated due to a lack of vital indications. However, if prenatal exposure to radiation should occur in the framework of a nuclear medical diagnostic procedure then fortunately no longterm side-effects would normally be expected. Radiation damage in the preimplantation phase leads to early abortion. However, if the further course of pregnancy remains uncomplicated then no subsequent side-effects need be expected. On a conservative estimate, it would require doses exceeding 50 mGy to cause radiation damage within the uterus after the preimplantation phase. However, the standard radioactivities applied for diagnostic purposes in nuclear medicine, can be obtained with doses of less than 20 mGy. On the basis of current knowledge, therefore, there is no reason to terminate pregnancy on medical grounds after diagnostic exposure to radiopharmaceuticals. (orig.)

  14. Low emission transport systems. Reduction of emissions with low-pollutant lubricants; Emissionsarmer Verkehr. Emissionsminderung durch schadstoffarme Schmierstoffe

    Energy Technology Data Exchange (ETDEWEB)

    Keller, D; Boehncke, A; Mangelsdorf, I

    2001-07-01

    Due to the lower EURO 4 emission limits, exhaust aftertreatment systems for heavy- and light-duty vehicles will be necessary which are more efficient than the today 3-way- or oxidation-type catalysts. Practicable exhaust aftertreatment systems are, for example, particle traps, SCR or NOx- adsorber catalysts, and combinations of these systems. Most of these exhaust control devices require fuels with sulphur contents below 10 ppm. Then the sulphate emissions from lubricants containing about 0.5% sulphur is in the same order of magnitude as sulphate emissions from low sulfur fuels. Measured data on the influence of sulphur from lubricating oils on future exhaust treatment systems are very limited. Conclusions have mostly been drawn from experimental results with low sulphur fuels. It cannot be ruled out, especially for NOx- adsorbers, that sulphur will adversely affect performance, thus making a reduction of sulphur levels in engine oils necessary. As far as diesel exhaust is concerned lubricants contribute approximately 20 - 26% to total particulate matter and more than 50% to the soluble organic fraction (SOF). Ash deposits derived from additives that contain zinc, calcium, sulphur, or phosphorous are likely to block the newly developed particle filter systems. Also for diesel technologies incorporating precious-metal catalysts (e.g. DOC, CDPF, CR-DPF, Urea- SCR) low sulphur levels are advantageous because the mass of sulphate particulate matter formed from fuel or lubricant sulphur is reduced. Conventional three-way catalysts are less sensitive, the light-off temperature being mainly affected. In summary, all available studies suggest that the lower the level of sulphur the lower emissions are. Furthermore phosphorous (associated with the antiwear additive ZDTP) was shown to limit catalyst life and, together with thermal degradation, is responsible for reduced catalyst efficiency over time. Although there is still a lack of quantitative technical information, it can be assumed that engine oil will make a significant contribution to EURO 4 limits of tail-pipe emissions, resulting mainly from secondary poisoning effects on catalyst and filter systems. Further research is thus necessary to make existing engine oil formulations and vehicle lubricant consumption compatible with the requirements of new exhaust aftertreatment technology. (orig.)

  15. Europe's gas imports via pipelines. Projects and safety aspects; Europas Gasimporte durch Pipelines. Projekte und Sicherheitsaspekte

    Energy Technology Data Exchange (ETDEWEB)

    Goetz, R.

    2008-08-15

    By the year 2030 Europe's gas imports will have risen to approximately 200 bn m{sup 3}, necessitating the installation of new pipelines and LNG terminals. The largest growth in imports is not expected from Russia but from Africa and the Near East. An analysis of projected pipelines demonstrates these regions' contribution to securing Europe's gas supply. Because they help to establish market dominance or to fend off potential competitors these pipelines also serve corporate strategies. The most reliable supply will continue to come from Norway. By contrast, gas imports via pipelines from North Africa, Russia and the Persian Gulf all carry high risks of approximately the same degree. The greatest risks are associated with gas imports from the Caspian Sea.

  16. Positive impact of circuit feedback by means of compensation effects. Energy saving lamps.; Positive Beeinflussung der Netzrueckwirkungen durch Kompensationseffekte. Energiesparlampen

    Energy Technology Data Exchange (ETDEWEB)

    Quadflieg, Dieter [Forum Netztechnik/Netzbetrieb im VDE, Berlin (Germany)

    2012-01-30

    The rectifier of modern energy saving lamps can have disturbing effects on the public power distribution network. An investigation by the Technical University of Dresden (Federal Republic of Germany) on behalf of the Forum Network Technology / Network Operation in VDE association for Electrical, Electronic and Information Technologies (Frankfurt, Federal Republic of Germany) examined the compensation effects during the simultaneous operation of such lamps with other household appliances in a realistic scenario.

  17. Perspectives on the German lignite industry in 2012. Stability through diversity; Perspektiven der deutschen Braunkohlenindustrie 2012. Stabilitaet durch Vielfalt

    Energy Technology Data Exchange (ETDEWEB)

    Lambertz, Johannes F. [RWE Power AG, Koeln (Germany); Milojcic, George [Bundesverband Braunkohle (DEBRIV), Koeln (Germany)

    2012-07-15

    The formula - stability through diversity - stands for a promising approach to energy policy. Germany will be phasing out nuclear energy by 2022 and giving a big push to renewables as a substitute. That changes the electricity mix. In this setting, lignite becomes more valuable as base load energy. Any look at the history of technology shows that, in the competition to find good solutions, experience proves that diversity is generated, and that means stability. In the energy sector, no one solution will determine the future, but many different technologies will co-exist in a pattern that is increasingly networked and integrated. The background here is a combination of nature circumstances, the wishes of consumers and, of course, the technical potential and availability of raw materials. There is no sign that coal, which is so abundantly available and competitive worldwide, will be excluded from the energy mix any time soon. The figures prove the contrary. The dynamism of world coal consumption speaks an unequivocal language. Germany, with its lignite, has a valuable natural resource which will be available for a long time to come. Germany's energy-policy aim should be to make use of the strengths of domestic lignite, strengths like security of supply and affordability, while working on minimising CO{sub 2} emissions, in particular through increases in efficiency and, in the long run, through CCS. Indispensable for this are the underlying production conditions. At the start, I had a word of thanks for our many partners for their good cooperation. We go on relying on your support. Specifically, we hope that the lignite industry, like other sectors will go on being appreciated for the benefits that it brings, and that no additional burdens are envisaged that might impair its competitiveness. It is our task in the lignite industry to further develop the potential of lignite with our wealth of ideas and fact-driven work. The good of today thus make a better tomorrow. In this respect, by including the interests of our partners and neighbours, and also of our employees, we will go on justifying the confidence placed in us in the various mining areas by the public and by decision-takers. We are keenly aware that dependability and a fair balancing of interests is the basis of any successful cooperation. Experience has shown that the lignite industry can prepare for new challenges. Ahead of us is an ambitious road that we can take with optimism and self-confidence. In my opinion, this includes a duty to provide a committed input to the debate surrounding our future. Good Luck.. or as we say in our industry: Glueckauf. (orig.)

  18. Topodiagnosis in Creutzfeldt-Jakob disease by HMPAO-SPECT. Topodiagnostik der Creutzfeldt-Jakobschen Krankheit durch HMPAO-SPECT

    Energy Technology Data Exchange (ETDEWEB)

    Heye, N. (Neurologische Klinik, St. Josef Hospital, Bochum Univ. (Germany)); Farahati, J. (Klinik und Poliklinik fuer Nuklearmedizin, Essen Univ. (Gesamthochschule) (Germany)); Heinz, A. (Neurologische Klinik, St. Josef Hospital, Bochum Univ. (Germany)); Buettner, T. (Neurologische Klinik, St. Josef Hospital, Bochum Univ. (Germany)); Przuntek, H. (Neurologische Klinik, St. Josef Hospital, Bochum Univ. (Germany)); Reiners, C. (Klinik und Poliklinik fuer Nuklearmedizin, Essen Univ. (Gesamthochschule) (Germany))

    1993-02-01

    A 80-year old female presented with an early stage of Creutzfeldt-Jakob disease with clinical, neurophysiological and neuropathological findings suggesting a focal involvement of the brain. HMPAO SPECT disclosed asymmetries of regional cerebral perfusion, thus suggesting that it may be a further diagnostic instrument in this disease. (orig.)

  19. Bis(s) ins Innere des Protons ein Science Slam durch die Welt der Elementarteilchen, der Beschleuniger und Supernerds

    CERN Document Server

    Lemmer, Boris

    2014-01-01

    Geben Sie's zu, wir alle fragen gerne mal: „Was ist da drin?“. Und einige, die hören mit dem Fragen einfach nicht mehr auf. Sie haken nach, bis es als Antwort nur noch gibt: „Das war’s, kleiner geht’s nicht mehr.“ Da wo's klein wird, wird die Welt plötzlich ganz verrückt: Aus purer Energie werden Teilchen erzeugt. Materieteilchen bekommen Geschwister aus Antimaterie. Teilchen, die es eigentlich gar nicht geben dürfte, entstehen plötzlich aus dem Nichts. Das ist die Welt der Teilchenphysik. Teilchenphysiker bauen die größten Experimente aller Zeiten, um die kleinsten Teilchen des Universums zu untersuchen. Sie gehen an die Grenzen des technisch Machbaren und überschreiten dabei die Grenzen unserer Länder. Wer das alles auch so spannend findet wie die Teilchenphysiker selbst, ist herzlich eingeladen, dieses Buch zu lesen. Wer glaubt, dass man ohne ein Studium in der Teilchenphysik nichts versteht, der auch. Quantenfeldtheorien, Teilchenbeschleuniger, Higgs-Mechanismus und Co werden hier...

  20. Comparative studies in the cellular immunostimulation by whole body irradiation. Vergleichende Untersuchungen ueber die zellulaere Immunstimulation durch Ganzkoerperbestrahlung

    Energy Technology Data Exchange (ETDEWEB)

    Dietz, R.; Schwarze, G. (Service de Radiologie, Centre Hospitalier de Luxembourg (Luxembourg) Medizinische Universitaetsklinik I, Homburg/Saar (Germany))

    1992-04-01

    The effect of the cellular immune response by total body irradiation was investigated. The transplant survival (skin grafts) was determined as immune parameter. Donors were colony bred Wistar rats and recipients were colony bred Sprague Dawley rats. The investigations were carried out with irradiated rats and with rats irradiated after thymectomy and/or adrenalectomy as well as with animals without irradiation. A single total-body irradiation (1 and 2 Gy) was administered. The skin graft survival in irradiated rats was significant shorter (radiogenic immunostimulation) than in unirradiated rats; there were no significant differences between the operated (thymectomy and/or adrenalectomy) and not operated animals. Including precedent examinations this radiogenic immunostimulation is caused by relativly selective inactivation of T-suppressor cells. (orig.).

  1. Online frequency adjustment for energy optimisation of induction hardening processes; Energetische Optimierung von Induktionshaertungsprozessen durch Online-Frequenzanpassung

    Energy Technology Data Exchange (ETDEWEB)

    Ulferts, Alexander; Andrae, Frank [HWG Inductoheat GmbH, Reichenbach (Germany)

    2011-06-15

    It is frequently necessary to harden multiple points on a component. The hardness specification may, in many cases, be variable, and the boundary conditions often diverse. The relevant sectors of the component are in many cases more deeply hardened, to enhance strength and vibration-fatigue properties, with simultaneous retention of ductile properties in the core, in order to reduce the danger of fracture of the heat-treated component in service. In other cases, the hardening process is intended more to provide protection against elevated surface loadings and against abrasive erosion of material. Both of these applications are illustrated on the basis of a component in the context of this article, and the requirements made on the inductive hardening process discussed. The authors consciously raise the question of the limits of technical feasibility. (orig.)

  2. Causes and avoidance of container damages by means of biocorrosion; Ursachen und Vermeidung von Behaelterschaeden durch Biokorrosion

    Energy Technology Data Exchange (ETDEWEB)

    Kuever, Jan [Amtliche Materialpruefungsanstalt Bremen (MPA), Bremen (Germany)

    2011-07-01

    The contribution under consideration deals with the causes and prevention of vessel damages due to corrosion by microorganisms (MIC, microbially induced corrosion) in the presence and absence of oxygen. In particular, the microbially induced corrosion by sulfate-reducing bacteria and the formation of sulfuric acid by microorganisms are described. Consequential damage caused by microorganisms are inactivation of filters and catalysts, degradation products from the fermentation process and deposits in the pipe system.

  3. Pilot tests in enhanced ultrasonic disintegration of sewage sludge; Pilotversuche zur Intensivierung der Schlammfaulung durch Klaerschlammdesintegration mit Ultraschall

    Energy Technology Data Exchange (ETDEWEB)

    Nickel, K.; Tiehm, A.; Neis, U. [Technische Univ. Hamburg-Harburg, Hamburg (Germany). Arbeitsbereich Abwasserwirtschaft

    1999-07-01

    The work has the objective to optimize ultrasonic disintegration of sewage sludge in permant routine operation. Anaerobic degradation of disintegrated crude and excess sludge was investigated on a pilot scale at a municipal sewage treatment plant. (orig.) [German] Ziel dieser Arbeit ist die Optimierung der Klaerschlammdesintegration mit Ultraschall im praktischen Dauerbetrieb. Der anaerobe Abbau von desintegriertem Roh- und Ueberschussschlamm wurde im Pilotmassstab vor Ort auf einer kommunalen Klaeranlage untersucht. (orig.)

  4. Oil and gas-fuelled high-efficiency boilers still going strong; Oel und Gas - Brennwert setzt sich weiter durch

    Energy Technology Data Exchange (ETDEWEB)

    Donnerbauer, R.

    2007-07-15

    High-efficiency boilers are going strong. They are generally used in gas boilers and are now conquering the gas boiler field as well. Producers are advertising their high energy efficiency, as was reflected at the ISH 2007. Further, the option of bio-natural gas and bio-oil provides an image of high sustainability. (orig.)

  5. Kopplung metallorganischer Reaktionszentren durch den nichtplanaren Brückenliganden 2,3-Bis(2-pyridyl)pyrazin

    Czech Academy of Sciences Publication Activity Database

    Berger, S.; Scheiring, T.; Fiedler, Jan; Kaim, W.

    2004-01-01

    Roč. 630, - (2004), s. 2409-2417 ISSN 0044-2313 R&D Projects: GA MŠk OC D15.10; GA MŠk OC D14.20 Institutional research plan: CEZ:AV0Z4040901 Keywords : crystal structure * electrochemistry * iridium and rhodium Subject RIV: CF - Physical ; Theoretical Chemistry Impact factor: 1.086, year: 2004

  6. Beeinflussung der Wirkung von Ernährungsinformation durch Framing: Analyse am Beispiel von Folsäure

    OpenAIRE

    Lensch, Kathrin; Hartmann, Monika; Simons, Johannes

    2011-01-01

    Die Bereitstellung und verbrauchergerechte Aufbereitung von Informationen stellt eine Möglichkeit dar, Konsumenten darin zu unterstützen, Gesundheitsaspekte vermehrt in das Kauf- und Essverhalten zu integrieren. In der Verhaltensökonomik gelten Framing-Effekte als wichtige Bestimmungsfaktoren für die Wahrnehmung von Informationen. Im Rahmen des vorliegenden Beitrags werden Framing-Effekte am Beispiel von Ernährungsinformationen über Folsäure mit Hilfe eines Experiments untersucht. Die Ergebni...

  7. More safety in the medium-voltage network by casting resin transformers; Mehr Sicherheit im Mittelspannungs-Netz durch Giessharztransformatoren

    Energy Technology Data Exchange (ETDEWEB)

    Tschaetsch, H.U.

    2006-07-15

    Drying transformers or casting resin transformers are employed at places where oil-isolated transformers may not be used for safety reasons. Characteristics such as operational safety and long life span ensure greatest possible safety with wind power stations, in water protection zones, in multi-storied buildings and in each subway railway station or rapid-transit railway station. A further substantial characteristic is in demand: the very good fire behaviour. Drying transformers not only are difficulty inflammable, but also go out by one self. In addition the transformers are maintenance-free, have a compact design, are easily installable and make no high requirements to the maintenance staff. Drying transformers are ecologically beneficial and can be recycled well. Therefore, drying transformers are indispensable in the public and industrial power supply.

  8. Improvement of resource efficiency by efficient waste shipment inspections; Steigerung der Ressourceneffizienz durch effiziente Kontrollen von Abfallverbringungen

    Energy Technology Data Exchange (ETDEWEB)

    Schilling, Stephanie [Institut fuer Oekologie und Politik GmbH (OEKOPOL), Hamburg (Germany)

    2011-09-15

    Illegal shipment of waste as well as enforcement related to waste shipment have been regularly the centre of attention of public and professional debates and are also a topic of cross-national relations. In addition, the fear persists that by illegal waste shipments waste is treated in plants neither adapted to protect the environment and health nor having sufficient recuperation capabilities for precious raw materials. This project therefore intends to clarify the status quo of waste shipment inspections in the 16 federal states of Germany (Bundeslaender, in the following cited as states or federal states) to identify potential for development regarding the organisation and execution of inspections and to elaborate recommendations to optimise enforcement activities and further development of European and German legislative regulations. In order to optimise the enforcement of the European Waste Shipment Regulation (WSR) and the German Waste Shipment Act (AbfVerbrG), an adequate number of qualified personnel is necessary within all bodies involved into waste shipment inspections. Those bodies are namely the competent waste authorities, customs, police, the Federal Office for Transport of Goods (BAG), the Federal Railway Authority (EBA) and the prosecution offices. An adequate number of qualified personnel is not provided for in all states/authorities. This is also reflected in the number of transport and plant inspections which deviate between zero to a fixed number per year as well as being continuously performed and based occasion-/cause oriented inspections. Tangible means like access to IT-systems and the Internet should be provided for on-site inspections. Besides qualified and experienced personnel also IT-Systems have a relevant impact on the preselection of the entity to be inspected as well as for on-the-spot investigations. Therefore IT-System can increase the efficiency of inspections (inspections per time unit resp. exposure of illegal shipments per time unit). Those already available IT-Systems could be enhanced in relation to waste transport in transit and should be available to the mobile inspection teams (depending on the inspection strategy of the states). Partially a closer cross linking (on federal and federal state level) with different inspections and permitting authorities as well as with competent authorities for national waste transports and international waste shipments was wished for and is sensible for some states. Generally it would be sensible to perform strategic analyses of the waste shipment situation in Germany on a regular basis in order to perform purposeful inspections.For the figuration of the urgency and control of the effect of the enforcement measures, statistics are of relevant significance. For the preparation of these statistics, IT-systems are useful. Jurisdiction and related procedures have been assessed by most competent waste authorities as sufficient and clear. Room for improvement is solely seen when it comes to sampling at the inspection site, shipments containing waste mixed abroad, sanctions for foreign parties involved into illegal shipments, lacking areas for impoundments and inspection of rail-bound waste shipments. The increased application of inspections at focal points of waste shipments like plants, hubs and collection areas as well as specialised waste shipment inspection teams were identified as sensible means to enhance the inspection efficiency. In addition waste shipment inspections should be an inherent part of general inspections performed in the regions. All of these measures are already performed in parts, although some of the necessary requirements for the inspecting authorities' are not yet sufficiently provided and require further activities in particular from the competent waste authorities' of the states resp. the federal state ministries. This issue is closely connected to the cooperation of the different authorities among each other and within one authority. The majority of the competent waste authorities assessed the level of cooperation as being sufficient. But the study also revealed that in most cases staffing and hierarchic sensitivities influence the satisfaction of the cooperation to a larger extent than the specific authority with which cooperation is being carried out. On national level an intensification of the working meetings of the German Federal Environmental Agency (UBA) can ameliorate the cooperation of the authorities. On international level a more regularly and structured participation resp. integration of German authorities into the IMPEL-TFS activities is being proposed. The cooperation between inspection and waste authorities' as well as prosecution offices could also be enhanced. In addition the WSR does not contain enough mechanism for sanctions for the waste consignee. Ad-justments according to the AbfVerbrG could be sensible. The AbfVerbrG or permitting laws could be adapted allowing a more facile interim storage of illegally shipped waste. (orig.)

  9. Optimisation of small-scale hydropower using quality assurance methods - Preliminary project; Vorprojekt: Optimierung von Kleinwasserkraftwerken durch Qualitaetssicherung. Programm Kleinwasserkraftwerke

    Energy Technology Data Exchange (ETDEWEB)

    Hofer, S.; Staubli, T.

    2006-11-15

    This comprehensive final report for the Swiss Federal Office of Energy (SFOE) presents the results of a preliminary project that examined how quality assurance methods can be used in the optimisation of small-scale hydropower projects. The aim of the project, to use existing know-how, experience and synergies, is examined. Discrepancies in quality and their effects on production prices were determined in interviews. The paper describes best-practice guidelines for the quality assurance of small-scale hydro schemes. A flow chart describes the various steps that have to be taken in the project and realisation work. Information collected from planners and from interviews made with them are presented along with further information obtained from literature. The results of interviews concerning planning work, putting to tender and the construction stages of these hydro schemes are presented and commented on. Similarly, the operational phase of such power plant is also examined, including questions on operation and guarantees. The aims of the follow-up main project - the definition of a tool and guidelines for ensuring quality - are briefly reviewed.

  10. Evaluierung eines etablierten Universitätslehrganges für Krankenhausmanagement durch telefonische Befragung ehemaliger Teilnehmer

    NARCIS (Netherlands)

    Lorenz, I. H.; Schubert, H. M.; Lirk, P.; Moser, P. L.; Hohlrieder, M.; Schlimp, C.; Hackl, J. M.; Kolbitsch, C.

    2003-01-01

    AIM OF THE STUDY: Participation in courses for health and hospital management is increasingly becoming a conditio sine qua non for candidates for executive positions in the health professions. The aim of this study was thus to evaluate the two-semester university course for health and hospital

  11. Distinction between magnesium diboride and tetraboride by kelvin probe force microscopy; Unterscheidung von Magnesiumdiborid und Magnesiumtetraborid durch Kelvinsondenkraftmikroskopie

    Energy Technology Data Exchange (ETDEWEB)

    Kim, Du-Na; Caron, Arnaud; Park, Hai Woong [KoreaTech - Korea Univ. of Technology and Education, Chungnam (Korea, Republic of). School of Energy, Materials and Chemical Engineering

    2016-08-15

    We analyze mixtures of magnesium diboride and tetraboride synthesized with magnesium powders of different shapes. To distinguish between magnesium diboride and tetraboride we use the contrast of kelvin probe force microscopy. The microstructural morphology strongly depends on the shape of the magnesium powders used in the reaction between magnesium and magnesium tetraboride to form magnesium diboride. With spherical magnesium powder an equiaxed microstructure of magnesium diboride is formed with residual magnesium tetraboride at the grain boundaries. With plate-like magnesium powders elongated magnesium diboride grains are formed. In this case, residual magnesium tetraboride is found to agglomerate.

  12. MEGA. Higher energy-efficiency through systematic user information - Final report; MEGA. Mehr Energieeffizienz durch gezielte Anwenderinformationen - Schlussbericht

    Energy Technology Data Exchange (ETDEWEB)

    Fercu, M.; Kistler, R. [Hochschule Luzern Technik und Architektur, CEESAR - iHomeLab, Horw (Switzerland); Egli, A. [Hochschule Luzern Technik und Architektur, ISIS, Horw (Switzerland); Gallati, J. [Hochschule Luzern Technik und Architektur, Wirtschaft, Horw (Switzerland)

    2010-09-15

    Individuals are empowered to conserve energy and natural resources when provided with motivational and personalized information on its use. By presenting information about the energy consumption from the home's energy meters along with recommended actions, the residential customer becomes aware of how in/efficiently energy is consumed within his home and can decide on how to act to conserve. This information can provide an accurate metric of how effective a conservation action is even to inhabitants that are not yet knowledgeable about or self-motivated by the monetary and ecologic rewards of conserving. This project was designed to build knowledge on technically and economically feasible ways to create an awareness of energy (especially electricity) for the sake of conservation. Specifically, it implements an exemplar prototype of a highly effective energy feedback system that is an interactive, real-time, in-home display. Toward this goal, four system architecture configuration proposals, a set of system requirements, and ideal system features are synthesized; they are based on the results of the research that evaluates effectiveness of existing energy-efficiency and -conservation methods and studies related technologies. Three of the four systems proposed represent energy technologies expected to be available within the next decade. The fourth system proposal is a demonstration prototype designed for implementation in the iHomeLab. This prototype is an open, modular, robust, cross-platform software framework that collects data, processes, and presents it interactively and visually on hardware available in most households. The results of this project both indicate that the creation of such energy feedback systems appear beneficial and also provide guidelines for their design. However, further development of infrastructure and elaboration of design is foreseen as necessary for this system to be suitable for mass deployment. (author)

  13. Utilization of solar energy by means of photovoltaic cells on a captive balloon. Sonnenstrahlenenergienutzung durch photovoltaische Zellen auf Fesselballon

    Energy Technology Data Exchange (ETDEWEB)

    Scheib, A.

    1988-02-25

    For the use of solar energy photovoltaic cells are used which are deposited on the envelope of a captive balloon which floats over the ground according to the hot air principle in a sufficient height free of atmospheric influences (about 10 km) and whose stay ropes are used for the transfer of generated electric power. The part of the envelope of the balloon equipped with solar cells is to be made as a plane surface and this solar cell surface can be positioned by means of a variation of the free stay rope lengths controlled automatically in an optimal way according to the sun beam direction. In connection with the absence of atmospheric influences, a generation of maximum energy in great constancy during nearly the whole daytime, is made possible.

  14. Relief for the environment and for traffic through regional economies; Entlastung der Umwelt und des Verkehrs durch regionale Wirtschaftskreislaeufe

    Energy Technology Data Exchange (ETDEWEB)

    Sprenger, R.U.; Arnold-Rothmaier, H.; Kiemer, K.; Pintarits, S.; Wackerbauer, J.

    2003-01-01

    Transport performance has outpaced the growth of real GDP in recent decades. By 20015 a further increase in transport performance of between 50% and 79% over 1997 is forecast. Strengthening regional economies is one way of structurally countering the trend of over-proportionally rising traffic flows in the long term. The study examines the links between economic and transport development at the regional level. Options are also presented for promoting regional economies, thereby decreasing the volume of inter-regional transport. (orig.) [German] Die Verkehrsleistung nahm in den letzten Jahrzehnten staerker zu als das reale Bruttoinlandsprodukt. Gegenueber 1997 wird bis zum Jahr 2015 eine weitere Steigerung der Verkehrsleistung auf der Strasse von 50% und 79% prognostiziert. Eine Staerkung regionaler Wirtschaftskreislaeufe wird als Mittel gesehen, um dem Trend ueberproportional steigender Verkehrsstroeme strukturell und langfristig entgegenzuwirken. In der Studie wurden die Zusammenhaenge zwischen wirtschaftlicher und verkehrlicher Entwicklung auf regionaler Ebene erforscht. Zudem werden Moeglichkeiten eroertert, die regionale Wirtschaftskreislaeufe foerdern und so das Volumen interregionaler Transporte verringern. (orig.)

  15. Efficient four-wave mixing by usage of resonances in mercury; Effizientes Vierwellenmischen durch Ausnutzen von Resonanzen in Quecksilber

    Energy Technology Data Exchange (ETDEWEB)

    Kolbe, Daniel

    2011-05-05

    A continuous, coherent radiation source in the vacuum ultraviolet spectral region is presented. It is based on four-wave-mixing in mercury vapor with fundamental beams at 253.7 nm, 407.9 nm und 545.5 nm wavelength. The fundamental beams are produced by frequency doubling and quadrupling of beams from solid-state laser-systems respectively. Due to the 6{sup 1}S-7{sup 1}S two-photon resonance and additionally the 6{sup 1}S-6{sup 3}P one-photon resonance the efficiency can be increased compared to former sources. A near one-photon resonance reduces the optimal phasematching temperature of the four-wave-mixing process. This leads to smaller Doppler and pressure broadening resulting in a higher four-wave-mixing efficiency. A maximum power of 0.3 nW at 121.56 nm wavelength, the 1S-2P Lyman-{alpha} transition in hydrogen, can be obtained. This Lyman-{alpha} source is needed for future laser cooling of antihydrogen. Apart from the Lyman-{alpha} generation, four-wave-mixing with a slightly different third fundamental wavelength results in radiation near a one-photon resonance in the VUV at the 6{sup 1}S-12{sup 1}P transition in mercury. Due to this additional one-photon resonance the nonlinear susceptibility, responsible for the four-wave-mixing, can be strongly increased without an influence on the phasematching. With such a mixing process the efficiency can be enlarged by three orders of magnitude and powers up to 6 {mu}W in the VUV could be realised. This is an improvement of a factor of 30 to former laser sources in this VUV regime. Furthermore the two-photon resonance of mercury could be investigated in detail. We observed a velocity-selective double resonance at small Rabi frequencies of the fundamental beams, which has the same origin as dark resonances in {lambda}-systems. At high Rabi frequencies excitation to the two-photon level can be high enough to initiate a laser process on the 7{sup 1}S-6{sup 1}P transition. This process could be observed with continuouswave fundamental lasers for the first time. It can be shown that the additional laser process does not limit the four-wave-mixing efficiency. (orig.)

  16. Customer Value durch Management der Kundenzugangswege: Die zukünftige Rolle der Intermediäre im Versicherungsmarkt

    OpenAIRE

    Maas, Peter; Rüfenacht, Matthias

    2013-01-01

    Vergleicht man die Ausgestaltung der Zugangswege von Versicherern mit anderen Branchen, so lassen sich gravierende Unterschiede konstatieren: Tankstellen und Warenhäuser wandeln sich kontinuierlich und decken - neben der Kernleistung - eine Vielzahl zusätzlicher Bedürfnisse ab. Sportartikelhersteller wie Nike setzen mit Niketown genauso wie Apple mit seinen Genius Bars neue Massstäbe punkto Zugangswege und Emotionalisierung. Doch auch weniger emotionalisierte Branchen sehen sich solchen Verän...

  17. Intelligent production of rotor blades using IT-aided automation approaches; Intelligente Fertigung von Rotorblaettern durch IT-gestuetzte Automationsansaetze

    Energy Technology Data Exchange (ETDEWEB)

    Ohlendorf, J.H.; Thoben, K.D. [Bremen Univ. (Germany). BIK Institut fuer integrierte Produktentwicklung; Hans, C.; Ghrairi, Z. [Bremer Institut fuer Produktion und Logistik GmbH, Bremen (Germany)

    2010-08-15

    In this paper, the necessity of a control system for resin infusion and curing was elaborated with the example of rotor blade manufacturing. Also, an innovative multi-component learning control system that is based on the results of the iReMo-project was introduced. It reveals so-far hidden processes within the moulding tools via a sophisticated sensor-network, meets all imposed requirements and will therewith considerably change and improve the moulding process of reinforced polymer composite materials. In an environment that has little contact with the automation technology today, these innovations already bear a great potential to increase efficiency and quality and reduce costs and lead times. Further benefits will result from the interconnection with other automation solutions for fibre-reinforced composites products, i.e., the automatic placement of fabrics in the mould and will be subject to future research activities. An emphasis will be put on the continuous data management to assure quality and traceability. A consequent gathering and filing of all product data in terms of a Product Lifecyle Management (PLM) would be also possible for fibre-reinforced composites. (orig.)

  18. With the sun through thick and thin? Photovoltaic modules; Mit der Sonne durch dick oder duenn? Photovoltaikmodule

    Energy Technology Data Exchange (ETDEWEB)

    Anon.

    2012-07-01

    Two technologies quarrel over the ‚place in the sun': The classical silicon panels are considered to be efficient and reliable. Instead of this, new thin-film plates provide maximal performance also at weak light and heat. Which method ranks first? The authors of the contribution under consideration highlight the advantages and disadvantages.

  19. Variations of NMR signals by hyperpolarization and ultrasound; Variation von NMR-Signalen durch Hyperpolarisation und Ultraschall

    Energy Technology Data Exchange (ETDEWEB)

    Engelbertz, A.

    2006-07-01

    In this thesis it is described how p-NMR can be applied to metals with verlo low hydrogen concentrations and how a combination of ultrasound and NMR can lead to an improvement of the measureing method. As examples measurements on H{sub 2}O and ethanol are described. (HSI)

  20. Auf gute Nachbarschaft!. Verantwortungsübernahme durch Unternehmen für die Stadtteilentwicklung - Haniel und Grillo in Duisburg

    Science.gov (United States)

    Kleine-König, Christiane; Hohn, Uta

    2016-03-01

    Companies' community involvement turns out to be spatially relevant and-in many cases-to be focused on the near surroundings of the place of business. Some companies strategically align their involvement in order to systematically address local challenges. The essay at hand addresses the subject of corporate social responsibility from a local development perspective. Using the example of two family-owned enterprises based in Duisburg, Haniel and Grillo, it illustrates how socially committed companies can get involved with their local community by acting as good neighbours. Furthermore, it argues that socially committed companies can function as producers of space concerning matters of urban and local development. The specific local settings as well as the economic conditions of the local community serve as an explanatory background of the companies' involvement. The cases presented in this paper prove the firms' specific knowledge of local development needs and possibilities. This makes them qualified partners for local government actors and civil society actors. Thus, in the future, it is worth addressing corporate local responsibility from a governance point of view both in theory and in practice.