WorldWideScience

Sample records for dung buc xa

  1. BUC implementation in Slovakia

    International Nuclear Information System (INIS)

    Chrapciak, V.; Vaclav, J.

    2009-01-01

    Improved calculation methods allow one to take credit for the reactivity reduction associated with fuel burnup. This means reducing the analysis conservatism while maintaining an adequate criticality safety margin. Application of burnup credit (BUC) requires knowledge of the reactivity state of the irradiated fuel for which BUC is taken. The isotopic inventory and reactivity has to be calculated with validated codes. We use in Slovakia Gd 2 fuel with maximal enrichment of fuel pins 4.4%. Our transport and storage basket KZ-48 with boron steel is licensed for fresh fuel with enrichment 4.4%. In near future (2011 or 2012) we will use a new fuel with maximal enrichment of fuel pins 4.9%. For this fuel we plan to use existing KZ-48 with BUC application. In cooperation with Slovak Nuclear Regulatory Authority (UJD) we have started several years ago process of BUC implementation in Slovakia for VVER-440 reactors. We have already prepared methodology according IAEA methodology. We have validated computational systems (SCALE 5.1 already, SCALE 6 in progress). UJD will prepare regulation about BUC application in Slovakia. Last item is preparation of safety reports (for transport and storage) for the new fuel with average enrichment 4.87% in basket KZ-48 with BUC application.

  2. Expressional and Biochemical Characterization of Rice Disease Resistance Gene Xa3/Xa26 Family

    Institute of Scientific and Technical Information of China (English)

    Songjie Xu; Yinglong Cao; Xianghua Li; Shiping Wang

    2007-01-01

    The rice (Oryza sativa L.) Xa3/Xa26 gene, conferring race-specific resistance to bacterial blight disease and encoding a leucine-rich repeat (LRR) receptor kinase-like protein, belongs to a multigene family consisting of tandem clustered homologous genes, colocalizing with several uncharacterized genes for resistance to bacterial blight or fungal blast. To provide more information on the expressional and biochemical characteristics of the Xa3/Xa26 family, we analyzed the family members. Four Xa3/Xa26 family members in the indica rice variety Teqing, which carries a bacterial blight resistance gene with a chromosomal location tightly linked to Xa3/Xa26, and five Xa3/Xa26 family members in the japonica rice variety Nipponbare, which carries at least one uncharacterized blast resistance gene, were constitutively expressed in leaf tissue. The result suggests that some of the family members may be candidates of these uncharacterized resistance genes. At least five putative N-glycosylation sites in the LRR domain of XA3/XA26 protein are not glycosylated. The XA3/XA26 and its family members MRKa and MRKc all possess the consensus sequences of paired cysteines, which putatively function in dimerization of the receptor proteins for signal transduction, immediately before the first LRR and immediately after the last LRR. However, no homo-dimer between the XA3/XA26 molecules or hetero-dimer between XA3/XA26 and MRKa or MRKc were formed, indicating that XA3/XA26 protein might function either as a monomer or a hetero-dimer formed with other protein outside of the XA3/XA26 family. These results provide valuable information for further extensive investigation into this multiple protein family.

  3. Ortholog Alleles at Xa3/Xa26 Locus Confer Conserved Race-Specific Resistance against Xanthomonas oryzae in Rice

    Institute of Scientific and Technical Information of China (English)

    Hong-Jing Li; Xiang-Hua Li; Jing-Hua Xiao; Rod A. Wing; Shi-Ping Wang

    2012-01-01

    The rice disease resistance (R) gene Xa3/Xa26 (having also been named Xa3 and Xa26) against Xanthomonas oryzae pv.oryzae (Xoo),which causes bacterial blight disease,belongs to a multiple gene family clustered in chromosome 11 and is from an AA genome rice cultivar (Oryza sativa L.).This family encodes leucine-rich repeat (LRR) receptor kinasetype proteins.Here,we show that the orthologs (alleles) of Xa3/Xa26,Xa3/Xa26-2,and Xa3/Xa26-3,from wild Oryza species O.officinalis (CC genome) and O.minuta (BBCC genome),respectively,were also R genes against Xoo.Xa3/Xa26-2 and Xa3/Xa26-3 conferred resistance to 16 of the 18 Xoo strains examined.Comparative sequence analysis of the Xa3/Xa26 families in the two wild Oryza species showed that Xa3/Xa26-3 appeared to have originated from the CC genome of O.minuta.The predicted proteins encoded by Xa3/Xa26,Xa3/Xa26-2,and Xa3/Xa26-3 share 91-99% sequence identity and 94-99% sequence similarity.Transgenic plants carrying a single copy of Xa3/Xa26,Xa3/Xa26-2,or Xa3/Xa26-3,in the same genetic background,showed a similar resistance spectrum to a set of Xoo strains,although plants carrying Xa3/Xa26-2 or Xa3/Xa26-3 showed lower resistance levels than the plants carrying Xa3/Xa26.These results suggest that the Xa3/Xa26 locus predates the speciation of A and C genome,which is approximately 7.5 million years ago.Thus,the resistance specificity of this locus has been conserved for a long time.

  4. Exploiting VM/XA

    International Nuclear Information System (INIS)

    Boeheim, C.

    1990-03-01

    The Stanford Linear Accelerator Center has recently completed a conversion to IBM's VM/XA SP Release 2 operating system. The primary physics application had been constrained by the previous 16 megabyte memory limit. Work is underway to enable this application to exploit the new features of VM/XA. This paper presents a brief tutorial on how to convert an application to exploit VM/XA and discusses some of the SLAC experiences in doing so. 13 figs

  5. Development of a Dung Beetle Robot and Investigation of Its Dung-Rolling Behavior

    Directory of Open Access Journals (Sweden)

    Jen-Wei Wang

    2018-04-01

    Full Text Available In this study, a bio-inspired dung beetle robot was developed that emulated the dung rolling motion of the dung beetle. Dung beetles, which can roll objects up to 1000 times their own body weight, are one of the strongest insect species in the world. While the locomotion of many insects, such as cockroaches, inchworms, and butterflies, has been studied widely, the locomotion of dung beetles has rarely been given attention. Here, we report on the development of a dung beetle robot made specifically to investigate dung-rolling behavior and to determine and understand the underlying mechanism. Two versions of the robot were built, and the leg trajectories were carefully designed based on kinematic analysis. Cylinder and ball rolling experiments were conducted, and the results showed that the dung beetle robot could successfully and reliably roll objects. This further suggests that the dung beetle robot, with its current morphology, is capable of reliably rolling dung without the need for complex control strategies.

  6. Silencing of the Rice Gene LRR1 Compromises Rice Xa21 Transcript Accumulation and XA21-Mediated Immunity.

    Science.gov (United States)

    Caddell, Daniel F; Park, Chang-Jin; Thomas, Nicholas C; Canlas, Patrick E; Ronald, Pamela C

    2017-12-01

    The rice immune receptor XA21 confers resistance to Xanthomonas oryzae pv. oryzae (Xoo), the causal agent of bacterial leaf blight. We previously demonstrated that an auxilin-like protein, XA21 BINDING PROTEIN 21 (XB21), positively regulates resistance to Xoo. To further investigate the function of XB21, we performed a yeast two-hybrid screen. We identified 22 unique XB21 interacting proteins, including LEUCINE-RICH REPEAT PROTEIN 1 (LRR1), which we selected for further analysis. Silencing of LRR1 in the XA21 genetic background (XA21-LRR1Ri) compromises resistance to Xoo compared with control XA21 plants. XA21-LRR1Ri plants have reduced Xa21 transcript levels and reduced expression of genes that serve as markers of XA21-mediated activation. Overexpression of LRR1 is insufficient to alter resistance to Xoo in rice lines lacking XA21. Taken together, our results indicate that LRR1 is required for wild-type Xa21 transcript expression and XA21-mediated immunity.

  7. Marker-aided Incorporation of Xa38, a Novel Bacterial Blight Resistance Gene, in PB1121 and Comparison of its Resistance Spectrum with xa13 + Xa21.

    Science.gov (United States)

    Ellur, Ranjith K; Khanna, Apurva; S, Gopala Krishnan; Bhowmick, Prolay K; Vinod, K K; Nagarajan, M; Mondal, Kalyan K; Singh, Nagendra K; Singh, Kuldeep; Prabhu, Kumble Vinod; Singh, Ashok K

    2016-07-11

    Basmati rice is preferred internationally because of its appealing taste, mouth feel and aroma. Pusa Basmati 1121 (PB1121) is a widely grown variety known for its excellent grain and cooking quality in the international and domestic market. It contributes approximately USD 3 billion to India's forex earning annually by being the most traded variety. However, PB1121 is highly susceptible to bacterial blight (BB) disease. A novel BB resistance gene Xa38 was incorporated in PB1121 from donor parent PR114-Xa38 using a modified marker-assisted backcross breeding (MABB) scheme. Phenotypic selection prior to background selection was instrumental in identifying the novel recombinants with maximum recovery of recurrent parent phenome. The strategy was effective in delimiting the linkage drag to <0.5 mb upstream and <1.9 mb downstream of Xa38 with recurrent parent genome recovery upto 96.9% in the developed NILs. The NILs of PB1121 carrying Xa38 were compared with PB1121 NILs carrying xa13 + Xa21 (developed earlier in our lab) for their resistance to BB. Both NILs showed resistance against the Xoo races 1, 2, 3 and 6. Additionally, Xa38 also resisted Xoo race 5 to which xa13 + Xa21 was susceptible. The PB1121 NILs carrying Xa38 gene will provide effective control of BB in the Basmati growing region.

  8. Marker-aided Incorporation of Xa38, a Novel Bacterial Blight Resistance Gene, in PB1121 and Comparison of its Resistance Spectrum with xa13 + Xa21

    Science.gov (United States)

    Ellur, Ranjith K.; Khanna, Apurva; S, Gopala Krishnan.; Bhowmick, Prolay K.; Vinod, K. K.; Nagarajan, M.; Mondal, Kalyan K.; Singh, Nagendra K.; Singh, Kuldeep; Prabhu, Kumble Vinod; Singh, Ashok K.

    2016-01-01

    Basmati rice is preferred internationally because of its appealing taste, mouth feel and aroma. Pusa Basmati 1121 (PB1121) is a widely grown variety known for its excellent grain and cooking quality in the international and domestic market. It contributes approximately USD 3 billion to India’s forex earning annually by being the most traded variety. However, PB1121 is highly susceptible to bacterial blight (BB) disease. A novel BB resistance gene Xa38 was incorporated in PB1121 from donor parent PR114-Xa38 using a modified marker-assisted backcross breeding (MABB) scheme. Phenotypic selection prior to background selection was instrumental in identifying the novel recombinants with maximum recovery of recurrent parent phenome. The strategy was effective in delimiting the linkage drag to <0.5 mb upstream and <1.9 mb downstream of Xa38 with recurrent parent genome recovery upto 96.9% in the developed NILs. The NILs of PB1121 carrying Xa38 were compared with PB1121 NILs carrying xa13 + Xa21 (developed earlier in our lab) for their resistance to BB. Both NILs showed resistance against the Xoo races 1, 2, 3 and 6. Additionally, Xa38 also resisted Xoo race 5 to which xa13 + Xa21 was susceptible. The PB1121 NILs carrying Xa38 gene will provide effective control of BB in the Basmati growing region. PMID:27403778

  9. Treating cattle with antibiotics affects greenhouse gas emissions, and microbiota in dung and dung beetles

    Science.gov (United States)

    Fierer, Noah; Hardwick, Bess; Simojoki, Asko; Slade, Eleanor; Taponen, Juhani; Viljanen, Heidi; Roslin, Tomas

    2016-01-01

    Antibiotics are routinely used to improve livestock health and growth. However, this practice may have unintended environmental impacts mediated by interactions among the wide range of micro- and macroorganisms found in agroecosystems. For example, antibiotics may alter microbial emissions of greenhouse gases by affecting livestock gut microbiota. Furthermore, antibiotics may affect the microbiota of non-target animals that rely on dung, such as dung beetles, and the ecosystem services they provide. To examine these interactions, we treated cattle with a commonly used broad-spectrum antibiotic and assessed downstream effects on microbiota in dung and dung beetles, greenhouse gas fluxes from dung, and beetle size, survival and reproduction. We found that antibiotic treatment restructured microbiota in dung beetles, which harboured a microbial community distinct from those in the dung they were consuming. The antibiotic effect on beetle microbiota was not associated with smaller size or lower numbers. Unexpectedly, antibiotic treatment raised methane fluxes from dung, possibly by altering the interactions between methanogenic archaea and bacteria in rumen and dung environments. Our findings that antibiotics restructure dung beetle microbiota and modify greenhouse gas emissions from dung indicate that antibiotic treatment may have unintended, cascading ecological effects that extend beyond the target animal. PMID:27226475

  10. Treating cattle with antibiotics affects greenhouse gas emissions, and microbiota in dung and dung beetles.

    Science.gov (United States)

    Hammer, Tobin J; Fierer, Noah; Hardwick, Bess; Simojoki, Asko; Slade, Eleanor; Taponen, Juhani; Viljanen, Heidi; Roslin, Tomas

    2016-05-25

    Antibiotics are routinely used to improve livestock health and growth. However, this practice may have unintended environmental impacts mediated by interactions among the wide range of micro- and macroorganisms found in agroecosystems. For example, antibiotics may alter microbial emissions of greenhouse gases by affecting livestock gut microbiota. Furthermore, antibiotics may affect the microbiota of non-target animals that rely on dung, such as dung beetles, and the ecosystem services they provide. To examine these interactions, we treated cattle with a commonly used broad-spectrum antibiotic and assessed downstream effects on microbiota in dung and dung beetles, greenhouse gas fluxes from dung, and beetle size, survival and reproduction. We found that antibiotic treatment restructured microbiota in dung beetles, which harboured a microbial community distinct from those in the dung they were consuming. The antibiotic effect on beetle microbiota was not associated with smaller size or lower numbers. Unexpectedly, antibiotic treatment raised methane fluxes from dung, possibly by altering the interactions between methanogenic archaea and bacteria in rumen and dung environments. Our findings that antibiotics restructure dung beetle microbiota and modify greenhouse gas emissions from dung indicate that antibiotic treatment may have unintended, cascading ecological effects that extend beyond the target animal. © 2016 The Author(s).

  11. Removal rates of native and exotic dung by dung beetles (Scarabaeidae: Scarabaeinae) in a fragmented tropical rain forest.

    Science.gov (United States)

    Amézquita, Sandra; Favila, Mario E

    2010-04-01

    Many studies have evaluated the effect of forest fragmentation on dung beetle assemblage structure. However, few have analyzed how forest fragmentation affects the processes carried out by these insects in tropical forests where their food sources consist mainly of dung produced by native herbivore mammals. With the conversion of forests to pastures, cattle dung has become an exotic alternative and abundant food for dung beetles. This study compares dung removal rates of native (monkey) and exotic (cow) dung in different-sized fragments of tropical rain forests, during the dry and rainy seasons at the Los Tuxtlas Biosphere Reserve. Dung removal rates were affected by season, dung type, and the interaction between resource type and season. During the dry season, the removal rates of monkey dung were somewhat similar than during the rainy season, whereas the removal rates of cow dung were much higher during the rainy season. Dung beetle biomass and species richness were almost three times greater in monkey dung than in cow dung. Monkey dung attracted species belonging to the dweller, roller, and tunneler guilds; cow dung attracted mostly tunnelers. Therefore, the use of exotic dung may result in a biased misconception of the rates of dung removal in tropical forest and an underestimation of dung beetle diversity. This study highlights the importance of working with natural tropical forest resources when attempting to identify realistic tendencies concerning processes in natural habitats and those modified by fragmentation and by other human activities.

  12. Greenhouse gas emissions from dung pats vary with dung beetle species and with assemblage composition.

    Directory of Open Access Journals (Sweden)

    Irene Piccini

    Full Text Available Cattle farming is a major source of greenhouse gases (GHGs. Recent research suggests that GHG fluxes from dung pats could be affected by biotic interactions involving dung beetles. Whether and how these effects vary among beetle species and with assemblage composition is yet to be established. To examine the link between GHGs and different dung beetle species assemblages, we used a closed chamber system to measure fluxes of carbon dioxide (CO2, methane (CH4 and nitrous oxide (N2O from cattle dung pats. Targeting a total of four dung beetle species (a pat-dwelling species, a roller of dung balls, a large and a small tunnelling species, we ran six experimental treatments (four monospecific and two mixed and two controls (one with dung but without beetles, and one with neither dung nor beetles. In this setting, the overall presence of beetles significantly affected the gas fluxes, but different species contributed unequally to GHG emissions. When compared to the control with dung, we detected an overall reduction in the total cumulative CO2 flux from all treatments with beetles and a reduction in N2O flux from the treatments with the three most abundant dung beetle species. These reductions can be seen as beneficial ecosystem services. Nonetheless, we also observed a disservice provided by the large tunneler, Copris lunaris, which significantly increased the CH4 flux-an effect potentially traceable to the species' nesting strategy involving the construction of large brood balls. When fluxes were summed into CO2-equivalents across individual GHG compounds, dung with beetles proved to emit less GHGs than did beetle-free dung, with the mix of the three most abundant species providing the highest reduction (-32%. As the mix of multiple species proved the most effective in reducing CO2-equivalents, the conservation of diverse assemblages of dung beetles emerges as a priority in agro-pastoral ecosystems.

  13. Clinical Scenarios for Discordant Anti-Xa

    Directory of Open Access Journals (Sweden)

    Jesus Vera-Aguilera

    2016-01-01

    Full Text Available Anti-Xa test measures the activity of heparin against the activity of activated coagulation factor X; significant variability of anti-Xa levels in common clinical scenarios has been observed. Objective. To review the most common clinical settings in which anti-Xa results can be bias. Evidence Review. Guidelines and current literature search: we used PubMed, Medline, Embase, and MEDION, from 2000 to October 2013. Results. Anti-Xa test is widely used; however the assay underestimates heparin concentration in the presence of significant AT deficiency, pregnancy, end stage renal disease, and postthrombolysis and in patients with hyperbilirubinemia; limited published data evaluating the safety and effectiveness of anti-Xa assays for managing UH therapy is available. Conclusions and Relevance. To our knowledge this is the first paper that summarizes the most common causes in which this assay can be affected, several “day to day” clinical scenarios can modify the outcomes, and we concur that these rarely recognized scenarios can be affected by negative outcomes in the daily practice.

  14. A review on the effect of macrocyclic lactones on dung-dwelling insects: Toxicity of macrocyclic lactones to dung beetles

    Directory of Open Access Journals (Sweden)

    Carmen T. Jacobs

    2015-04-01

    Full Text Available Avermectins and milbemycins are commonly used in agro-ecosystems for the control of parasites in domestic livestock. As integral members of agro-ecosystems with importance in maintaining pasture health through dung burial behaviour, dung beetles are an excellent nontarget bio-indicator taxon for examining potential detrimental effects of pesticide application. The current review focuses on the relative toxicity of four different anthelmintics (ivermectin, eprinomectin, doramectin and moxidectin in dung residues using dung beetles as a bioindicator species. One of the implications of this review is that there could be an effect that extends to the entire natural assemblage of insects inhabiting and feeding on the dung of cattle treated with avermectin or milbemycin products. Over time, reduced reproductive rate would result in decreased dung beetle populations and ultimately, a decrease in the rate of dung degradation and dung burial.

  15. What do dung beetles eat?

    DEFF Research Database (Denmark)

    Holter, Peter; Scholtz, Clarke H.

    2007-01-01

    Most adult coprophagous beetles feed on fresh dung of mammalian herbivores, confining ingestion to small particles with measured maximum diameters from 2-5 to 130 µm, according to body size and kind of beetle. This study explores benefits and costs of selective feeding in a ‘typical' dung beetle...... that of elephant and rhino (40-58%) was available to selective feeders. 3. Nitrogen concentrations were high - and C/N ratios low - in most types of bulk dung compared with the average food of terrestrial detritivores or herbivores. Exceptions were elephant and rhino dung with low nitrogen concentrations and high...... C/N ratios. 4. Estimated C/N ratios of 13-39 in bulk dung (sheep-elephant) were decreased by selective feeding to 7.3-12.6 in the ingested material. In assimilated food, ratios are probably only 5-7, as most assimilable nitrogen and carbon may be of microbial origin. If so, the assimilable food...

  16. The materiality of dung: the manipulation of dung in Neolithic Mediterranean caves

    Directory of Open Access Journals (Sweden)

    Dimitrij Mlekuž

    2009-12-01

    Full Text Available This paper discusses the formation of layers of burnt herbivore dung in Neolithic, Eneolithic and Bronze Age Mediterranean caves. While these layers are clearly connected with transhumant pastoralism and the practice of keeping herds in the caves, their formation should not be seen as the result of purely practical and ‘rational’ reasons. In this paper, I develop an argument that they are remnants of a complex manipulation of substances which includes burning dung to make white ash. Thus instead of seeing dung as a culturally neutral refuse which has to be disposed of, we might see its burning and deposition as the cultural manipulation of potent substance.

  17. 3.10/49 B. GERHARD VON RAD, Das ersfe BucA Mose, Xap. 1-12:9 ...

    African Journals Online (AJOL)

    Test

    3.10/49. B. GERHARD VON RAD, Das ersfe BucA Mose, Xap. 1-12:9. Das Alte. Testament Deutsch, Neues Göttinger Bibelwerk, Nr. 2. Göttingen,. Vandenhoeck und Ruprecht, 1949, 136 bis. Prys 5.40 DM, geb. 7.90 DM. Met hierdie „Teilband" begin 'n besonder welkome verklaring van die Ou Testament in die Duitse taal, ...

  18. Dungeness bibliography

    International Nuclear Information System (INIS)

    Riley, H.

    1989-01-01

    This report is a bibliography of material relating to the ecology of Dungeness in Kent and has been produced, under contract, for the Nature Conservancy Council. Since its first appearance in 1985, much new material has been published or has come to light, and is included in this 1989 edition. The area concerned comprises the system of shingle beaches between Jury's Gap and Greatstone-on-Sea on the south Kent/Sussex coast, and is a site of international conservation importance. It is one of the finest examples of an apposition shingle beach in the world and in terms of physiography, botany, entomology and ornithology it is an area of high scientific interest. As well as being of great scientific importance, Dungeness is subject to a high degree of 'human' pressure: excavation and building operations, military activity, vehicular damage and trampling threaten to destroy what is left of the natural shingle ecosystem at Dungeness. In recognition of this the Nature Conservancy Council is supporting a renewed programme of research into the ecology of the site, to try to determine how best to protect the remaining intact areas. (author)

  19. Molecular screening of rice ( Oryza sativa L.) germplasm for Xa4 ...

    African Journals Online (AJOL)

    DNA fingerprinting results indicated the presence of Xa4 gene in 41 entries, while 14 lines were positive for xa5 gene. Only one local line was carrying Xa21 gene along with Xa4. Thus, the present study will not only be helpful for rice breeders to develop new rice varieties carrying disease resistant genes, but will also ...

  20. Maximize x(a - x)

    Science.gov (United States)

    Lange, L. H.

    1974-01-01

    Five different methods for determining the maximizing condition for x(a - x) are presented. Included is the ancient Greek version and a method attributed to Fermat. None of the proofs use calculus. (LS)

  1. Revisiting the Life Cycle of Dung Fungi, Including Sordaria fimicola.

    Science.gov (United States)

    Newcombe, George; Campbell, Jason; Griffith, David; Baynes, Melissa; Launchbaugh, Karen; Pendleton, Rosemary

    2016-01-01

    Dung fungi, such as Sordaria fimicola, generally reproduce sexually with ascospores discharged from mammalian dung after passage through herbivores. Their life cycle is thought to be obligate to dung, and thus their ascospores in Quaternary sediments have been interpreted as evidence of past mammalian herbivore activity. Reports of dung fungi as endophytes would seem to challenge the view that they are obligate to dung. However, endophyte status is controversial because surface-sterilization protocols could fail to kill dung fungus ascospores stuck to the plant surface. Thus, we first tested the ability of representative isolates of three common genera of dung fungi to affect plant growth and fecundity given that significant effects on plant fitness could not result from ascospores merely stuck to the plant surface. Isolates of S. fimicola, Preussia sp., and Sporormiella sp. reduced growth and fecundity of two of three populations of Bromus tectorum, the host from which they had been isolated. In further work with S. fimicola we showed that inoculations of roots of B. tectorum led to some colonization of aboveground tissues. The same isolate of S. fimicola reproduced sexually on inoculated host plant tissues as well as in dung after passage through sheep, thus demonstrating a facultative rather than an obligate life cycle. Finally, plants inoculated with S. fimicola were not preferred by sheep; preference had been expected if the fungus were obligate to dung. Overall, these findings make us question the assumption that these fungi are obligate to dung.

  2. Treating cattle with antibiotics affects greenhouse gas emissions, and microbiota in dung and dung beetles

    OpenAIRE

    Hammer, Tobin J.; Fierer, Noah; Hardwick, Bess; Simojoki, Asko; Slade, Eleanor; Taponen, Juhani; Viljanen, Heidi; Roslin, Tomas

    2016-01-01

    Antibiotics are routinely used to improve livestock health and growth. However, this practice may have unintended environmental impacts mediated by interactions among the wide range of micro- and macroorganisms found in agroecosystems. For example, antibiotics may alter microbial emissions of greenhouse gases by affecting livestock gut microbiota. Furthermore, antibiotics may affect the microbiota of non-target animals that rely on dung, such as dung beetles, and the ecosystem services they p...

  3. Revisiting the Life Cycle of Dung Fungi, Including Sordaria fimicola.

    Directory of Open Access Journals (Sweden)

    George Newcombe

    Full Text Available Dung fungi, such as Sordaria fimicola, generally reproduce sexually with ascospores discharged from mammalian dung after passage through herbivores. Their life cycle is thought to be obligate to dung, and thus their ascospores in Quaternary sediments have been interpreted as evidence of past mammalian herbivore activity. Reports of dung fungi as endophytes would seem to challenge the view that they are obligate to dung. However, endophyte status is controversial because surface-sterilization protocols could fail to kill dung fungus ascospores stuck to the plant surface. Thus, we first tested the ability of representative isolates of three common genera of dung fungi to affect plant growth and fecundity given that significant effects on plant fitness could not result from ascospores merely stuck to the plant surface. Isolates of S. fimicola, Preussia sp., and Sporormiella sp. reduced growth and fecundity of two of three populations of Bromus tectorum, the host from which they had been isolated. In further work with S. fimicola we showed that inoculations of roots of B. tectorum led to some colonization of aboveground tissues. The same isolate of S. fimicola reproduced sexually on inoculated host plant tissues as well as in dung after passage through sheep, thus demonstrating a facultative rather than an obligate life cycle. Finally, plants inoculated with S. fimicola were not preferred by sheep; preference had been expected if the fungus were obligate to dung. Overall, these findings make us question the assumption that these fungi are obligate to dung.

  4. Activation of human factor V by factor Xa and thrombin

    International Nuclear Information System (INIS)

    Monkovic, D.D.; Tracy, P.B.

    1990-01-01

    The activation of human factor V by factor Xa and thrombin was studied by functional assessment of cofactor activity and sodium dodecyl sulfate-polycarylamide gel electrophoresis followed by either autoradiography of 125 I-labeled factor V activation products or Western blot analyses of unlabeled factor V activation products. Cofactor activity was measured by the ability of the factor V/Va peptides to support the activation of prothrombin. The factor Xa catalyzed cleavage of factor V was observed to be time, phospholipid, and calcium ion dependent, yielding a cofactor with activity equal to that of thrombin-activated factor V (factor Va). The cleavage pattern differed markedly from the one observed in the bovine system. The factor Xa activated factor V subunits expressing cofactor activity were isolated and found to consist of peptides of M r 220,000 and 105,000. Although thrombin cleaved the M r 220,000 peptide to yield peptides previously shown to be products of thrombin activation, cofactor activity did not increase. N-Terminal sequence analysis confirmed that both factor Xa and thrombin cleave factor V at the same bond to generate the M r 220,000 peptide. The factor Xa dependent functional assessment of 125 I-labeled factor V coupled with densitometric analyses of the cleavage products indicated that the cofactor activity of factor Xa activated factor V closely paralleled the appearance of the M r 220,000 peptide. The data indicate that factor Xa is as efficient an enzyme toward factor V as thrombin

  5. Induction of Xa10-like Genes in Rice Cultivar Nipponbare Confers Disease Resistance to Rice Bacterial Blight.

    Science.gov (United States)

    Wang, Jun; Tian, Dongsheng; Gu, Keyu; Yang, Xiaobei; Wang, Lanlan; Zeng, Xuan; Yin, Zhongchao

    2017-06-01

    Bacterial blight of rice, caused by Xanthomonas oryzae pv. oryzae, is one of the most destructive bacterial diseases throughout the major rice-growing regions in the world. The rice disease resistance (R) gene Xa10 confers race-specific disease resistance to X. oryzae pv. oryzae strains that deliver the corresponding transcription activator-like (TAL) effector AvrXa10. Upon bacterial infection, AvrXa10 binds specifically to the effector binding element in the promoter of the R gene and activates its expression. Xa10 encodes an executor R protein that triggers hypersensitive response and activates disease resistance. 'Nipponbare' rice carries two Xa10-like genes in its genome, of which one is the susceptible allele of the Xa23 gene, a Xa10-like TAL effector-dependent executor R gene isolated recently from 'CBB23' rice. However, the function of the two Xa10-like genes in disease resistance to X. oryzae pv. oryzae strains has not been investigated. Here, we designated the two Xa10-like genes as Xa10-Ni and Xa23-Ni and characterized their function for disease resistance to rice bacterial blight. Both Xa10-Ni and Xa23-Ni provided disease resistance to X. oryzae pv. oryzae strains that deliver the matching artificially designed TAL effectors (dTALE). Transgenic rice plants containing Xa10-Ni and Xa23-Ni under the Xa10 promoter provided specific disease resistance to X. oryzae pv. oryzae strains that deliver AvrXa10. Xa10-Ni and Xa23-Ni knock-out mutants abolished dTALE-dependent disease resistance to X. oryzae pv. oryzae. Heterologous expression of Xa10-Ni and Xa23-Ni in Nicotiana benthamiana triggered cell death. The 19-amino-acid residues at the N-terminal regions of XA10 or XA10-Ni are dispensable for their function in inducing cell death in N. benthamiana and the C-terminal regions of XA10, XA10-Ni, and XA23-Ni are interchangeable among each other without affecting their function. Like XA10, both XA10-Ni and XA23-Ni locate to the endoplasmic reticulum (ER) membrane

  6. Origin and Diversification of Dung Beetles in Madagascar

    Directory of Open Access Journals (Sweden)

    Andreia Miraldo

    2011-04-01

    Full Text Available Madagascar has a rich fauna of dung beetles (Scarabaeinae and Aphodiinae withalmost 300 species described to date. Like most other taxa in Madagascar, dung beetles exhibit an exceptionally high level of endemism (96% of the species. Here,we review the current knowledge of the origin and diversification of Malagasy dung beetles. Based on molecular phylogenies, the extant dung beetles originate from eight colonizations, of which four have given rise to extensive radiations. These radiations have occurred in wet forests, while the few extant species in the less successfulradiations occur in open and semi-open habitats. We discuss the likely mechanisms of speciation and the ecological characteristics of the extant communities, emphasizing the role of adaptation along environmental gradients and allopatric speciation in generating the exceptionally high beta diversity in Malagasy dung beetles. Phylogeographic analyses of selected species reveal complex patterns with evidence for genetic introgression between old taxa. The introduction of cattle to Madagascar 1500 years ago created a new abundant resource, onto which a few species haveshifted and thereby been able to greatly expand their geographical ranges.

  7. Comparative study of biogas from cattle dung and mixture of cattle ...

    African Journals Online (AJOL)

    This paper compares the rate of biogas production of cattle dung and a mixture of plantain peels with cattle dung. 18kg of cattle dung mixed with 36kg of water were charged to a digester while 9kg each of cattle dung and plantain peels mixed together with 36kg of water were charged to a separate digester. Both digesters ...

  8. XA23 is an executor R protein and confers broad-spectrum disease resistance in rice.

    Science.gov (United States)

    Wang, Chunlian; Zhang, Xiaoping; Fan, Yinglun; Gao, Ying; Zhu, Qinlong; Zheng, Chongke; Qin, Tengfei; Li, Yanqiang; Che, Jinying; Zhang, Mingwei; Yang, Bing; Liu, Yaoguang; Zhao, Kaijun

    2014-11-09

    The majority of plant disease resistance (R) genes encode proteins that share common structural features. However, the transcription activator-like effector (TALE) associated executor type R genes show no considerable sequence homology to any known R genes. We adopted a map-based cloning approach and TALE-based technology to isolate and characterize Xa23, a new executor R gene derived from the wild rice (Oryza rufipogon) that confers an extremely broad spectrum of resistance to bacterial blight caused by Xanthomonas oryzae pv. oryzae (Xoo). Xa23 encodes a 113-amino acid protein that shares 50% identity to the known executor R protein XA10. The predicted transmembrane helices in XA23 also overlap with those of XA10. Unlike Xa10, however, Xa23 transcription is specifically activated by AvrXa23, a TALE present in all examined Xoo field isolates. Moreover, the susceptible xa23 allele has an identical open reading frame of Xa23, but differs in promoter region by lacking the TALE binding-element (EBE) for AvrXa23. XA23 can trigger strong hypersensitive response in rice, tobacco and tomato. Our results provide the first evidence that plant genomes have an executor R gene family in which members execute their function and spectrum of disease resistance by recognizing the cognate TALEs in pathogen. © The Author 2014. Published by the Molecular Plant Shanghai Editorial Office in association with Oxford University Press on behalf of CSPB and IPPE, SIBS, CAS.

  9. effects of nitrogen enrichment on heavy metals content of cattle dung ...

    African Journals Online (AJOL)

    Admin

    dung/poultry manure supplemented with 25 kg of urea (CDPMU) and (iii) cattle dung (CD) as ... Key words: Nitrogen Enrichment, Heavy Metals, Cattle Dung, Poultry Manure, Compost. .... available phosphorus, exchangeable bases and base.

  10. Bearing selection in ball-rolling dung beetles: is it constant?

    Science.gov (United States)

    Baird, Emily; Byrne, Marcus J; Scholtz, Clarke H; Warrant, Eric J; Dacke, Marie

    2010-11-01

    Ball rolling in dung beetles is thought to have evolved as a means to escape intense inter- and intra-specific competition at the dung pile. Accordingly, dung beetles typically roll along a straight-line path away from the pile, this being the most effective escape strategy for transporting dung to a suitable burial site. In this study, we investigate how individual diurnal dung beetles, Scarabaeus (Kheper) nigroaeneus, select the compass bearing of their straight-line rolls. In particular, we examine whether roll bearings are constant with respect to geographic cues, celestial cues, or other environmental cues (such as wind direction). Our results reveal that the roll bearings taken by individual beetles are not constant with respect to geographic or celestial references. Environmental cues appear to have some influence over bearing selection, although the relationship is not strong. Furthermore, the variance in roll bearing that we observe is not affected by the presence or absence of other beetles. Thus, rather than being constant for individual beetles, bearing selection varies each time a beetle makes a ball and rolls it away from the dung pile. This strategy allows beetles to make an efficient escape from the dung pile while minimizing the chance of encountering competition.

  11. Quantifying Beetle-Mediated Effects on Gas Fluxes from Dung Pats

    Science.gov (United States)

    Penttilä, Atte; Slade, Eleanor M.; Simojoki, Asko; Riutta, Terhi; Minkkinen, Kari; Roslin, Tomas

    2013-01-01

    Agriculture is one of the largest contributors of the anthropogenic greenhouse gases (GHGs) responsible for global warming. Measurements of gas fluxes from dung pats suggest that dung is a source of GHGs, but whether these emissions are modified by arthropods has not been studied. A closed chamber system was used to measure the fluxes of carbon dioxide (CO2), methane (CH4) and nitrous oxide (N2O) from dung pats with and without dung beetles on a grass sward. The presence of dung beetles significantly affected the fluxes of GHGs from dung pats. Most importantly, fresh dung pats emitted higher amounts of CO2 and lower amounts of CH4 per day in the presence than absence of beetles. Emissions of N2O showed a distinct peak three weeks after the start of the experiment – a pattern detected only in the presence of beetles. When summed over the main grazing season (June–July), total emissions of CH4 proved significantly lower, and total emissions of N2O significantly higher in the presence than absence of beetles. While clearly conditional on the experimental conditions, the patterns observed here reveal a potential impact of dung beetles on gas fluxes realized at a small spatial scale, and thereby suggest that arthropods may have an overall effect on gas fluxes from agriculture. Dissecting the exact mechanisms behind these effects, mapping out the range of conditions under which they occur, and quantifying effect sizes under variable environmental conditions emerge as key priorities for further research. PMID:23940758

  12. Theoretical calculation of shakeup intensities using Xa--SW wave functions

    International Nuclear Information System (INIS)

    Tse, J.S.; Loubriel, G.

    1981-01-01

    The ground and 1s core hole state molecular wave functions of CH 4 , NH 3 , H 2 O, and HF obtained from Xa--SW calculations using the touching spheres (TS) and overlapping spheres (OS) approximations are used to calculate the intensity of shakeup satellites observed in their ls core level photoelectron spectra. The sudden approximation was assumed in the calculation. In case of TS Xa--SW wave functions, the one electron overlap integral inside the intersphere was calculated via Green's theorem. For OS Xa--SW wave functions, the integration over the awkwardly shaped intersphere region was circumvented by distributing the intersphere charge into the atomic spheres according to the charge partition scheme suggested by Case and Karplus. Our results show that there are no significant differences between the shakeup energies calculated from the TS and OS approximations. However, shakeup intensities calculated from TS Xa--SW wave functions are more reliable and in better numerical agreement with experiment

  13. On the road of dung: hypothetical dispersal routes of dung beetles in the circum–Sicilian volcanic islands

    Energy Technology Data Exchange (ETDEWEB)

    Tonelli, M.; Agoglitta, R.; Dawson, H.; Zunino, M.

    2016-07-01

    We analysed dung beetle communities on ten volcanic islands located around Sicily (Italy) to identify the most probable dispersal routes in the colonization of these islands. Assuming two scenarios, we analysed the dung beetle communities through the coefficient of dispersal direction DD2. Our results suggest that dispersal fluxes do not strictly follow the ‘stepping stone’ dynamic. Lipari and Vulcano are the likely core source areas for the north–of–Sicily area. In the Sicily Channel, Linosa appears to have been the main target area with three equivalent fluxes from Tunisia, Sicily, and Malta, while the fauna of Pantelleria resulted from their interchange and proximity to Tunisian fauna. In light of the congruence of our results with the known history of human movements and colonization, we propose a likely human contribution to the genesis of the dung beetle fauna of the circum–Sicilian volcanic islands. (Author)

  14. Anatomical organization of the brain of a diurnal and a nocturnal dung beetle.

    Science.gov (United States)

    Immonen, Esa-Ville; Dacke, Marie; Heinze, Stanley; El Jundi, Basil

    2017-06-01

    To avoid the fierce competition for food, South African ball-rolling dung beetles carve a piece of dung off a dung-pile, shape it into a ball and roll it away along a straight line path. For this unidirectional exit from the busy dung pile, at night and day, the beetles use a wide repertoire of celestial compass cues. This robust and relatively easily measurable orientation behavior has made ball-rolling dung beetles an attractive model organism for the study of the neuroethology behind insect orientation and sensory ecology. Although there is already some knowledge emerging concerning how celestial cues are processed in the dung beetle brain, little is known about its general neural layout. Mapping the neuropils of the dung beetle brain is thus a prerequisite to understand the neuronal network that underlies celestial compass orientation. Here, we describe and compare the brains of a day-active and a night-active dung beetle species based on immunostainings against synapsin and serotonin. We also provide 3D reconstructions for all brain areas and many of the fiber bundles in the brain of the day-active dung beetle. Comparison of neuropil structures between the two dung beetle species revealed differences that reflect adaptations to different light conditions. Altogether, our results provide a reference framework for future studies on the neuroethology of insects in general and dung beetles in particular. © 2017 Wiley Periodicals, Inc.

  15. Factor Xa stimulates fibroblast procollagen production, proliferation, and calcium signaling via PAR1 activation

    International Nuclear Information System (INIS)

    Blanc-Brude, Olivier P.; Archer, Fabienne; Leoni, Patricia; Derian, Claudia; Bolsover, Steven; Laurent, Geoffrey J.; Chambers, Rachel C.

    2005-01-01

    Fibroblast proliferation and procollagen production are central features of tissue repair and fibrosis. In addition to its role in blood clotting, the coagulation cascade proteinase thrombin can contribute to tissue repair by stimulating fibroblasts via proteolytic activation of proteinase-activated receptor-1 (PAR 1 ). During hemostasis, the coagulation cascade proteinase factor X is converted into factor Xa. We have previously shown that factor Xa upregulates fibroblast proliferation via production of autocrine PDGF. In this study, we further examined the effects of factor Xa on fibroblast function and aimed to identify its signaling receptor. We showed that factor Xa stimulates procollagen promoter activity and protein production by human and mouse fibroblasts. This effect was independent of PDGF and thrombin production, but dependent on factor Xa proteolytic activity. We also showed that PAR 1 -deficient mouse fibroblasts did not upregulate procollagen production, mobilize cytosolic calcium, or proliferate in response to factor Xa. Desensitization techniques and PAR 1 -specific agonists and inhibitors were used to demonstrate that PAR 1 mediates factor Xa signaling in human fibroblasts. This is the first report that factor Xa stimulates extracellular matrix production. In contrast with endothelial cells and vascular smooth muscle cells, fibroblasts appear to be the only cell type in which the effects of factor Xa are mediated mainly via PAR 1 and not PAR 2 . These findings are critical for our understanding of tissue repair and fibrotic mechanisms, and for the design of novel approaches to inhibit the profibrotic effects of the coagulation cascade without compromising blood hemostasis

  16. Low doses of ivermectin cause sensory and locomotor disorders in dung beetles

    Science.gov (United States)

    Verdú, José R.; Cortez, Vieyle; Ortiz, Antonio J.; González-Rodríguez, Estela; Martinez-Pinna, Juan; Lumaret, Jean-Pierre; Lobo, Jorge M.; Numa, Catherine; Sánchez-Piñero, Francisco

    2015-09-01

    Ivermectin is a veterinary pharmaceutical generally used to control the ecto- and endoparasites of livestock, but its use has resulted in adverse effects on coprophilous insects, causing population decline and biodiversity loss. There is currently no information regarding the direct effects of ivermectin on dung beetle physiology and behaviour. Here, based on electroantennography and spontaneous muscle force tests, we show sub-lethal disorders caused by ivermectin in sensory and locomotor systems of Scarabaeus cicatricosus, a key dung beetle species in Mediterranean ecosystems. Our findings show that ivermectin decreases the olfactory and locomotor capacity of dung beetles, preventing them from performing basic biological activities. These effects are observed at concentrations lower than those usually measured in the dung of treated livestock. Taking into account that ivermectin acts on both glutamate-gated and GABA-gated chloride ion channels of nerve and muscle cells, we predict that ivermectin’s effects at the physiological level could influence many members of the dung pat community. The results indicate that the decline of dung beetle populations could be related to the harmful effects of chemical contamination in the dung.

  17. Recycling of cattle dung, biogas plant-effluent and water hyacinth in vermiculture

    Energy Technology Data Exchange (ETDEWEB)

    Balasubramanian, P.R.; Bai, R.K. [Madurai Kamaraj Univ. (India)

    1995-08-01

    The efficiency of recycling cattle dung, anaerobically digested cattle dung (biogas plant-effluent) and water hyacinth (Eichhornia crassipes) by culture of the earthworm Megascolex sp. was studied. The growth of the earthworms was increased by 156, 148 and 119% in soil supplemented with water hyacinth, cattle dung and biogas plant-effluent, respectively. The growth rate of the earthworms was increased significantly by raw cattle dung and water hyacinth over that by biodigested slurry. (author)

  18. Biogas production enhancement by soya sludge amendment in cattle dung digesters

    Energy Technology Data Exchange (ETDEWEB)

    Satyanarayan, Shanta; Ramakant; Shivayogi [WWT Division, NEERI, Nagpur 400 020 (India)

    2010-09-15

    Biogas energy production from cattle dung is an economically feasible and eco-friendly in nature. But dependence only on cattle dung is a limiting factor. Rich nitrogen containing substrate addition to extra carbohydrate digester like cattle dung could improve the biogas production. Detailed performance of the digesters at different ratios of cattle dung and soya sludge has been discussed in this paper considering the cold countries climate. Soya sludge substrate not only has high nitrogen content of 4.0-4.8% but it also has high percentage of volatile solids content in the range of 97.8-98.8%. Soya sludge addition also improved the manurial value of the digested slurry and also improved the dewater-ability of the sludge. Results indicated an increment of 27.0% gas production at 25.0% amendment of soya sludge in non-homogenized cattle dung (NCD) digester. The amount of gas production increased to 46.4% in case of homogenized cattle dung (HCD) with respect to NCD feed at the same amendment. (author)

  19. Andexanet Alfa for Acute Major Bleeding Associated with Factor Xa Inhibitors

    NARCIS (Netherlands)

    Connolly, Stuart J.; Milling, Truman J.; Eikelboom, John W.; Gibson, C. Michael; Curnutte, John T.; Gold, Alex; Bronson, Michele D.; Lu, Genmin; Conley, Pamela B.; Verhamme, Peter; Schmidt, Jeannot; Middeldorp, Saskia; Cohen, Alexander T.; Beyer-Westendorf, Jan; Albaladejo, Pierre; Lopez-Sendon, Jose; Goodman, Shelly; Leeds, Janet; Wiens, Brian L.; Siegal, Deborah M.; Zotova, Elena; Meeks, Brandi; Nakamya, Juliet; Lim, W. Ting; Crowther, Mark; Connolly, S. C.; Crowther, M.; Eikelboom, J.; Gibson, M.; Milling, T. J.; Albaladejo, P.; Cohen, A.; Lopez-Sendon, J.; Schmidt, J.; Verhamme, P.; Beyer-Westendorf, J.; Wyse, D. G.; Garcia, D.; Prins, M. [=Martin H.; Nakamya, J.; Büller, H. R.; Mahaffey, K.; Alexander, J.; Demchuk, A.; Raskob, G.; Schulman, S.; Meeks, B.; Zotova, E.; Holadyk-Gris, I.; Coppens, M.

    2016-01-01

    Background Andexanet alfa (andexanet) is a recombinant modified human factor Xa decoy protein that has been shown to reverse the inhibition of factor Xa in healthy volunteers. Methods In this multicenter, prospective, open-label, single-group study, we evaluated 67 patients who had acute major

  20. Cow Dung Ingestion and Inhalation Dependence: A Case Report

    Science.gov (United States)

    Khairkar, Praveen; Tiple, Prashant; Bang, Govind

    2009-01-01

    Although abuse of several unusual inhalants had been documented, addiction to cow dung fumes or their ashes has not been reported in medical literature as yet. We are reporting a case of cow dung dependence in ingestion and inhalational form.

  1. Multiplicity of Buc copies in Atlantic salmon contrasts with loss of the germ cell determinant in primates, rodents and axolotl

    OpenAIRE

    Skugor, Adrijana; Tveiten, Helge; Johnsen, Hanne; Andersen, Øivind

    2016-01-01

    Background The primordial germ cells (PGCs) giving rise to gametes are determined by two different mechanisms in vertebrates. While the germ cell fate in mammals and salamanders is induced by zygotic signals, maternally delivered germ cell determinants specify the PGCs in birds, frogs and teleost fish. Assembly of the germ plasm in the oocyte is organized by the single Buc in zebrafish, named Velo1 in Xenopus, and by Oskar in Drosophila. Secondary loss of oskar in several insect lineages coin...

  2. The role of dung beetles in reducing greenhouse gas emissions from cattle farming.

    Science.gov (United States)

    Slade, Eleanor M; Riutta, Terhi; Roslin, Tomas; Tuomisto, Hanna L

    2016-01-05

    Agriculture is one of the largest anthropogenic sources of greenhouse gases (GHGs), with dairy and beef production accounting for nearly two-thirds of emissions. Several recent papers suggest that dung beetles may affect fluxes of GHGs from cattle farming. Here, we put these previous findings into context. Using Finland as an example, we assessed GHG emissions at three scales: the dung pat, pasture ecosystem, and whole lifecycle of milk or beef production. At the first two levels, dung beetles reduced GHG emissions by up to 7% and 12% respectively, mainly through large reductions in methane (CH4) emissions. However, at the lifecycle level, dung beetles accounted for only a 0.05-0.13% reduction of overall GHG emissions. This mismatch derives from the fact that in intensive production systems, only a limited fraction of all cow pats end up on pastures, offering limited scope for dung beetle mitigation of GHG fluxes. In contrast, we suggest that the effects of dung beetles may be accentuated in tropical countries, where more manure is left on pastures, and dung beetles remove and aerate dung faster, and that this is thus a key area for future research. These considerations give a new perspective on previous results, [corrected] and suggest that studies of biotic effects on GHG emissions from dung pats on a global scale are a priority for current research.

  3. The role of dung beetles in reducing greenhouse gas emissions from cattle farming

    Science.gov (United States)

    Slade, Eleanor M.; Riutta, Terhi; Roslin, Tomas; Tuomisto, Hanna L.

    2016-01-01

    Agriculture is one of the largest anthropogenic sources of greenhouse gases (GHGs), with dairy and beef production accounting for nearly two-thirds of emissions. Several recent papers suggest that dung beetles may affect fluxes of GHGs from cattle farming. Here, we put these previous findings into context. Using Finland as an example, we assessed GHG emissions at three scales: the dung pat, pasture ecosystem, and whole lifecycle of milk or beef production. At the first two levels, dung beetles reduced GHG emissions by up to 7% and 12% respectively, mainly through large reductions in methane (CH4) emissions. However, at the lifecycle level, dung beetles accounted for only a 0.05-0.13% reduction of overall GHG emissions. This mismatch derives from the fact that in intensive production systems, only a limited fraction of all cow pats end up on pastures, offering limited scope for dung beetle mitigation of GHG fluxes. In contrast, we suggest that the effects of dung beetles may be accentuated in tropical countries, where more manure is left on pastures, and dung beetles remove and aerate dung faster, and that this is thus a key area for future research. These considerations give a new perspective on previous results perspective, and suggest that studies of biotic effects on GHG emissions from dung pats on a global scale are a priority for current research.

  4. Preliminary biological screening of microbes isolated from cow dung ...

    African Journals Online (AJOL)

    Preliminary biological screening of microbes isolated from cow dung in Kampar. KC Teo, SM Teoh. Abstract. Five distinct morphologically and physiologically isolates were isolated from cow dung at Kampar, Perak, Malaysia and cultured on nutrient agar (NA) plates. Morphological studies including microscopic examination ...

  5. XA readout chip characteristics and CdZnTe spectral measurements

    International Nuclear Information System (INIS)

    Barbier, L.M.; Birsa, F.; Odom, J.

    1999-01-01

    The authors report on the performance of a CdZnTe (CZT) array readout by an XA (X-ray imaging chip produced at the AMS foundry) application specific readout chip (ASIC). The array was designed and fabricated at NASA/Goddard Space Flight Center (GSFC) as a prototype for the Burst Arc-Second Imaging and Spectroscopy gamma-ray instrument. The XA ASIC was obtained from Integrated Detector and Electronics (IDE), in Norway. Performance characteristics and spectral data for 241 Am are presented both at room temperature and at -20 C. The measured noise (σ) was 2.5 keV at 60 keV at room temperature. This paper represents a progress report on work with the XA ASIC and CZT detectors. Work is continuing and in particular, larger arrays are planned for future NASA missions

  6. Co-Digestion of Napier Grass and Its Silage with Cow Dung for Methane Production

    Directory of Open Access Journals (Sweden)

    Wipa Prapinagsorn

    2017-10-01

    Full Text Available Methane production from co-digestion of grass with cow dung and silage with cow dung was conducted by a bioaugmentation technique. For self-fermentation, maximum methane yield (MY of 176.66 and 184.94 mL CH4/g-VSadded were achieved at a ratio of grass to cow dung and silage to cow dung of 1:1, respectively. A higher maximum MY of 179.59 and 208.11 mL CH4/g-VSadded was obtained from co-digestion of grass with cow dung and silage with cow dung bioaugmented with anaerobic sludge at a ratio of 3:1. The solid residue left over after co-digestion at a ratio of 3:1 was pretreated by alkaline plus enzyme before used to produce methane and a maximum MY of 333.63 and 301.38 mL CH4/g-VSadded, respectively, was achieved. Overall power generated from co-digestion of grass with cow dung plus pretreated solid residues and co-digestion of silage with cow dung plus pretreated solid residues were 0.0397 and 0.007 watt, respectively.

  7. The rice XA21 ectodomain fused to the Arabidopsis EFR cytoplasmic domain confers resistance to Xanthomonas oryzae pv. oryzae.

    Science.gov (United States)

    Thomas, Nicholas C; Oksenberg, Nir; Liu, Furong; Caddell, Daniel; Nalyvayko, Alina; Nguyen, Yen; Schwessinger, Benjamin; Ronald, Pamela C

    2018-01-01

    Rice ( Oryza sativa ) plants expressing the XA21 cell-surface receptor kinase are resistant to Xanthomonas oryzae pv. oryzae (Xoo) infection. We previously demonstrated that expressing a chimeric protein containing the ELONGATION FACTOR Tu RECEPTOR (EFR) ectodomain and the XA21 endodomain (EFR:XA21) in rice does not confer robust resistance to Xoo . To test if the XA21 ectodomain is required for Xoo resistance, we produced transgenic rice lines expressing a chimeric protein consisting of the XA21 ectodomain and EFR endodomain (XA21:EFR) and inoculated these lines with Xoo . We also tested if the XA21:EFR rice plants respond to a synthetic sulfated 21 amino acid derivative (RaxX21-sY) of the activator of XA21-mediated immunity, RaxX. We found that five independently transformed XA21:EFR rice lines displayed resistance to Xoo as measured by lesion length analysis, and showed that five lines share characteristic markers of the XA21 defense response (generation of reactive oxygen species and defense response gene expression) after treatment with RaxX21-sY. Our results indicate that expression of the XA21:EFR chimeric receptor in rice confers resistance to Xoo . These results suggest that the endodomain of the EFR and XA21 immune receptors are interchangeable and the XA21 ectodomain is the key determinant conferring robust resistance to Xoo .

  8. Large herbivores affect forest ecosystem functions by altering the structure of dung beetle communities

    Science.gov (United States)

    Iida, Taichi; Soga, Masashi; Koike, Shinsuke

    2018-04-01

    Dramatic increases in populations of large mammalian herbivores have become a major ecological issue, particularly in the northern hemisphere, due to their substantial impacts on both animal and plant communities through processes such as grazing, browsing, and trampling. However, little is known about the consequences of these population explosions on ecosystem functions. Here, we experimentally investigated how the population density of sika deer (Cervus nippon) in temperate deciduous forest areas in Japan affected the decomposition of mammal dung by dung beetles, which is a key process in forest ecosystems. We measured a range of environmental variables (e.g., vegetation cover, soil hardness) and the dung decomposition rate, measured as the amount of deer dung decomposed during one week, and sampled dung beetles at 16 study sites with three different deer densities (high/intermediate/low). We then used structural equation modeling to investigate the relationships between deer density, environmental variables, the biomass of dung beetles (classified into small or large species), and the dung decomposition rate. We found that the biomass of small species increased with increasing deer density, whereas that of large species was not related to deer density. Furthermore, the dung decomposition rate was positively related to the biomass of small species but unrelated to that of large species. Overall, our results showed that an increase in deer density affects the decomposition rate of mammal dung by changing the structure of dung beetle communities (i.e., increasing the number of small dung beetles). Such an understanding of how increases in large herbivore populations affect ecosystem functions is important for accurately evaluating the ecological consequences of their overabundance and ultimately managing their populations appropriately.

  9. Dung beetles (Coleoptera: Scarabaeoidea in three landscapes in Mato Grosso do Sul, Brazil

    Directory of Open Access Journals (Sweden)

    MM. Rodrigues

    Full Text Available Dung beetles (Coleoptera: Scarabaeoidea in three landscapes in Mato Grosso do Sul, Brazil. Dung Beetles are important for biological control of intestinal worms and dipterans of economic importance to cattle, because they feed and breed in dung, killing parasites inside it. They are also very useful as bioindicators of species diversity in agricultural or natural environments. The aims of this paper were to study the species richness, and abundance of dung beetles, helping to answer the question: are there differences in the patterns of dung beetle diversity in three environments (pasture, agriculture and forest in the municipality of Dourados, in the state of Mato Grosso do Sul. A total of 105 samplings were carried out weekly, from November 2005 to November 2007, using three pitfall traps in each environment. The traps were baited with fresh bovine dung, and 44,355 adult dung beetles from 54 species were captured: two from Hyborosidae and 52 from Scarabaeidae. Five species were constant, very abundant and dominant on the pasture, two in the agricultural environment, and two in the environment of Semideciduous forest. Most of the species were characterised as accessories, common and not-dominant. The species with higher abundance was Ataenius platensis Blanchard, 1844. The indexes of Shannon-Wiener diversity were: 2.90 in the pasture, 2.84 in the agricultural environment and 2.66 in the area of native forest. The medium positive presence of dung beetles in the traps in each environment were: 36.88, 42.73 and 20.18 individuals per trap, in the pasture, agricultural environment and in the native forest, respectively. The pasture environment presented a higher diversity index. The species diversity of dung beetles was superior where there was higher abundance and regularity of resource (bovine dung.

  10. Treatment of reindeer with ivermectin - effect on dung insect fauna

    Directory of Open Access Journals (Sweden)

    Arne C. Nilssen

    1999-04-01

    Full Text Available Ivermectin is an antiparasitic drug widely used in reindeer (Rangifer tarandus (L. in Fennoscandia and North America. Most of the ivermectin injected in the animal is excreted unchanged in the faeces. Several reports show that ivermectin in cattle dung disrupts colonisation and survival of beneficial dung breeding insects. The present study investigated the effect of ivermectin on the reindeer dung fauna. Four reindeer calves (males, 6 months of age were injected subcutaneously with standard doses of ivermectin (0.2 mg/kg body weight in early December. The daily produced faeces was collected until day 30 after treatment, and the concentration of ivermectin was determined by high pressure liquid chromatography (HPLC with fluorescence detection. The highest concentration measured (mean 1632 ng/g faeces (dry weight, range 907 to 2261 ng/g among the animals was on day 4 after treatment. The concentration decreased gradually to 28 ng/g (range 6 to 58 ng/g on day 30. Faeces portions from day 4 and from untreated reindeer were placed in the field on 2-4 July and recollected on 13-22 September in order to detect possible differences in decomposition fauna between the samples. The most important coprophilous beetles (Apbodius spp. and flies (Scatbophaga spp. were not detected in this winter dung whether it contained ivermectin or not, probably because of the dry consistency and small size of the pellets. On the other hand, these insects (larvae and imagines were common in summer dung, which had been deposited naturally in the field and later placed together with the ivermectin-containing winter dung for comparison. The summer dung has a more soft and lumpy consistency. Treatment in autumn or early winter implies that the bulk of the ivermectin from the animal will be present in faeces with winter consistency, since this bulk portion is excreted during the first 30 days after treatment. This dry and pelleted faeces is not utilized by the important

  11. Fine mapping of the rice bacterial blight resistance gene Xa-4 and its co-segregation marker

    Institute of Scientific and Technical Information of China (English)

    2000-01-01

    An F2 population developed from the Xa-4 near isogenic lines,IR24 and IRBB4,was used for fine mapping of the rice bacterial blight resistance gene,Xa-4.Some restriction fragment length polymorphism (RFLP) markers on the high-density map constructed by Harushima et al.and the amplified DNA fragments homologous to the conserved domains of plant disease resistance (R) genes were used to construct the genetic linkage map around the gene Xa-4 by scoring susceptible individuals in the population.Xa-4 was mapped between the RFLP marker G181 and the polymerase chain reaction (PCR) marker M55.The R gene homologous fragment marker RS13 was found co-segregating with Xa-4 by analyzing all the plants in the population.This result opened an approach to map-based cloning of this gene,and marker RS13 can be applied to molecular marker-assisted selection of Xa-4 in rice breeding programs.

  12. Preliminary Diversity Of Dung Beetles (Coleoptera: Scarabaeinae Attracting By Human Dung (Calvario, Meta

    Directory of Open Access Journals (Sweden)

    Ruth Mariela Castillo Morales

    2011-12-01

    Full Text Available In the Private Reserve, Refugio del Oso de Anteojos (El Calvario-Meta, the diversity of dung beetles was studied (Coleoptera: Scarabaeinae, grouped around different types of vegetation (Montane Rain Forest, Rainforest Premontane, Lower Montane Rain Forest, by using pitfall traps baited with human dung. During the samplings carried out in the rainy station on 2008, were captured a total of 177 individuals belonging to 9 species. The tribe Canthonini was the most representative with 87.5%, of the described species, followed by Aechini 10.8%, and Onthophagini 1.7%. The dominant species was Canthon lituratus in the three vegetation units: Lower montane rain forest was the richest (9 species and abundance (86 individuals, compared with other environments sampled. By calculating the complementarity index, shows a similar species composition in the three habitats sampled, possibly, related to the floristic composition presented in each one of them.

  13. How useful is determination of anti-factor Xa activity to guide bridging therapy with enoxaparin? A pilot study.

    Science.gov (United States)

    Hammerstingl, Christoph; Omran, Heyder; Tripp, Christian; Poetzsch, Bernd

    2009-02-01

    Low-molecular-weight heparins (LMWH) are commonly used as peri-procedural bridging anticoagulants. The usefulness of measurement of anti-factor Xa activity (anti-Xa) to guide bridging therapy with LMWH is unknown. It was the objective of this study to determine levels of anti-Xa during standard bridging therapy with enoxaparin, and to examine predictors for residual anti-Xa. Consecutive patients receiving enoxaparin at a dosage of 1 mg/kg body weight/12 hours for temporary interruption of phenprocoumon were prospectively enrolled to the study. Blood-samples were obtained 14 hours after LMWH-application immediately pre- procedurally. Procedural details, clinical and demographic data were collected and subsequently analyzed. Seventy patients were included (age 75.2 +/- 10.8 years, Cr Cl 55.7 +/- 21.7ml/min, body mass index [BMI] 27.1 +/- 4.9). LMWH- therapy was for a mean of 4.2 +/- 1.6 days; overall anti-Xa was 0.58 +/- 0.32 U/ml. In 37 (52.8%) of patients anti-Xa was > or U/ml, including 10 (14.3%) patients with anti-Xa > 1U/ml. Linear regression analysis of single variables and logistic multivariable regression analysis failed to prove a correlation between anti-Xa and single or combined factors. No major bleeding, no thromboembolism and four (5.7%) minor haemorrhages were observed. When bridging OAC with therapeutic doses of enoxaparin a high percentage of patients undergo interventions with high residual anti-Xa. The levels of anti-Xa vary largely and are independent of single or combined clinical variables. Since the anti-Xa-related outcome of patients receiving bridging therapy with LMWH is not investigated, no firm recommendation on the usefulness of monitoring of anti-Xa can be given at this stage.

  14. Can the trees save the soil? Biomass fuel consumption and dung use as manure in highland Ethiopia

    Energy Technology Data Exchange (ETDEWEB)

    Mekonnen Getnet, Alemu (Addis Ababa Univ., Addis Ababa (Ethiopia)); Koehlin, Gunnar (Goeteborg Univ., Goeteborg (Sweden))

    2008-07-01

    Dung use as manure is limited partly because of dung consumption as fuel. Plantations are assumed to substitute fuelwood for dung as fuel. This study examines the determinants of: (1) decision to use dung as fuel and as manure and (2) woody biomass and dung consumption as fuel. The results suggest roles of credit, factor and product market imperfections and indicate wood and dung are complements as fuel. Implications include the need to focus on the asset poor and use of appropriate stove/energy types in attempts to address issues of limited manure use and significant dung use as fuel

  15. Identification of anthranilamide derivatives as potential factor Xa inhibitors: drug design, synthesis and biological evaluation.

    Science.gov (United States)

    Xing, Junhao; Yang, Lingyun; Li, Hui; Li, Qing; Zhao, Leilei; Wang, Xinning; Zhang, Yuan; Zhou, Muxing; Zhou, Jinpei; Zhang, Huibin

    2015-05-05

    The coagulation enzyme factor Xa (fXa) plays a crucial role in the blood coagulation cascade. In this study, three-dimensional fragment based drug design (FBDD) combined with structure-based pharmacophore (SBP) model and structural consensus docking were employed to identify novel fXa inhibitors. After a multi-stage virtual screening (VS) workflow, two hit compounds 3780 and 319 having persistent high performance were identified. Then, these two hit compounds and several analogs were synthesized and screened for in-vitro inhibition of fXa. The experimental data showed that most of the designed compounds displayed significant in vitro potency against fXa. Among them, compound 9b displayed the greatest in vitro potency against fXa with the IC50 value of 23 nM and excellent selectivity versus thrombin (IC50 = 40 μM). Moreover, the prolongation of the prothrombin time (PT) was measured for compound 9b to evaluate its in vitro anticoagulant activity. As a result, compound 9b exhibited pronounced anticoagulant activity with the 2 × PT value of 8.7 μM. Copyright © 2015 Elsevier Masson SAS. All rights reserved.

  16. Vermicomposting of Vegetable Wastes Using Cow Dung

    Directory of Open Access Journals (Sweden)

    K. Muthukumaravel

    2008-01-01

    Full Text Available Municipal solid wastes are mainly from domestic and commercial areas containing recyclable toxic substances, compostable organic matter and others. With rapid increase in population, the generation of municipal solid wastes has increased several folds during last few years. Disposal of solid wastes can be done by methods like land filling, incineration, recycling, conversion into biogas, disposal into sea and composting. Vermicomposting is one of the recycling technologies which will improve the quality of the products. The present study aims to find out the possibility of utilization of vegetable wastes for vermiculture. Earthworm Megascolex mauritii cultured in plastic trays (45 x 30 x 30 cm containing soil alone (control (T1, soil + cow dung (T2, soil + vegetable waste (T3 and soil + vegetable waste + cow dung (T4 for 60 days. Nutrient values were determined from the compost and compared with that of the control. From these results, it was found that NPK values were maximum in compost obtained from vegetable waste with the use of cow dung.

  17. Factor Xa generation by computational modeling: an additional discriminator to thrombin generation evaluation.

    Directory of Open Access Journals (Sweden)

    Kathleen E Brummel-Ziedins

    Full Text Available Factor (fXa is a critical enzyme in blood coagulation that is responsible for the initiation and propagation of thrombin generation. Previously we have shown that analysis of computationally generated thrombin profiles is a tool to investigate hemostasis in various populations. In this study, we evaluate the potential of computationally derived time courses of fXa generation as another approach for investigating thrombotic risk. Utilizing the case (n = 473 and control (n = 426 population from the Leiden Thrombophilia Study and each individual's plasma protein factor composition for fII, fV, fVII, fVIII, fIX, fX, antithrombin and tissue factor pathway inhibitor, tissue factor-initiated total active fXa generation was assessed using a mathematical model. FXa generation was evaluated by the area under the curve (AUC, the maximum rate (MaxR and level (MaxL and the time to reach these, TMaxR and TMaxL, respectively. FXa generation was analyzed in the entire populations and in defined subgroups (by sex, age, body mass index, oral contraceptive use. The maximum rates and levels of fXa generation occur over a 10- to 12- fold range in both cases and controls. This variation is larger than that observed with thrombin (3-6 fold in the same population. The greatest risk association was obtained using either MaxR or MaxL of fXa generation; with an ∼2.2 fold increased risk for individuals exceeding the 90(th percentile. This risk was similar to that of thrombin generation(MaxR OR 2.6. Grouping defined by oral contraceptive (OC use in the control population showed the biggest differences in fXa generation; a >60% increase in the MaxR upon OC use. FXa generation can distinguish between a subset of individuals characterized by overlapping thrombin generation profiles. Analysis of fXa generation is a phenotypic characteristic which may prove to be a more sensitive discriminator than thrombin generation among all individuals.

  18. Effect of abdominal waste on biogas production from cow dung ...

    African Journals Online (AJOL)

    Studies have been carried out on the production of biogas from mixture of cow abdominal waste and its dung. The rate of biogas production and cumulative volume of the gas produced was compared with that of pure cow dung under the same experimental conditions. The result shows that the mixture of the cow abdominal ...

  19. Microbial safety control of compost material with cow dung by heat treatment.

    Science.gov (United States)

    Gong, Chun-ming

    2007-01-01

    Various kinds of pathogenic bacteria derived from the intestinal tract of animals exist in compost material like cow dung. In order to sterilize the pathogenic bacteria completely in compost material, the cow dung was put into a heat treatment machine in pilot plan, and harmless condition in short time was examined. The results indicated, pathogenic indicator bacteria such as coliform bacteria, fecal coliform, Escherichia coli and salmonella were all 106 cfu/g dw at the beginning, died rapidly when cow dung temperature rose to above 50 degrees C, and not detected at 54-68 degrees C for 6-24 h heat treatment. Coliform bacteria and salmonella in heated cow dung were not detected by re-growth culture and enrichment culture examination. Moreover, it was hardly influenced on the fermentation ability of composting microbe, organic decomposition bacteria. During heat treatment, the mesophile decreased rapidly and the thermophile stabilized or increased, and the most of composting microbe were bacillus in cow dung by fluorescence microscope, this indicated that bacillus was dominator and composting microbe in composting process.

  20. Comparison of in vitro toxicological effects of biomass smoke from different sources of animal dung.

    Science.gov (United States)

    McCarthy, Claire E; Duffney, Parker F; Wyatt, Jeffrey D; Thatcher, Thomas H; Phipps, Richard P; Sime, Patricia J

    2017-09-01

    Worldwide, over 4 million premature deaths each year are attributed to the burning of biomass fuels for cooking and heating. Epidemiological studies associate household air pollution with lung diseases, including chronic obstructive pulmonary disease, lung cancer, and respiratory infections. Animal dung, a biomass fuel used by economically vulnerable populations, generates more toxic compounds per mass burned than other biomass fuels. The type of animal dung used varies widely depending on local agro-geography. There are currently neither standardized experimental systems for dung biomass smoke research nor studies assessing the health impacts of different types of dung smoke. Here, we used a novel reproducible exposure system to assess outcomes related to inflammation and respiratory infections in human airway cells exposed to six different types of dung biomass smoke. We report that dung biomass smoke, regardless of species, is pro-inflammatory and activates the aryl hydrocarbon receptor and JNK transcription factors; however, dung smoke also suppresses interferon responses after a challenge with a viral mimetic. These effects are consistent with epidemiological data, and suggest a mechanism by which the combustion of animal dung can directly cause lung diseases, promote increased susceptibility to infection, and contribute to the global health problem of household air pollution. Copyright © 2017. Published by Elsevier Ltd.

  1. Succession and Abundance of Staphylinidae in Cattle Dung in Uberlândia, Brazil

    Directory of Open Access Journals (Sweden)

    Jorge Anderson Guimarães

    1998-01-01

    Full Text Available Fimicolous Staphylinidae prey on rearing dipterous in cattle dung, acting as their natural controllers, including pests such as horn fly. To survey the abundance and succession of these coleopterans in cattle dung deposited in pasture, six experiments were conducted from March to October 1995 in Uberlândia, State of Minas Gerais, Brazil. Cattle dung pats were exposed at a pasture for 1 hr, 8 hr, 24 hr, 2, 3, 7 and 10 days and were than taken to laboratory separate from each other, for Staphylinidae extraction. A total of 156 dung pats were exposed at pasture, from which 6225 Staphylinidae were recovered. Representing at least 30 species. Staphylinidae sp.1 (29.6%, Philonthus flavolimbatus (22.2%, Heterothops sp.1 (16.6%, Oxytelus sp.2 (7.6%, Aleochara sp.2 (7.6% and Criptobium sp.1 (4.4% were the most abundant, representing 87.8% from the total. The increased frequency of the majority of these species along the dung exposition time at pasture, indicated tha, they would be preying on at all the immature stages of the dipterous, or eggs and first instar larvae of species that lay eggs on the dung after its second exposition day at the pasture

  2. A novel approach in red mud neutralization using cow dung.

    Science.gov (United States)

    Patel, Sucharita; Pal, Bhatu Kumar; Patel, Raj Kishore

    2018-05-01

    In this study, cow dung was identified as a neutralizing agent for red mud (RM). Present research estimated a significant reduction in pH value of red mud (10 g) from 10.28 to 8.15 and reduction in alkalinity of ~148 mg/L from ~488 mg/L by adding 80 g of cow dung in 40 days of anaerobic condition. XRD results exhibit a high intensity of quartz and found new compound, the calcium carbide. The acid neutralizing capacity (ANC) of NRM reduces to ~0.87 from ~1.506 mol H + /kg. Based on the resultant research, present study proposes cow dung as an efficient neutralizing agent for reducing the pH and alkalinity in the red mud.

  3. Assessment of anti-factor Xa activity of heparin in binary parenteral nutrition admixtures for premature neonates.

    Science.gov (United States)

    Foinard, A; Perez, M; Barthélémy, C; Lannoy, D; Flamein, F; Storme, L; Tournoys, A; Décaudin, B; Odou, P

    2015-07-01

    An in vitro study was carried out to determine the anti-Xa activity of heparin in binary parenteral nutrition (BPN) admixtures for premature neonates in our neonatal intensive care unit (NICU) after a 24-hour infusion, as well as to assess drug interaction with a 50% glucose solution. Two types of bags were prepared: (1) BPN admixtures (composition defined in the NICU) including sodium heparin at 77 UI/mL and (2) bags containing only G50% with sodium heparin at 193 UI/mL. The anti-Xa activity of heparin was measured in bags at T0, after the 24-hour infusion and in eluates at the outlet of the infusion line after 24hours, using a validated chromogenic anti-Xa method. Comparisons of the mean concentration observed with the theoretical value for anti-Xa activity were performed with the Student t-test. Mean values of anti-Xa activity do not differ significantly from the values expected for all conditions. We found a slight variation in anti-Xa activity when infused over 24hours for both types of bags, with and without in-line filtration, showing that heparin remains stable during this infusion period in both BPN admixtures and G50%. Copyright © 2015 Elsevier Masson SAS. All rights reserved.

  4. Development of bio-gas using crop wastes and pig dung ...

    African Journals Online (AJOL)

    Effect of crop wastes on the production of pig dung bio-gas was investigated. Beans husks, peels of cassava, plantain and yam were processed with fresh dung of pig. Bacterial and fungal counts in the digesting materials ranged from 1.5 x 1011cfu/ml to 3.5 x 1011cfu/ml and 0.8 x 1011sfu/ml to 1.4 x1011sfu/ml respectively.

  5. Brood ball-mediated transmission of microbiome members in the dung beetle, Onthophagus taurus (Coleoptera: Scarabaeidae.

    Directory of Open Access Journals (Sweden)

    Anne M Estes

    Full Text Available Insects feeding on plant sap, blood, and other nutritionally incomplete diets are typically associated with mutualistic bacteria that supplement missing nutrients. Herbivorous mammal dung contains more than 86% cellulose and lacks amino acids essential for insect development and reproduction. Yet one of the most ecologically necessary and evolutionarily successful groups of beetles, the dung beetles (Scarabaeinae feeds primarily, or exclusively, on dung. These associations suggest that dung beetles may benefit from mutualistic bacteria that provide nutrients missing from dung. The nesting behaviors of the female parent and the feeding behaviors of the larvae suggest that a microbiome could be vertically transmitted from the parental female to her offspring through the brood ball. Using sterile rearing and a combination of molecular and culture-based techniques, we examine transmission of the microbiome in the bull-headed dung beetle, Onthophagus taurus. Beetles were reared on autoclaved dung and the microbiome was characterized across development. A ~1425 bp region of the 16S rRNA identified Pseudomonadaceae, Enterobacteriaceae, and Comamonadaceae as the most common bacterial families across all life stages and populations, including cultured isolates from the 3(rd instar digestive system. Finer level phylotyping analyses based on lepA and gyrB amplicons of cultured isolates placed the isolates closest to Enterobacter cloacae, Providencia stuartii, Pusillimonas sp., Pedobacter heparinus, and Lysinibacillus sphaericus. Scanning electron micrographs of brood balls constructed from sterile dung reveals secretions and microbes only in the chamber the female prepares for the egg. The use of autoclaved dung for rearing, the presence of microbes in the brood ball and offspring, and identical 16S rRNA sequences in both parent and offspring suggests that the O. taurus female parent transmits specific microbiome members to her offspring through the brood

  6. Spectral information as an orientation cue in dung beetles

    OpenAIRE

    el Jundi, Basil; Foster, James J.; Byrne, Marcus J.; Baird, Emily; Dacke, Marie

    2015-01-01

    During the day, a non-uniform distribution of long and short wavelength light generates a colour gradient across the sky. This gradient could be used as a compass cue, particularly by animals such as dung beetles that rely primarily on celestial cues for orientation. Here, we tested if dung beetles can use spectral cues for orientation by presenting them with monochromatic (green and UV) light spots in an indoor arena. Beetles kept their original bearing when presented with a single light cue...

  7. Effect of land use change on ecosystem function of dung beetles: experimental evidence from Wallacea Region in Sulawesi, Indonesia

    Directory of Open Access Journals (Sweden)

    SHAHABUDDIN

    2011-07-01

    Full Text Available Shahabuddin (2011 Effect of land use change on ecosystem function of dung beetles: experimental evidence from Wallacea Region in Sulawesi, Indonesia. Biodiversitas 12: 177-181. The deforestation of tropical forests and their subsequent conversion to human-dominated land-use systems is one of the most significant causes of biodiversity loss. However clear understanding of the links between ecological functions and biodiversity is needed to evaluate and predict the true environmental consequences of human activities. This study provided experimental evidence comparing ecosystem function of dung beetles across a land use gradient ranging from natural tropical forest and agroforestry systems to open cultivated areas in Central Sulawesi. Therefore, standardized dung pats were exposed at each land-use type to assess dung removal and parasite suppression activity by dung beetles. The results showed that ecosystem function of dung beetles especially dung burial activity were remarkably disrupted by land use changes from natural forest to open agricultural area. Dung beetles presence enhanced about 53% of the total dung removed and reduced about 83% and 63% of fly population and species number respectively, indicating a pronounce contribution of dung beetles in our ecosystem.

  8. High-Yield Production of Levulinic Acid from Pretreated Cow Dung in Dilute Acid Aqueous Solution

    Directory of Open Access Journals (Sweden)

    Jialei Su

    2017-02-01

    Full Text Available Agricultural waste cow dung was used as feedstock for the production of a high value–added chemical levulinic acid (LA in dilute acid aqueous solutions. A high LA yield of 338.9 g/kg was obtained from the pretreated cow dung, which was much higher than that obtained from the crude cow dung (135 g/kg, mainly attributed to the breakage of the lignin fraction in the lignocellulose structure of the cow dung by potassium hydroxide (KOH pretreatment, and thus enhanced the accessibility of cow dung to the acid sites in the catalytic reaction. Meanwhile, another value-added chemical formic acid could be obtained with a yield of ca. 160 g/kg in the process, implying a total production of ca. 500 g/kg yield for LA and formic acid from the pretreated cow dung with the proposed process. The developed process was shown to be tolerant to high initial substrate loading with a satisfied LA yield. This work provides a promising strategy for the value-increment utilization of liglocellulosic agricultural residues.

  9. Introduction of a rice blight resistance gene, Xa21, into five Chinese rice varieties through an Agrobacterium-mediated system

    Institute of Scientific and Technical Information of China (English)

    2000-01-01

    A cloned gene, Xa21 was transferred into five widely-used Chinese rice varieties through an Agrobacterium-mediated system, and over 110 independent transgenic lines were obtained. PCR and Southern analysis of transgenic plants revealed the integration of the whole Xa21 gene into the host genomes. The integrated Xa21 gene was stably inherited, and segregated in a 3∶1 ratio in the selfed T1 generation when one copy of the gene was integrated in the transformants. Inoculation tests displayed that transgenic T0 plants and Xa21 PCR-positive T1 plants were highly resistant to bacterial blight disease. The selected Xa21 homozygous resistant transgenic lines with desirable qualities may be propagated as new varieties or utilized in hybrid rice breeding.

  10. Introduction of a rice blight resistance gene, Xa21, into five Chinese rice varieties through an Agrobacterium -mediated system

    Institute of Scientific and Technical Information of China (English)

    翟文学; 李晓兵; 田文忠; 周永力; 潘学彪; 曹守云; 赵显峰; 赵彬; 章琦; 朱立煌

    2000-01-01

    A cloned gene, Xa21 was transferred into five widely-used Chinese rice varieties through an Agrobacterium-mediated system, and over 110 independent transgenic lines were obtained. PCR and Southern analysis of transgenic plants revealed the integration of the whole Xa21 gene into the host genomes. The integrated Xa21 gene was stably inherited, and segregated in a 3 : 1 ratio in the selfed T1 generation when one copy of the gene was integrated in the transfor-mants. Inoculation tests displayed that transgenic T0 plants and Xa21 PCR-positive T1 plants were highly resistant to bacterial blight disease. The selected Xa21 homozygous resistant transgenic lines with desirable qualities may be propagated as new varieties or utilized in hybrid rice breeding.

  11. Dung pat nesting by the solitary bee, Osmia (Acanthosmiodes) integra (Megachilidae: Apiformes).

    Science.gov (United States)

    Solitary bees nest in a diversity of substrates, typically soil, but also wood, stems and twigs. A new and novel substrate is reported here, dried cattle dung. Two species of Osmia bees were found nesting in dung in Wyoming. One species, O. integra, otherwise nests shallowly in soil. Nests were ...

  12. Role of Factor Xa Inhibitors in Cancer-Associated Thrombosis: Any New Data?

    Directory of Open Access Journals (Sweden)

    Ali Zalpour

    2011-01-01

    Full Text Available The association between cancer and venous thromboembolism (VTE has been well documented in the literature. Prevention and treatment of VTE in cancer patients is imperative. Typically, the mainstay regimen for VTE prevention and treatment has been anticoagulation therapy, unless contraindicated. This therapy consists of unfractionated heparin (UFH, low-molecular-weight heparin (LMWH, factor Xa inhibitor, or vitamin K antagonist (VKA. Current guidelines recommend LMWH over VKA for the treatment of VTE in cancer patients. Factor-specific anticoagulants have been proven safe and effective, and recently factor Xa inhibitors have emerged as a treatment alternative to heparins and VKA. Currently, three factor Xa inhibitors have been identified: fondaparinux (the only one approved so far by the US Food and Drug Administration, idraparinux (in clinical trials, and idrabiotaparinux (in clinical trials. This paper will examine the role of these agents, focusing on fondaparinux, for the prevention and treatment of VTE in cancer patients.

  13. effect of combined use of urea and goat dung manure on celosia

    African Journals Online (AJOL)

    Three field experiments were conducted to investigate the separate and combined effects of urea and goat dung manure on leaf nutrient contents, growth and yield of Celosia argentea in southwest Nigeria. Each experiment involved 7 treatments namely: no treatment, 10t/ha goat dung, 125 kg/ha urea, 125 kg/ha urea + ...

  14. Dung beetles eat acorns to increase their ovarian development and thermal tolerance.

    Directory of Open Access Journals (Sweden)

    José R Verdú

    Full Text Available Animals eat different foods in proportions that yield a more favorable balance of nutrients. Despite known examples of these behaviors across different taxa, their ecological and physiological benefits remain unclear. We identified a surprising dietary shift that confers ecophysiological advantages in a dung beetle species. Thorectes lusitanicus, a Mediterranean ecosystem species adapted to eat semi-dry and dry dung (dung-fiber consumers is also actively attracted to oak acorns, consuming and burying them. Acorn consumption appears to confer potential advantages over beetles that do not eat acorns: acorn-fed beetles showed important improvements in the fat body mass, hemolymph composition, and ovary development. During the reproductive period (October-December beetles incorporating acorns into their diets should have greatly improved resistance to low-temperature conditions and improved ovarian development. In addition to enhancing the understanding of the relevance of dietary plasticity to the evolutionary biology of dung beetles, these results open the way to a more general understanding of the ecophysiological implications of differential dietary selection on the ecology and biogeography of these insects.

  15. Co-composting of physic nut (Jatropha curcas) deoiled cake with rice straw and different animal dung.

    Science.gov (United States)

    Das, Manab; Uppal, H S; Singh, Reena; Beri, Shanuja; Mohan, K S; Gupta, Vikas C; Adholeya, Alok

    2011-06-01

    To address the dispensing of this growing volume, a study on utilization of jatropha (Jatropha curcas) deoiled cake through compost production was carried out. The deoiled cake was composted with rice straw, four different animal dung (cow dung, buffalo dung, horse dung and goat dung) and hen droppings in different proportions followed by assessment, and comparison of biochemical characteristics among finished composts. Nutrient content in finished compost was within the desired level whereas metals such as copper, lead and nickel were much below the maximum allowable concentrations. Although a few finished material contained phorbol ester (0.12 mg/g), but it was far below the original level found in the deoiled cake. Such a study indicates that a huge volume of jatropha deoiled cake can be eliminated through composting. Copyright © 2011 Elsevier Ltd. All rights reserved.

  16. Dung Beetles Associated with Agroecosystems of Southern Brazil: Relationship with Soil Properties

    Directory of Open Access Journals (Sweden)

    Patrícia Menegaz de Farias

    Full Text Available ABSTRACT Knowing the biodiversity of dung beetles in agricultural and livestock environments is the basis for understanding the contribution that these organisms make in nutrient cycling and ecosystem functions. The aim of the present study was to investigate the structure of copronecrophagous dung beetle communities inhabiting the main agroecosystems in southern Brazil and correlate the presence of these organisms with soil properties. From December 2012 to April 2013, samples of dung beetles were taken in the municipality of Tubarão, Santa Catarina, Brazil (28° 28’ S; 48° 56’ W in corn, bean, and sugarcane crops, and in cattle pastures. Beetles were captured in 16 sampling sites, four from each agroecosystem, following a standardized methodology: 10 baited pitfall traps (feces and rotting meat at a spacing of 50 m with exposure for 48 h. The beetles were identified, weighed, and measured. Soil analyses were performed in order to correlate data on organic matter, texture, macro and micronutrients, and pH with data on the abundance of beetle species using canonical correspondence analysis. A total of 110 individuals belonging to 10 species of dung beetles was found. Twenty-four individuals from seven species (with total biomass of 2.4 g were found in the corn crop; five individuals from three species (1.8 g were found in the bean crop; 81 individuals from nine species (30.3 g were found in cattle pasture areas; and lastly, there were no dung beetles recorded in the sugarcane crop. In areas of cattle grazing, the tunnelers Dichotomius nisus and Trichillum externepunctatum correlated positively with organic matter content, whereas the roller species Canthon chalybaeus correlated positively with soil texture, preferring sandier soils. In corn crop areas, D. nisus was again correlated with organic matter content. Paracoprid dung beetle species were correlated with organic matter content in the soil, and species belonging to the roller

  17. [Effects of fermented cattle dung on the growth and development of Tenebrio molitor larvae].

    Science.gov (United States)

    Zeng, Xiang-Wei; Wang, Xia; Guo, Li-Yue; Zhan, Li-Jie; Bo, Wen-Jing; Li, Zhan; Wu, Guang-Lei; Jiang, Gao-Ming

    2012-07-01

    In order to make use of and industrialize the animal dung from large cattle farms, this paper explored the feasibility of using Tenebrio molitor to digest and utilize cattle dung. Cattle dung was mixed with the conventional feed (65% wheat bran, 30% corn flour, and 5% bean pulp) of T. molitor in definite proportions, and fermented with effective microorganisms (EM). The fermented products containing 60% and 80% of cattle dung (FD1 and FD2, respectively) were selected to feed T. molitor larvae, and the effects of the fermented products on the growth curve, death rate, pupation rate, and antioxidant system of the larvae were compared. Compared with CK (conventional deed), the FD1 made the developmental duration of the larvae prolonged by 10 days and the larvae's death rate upraised somewhat, but made the single larva's total food intake, average body mass, crude fat content, and ratio of unsaturated to saturated fat acids increased by 49%, 28%, 26%, and 32%, respectively (P molitor larvae had weak adaptability to FD2. Our findings suggested that using FD1 to feed the 3rd instar of T. molitor larvae would have good practical prospects in industrializing cattle dung.

  18. Benzene bioremediation using cow dung microflora in two phase partitioning bioreactor

    Energy Technology Data Exchange (ETDEWEB)

    Singh, Dipty [Environmental Biotechnology Laboratory, Department of Life Sciences, University of Mumbai, Vidyanagari Campus, Santacruz (E), Mumbai-400 098 (India); Fulekar, M.H., E-mail: mhfulekar@yahoo.com [Environmental Biotechnology Laboratory, Department of Life Sciences, University of Mumbai, Vidyanagari Campus, Santacruz (E), Mumbai-400 098 (India)

    2010-03-15

    Bioremediation of benzene has been carried out using cow dung microflora in a bioreactor. The bioremediation of benzene under the influence of cow dung microflora was found to be 100% and 67.5%, at initial concentrations of 100 mg/l and 250 mg/l within 72 h and 168 h respectively; where as at higher concentration (500 mg/l), benzene was found to be inhibitory. Hence the two phase partitioning bioreactor (TPPB) has been designed and developed to carryout biodegradation at higher concentration. In TPPB 5000 mg/l benzene was biodegraded up to 50.17% over a period of 168 h. Further the Pseudomonas putida MHF 7109 was isolated from cow dung microflora as potential benzene degrader and its ability to degrade benzene at various concentrations was evaluated. The data indicates 100%, 81% and 65% degradation at the concentrations of 50 mg/l, 100 mg/l, 250 mg/l within the time period of 24 h, 96 h and 168 h respectively. The GC-MS data also shows the presence of catechol and 2-hydroxymuconic semialdehyde, which confirms the established pathway of benzene biodegradation. The present research proves the potential of cow dung microflora as a source of biomass for benzene biodegradation in TPPB.

  19. Bio-Inspired Design and Kinematic Analysis of Dung Beetle-Like Legs

    DEFF Research Database (Denmark)

    Aditya, Sai Krishna Venkata; Ignasov, Jevgeni; Filonenko, Konstantin

    2017-01-01

    The African dung beetle Scarabaeus galenus can use its front legs to walk and manipulate or form a dung ball. The interesting multifunctional legs have not been fully investigated or even used as inspiration for robot leg design. Thus, in this paper, we present the development of real dung beetle......-like front legs based on biological investigation. As a result, each leg consists of three main segments which were built using 3D printing. The segments were combined with in total four active DOFs in order to mimic locomotion and object manipulation of the beetle. Kinematics analysis of the leg was also...... performed to identify its workspace as well as to design its trajectory. To this end, the study contributes not only novel multifunctional robotic legs but also the methodology of the bio-inspired leg design....

  20. [Research on compatibility of prescriptions including Ginseng Radix et Rhizoma and Trogopterus Dung based on complex network analysis].

    Science.gov (United States)

    Li, Meng-Wen; Fan, Xin-Sheng; Zhang, Ling-Shan; Wang, Cong-Jun

    2017-09-01

    The applications of prescriptions including Ginseng Radix et Rhizoma and Trogopterus Dung in contemporary literatures from 1949 to 2016 are compiled and the data mining techniques containing scale-free complex network method are utilized to explore its practical characteristics, with comparison between modern and ancient ones. The results indicate that malignant neoplasms, coronary heart disease which present Qi deficiency and blood stasis type are the main diseases treated by prescriptions including Ginseng Radix et Rhizoma and Trogopterus Dung according to the reports during 1949 to 2016. The complex network connection shows that Glycyrrhizae Radixet Rhizoma, Angelicae Sinensis Radix, Astragali Radix, Typhae Pollen, Salviae Miltiorrhizae Radix et Rhizoma are the primary drugs related to Ginseng Radix et Rhizoma and Trogopterus Dung. The next are Paeoniae Radix Alba, Atractylodis Macrocephalae Rhizoma, Persicae Semen, Foria, et al. Carthami Flos, Notoginseng Radix et Rhizoma, Cyperi Rhizoma, Bupleuri Radix are the peripheral ones. Also, Ginseng Radix et Rhizoma-Glycyrrhizae Radixet Rhizoma, Trogopterus Dung-Glycyrrhizae Radixet Rhizoma, Ginseng Radix et Rhizoma-Angelicae Sinensis Radix, Trogopterus Dung-Angelicae Sinensis Radix, Ginseng Radix et Rhizoma-Astragali Radix, Trogopterus Dung-Astragali Radix are the main paired drugs. The paired drugs including Ginseng Radix et Rhizoma-Trogopterus Dung-Glycyrrhizae Radixet Rhizoma, Ginseng Radix et Rhizoma-Trogopterus Dung-Angelicae Sinensis Radix, Ginseng Radix et Rhizoma-Trogopterus Dung-Astragali Radix, Ginseng Radix et Rhizoma-Trogopterus Dung-Typhae Pollen have a higher support degree. The main compatible drugs are different in ancient and modern prescriptions including Ginseng Radix et Rhizoma and Trogopterus Dung. Notoginseng Radix et Rhizoma, Typhae Pollen, Salviae Miltiorrhizae Radix et Rhizoma, Astragali Radix are utilized frequently in modern prescriptions while less used in ancient ones. It is also shown

  1. Comparison of chemical attractants against dung beetles and application for rangeland and animal health

    Science.gov (United States)

    Dung beetles (Coleoptera: Scarabaeidae) play a major role in nutrient cycling, soil aeration, and biological control of pests and parasites that breed in manure. Habitat fragmentation, pesticide usage, and conventional agricultural practices threaten dung beetle diversity, and their conservation is ...

  2. Biogas from mesophilic anaerobic digestion of cow dung using gelatin as additive

    Science.gov (United States)

    Salam, Bodius; Rahman, Md Mizanur; Sikder, Md Asif R.; Islam, Majedul

    2017-06-01

    A research work was conducted to investigate the enhanced production ability of biogas from mesophilic anaerobic digestions of cow dung (CD) using gelatin as additive. Five laboratory scale digesters were constructed to digest cow dung, where one set up was used for digestion of cow dung without additive and the other set up were used for digestion with additive. Gelatin additive was added in the slurry of amount 0.29, 0,57, 0.85 and 1.14% (wt.). The digesters were made of glass conical flask of 1-liter capacity each. Cow dung was used 335 gm and water was used 365 gm in each experiment. In the slurry, total solid content was maintained 8% (wt.) for all the observations. The digesters were fed on batch basis. The digesters were operated at ambient temperatures of 26 - 35°C. The total gas yield was obtained about 14.4 L/kg CD for digestion without additive and about 65% more biogas for digestion with 0.29% gelatin additive. The retention time for digestion without additive was 38 days and with additive retention time varied between 24 and 52 days.

  3. 3D/3D registration of coronary CTA and biplane XA reconstructions for improved image guidance

    Energy Technology Data Exchange (ETDEWEB)

    Dibildox, Gerardo, E-mail: g.dibildox@erasmusmc.nl; Baka, Nora; Walsum, Theo van [Biomedical Imaging Group Rotterdam, Departments of Radiology and Medical Informatics, Erasmus Medical Center, 3015 GE Rotterdam (Netherlands); Punt, Mark; Aben, Jean-Paul [Pie Medical Imaging, 6227 AJ Maastricht (Netherlands); Schultz, Carl [Department of Cardiology, Erasmus Medical Center, 3015 GE Rotterdam (Netherlands); Niessen, Wiro [Quantitative Imaging Group, Faculty of Applied Sciences, Delft University of Technology, 2628 CJ Delft, The Netherlands and Biomedical Imaging Group Rotterdam, Departments of Radiology and Medical Informatics, Erasmus Medical Center, 3015 GE Rotterdam (Netherlands)

    2014-09-15

    Purpose: The authors aim to improve image guidance during percutaneous coronary interventions of chronic total occlusions (CTO) by providing information obtained from computed tomography angiography (CTA) to the cardiac interventionist. To this end, the authors investigate a method to register a 3D CTA model to biplane reconstructions. Methods: The authors developed a method for registering preoperative coronary CTA with intraoperative biplane x-ray angiography (XA) images via 3D models of the coronary arteries. The models are extracted from the CTA and biplane XA images, and are temporally aligned based on CTA reconstruction phase and XA ECG signals. Rigid spatial alignment is achieved with a robust probabilistic point set registration approach using Gaussian mixture models (GMMs). This approach is extended by including orientation in the Gaussian mixtures and by weighting bifurcation points. The method is evaluated on retrospectively acquired coronary CTA datasets of 23 CTO patients for which biplane XA images are available. Results: The Gaussian mixture model approach achieved a median registration accuracy of 1.7 mm. The extended GMM approach including orientation was not significantly different (P > 0.1) but did improve robustness with regards to the initialization of the 3D models. Conclusions: The authors demonstrated that the GMM approach can effectively be applied to register CTA to biplane XA images for the purpose of improving image guidance in percutaneous coronary interventions.

  4. The Importance of Maize Management on Dung Beetle Communities in Atlantic Forest Fragments.

    Directory of Open Access Journals (Sweden)

    Renata Calixto Campos

    Full Text Available Dung beetle community structures changes due to the effects of destruction, fragmentation, isolation and decrease in tropical forest area, and therefore are considered ecological indicators. In order to assess the influence of type of maize cultivated and associated maize management on dung beetle communities in Atlantic Forest fragments surrounded by conventional and transgenic maize were evaluated 40 Atlantic Forest fragments of different sizes, 20 surrounded by GM maize and 20 surrounded by conventional maize, in February 2013 and 2014 in Southern Brazil. After applying a sampling protocol in each fragment (10 pitfall traps baited with human feces or carrion exposed for 48 h, a total of 3454 individuals from 44 species were captured: 1142 individuals from 38 species in GM maize surrounded fragments, and 2312 from 42 species in conventional maize surrounded fragments. Differences in dung beetle communities were found between GM and conventional maize communities. As expected for fragmented areas, the covariance analysis showed a greater species richness in larger fragments under both conditions; however species richness was greater in fragments surrounded by conventional maize. Dung beetle structure in the forest fragments was explained by environmental variables, fragment area, spatial distance and also type of maize (transgenic or conventional associated with maize management techniques. In Southern Brazil's scenario, the use of GM maize combined with associated agricultural management may be accelerating the loss of diversity in Atlantic Forest areas, and consequently, important ecosystem services provided by dung beetles may be lost.

  5. The Importance of Maize Management on Dung Beetle Communities in Atlantic Forest Fragments.

    Science.gov (United States)

    Campos, Renata Calixto; Hernández, Malva Isabel Medina

    2015-01-01

    Dung beetle community structures changes due to the effects of destruction, fragmentation, isolation and decrease in tropical forest area, and therefore are considered ecological indicators. In order to assess the influence of type of maize cultivated and associated maize management on dung beetle communities in Atlantic Forest fragments surrounded by conventional and transgenic maize were evaluated 40 Atlantic Forest fragments of different sizes, 20 surrounded by GM maize and 20 surrounded by conventional maize, in February 2013 and 2014 in Southern Brazil. After applying a sampling protocol in each fragment (10 pitfall traps baited with human feces or carrion exposed for 48 h), a total of 3454 individuals from 44 species were captured: 1142 individuals from 38 species in GM maize surrounded fragments, and 2312 from 42 species in conventional maize surrounded fragments. Differences in dung beetle communities were found between GM and conventional maize communities. As expected for fragmented areas, the covariance analysis showed a greater species richness in larger fragments under both conditions; however species richness was greater in fragments surrounded by conventional maize. Dung beetle structure in the forest fragments was explained by environmental variables, fragment area, spatial distance and also type of maize (transgenic or conventional) associated with maize management techniques. In Southern Brazil's scenario, the use of GM maize combined with associated agricultural management may be accelerating the loss of diversity in Atlantic Forest areas, and consequently, important ecosystem services provided by dung beetles may be lost.

  6. Methane gas from cow dung

    Energy Technology Data Exchange (ETDEWEB)

    1974-01-01

    The Khadi and Village Industries Commission offers a gobar gas (methane gas) production scheme. The gas plant, available in sizes of 60 to 3000 cu ft, requires only low maintenance expenditures. The cow dung, which is at present being wasted or burned as domestic fuel, can be used for manufacturing methane for fuel gas. The residue will be a good fertilizer for increasing food production. There are now about 4000 gobar gas plants in India.

  7. Reduced germination success of temperate grassland seeds sown in dung: consequences for post-dispersal seed fate.

    Science.gov (United States)

    Milotić, T; Hoffmann, M

    2016-11-01

    Endozoochory is one of the main drivers shaping temperate grassland communities by maintaining plant populations of its constituents and enabling plants to colonize new habitats. Successful endozoochorous dispersal implies that seeds not only get consumed and survive the digestive tract but are also able to develop into viable seedlings in a dung environment. We experimentally assessed the germination probability and timing of 15 annual and perennial temperate European grassland species in cattle and horse dung and in different climatic conditions (greenhouse and outdoor conditions). Interspecific variation in germinability and germination timing are found, while life strategy had only an effect on germination timing. We found adverse effects of both cattle and horse dung on the germination characteristics of all tested grassland species, but the effects of cattle dung were more pronounced. In comparison with the control treatment, fewer seeds emerged in dung and more time was needed to germinate. Also, germination metrics clearly differed between the artificial greenhouse and outdoor conditions, with generally a lower germinability in outdoor conditions. According to our results, a large cost seems to be associated with endozoochorous dispersal in this stage of the life cycle, as seed dispersal effectiveness strongly depends on the quality of the deposition site with a lowered survival and germination probability when seeds are deposited in dung. © 2016 German Botanical Society and The Royal Botanical Society of the Netherlands.

  8. Laboratory Scale Bioremediation of Petroleum Hydrocarbon – Polluted Mangrove Swamps in the Niger Delta Using Cow Dung

    Directory of Open Access Journals (Sweden)

    Dike, E. N.

    2012-01-01

    Full Text Available Aims: The aim of the study was to carry-out laboratory–scale bioremediation of petroleum hydrocarbon polluted mangrove swamps using cow dung as source of limiting of nutrients.Methodology and Results: In a 70 days study, the cow dung treated polluted soil had its total culturable hydrocarbon utilising bacterial/fungi, heterotrophic bacterial and fungal counts increased progressively from the 28th day to the 70th day. The control set- up showed very slight increment in its microbial growth. Alkaline pH was observed in all the treatments and control during the study period. The conductivity values of cow dung decreased progressively. In the cow dung treatment option, the nitrate concentration decreased from 35.44 mg/kg to 14.28 mg/kg. Phosphate concentration of cow dung option decreased from 25.41 mg/kg to 9.31mg/kg. The control had the nitrate decreased from 8.42 mg/kg to 6.98 mg/kg. Percentage total organic carbon (% TOC in the cow dung option decreased from 4.06% to 0.96%. Control experiment had the % TOC decreased from 3.32% to 2.99%. Studies using Gas chromatographic analyses showed that 0%, 49.88%, and 69.85% of Total petroleum hydrocarbon (TPH were lost at zero hour, 28th day and 70th day respectively in the cow dung option. In addition, in the control experimental set-up, 0%, 7.14% and 13.42% of TPH were lost at zero hour, 28th day and 70th day respectively.Conclusion, significance and impact of study: The use of organic nutrient sources such as cow dung has shown good promises in bioremediation of crude oil impacted Mangrove Swamps in the Niger Delta. The next line of action is to transfer the technology to pilot scale study.

  9. Biogas from mesophilic digestion of cow dung using charcoal and gelatin as additives

    Science.gov (United States)

    Islam, Md Rashedul; Salam, Bodius; Rahman, Md Mizanur; Mamun, Abdullah Al

    2017-06-01

    Biogas, a source of renewable energy is produced from bacteria in the process of biodegradation of organic matter under anaerobic conditions. A research work was performed to find out the production of biogas from cow dung using charcoal and gelatin as additives. Five laboatory scale experimental set-up were constructed using 0, 0.2, 0.4, 0.6 and 0.8% gelatin with cow dung as additive to perform the research work. For all the set-up 0.5% charcoal was also added. All the set-ups were made from 1-liter capacity conical flask. The amount of water and cow dung was used respectively 382 gm. and 318 gm. in every set-up. Total solid content was maintained 8% throughout all set-ups. The digesters were operated at ambient temperature of 26°-32°C. The total gas yield without using gelatin additive was found to be 12 L/kg cow dung. The maximum gas yield was found from 0.2% gelatin additive and 23% more as compared to without gelatin gas production. The retention time varied from 28 to 79 days for the experiments.

  10. Diversity and community structure of dung beetles (Coleoptera: Scarabaeidae across a habitat disturbance gradient in Lore Lindu National Park, Central Sulawesi

    Directory of Open Access Journals (Sweden)

    SHAHABUDDIN

    2010-01-01

    Full Text Available Shahabuddin (2010 Diversity and community structure of dung beetles (Coleoptera: Scarabaeidae across habitat disturbance gradient in Lore Lindu National Park, Central Sulawesi. Biodiversitas 11: 29-33. Dung beetles are important component of most terrestrial ecosystems and used to assess the effects of habitat disturbance and deforestation. This study aimed at comparing dung beetle assemblages among several habitat types ranging from natural tropical forest and agroforestry systems to open cultivated areas at the margin of Lore Lindu National Park (LLNP, Central Sulawesi (one of Indonesia’s biodiversity hotspots. Therefore, 10 pitfall traps baited with cattle dung were exposed at each habitat type (n = 4 replicate sites per habitat type to collect the dung beetles. The results showed that species richness of dung beetles declined significantly from natural forest to open area. However cacao agroforestry systems seemed to be capable of maintaining a high portion of dung beetle species inhabiting at forest sites. The closer relationship between dung beetle assemblages recorded at forest and agroforestry sites reflects the high similarity of some measured habitat parameters (e.g. vegetation structure and microclimate between both habitat types, while species assemblages at open areas differed significantly from both other habitat groups. These results indicated that habitat type has importance effect on determining the species richness and community structure of dung beetles at the margin of LLNP.

  11. Effect of volatile and acid accumulation in dung digestion

    Energy Technology Data Exchange (ETDEWEB)

    Rajagopal, G; Pathak, B N

    1966-01-01

    In continuation of laboratory experiments on the anaerobic digestion of cow dung experiments were carried out to determine the limiting concentrations of volatile acids and to investigate methods of regenerating digestion after failure. Volatile acids were increased by adding acetic acid to digesting dung slurry; digestion failed completely when volatile-acid concentration was 6194 mg per litre, at pH 4.4. Attempts were made to regenerate digestion by adding lime, after dilution with water, but although over a period the volatile-acid content was reduced from 5650 to 3730 mg per litre, and the pH value rose on average from 4.5 to 6.3, gas production remained at a low value until additional digested slurry was introduced, leading to resumption of normal digestion.

  12. A field test of the effect of spiked ivermectin concentrations on the biodiversity of coprophagous dung insects in Switzerland.

    Science.gov (United States)

    Jochmann, Ralf; Lipkow, Erhard; Blanckenhorn, Wolf U

    2016-08-01

    Veterinary medical product residues can cause severe damage in the dung ecosystem. Depending on the manner of application and the time after treatment, the excreted concentration of a given pharmaceutical varies. The popular anthelmintic drug ivermectin can be applied to livestock in several different ways and is fecally excreted over a period of days to months after application. In a field experiment replicated in summer and autumn, the authors mixed 6 ivermectin concentrations plus a null control into fresh cow dung to assess the reaction of the dung insect community. Taxon richness of the insect dung fauna emerging from the dung, but not Hill diversity ((1) D) or the total number of individuals (abundance), decreased as ivermectin concentration increased. Corresponding declines in the number of emerging insects were found for most larger brachyceran flies and hymenopteran parasitoids, but not for most smaller nematoceran flies or beetles (except Hydrophilidae). Parallel pitfall traps recovered all major dung organism groups that emerged from the experimental dung, although at times in vastly different numbers. Ivermectin generally did not change the attractiveness of dung: differences in emergence therefore reflect differences in survival of coprophagous offspring of colonizing insects. Because sample size was limited to 6 replicates, the authors generally recommend more than 10 (seasonal) replicates and also testing higher concentrations than used in the present study as positive controls in future studies. Results accord with parallel experiments in which the substance was applied and passed through the cow's digestive system. In principle, therefore, the authors' experimental design is suitable for such higher-tier field tests of the response of the entire dung community to pharmaceutical residues, at least for ivermectin. Environ Toxicol Chem 2016;35:1947-1952. © 2015 SETAC. © 2015 SETAC.

  13. Dung matters : An experimental study into the effectiveness of using dung from hay-fed livestock to reconstruct local vegetation

    NARCIS (Netherlands)

    Schepers, Mans; Van Haaster, Henk

    2015-01-01

    This paper explores the relationship between standing vegetation and dung from hay-fed cattle and sheep. In an experimental study, hay is retrieved from a known hay field, surrounded by a semi-open landscape of hedgerows, forests and heather fields. The hay is fed to cattle and sheep, after which

  14. Developing an Anti-Xa-Based Anticoagulation Protocol for Patients with Percutaneous Ventricular Assist Devices.

    Science.gov (United States)

    Sieg, Adam; Mardis, B Andrew; Mardis, Caitlin R; Huber, Michelle R; New, James P; Meadows, Holly B; Cook, Jennifer L; Toole, J Matthew; Uber, Walter E

    2015-01-01

    Because of the complexities associated with anticoagulation in temporary percutaneous ventricular assist device (pVAD) recipients, a lack of standardization exists in their management. This retrospective analysis evaluates current anticoagulation practices at a single center with the aim of identifying an optimal anticoagulation strategy and protocol. Patients were divided into two cohorts based on pVAD implanted (CentriMag (Thoratec; Pleasanton, CA) / TandemHeart (CardiacAssist; Pittsburgh, PA) or Impella (Abiomed, Danvers, MA)), with each group individually analyzed for bleeding and thrombotic complications. Patients in the CentriMag/TandemHeart cohort were subdivided based on the anticoagulation monitoring strategy (activated partial thromboplastin time (aPTT) or antifactor Xa unfractionated heparin (anti-Xa) values). In the CentriMag/TandemHeart cohort, there were five patients with anticoagulation titrated based on anti-Xa values; one patient developed a device thrombosis and a major bleed, whereas another patient experienced major bleeding. Eight patients received an Impella pVAD. Seven total major bleeds in three patients and no thrombotic events were detected. Based on distinct differences between the devices, anti-Xa values, and outcomes, two protocols were created to guide anticoagulation adjustments. However, anticoagulation in patients who require pVAD support is complex with constantly evolving anticoagulation goals. The ideal level of anticoagulation should be individually determined using several coagulation laboratory parameters in concert with hemodynamic changes in the patient's clinical status, the device, and the device cannulation.

  15. Effects of ivermectin application on the diversity and function of dung and soil fauna: Regulatory and scientific background information.

    Science.gov (United States)

    Adler, Nicole; Bachmann, Jean; Blanckenhorn, Wolf U; Floate, Kevin D; Jensen, John; Römbke, Jörg

    2016-08-01

    The application of veterinary medical products to livestock can impact soil organisms in manure-amended fields or adversely affect organisms that colonize dung pats of treated animals and potentially retard the degradation of dung on pastures. For this reason, the authorization process for veterinary medicinal products in the European Union includes a requirement for higher-tier tests when adverse effects on dung organisms are observed in single-species toxicity tests. However, no guidance documents for the performance of higher-tier tests are available. Hence, an international research project was undertaken to develop and validate a proposed test method under varying field conditions of climate, soil, and endemic coprophilous fauna at Lethbridge (Canada), Montpellier (France), Zurich (Switzerland), and Wageningen (The Netherlands). The specific objectives were to determine if fecal residues of an anthelmintic with known insecticidal activity (ivermectin) showed similar effects across sites on 1) insects breeding in dung of treated animals, 2) coprophilous organisms in the soil beneath the dung, and 3) rates of dung degradation. By evaluating the effects of parasiticides on communities of dung-breeding insects and soil fauna under field conditions, the test method meets the requirements of a higher-tier test as mandated by the European Union. The present study provides contextual information on authorization requirements for veterinary medicinal products and on the structure and function of dung and soil organism communities. It also provides a summary of the main findings. Subsequent studies on this issue provide detailed information on different aspects of this overall project. Environ Toxicol Chem 2016;35:1914-1923. © 2015 SETAC. © 2015 SETAC.

  16. Habitat differences in dung beetle assemblages in an African savanna-forest ecotone: implications for secondary seed dispersal.

    Science.gov (United States)

    Kunz, Britta K; Krell, Frank-Thorsten

    2011-06-01

    The probability and pattern of secondary seed dispersal by dung beetles (Scarabaeinae) depend on their community structure and composition at the site of primary deposition, which, in turn, seem to be strongly determined by vegetation. Consequently, we expected pronounced differences in secondary seed dispersal between forest and savanna in the northern Ivory Coast, West Africa. We found 99 dung beetle species at experimentally exposed dung piles of the olive baboon (Papio anubis (Lesson, 1827)), an important primary seed disperser in West Africa. Seventy-six species belonged to the roller and tunneler guilds, which are relevant for secondary seed dispersal. Most species showed a clear habitat preference. Contrary to the Neotropics, species number and abundance were much higher in the savanna than in the forest. Rollers and tunnelers each accounted for approximately 50% of the individuals in the savanna, but in the forest rollers made up only 4%. Seeds deposited into the savanna by an omnivorous primary disperser generally have a higher overall probability of being more rapidly dispersed secondarily by dung beetles than seeds in the forest. Also, rollers disperse seeds over larger distances. In contrast to other studies, small rollers were active in dispersal of large seeds, which were seemingly mistaken for dung balls. Our results suggest that rollers can remove seeds from any plant dispersed in primate dung in this ecosystem. © 2011 ISZS, Blackwell Publishing and IOZ/CAS.

  17. Decline of Ecological Functions Performed by Dung Beetles in Areas of Atlantic Forest and Contribution of Rollers and Tunnellers in Organic Matter Removal.

    Science.gov (United States)

    Batilani-Filho, M; Hernandez, M I M

    2017-08-01

    The feeding behavior of the Scarabaeinae subfamily has positive implications on ecosystem functioning. We characterize the necrophagous and coprophagous dung beetle assemblages, and we quantify the removal of swine carrion and domestic dog dung in two areas with different degrees of environmental disturbance in an Atlantic Forest remnant located in Florianopolis, SC, Brazil. The experiment was setup at eight sampling points in each area, by installing one control and two collection and removal assessment arenas for collecting necrophagous dung beetles while simultaneously evaluating the removal of carrion (50 g of rotting pork for 48 h). We used the same sample design with 50 g of domestic dog dung for evaluating the coprophagous dung beetle assemblage and dung removal. Our results indicated that necrophagous dung beetles were more sensitive to environmental disturbance owing to a lower richness and changes in species dominance, which resulted in a lower removal in the areas with greater disturbance and lower environmental quality (39.6% carrion removal) in relation to less disturbed areas (75.1% carrion removal). The dung beetle assemblages were similar in structure and removal rates between areas (80% of dung was removed). In assessing the influence of richness, abundance, and biomass of dung beetles on resource removal both for the whole assemblage and for each separate functional guild, only the abundance and biomass of rollers contributed significantly to dung removal. These results highlight the implications of environmental disturbances on the functions of dung beetles, which respond differently according to the resource they use. © The Authors 2017. Published by Oxford University Press on behalf of Entomological Society of America. All rights reserved. For Permissions, please email: journals.permissions@oup.com.

  18. Topical treatment of calves with synthetic pyrethroids: effects on the non-target dung fly Neomyia cornicina (Diptera: Muscidae)

    DEFF Research Database (Denmark)

    Sommer, C.; Jensen, Karl-Martin Vagn; Jespersen, Jørgen B.

    2001-01-01

    from calves dosed with topical preparations of deltamethrin, flumethrin, cyfluthrin, and - cypermethrin. Larval mortality was significantly increased in dung collected up to at least seven days after treatment with deltamethrin, -cypermethrin and cyfluthrin. Alpha-cypermethrin caused significant......). Fluctuating asymmetry of a wing vein character did not reflect the anticipated levels of exposure. The study strongly indicated that the use of synthetic pyrethroids affected the insect dung fauna and that such use may reduce dung decomposition....

  19. Preliminary biological screening of microbes isolated from cow dung ...

    African Journals Online (AJOL)

    user

    2011-02-28

    Feb 28, 2011 ... Susceptibilities of five isolates to 17 different types of antibiotics were evaluated using the ... All isolates produced protease, lipase and esterase lipase. Further ... Cow dung is excreted by bovine animal species which.

  20. Dung-associated, Potentially Hallucinogenic Mushrooms from Taiwan

    OpenAIRE

    Yen-Wen Wang; Shean-Shong Tzean

    2015-01-01

    To identify potentially hallucinogenic mushrooms, dung-associated mushrooms collected from Qingtiangang, Yangmingshan National Park were subjected to a detailed morphological investigation and phylogentic analysis. The investigation identified four taxa: a recorded species (Panaeolus antillarum); a new combination (Conocybe nitrophila); and two new species (Psilocybe angulospora, Protostropharia ovalispora). Morphological and molecular characteristics of the collected mushrooms were compared ...

  1. Effect of pig dung fertilizer on zooplankton production

    African Journals Online (AJOL)

    SARAH

    2014-12-29

    Dec 29, 2014 ... Key-words: pig dung, fertilization, zooplankton production. ... an already widespread practice in many Asian countries (fukusho, et al., ..... Elsevier Scientific Publishing Company,. New York ... Effect on Water Quality, pond productivity and. Growth of ... McQueen DJ, Johannes MRS, Post JR, Stewart TJ, Lean.

  2. Identification of bacterial blight resistance genes Xa4 in Pakistani ...

    African Journals Online (AJOL)

    SERVER

    2008-03-04

    Mar 4, 2008 ... Bacterial blight (BB) caused by Xanthomonas oryzae pv oryzae (Xoo) is a major biotic constraint in the irrigated rice belts. Genetic resistance is the most effective and economical control for bacterial blight. Molecular survey was conducted to identify the rice germplasm/lines for the presence of Xa4, a.

  3. Diurnal dung beetles use the intensity gradient and the polarization pattern of the sky for orientation.

    Science.gov (United States)

    el Jundi, Basil; Smolka, Jochen; Baird, Emily; Byrne, Marcus J; Dacke, Marie

    2014-07-01

    To escape competition at the dung pile, a ball-rolling dung beetle forms a piece of dung into a ball and rolls it away. To ensure their efficient escape from the dung pile, beetles rely on a 'celestial compass' to move along a straight path. Here, we analyzed the reliability of different skylight cues for this compass and found that dung beetles rely not only on the sun but also on the skylight polarization pattern. Moreover, we show the first evidence of an insect using the celestial light-intensity gradient for orientation. Using a polarizer, we manipulated skylight so that the polarization pattern appeared to turn by 90 deg. The beetles then changed their bearing close to the expected 90 deg. This behavior was abolished if the sun was visible to the beetle, suggesting that polarized light is hierarchically subordinate to the sun. When the sky was depolarized and the sun was invisible, the beetles could still move along straight paths. Therefore, we analyzed the use of the celestial light-intensity gradient for orientation. Artificial rotation of the intensity pattern by 180 deg caused beetles to orient in the opposite direction. This light-intensity cue was also found to be subordinate to the sun and could play a role in disambiguating the polarization signal, especially at low sun elevations. © 2014. Published by The Company of Biologists Ltd.

  4. Appraisal of biogas potential of biogas from animal dung in saeedabad, pakistan

    International Nuclear Information System (INIS)

    Shah, A.A.; Sahito, A.R.

    2017-01-01

    Pakistan is facing energy scarcity. The biogas is one of the renewable substitutes. It does not only overcome the energy scarcity but also harness the energy from animal dung which causes the CO/sub 2/ emissions. The present study was done on the appraisal of potential of biogas from the dung of animals (Buffaloes, Cows, Goats and Sheep) within the villages surrounded by Taluka Saeedabad. The purpose of the study was the energy potential of the biogas and the selection of the most suitable design and size of the biogas plant for the villagers. The present study also includes the domestic biogas plant economics. As per the estimation, total quantity of animal dung generated was about 129 tons/day, which can produce 3859 m/sup 3/ of biogas per day. On the contrary, for cooking villagers require only 2748 m3 of biogas per day. Moreover, the surplus biogas of 1111 m/sup 3/ per day can be used to produce electricity of 6666 kWh per day, which can fulfill the demand of about half of the population of villages under study. People are using firewood, cotton stalks, kerosene oil and LPG (Liquefied Petroleum Gas) for cooking. Converting animal dung into the biogas not only reduces the consumption of the traditional fuels used (Firewood, Cotton Stalks, Kerosene Oil and LPG), but also prevents about 900 thousand tons of CO/sub 2/ emissions into the environment. Additionally, a fixed dome biogas plant of 8-10 m/sup 3/ size was recommended for each of the houses under study. (author)

  5. Appraisal of Biogas Potential of Biogas from Animal Dung in Saeedabad, Pakistan

    Directory of Open Access Journals (Sweden)

    AMJAD ALISHAH

    2017-07-01

    Full Text Available Pakistan is facing energy scarcity. The biogas is one of the renewable substitutes. It does not only overcome the energy scarcity but also harness the energy from animal dung which causes the CO2 emissions. The present study was done on the appraisal of potential of biogas from the dung of animals (Buffaloes, Cows, Goats and Sheep within the villages surrounded by Taluka Saeedabad. The purpose of the study was the energy potential of the biogas and the selection of the most suitable design and size of the biogas plant for the villagers. The present study also includes the domestic biogas plant economics. As per the estimation, total quantity of animal dung generated was about 129 tons/day, which can produce 3859 m3 of biogas per day. On the contrary, for cooking villagers require only 2748 m3 of biogas per day. Moreover, the surplus biogas of 1111 m3 per day can be used to produce electricity of 6666 kWh per day, which can fulfill the demand of about half of the population of villages under study. People are using firewood, cotton stalks, kerosene oil and LPG (Liquefied Petroleum Gas for cooking. Converting animal dung into the biogas not only reduces the consumption of the traditional fuels used (Firewood, Cotton Stalks, Kerosene Oil and LPG, but also prevents about 900 thousand tons of CO2 emissions into the environment. Additionally, a fixed dome biogas plant of 8-10 m3 size was recommended for each of the houses under study.

  6. Spatial variation of dung beetle assemblages associated with forest structure in remnants of southern Brazilian Atlantic Forest

    Directory of Open Access Journals (Sweden)

    Pedro Giovâni da Silva

    2016-01-01

    Full Text Available The Brazilian Atlantic Forest is one of the world's biodiversity hotspots, and is currently highly fragmented and disturbed due to human activities. Variation in environmental conditions in the Atlantic Forest can influence the distribution of species, which may show associations with some environmental features. Dung beetles (Coleoptera: Scarabaeinae are insects that act in nutrient cycling via organic matter decomposition and have been used for monitoring environmental changes. The aim of this study is to identify associations between the spatial distribution of dung beetle species and Atlantic Forest structure. The spatial distribution of some dung beetle species was associated with structural forest features. The number of species among the sampling sites ranged widely, and few species were found in all remnant areas. Principal coordinates analysis indicated that species composition, abundance and biomass showed a spatially structured distribution, and these results were corroborated by permutational multivariate analysis of variance. The indicator value index and redundancy analysis showed an association of several dung beetle species with some explanatory environmental variables related to Atlantic Forest structure. This work demonstrated the existence of a spatially structured distribution of dung beetles, with significant associations between several species and forest structure in Atlantic Forest remnants from Southern Brazil. Keywords: Beta diversity, Species composition, Species diversity, Spatial distribution, Tropical forest

  7. Studies of Cr (VI) uptake by a green resin: dry cow dung

    International Nuclear Information System (INIS)

    Barot, Nisha S.; Bagla, Hemlata

    2009-01-01

    In the present investigation dry cow dung powder has been employed as an indigenous, inexpensive and eco-friendly material for the removal of Cr (VI) from aqueous medium. The effect of various process parameters such as optimum pH, temperature, amount of resin, time of equilibration and concentration of metal ion etc. have been studied. Many naturally available materials are used for the adsorption of heavy metal pollutant, where most of them are modified physically or chemically. Dry cow dung powder has been utilized with simple chemical treatment thus manifesting the principle of Green Chemistry. (author)

  8. A molecular phylogenetic analysis of the Scarabaeinae (dung beetles).

    Science.gov (United States)

    Monaghan, Michael T; Inward, Daegan J G; Hunt, Toby; Vogler, Alfried P

    2007-11-01

    The dung beetles (Scarabaeinae) include ca. 5000 species and exhibit a diverse array of morphologies and behaviors. This variation presumably reflects the adaptation to a diversity of food types and the different strategies used to avoid competition for vertebrate dung, which is the primary breeding environment for most species. The current classification gives great weight to the major behavioral types, separating the ball rollers and the tunnelers, but existing phylogenetic studies have been based on limited taxonomic or biogeographic sampling and have been contradictory. Here, we present a molecular phylogenetic analysis of 214 species of Scarabaeinae, representing all 12 traditionally recognized tribes and six biogeographical regions, using partial gene sequences from one nuclear (28S) and two mitochondrial (cox1, rrnL) genes. Length variation in 28S (588-621 bp) and rrnL (514-523 bp) was subjected to a thorough evaluation of alternative alignments, gap-coding methods, and tree searches using model-based (Bayesian and likelihood), maximum parsimony, and direct optimization analyses. The small-bodied, non-dung-feeding Sarophorus+Coptorhina were basal in all reconstructions. These were closely related to rolling Odontoloma+Dicranocara, suggesting an early acquisition of rolling behavior. Smaller tribes and most genera were monophyletic, while Canthonini and Dichotomiini each consisted of multiple paraphyletic lineages at hierarchical levels equivalent to the smaller tribes. Plasticity of rolling and tunneling was evidenced by a lack of monophyly (S-H test, p > 0.05) and several reversals within clades. The majority of previously unrecognized clades were geographical, including the well-supported Neotropical Phanaeini+Eucraniini, and a large Australian clade of rollers as well as tunneling Coptodactyla and Demarziella. Only three lineages, Gymnopleurini, Copris+Microcopris and Onthophagus, were widespread and therefore appear to be dispersive at a global scale. A

  9. Status of the Dungeness B project

    International Nuclear Information System (INIS)

    Algar, T.H.; Slack, M.R.; Sheppard, M.A.

    1985-01-01

    The commissioning of the two reactors at Dungeness B station, the first year's operation of the first unit and the work carried out in the statutory outage at the end of this period are described. The principal problems encountered and the means of overcoming them are discussed. The behaviour of the boiler penetrations was a major obstacle to output, and necessitated extensive modifications and the introduction of several novel features. These are described in some detail. (author)

  10. Diversity and abundance of dung beetles (Coleoptera: Scaraebidae) at several different ecosystem functions in Peninsular Malaysia

    Science.gov (United States)

    Din, Abdullah Muhaimin Mohammad; Yaakop, Salmah; Hazmi, Izfa Riza

    2015-09-01

    Dung beetles has known for its bioindicator characteristic. Sensitive towards forest disturbance, dung beetles population and diversity will be less in disturbed and modified area. The objective of this study is to evaluate the diversity and distribution of dung beetles in different type of ecosystems in Peninsular Malaysia. Fifteen baited pitfall traps aligned in three transects were used in this study. Samples were collected after 24 h and repeated three time collections and identified afterwards. Two ecosystem types were selected, which are forested and agricultural ecosystem (livestock and plantation). A total of 4249 individuals, 47 species, in 11 genera was successfully collected from all localities. The H' index for Fraser Hill, Langkawi, Bangi Reserve Forest, Selangor (HSB), Sungkai Reserve Forest, Perak (SRF), Chini Lake, Bera Lake, chicken farm, goat farm, Longan plantation, and palm oil plantation were 1.58, 1.74, 2.17, 2.63, 1.80, 1.52, 1.63, 0.46, 0.00 and 1.98 respectively.Forest ecosystem, SRF shows the highest abundance (1486 individuals) and diversity, while for agricultural ecosystem,palm oil plantation shows the highest with 273 individuals and 16 species. Based onDetrended Correspondence Analysis (DCA) shows two groups that separate forest ecosystem with the agricultural ecosystem, with palm oil is the nearest to the forest. Palm oil ecosystem can sustain a dung beetles population due to the area can provide the requirements for the dung beetles to survive, such as food which comes from local domestic cows, shade from sunlight provide by the palm oil trees, and ground cover from small plants and shrubs.Even though modified ecosystem should have lower diversity of dung beetles, but some factors must be measured as well in order to have a better point of view.

  11. Dung-associated, Potentially Hallucinogenic Mushrooms from Taiwan

    Directory of Open Access Journals (Sweden)

    Yen-Wen Wang

    2015-12-01

    Full Text Available To identify potentially hallucinogenic mushrooms, dung-associated mushrooms collected from Qingtiangang, Yangmingshan National Park were subjected to a detailed morphological investigation and phylogentic analysis. The investigation identified four taxa: a recorded species (Panaeolus antillarum; a new combination (Conocybe nitrophila; and two new species (Psilocybe angulospora, Protostropharia ovalispora. Morphological and molecular characteristics of the collected mushrooms were compared with allied fungal taxa.

  12. If Dung Beetles (Scarabaeidae: Scarabaeinae Arose in Association with Dinosaurs, Did They Also Suffer a Mass Co-Extinction at the K-Pg Boundary?

    Directory of Open Access Journals (Sweden)

    Nicole L Gunter

    Full Text Available The evolutionary success of beetles and numerous other terrestrial insects is generally attributed to co-radiation with flowering plants but most studies have focused on herbivorous or pollinating insects. Non-herbivores represent a significant proportion of beetle diversity yet potential factors that influence their diversification have been largely unexamined. In the present study, we examine the factors driving diversification within the Scarabaeidae, a speciose beetle family with a range of both herbivorous and non-herbivorous ecologies. In particular, it has been long debated whether the key event in the evolution of dung beetles (Scarabaeidae: Scarabaeinae was an adaptation to feeding on dinosaur or mammalian dung. Here we present molecular evidence to show that the origin of dung beetles occurred in the middle of the Cretaceous, likely in association with dinosaur dung, but more surprisingly the timing is consistent with the rise of the angiosperms. We hypothesize that the switch in dinosaur diet to incorporate more nutritious and less fibrous angiosperm foliage provided a palatable dung source that ultimately created a new niche for diversification. Given the well-accepted mass extinction of non-avian dinosaurs at the Cretaceous-Paleogene boundary, we examine a potential co-extinction of dung beetles due to the loss of an important evolutionary resource, i.e., dinosaur dung. The biogeography of dung beetles is also examined to explore the previously proposed "out of Africa" hypothesis. Given the inferred age of Scarabaeinae as originating in the Lower Cretaceous, the major radiation of dung feeders prior to the Cenomanian, and the early divergence of both African and Gondwanan lineages, we hypothesise that that faunal exchange between Africa and Gondwanaland occurred during the earliest evolution of the Scarabaeinae. Therefore we propose that both Gondwanan vicariance and dispersal of African lineages is responsible for present day

  13. If Dung Beetles (Scarabaeidae: Scarabaeinae) Arose in Association with Dinosaurs, Did They Also Suffer a Mass Co-Extinction at the K-Pg Boundary?

    Science.gov (United States)

    Gunter, Nicole L; Weir, Tom A; Slipinksi, Adam; Bocak, Ladislav; Cameron, Stephen L

    2016-01-01

    The evolutionary success of beetles and numerous other terrestrial insects is generally attributed to co-radiation with flowering plants but most studies have focused on herbivorous or pollinating insects. Non-herbivores represent a significant proportion of beetle diversity yet potential factors that influence their diversification have been largely unexamined. In the present study, we examine the factors driving diversification within the Scarabaeidae, a speciose beetle family with a range of both herbivorous and non-herbivorous ecologies. In particular, it has been long debated whether the key event in the evolution of dung beetles (Scarabaeidae: Scarabaeinae) was an adaptation to feeding on dinosaur or mammalian dung. Here we present molecular evidence to show that the origin of dung beetles occurred in the middle of the Cretaceous, likely in association with dinosaur dung, but more surprisingly the timing is consistent with the rise of the angiosperms. We hypothesize that the switch in dinosaur diet to incorporate more nutritious and less fibrous angiosperm foliage provided a palatable dung source that ultimately created a new niche for diversification. Given the well-accepted mass extinction of non-avian dinosaurs at the Cretaceous-Paleogene boundary, we examine a potential co-extinction of dung beetles due to the loss of an important evolutionary resource, i.e., dinosaur dung. The biogeography of dung beetles is also examined to explore the previously proposed "out of Africa" hypothesis. Given the inferred age of Scarabaeinae as originating in the Lower Cretaceous, the major radiation of dung feeders prior to the Cenomanian, and the early divergence of both African and Gondwanan lineages, we hypothesise that that faunal exchange between Africa and Gondwanaland occurred during the earliest evolution of the Scarabaeinae. Therefore we propose that both Gondwanan vicariance and dispersal of African lineages is responsible for present day distribution of

  14. Biodigestion of cassava peels blended with pig dung for methane ...

    African Journals Online (AJOL)

    OKOROIGWE

    2013-10-02

    Oct 2, 2013 ... Biogas production from cassava (Manihot esculentus) peels and pig dung under a mesophilic ... is a gap to be filled up by further investigation. Ezekoye ..... Biofertilizer and Chemical Fertilizer Application on Maize Production.

  15. Pyrolysis of attapulgite clay blended with yak dung enhances pasture growth and soil health: Characterization and initial field trials.

    Science.gov (United States)

    Rafiq, Muhammad Khalid; Joseph, Stephen D; Li, Fei; Bai, Yanfu; Shang, Zhanhuan; Rawal, Aditya; Hook, James M; Munroe, Paul R; Donne, Scott; Taherymoosavi, Sara; Mitchell, David R G; Pace, Ben; Mohammed, Mohanad; Horvat, Joseph; Marjo, Christopher E; Wagner, Avital; Wang, Yanlong; Ye, Jun; Long, Rui-Jun

    2017-12-31

    Recent studies have shown that the pyrolysis of biomass combined with clay can result in both lower cost and increase in plant yields. One of the major sources of nutrients for pasture growth, as well as fuel and building materials in Tibet is yak dung. This paper reports on the initial field testing in a pasture setting in Tibet using yak dung, biochar, and attapulgite clay/yak dung biochars produced at ratios of 10/90 and 50/50 clay to dung. We found that the treatment with attapulgite clay/yak dung (50/50) biochar resulted in the highest pasture yields and grass nutrition quality. We also measured the properties and yields of mixtures of clay/yak dung biochar used in the field trials produced at 400°C and 500°C to help determine a possible optimum final pyrolysis temperature and dung/clay ratio. It was observed that increasing clay content increased carbon stability, overall biochar yield, pore size, carboxyl and ketone/aldehyde functional groups, hematite and ferrous/ferric sulphate/thiosulphate concentration, surface area and magnetic moment. Decreasing clay content resulted in higher pH, CEC, N content and an enhanced ability to accept and donate electrons. The resulting properties were a complex function of both processing temperature and the percentage of clay for the biochars processed at both 400°C and 500°C. It is possible that the increase in yield and nutrient uptake in the field trial is related to the higher concentration of C/O functional groups, higher surface area and pore volume and higher content of Fe/O/S nanoparticles of multiple oxidation state in the 50/50 clay/dung. These properties have been found to significantly increase the abundance of beneficial microorganisms and hence improve the nutrient cycling and availability in soil. Further field trials are required to determine the optimum pyrolysis production conditions and application rate on the abundance of beneficial microorganisms, yields and nutrient quality. Copyright © 2017

  16. Anaerobic co-digestion of canola straw and buffalo dung: optimization of methane production in batch experiments

    International Nuclear Information System (INIS)

    Sahito, A.R.; Brohi, K.M.

    2014-01-01

    In several regions of the Pakistan, crop cultivation is leading to the production crop residues and its disposal problems. It has been suggested that the co-digestion of the crop residues with the buffalo dung might be a disposal way for the wasted portion of the crops residue. The objective of present study was to optimize the anaerobic co-digestion of canola straw and the buffalo dung through batch experiments in order to obtain maximum methane production. The optimization was carried out in three stages. In first stage, the best canola straw to buffalo dung ratio was evaluated. In second stage, the best concentration of sodium hydrogen carbonate was assessedas the alkaline pretreatment chemical, whereas in the third stage most suitable particle size of the canola strawwas evaluated. The assessment criteria for the optimization of a co-digestion were cumulative methane production and ABD (Anaerobic Biodegradability). The results yield that anaerobic co-digestibility of the canola straw and the buffalo dung is obviously influenced by all the three factors of optimization. The maximum methane production was obtained as 911 NmL from the canola straw to buffalo dung ratio of 40:60, the alkaline doze of 0.6 gNaHCO/sub 3/ gVS and canola straw particle size of 2mm. However, because of the higher shredding cost to produce 2mm sized canola straw, particle size 4mm could be the best canola straw particle size. (author)

  17. Anaerobic Co-Digestion of Canola Straw and Buffalo Dung: Optimization of Methane Production in Batch Experiments

    Directory of Open Access Journals (Sweden)

    Abdul Razaque Sahito

    2014-01-01

    Full Text Available In several regions of the Pakistan, crop cultivation is leading to the production crop residues and its disposal problems. It has been suggested that the co-digestion of the crop residues with the buffalo dung might be a disposal way for the wasted portion of the crops' residue. The objective of present study was to optimize the anaerobic co-digestion of canola straw and the buffalo dung through batch experiments in order to obtain maximum methane production. The optimization was carried out in three stages. In first stage, the best canola straw to buffalo dung ratio was evaluated. In second stage, the best concentration of sodium hydrogen carbonate was assessedas the alkaline pretreatment chemical, whereas in the third stage most suitable particle size of the canola strawwas evaluated. The assessment criteria for the optimization of a co-digestion were cumulative methane production and ABD (Anaerobic Biodegradability. The results yield that anaerobic co-digestibility of the canola straw and the buffalo dung is obviously influenced by all the three factors of optimization. The maximum methane production was obtained as 911 NmL from the canola straw to buffalo dung ratio of 40:60, the alkaline doze of 0.6 gNaHCO3 / gVS and canola straw particle size of 2mm. However, because of the higher shredding cost to produce 2mm sized canola straw, particle size 4mm could be the best canola straw particle size.

  18. Effects of Weed Control and Cow Dung Manure on Growth ...

    African Journals Online (AJOL)

    ISSN 0794-5698. Effects of Weed Control and Cow Dung Manure on Growth Performance of Quality Protein Maize in ... worldwide on over 159.5 million hectares in the year. 2010. ...... Fertilizer company of Nigeria, NAFCON, Port. Harcourt.

  19. PRODUCTION OF BIOG S FROM COW DUNG, WEEDS ND ...

    African Journals Online (AJOL)

    USER

    2017-05-26

    May 26, 2017 ... Ethiopian Journal of Environmental Studies & Management 10(4): 482 – 491, 2017. ISSN:1998- ... Department of Pure and Industrial Chemistry, Nnamdi Azikiwe University, Awka, ... Biogas production was carried out using cow dung, weeds, orange peelings and corn cob. ... This work is therefore aimed to.

  20. Effects of initiating anaerobic digestion of layer-hen poultry dung at sub-atmospheric pressure

    OpenAIRE

    Ngumah, Chima C.; Ogbulie, Jude N.; Orji, Justina C.; Amadi, Ekperechi S.

    2013-01-01

    This study investigated the effects of initiating anaerobic digestion (AD) of dry layer-hen poultry dung at the sub-atmospheric pressure of -30 cmHg on biodegradation, biogasification, and biomethanation. The setup was performed as a batch process at an average ambient temperature of 29±2 ºC and a retention time of 15 days. Comparisons were made with two other experiments which were both begun at ambient atmospheric pressure; one was inoculated with digestate from a previous layer-hen dung AD...

  1. Study on rapid bio-drying technology of cow dung with CaO2

    Science.gov (United States)

    Chen, Xiaotian; Qu, Guangfei; Liu, Shugen; Xie, Ruosong; He, Yanhua

    2017-05-01

    Effect of CaO2 on cow dung rapid bio-drying technology was researched. A static aerobic composting system was applied to this experiment which combining natural ventilation with Turing in the process of composting. The physical characteristics of cow dung was observed and the compost temperature, moisture content, organic matter, total nitrogen, total phosphorus, potassium content was determined which in order to study the effect of CaO2 on rapid drying of cattle in the compost. In the initial stage of compost, adding CaO2 groups compared with the control group, the temperature rise faster, 4-6 days in advance to the thermophilic phase; at the end of composting, the CaO2 composition and moisture content decreased significantly to below 30%. The addition of CaO2 in fertilizer was shorten the composting time, extend the thermophilic phase, to provide sufficient oxygen meeting the growth needs of aerobic microorganisms. It convinced that the rapid bio-drying of dairy manure has a good effect and provided a new idea for the effective treatment of cow dung.

  2. The veterinary drug ivermectin influences immune response in the yellow dung fly (Scathophaga stercoraria)

    International Nuclear Information System (INIS)

    West, Helen M.; Tracy, Saoirse R.

    2009-01-01

    Phenoloxidase (PO) is a key enzyme involved in the immune response of insects. We show that egg-to-adult exposure to residues of 0.001, but not 0.0005 mg kg -1 ivermectin elevated PO activity in yellow dung flies (Scathophaga stercoraria) developing in cattle dung. Fly fat content was unaffected by the treatments. Therefore, the response of PO was a direct effect of ivermectin and not an indirect one caused by an alteration in body 'condition'. This supports the non-intuitive conclusion that flies surviving exposure to faecal residues may have enhanced immune function. To our knowledge, this is the first study to assess the effects on PO activity of insecticidal residues in livestock dung. The non-target effects of such residues are of wide interest, given the global use of veterinary products. - Phenoloxidase activity in Scathophaga stercoraria is enhanced by ivermectin and that effect is transferred to the adult fly from the larval stage

  3. How Does Dung Beetle (Coleoptera: Scarabaeidae) Diversity Vary Along a Rainy Season in a Tropical Dry Forest?

    Science.gov (United States)

    Novais, Samuel M A; Evangelista, Lucas A; Reis-Júnior, Ronaldo; Neves, Frederico S

    2016-01-01

    Dung beetle community dynamics are determined by regional rainfall patterns. However, little is known about the temporal dynamics of these communities in tropical dry forests (TDFs). This study was designed to test the following predictions: 1) Peak diversity of dung beetle species occurs early in the wet season, with a decrease in diversity (α and β) and abundance throughout the season; 2) Nestedness is the primary process determining β-diversity, with species sampled in the middle and the end of the wet season representing subsets of the early wet season community. Dung beetles were collected in a TDF in the northern Minas Gerais state, Brazil over three sampling events (December 2009, February and April 2010). We sampled 2,018 dung beetles belonging to 39 species and distributed among 15 genera. Scarabaeinae α-diversity and abundance were highest in December and equivalent between February and April, while β-diversity among plots increased along the wet season. The importance of nestedness and species turnover varies between pairs of sample periods as the main process of temporal β-diversity. Most species collected in the middle and end of the wet season were found in greater abundance in early wet season. Thus, the dung beetle community becomes more homogeneous at the beginning of the wet season, and as the season advances, higher resource scarcity limits population size, which likely results in a smaller foraging range, increasing β-diversity. Our results demonstrate high synchronism between the dung beetle life cycle and seasonality of environmental conditions throughout the wet season in a TDF, where the onset of rains determines adult emergence for most species. © The Authors 2016. Published by Oxford University Press on behalf of Entomological Society of America.

  4. Laboratory Assessment of Potential Impacts to Dungeness Crabs from Disposal of Dredged Material from the Columbia River

    Energy Technology Data Exchange (ETDEWEB)

    Vavrinec, John; Pearson, Walter H.; Kohn, Nancy P.; Skalski, J. R.; Lee, Cheegwan; Hall, Kathleen D.; Romano, Brett A.; Miller, Martin C.; Khangaonkar, Tarang P.

    2007-05-07

    Dredging of the Columbia River navigation channel has raised concerns about dredging-related impacts on Dungeness crabs (Cancer magister) in the estuary, mouth of the estuary, and nearshore ocean areas adjacent to the Columbia River. The Portland District, U.S. Army Corps of Engineers engaged the Marine Sciences Laboratory (MSL) of the U.S. Department of Energy’s Pacific Northwest National Laboratory to review the state of knowledge and conduct studies concerning impacts on Dungeness crabs resulting from disposal during the Columbia River Channel Improvement Project and annual maintenance dredging in the mouth of the Columbia River. The present study concerns potential effects on Dungeness crabs from dredged material disposal specific to the mouth of the Columbia River.

  5. Dungeness Power Station off-site emergency plan

    International Nuclear Information System (INIS)

    1993-01-01

    This off-site Emergency Plan in the event of an accidental release of radioactivity at the Dungeness Nuclear power station sets out the necessary management and coordination processes between Nuclear Electric, operators of the site, the emergency services and relevant local authorities. The objectives promoting the aim are identified and the activities which will be undertaken to protect the public and the environment in the event of an emergency are outlined. (UK)

  6. Evolutionary constraints in hind wing shape in Chinese dung beetles (Coleoptera: Scarabaeinae.

    Directory of Open Access Journals (Sweden)

    Ming Bai

    Full Text Available This study examines the evolution hindwing shape in Chinese dung beetle species using morphometric and phylogenetic analyses. Previous studies have analyzed the evolution of wing shape within a single or very few species, or by comparing only a few wing traits. No study has analyzed wing shape evolution of a large number of species, or quantitatively compared morphological variation of wings with proposed phylogenetic relationships. This study examines the morphological variation of hindwings based on 19 landmarks, 119 morphological characters, and 81 beetle species. Only one most parsimonious tree (MPT was found based on 119 wing and body characters. To better understand the possible role of the hindwing in the evolution of Scarabaeinae, additional phylogenetic analyses were proposed based on the only body features (106 characters, wing characters excluded. Two MPT were found based on 106 body characters, and five nodes were collapsed in a strict consensus. There was a strong correlation between the morphometric tree and all phylogenetic trees (r>0.5. Reconstructions of the ancestral wing forms suggest that Scarabaeinae hindwing morphology has not changed substantially over time, but the morphological changes that do occur are focused at the base of the wing. These results suggest that flight has been important since the origin of Scarabaeinae, and that variation in hindwing morphology has been limited by functional constraints. Comparison of metric disparity values and relative evolutionary sequences among Scarabaeinae tribes suggest that the primitive dung beetles had relatively diverse hindwing morphologies, while advanced dung beetles have relatively similar wing morphologies. The strong correlation between the morphometric tree and phylogenetic trees suggest that hindwing features reflect the evolution of whole body morphology and that wing characters are suitable for the phylogenetic analyses. By integrating morphometric and cladistic

  7. [Effects of different soil and water loss control measures on the dung beetle assemblages in Huangfuchuan watershed, Inner Mongolia of North China].

    Science.gov (United States)

    Liu, Wei; Wang, Run-Run; Liu, Xin-Min

    2013-03-01

    By using pitfall trap method, and taking the croplands and natural grasslands under different soil and water loss control measures as sampling plots, an investigation was conducted on the dung beetle assemblages in the Huangfuchuan watershed of Inner Mongolia from September 2007 to September 2008, aimed to understand the effects of different soil and water loss control measures on the dung beetle assemblages in the watershed. A total of 6169 dung beetles were captured, belonging to 15 species, 5 genus, and 2 families. The dominant species were Aphodius rectus and Onthophagus gibbulus, accounting for 66. 54% and 13. 26% of the total captured beetles, respectively. A lack of the species suitable for living in woodland habitats was the basic feature of the dung beetle assemblages. As compared with the control, all test soil and water loss control measures did not cause an obvious increase of species richness, biomass, and abundance of the dung beetle assemblages. The biomass and species richness of the assemblages as well as the abundance of the functional groups II and III had a significant negative correlation with the average tree (grass) height. Under the effects of long-term agricultural cultivation and the lack of large herbivores, the species richness and abundance of the functional group I (larger paracoprids and telocoprids) were lower than those of the functional groups II (relatively smaller paracoprids) and II (endocoprids), the main components of the dung beetle assemblages in the watershed. The faeces of the residents and livestock in the study region provided abundant foods for the dung beetle assemblages, inducing the relatively high abundance and spices richness of the assemblages occurred in the croplands nearby the villages. Our results suggested that natural grasslands were the suitable habitats for the dung beetles in Huangfuchuan watershed. At regional scale, to popularize the successful experiences of comprehensive soil and water loss control

  8. Acorn consumption improves the immune response of the dung beetle Thorectes lusitanicus.

    Directory of Open Access Journals (Sweden)

    José R Verdú

    Full Text Available Thorectes lusitanicus, a typically coprophagous species is also actively attracted to oak acorns, consuming, burying them, and conferring ecophysiological and reproductive advantages to both the beetle and the tree. In this study, we explored the possible relation between diet shift and the health status of T. lusitanicus using a generalist entomopathogenic fungus (Metarhizium anisopliae as a natural pathogen. To measure the health condition and immune response of beetles, we analysed the protein content in the haemolymph, prophenoloxidase (proPO content, phenoloxidase (PO activity and mortality of beetles with diets based on either acorns or cow dung. Protein content, proPO levels and PO levels in the haemolymph of T. lusitanicus were found to be dependent on the type of diet. Furthermore, the beetles fed with acorns developed a more effective proPO-PO system than the beetles fed with cow dung. Furthermore, a significant decrease in mortality was observed when infected individuals were submitted to an acorn-based diet. In addition to enhancing an understanding of the relevance of dietary change to the evolutionary biology of dung beetles, these results provide a more general understanding of the ecophysiological implications of differential dietary selection in the context of fitness.

  9. Priming of soil carbon decomposition in two Inner Mongolia grassland soils following sheep dung addition: a study using ¹³C natural abundance approach.

    Science.gov (United States)

    Ma, Xiuzhi; Ambus, Per; Wang, Shiping; Wang, Yanfen; Wang, Chengjie

    2013-01-01

    To investigate the effect of sheep dung on soil carbon (C) sequestration, a 152 days incubation experiment was conducted with soils from two different Inner Mongolian grasslands, i.e. a Leymus chinensis dominated grassland representing the climax community (2.1% organic matter content) and a heavily degraded Artemisia frigida dominated community (1.3% organic matter content). Dung was collected from sheep either fed on L. chinensis (C3 plant with δ¹³C = -26.8‰; dung δ¹³C = -26.2‰) or Cleistogenes squarrosa (C₄ plant with δ¹³C = -14.6‰; dung δ¹³C = -15.7‰). Fresh C₃ and C₄ sheep dung was mixed with the two grassland soils and incubated under controlled conditions for analysis of ¹³C-CO₂ emissions. Soil samples were taken at days 17, 43, 86, 127 and 152 after sheep dung addition to detect the δ¹³C signal in soil and dung components. Analysis revealed that 16.9% and 16.6% of the sheep dung C had decomposed, of which 3.5% and 2.8% was sequestrated in the soils of L. chinensis and A. frigida grasslands, respectively, while the remaining decomposed sheep dung was emitted as CO₂. The cumulative amounts of C respired from dung treated soils during 152 days were 7-8 times higher than in the un-amended controls. In both grassland soils, ca. 60% of the evolved CO₂ originated from the decomposing sheep dung and 40% from the native soil C. Priming effects of soil C decomposition were observed in both soils, i.e. 1.4 g and 1.6 g additional soil C kg⁻¹ dry soil had been emitted as CO₂ for the L. chinensis and A. frigida soils, respectively. Hence, the net C losses from L. chinensis and A. frigida soils were 0.6 g and 0.9 g C kg⁻¹ soil, which was 2.6% and 7.0% of the total C in L. chinensis and A. frigida grasslands soils, respectively. Our results suggest that grazing of degraded Inner Mongolian pastures may cause a net soil C loss due to the positive priming effect, thereby accelerating soil deterioration.

  10. Priming of soil carbon decomposition in two inner Mongolia grassland soils following sheep dung addition: A study using13C natural abundance approach

    DEFF Research Database (Denmark)

    Ma, Xiuzhi; Ambus, Per; Wang, Shiping

    2013-01-01

    To investigate the effect of sheep dung on soil carbon (C) sequestration, a 152 days incubation experiment was conducted with soils from two different Inner Mongolian grasslands, i.e. a Leymus chinensis dominated grassland representing the climax community (2.1% organic matter content) and a heav......To investigate the effect of sheep dung on soil carbon (C) sequestration, a 152 days incubation experiment was conducted with soils from two different Inner Mongolian grasslands, i.e. a Leymus chinensis dominated grassland representing the climax community (2.1% organic matter content......) and a heavily degraded Artemisia frigida dominated community (1.3% organic matter content). Dung was collected from sheep either fed on L. chinensis (C3 plant with δ13C = -26.8‰; dung δ13C = -26.2‰) or Cleistogenes squarrosa (C4 plant with δ13C = -14.6‰; dung δ13C = -15.7‰). Fresh C3 and C4 sheep dung was mixed......-amended controls. In both grassland soils, ca. 60% of the evolved CO2 originated from the decomposing sheep dung and 40% from the native soil C. Priming effects of soil C decomposition were observed in both soils, i.e. 1.4 g and 1.6 g additional soil C kg-1 dry soil had been emitted as CO2 for the L. chinensis...

  11. Comparative Transcriptome Profiling of Rice Near-Isogenic Line Carrying Xa23 under Infection of Xanthomonas oryzae pv. oryzae.

    Science.gov (United States)

    Tariq, Rezwan; Wang, Chunlian; Qin, Tengfei; Xu, Feifei; Tang, Yongchao; Gao, Ying; Ji, Zhiyuan; Zhao, Kaijun

    2018-03-02

    Bacterial blight, caused by Xanthomonas oryzae pv. oryzae ( Xoo ), is an overwhelming disease in rice-growing regions worldwide. Our previous studies revealed that the executor R gene Xa23 confers broad-spectrum disease resistance to all naturally occurring biotypes of Xoo . In this study, comparative transcriptomic profiling of two near-isogenic lines (NILs), CBB23 (harboring Xa23 ) and JG30 (without Xa23 ), before and after infection of the Xoo strain, PXO99 A , was done by RNA sequencing, to identify genes associated with the resistance. After high throughput sequencing, 1645 differentially expressed genes (DEGs) were identified between CBB23 and JG30 at different time points. Gene Ontlogy (GO) analysis categorized the DEGs into biological process, molecular function, and cellular component. KEGG analysis categorized the DEGs into different pathways, and phenylpropanoid biosynthesis was the most prominent pathway, followed by biosynthesis of plant hormones, flavonoid biosynthesis, and glycolysis/gluconeogenesis. Further analysis led to the identification of differentially expressed transcription factors (TFs) and different kinase responsive genes in CBB23, than that in JG30. Besides TFs and kinase responsive genes, DEGs related to ethylene, jasmonic acid, and secondary metabolites were also identified in both genotypes after PXO99 A infection. The data of DEGs are a precious resource for further clarifying the network of Xa23 -mediated resistance.

  12. Dung-inhabiting fungi: a potential reservoir of novel secondary metabolites for the control of plant pathogens.

    Science.gov (United States)

    Sarrocco, Sabrina

    2016-04-01

    Coprophilous fungi are a large group of saprotrophic fungi mostly found in herbivore dung. The number of these fungi undergoing investigation is continually increasing, and new species and genera continue to be described. Dung-inhabiting fungi play an important ecological role in decomposing and recycling nutrients from animal dung. They produce a large array of bioactive secondary metabolites and have a potent enzymatic arsenal able to utilise even complex molecules. Bioactive secondary metabolites are actively involved in interaction with and defence against other organisms whose growth can be inhibited, resulting in an enhanced ecological fitness of producer strains. Currently, these antibiotics and bioactive secondary metabolites are of interest in medicine in particular, while very little information is available concerning their potential use in agriculture. This review introduces the ecology of dung-inhabiting fungi, with particular emphasis on the production of antibiotic compounds as a means to compete with other microorganisms. Owing to the fast pace of technological progress, new approaches to predicting the biosynthesis of bioactive metabolites are proposed. Coprophilous fungi should be considered as elite candidate organisms for the discovery of novel antifungal compounds, above all in view of their exploitation for crop protection. © 2015 Society of Chemical Industry.

  13. Cow-dung gas plants

    Energy Technology Data Exchange (ETDEWEB)

    Acharya, C N

    1953-12-01

    A description of experimental work in India and a variety of digesters is given. A small plant at the Indian Agricultural Research Institute, New Delhi, was built in 1941 and has been operating on 4.5 kg of manure/day for 12 years. A plant capable of handling 1800--2300 kg of cow dung per day was built by Prof. V. N. Joshi on the sugarcane estate of Walchandnagar Industries. Shri Chandra Das Gupta experimented with bamboo thatch cylinders sunk into the ground to form tanks, and with bamboo thatch plastered with earth and cement to form gasholders. The West Bengal Government Farm at Harenghatta houses a digestion plant consisting of a series of crude-oil drums through which the slurry passes, gas being collected from all drums.

  14. A four-country ring test of nontarget effects of ivermectin residues on the function of coprophilous communities of arthropods in breaking down livestock dung.

    Science.gov (United States)

    Tixier, Thomas; Blanckenhorn, Wolf U; Lahr, Joost; Floate, Kevin; Scheffczyk, Adam; Düring, Rolf-Alexander; Wohde, Manuel; Römbke, Jörg; Lumaret, Jean-Pierre

    2016-08-01

    By degrading the dung of livestock that graze on pastures, coprophilous arthropods accelerate the cycling of nutrients to maintain pasture quality. Many veterinary medicinal products, such as ivermectin, are excreted unchanged in the dung of treated livestock. These residues can be insecticidal and may reduce the function (i.e., dung-degradation) of the coprophilous community. In the present study, we used a standard method to monitor the degradation of dung from cattle treated with ivermectin. The present study was performed during a 1-yr period on pastures in Canada, France, The Netherlands, and Switzerland. Large effects of residue were detected on the coprophilous community, but degradation of dung was not significantly hampered. The results emphasize that failure to detect an effect of veterinary medicinal product residues on dung-degradation does not mean that the residues do not affect the coprophilous community. Rather, insect activity is only one of many factors that affect degradation, and these other factors may mask the nontarget effect of residues. Environ Toxicol Chem 2016;35:1953-1958. © 2015 SETAC. © 2015 SETAC.

  15. Zygomycetes from herbivore dung in the ecological reserve of Dois Irmãos, Northeast Brazil

    Directory of Open Access Journals (Sweden)

    André Luiz Cabral Monteiro de Azevedo Santiago

    2011-03-01

    Full Text Available Thirty-eight taxa of Zygomycetes distributed in 15 genera were recorded from tapir (Tapirus terrestris, camel (Camelus bactrianus, horse (Equus caballus, deer (Cervus elaphus, agouti (Dasyprocta aguti, donkey (Equus asinus, llama (Llama glama and waterbuck (Kobus ellipsiprymnus dung collected at the Reserva Ecológica de Dois Irmãos located in Recife, State of Pernambuco, Northeast Brazil. The samples were collected on a monthly basis from June 2005 to May 2006, taken to the laboratory and incubated in moist chambers. Higher number of taxa was observed in the excrements of tapir, followed by deer and donkey. The highest number of species was detected for Mucor, followed by Pilobolus. Statistical analyses showed significant differences in richness of Zygomycetes taxa between the herbivore dung types. Differences of species composition, however, were weak. Seasonality influenced the Zygomycetes species composition but not its richness. Variations in taxa composition between ruminants and non-ruminants dung were non significant.

  16. Zygomycetes From Herbivore Dung in the Ecological Reserve of Dois IrmÃOs, Northeast Brazil

    Science.gov (United States)

    de Azevedo Santiago, André Luiz Cabral Monteiro; Botelho Trufem, Sandra Farto; Malosso, Elaine; dos Santos, Paulo Jorge Parreira; de Queiroz Cavalcanti, Maria Auxiliadora

    2011-01-01

    Thirty-eight taxa of Zygomycetes distributed in 15 genera were recorded from tapir (Tapirus terrestris), camel (Camelus bactrianus), horse (Equus caballus), deer (Cervus elaphus), agouti (Dasyprocta aguti), donkey (Equus asinus), llama (Llama glama) and waterbuck (Kobus ellipsiprymnus) dung collected at the Reserva Ecológica de Dois Irmãos located in Recife, State of Pernambuco, Northeast Brazil. The samples were collected on a monthly basis from June 2005 to May 2006, taken to the laboratory and incubated in moist chambers. Higher number of taxa was observed in the excrements of tapir, followed by deer and donkey. The highest number of species was detected for Mucor, followed by Pilobolus. Statistical analyses showed significant differences in richness of Zygomycetes taxa between the herbivore dung types. Differences of species composition, however, were weak. Seasonality influenced the Zygomycetes species composition but not its richness. Variations in taxa composition between ruminants and non-ruminants dung were non significant. PMID:24031609

  17. Effects of increasing levels of cow dung application associated with ...

    African Journals Online (AJOL)

    Guatemala grass (Tripsacum laxum) originating from Tropical America was introduced to Cameroon as an attempt to solve the problem of low forage availability during the dry season. Tripsacum laxum forage production under cow dung fertilization associated with the probiotic Light Matrix Organic (LMO) was evaluated at ...

  18. Absence of endothermy in flightless dung beetles from southern Africa

    African Journals Online (AJOL)

    1987-06-19

    Jun 19, 1987 ... Bartholomew & Heinrich (1978) found that when the diurnal species were rolling dung balls their Tmth was increased by endothermic means and then further elevated by solar radiation. However, these beetles still. Table 1 Metathoracic temperatures of Circe/lium bacchus during various activities. Activity.

  19. Molecular Investigation of the Short-term Sequestration of Natural Abundance 13C -labelled Cow Dung in the Surface Horizons of a Temperate Grassland Soil

    Science.gov (United States)

    Dungait, J.; Bol, R.; Evershed, R. P.

    2004-12-01

    An adequate understanding of the carbon (C) sequestration potential of grasslands requires that the quantity and residence times of C inputs be measured. Herbivore dung is largely comprised of plant cell wall material, a significant source of stable C in intensively grazed temperate grassland ecosystems that contributes to the soil carbon budget. Our work uses compound-specific isotope analysis to identify the pattern of input of dung-derived compounds from natural abundance 13C/-labelled cow dung into the surface horizons of a temperate grassland soil over one year. C4 dung (δ 13C \\-12.6 ‰ ) from maize fed cows was applied to a temperate grassland surface (δ 13C \\-29.95 ‰ ) at IGER-North Wyke (Devon, UK), and dung remains and soil cores beneath the treatments collected at ŧ = 7, 14, 28, 56, 112, 224 and 372 days. Bulk dung carbon present in the 0\\-1 cm and 1\\-5 cm surface horizons of a grassland soil over one year was estimated using Δ 13C between C4 dung and C3 dung, after Bol {\\et al.} (2000). The major biochemical components of dung were quantified using proximate forage fibre analyses, after Goering and Van Soest (1970) and identified using `wet' chemical and GC-MS methods. Plant cell wall polysaccharides and lignin were found to account for up to 67 {%} of dung dry matter. Hydrolysed polysaccharides were prepared as alditol acetates for analyses (after Docherty {\\et al.}, 2001), and a novel application of an off-line pyrolysis method applied to measure lignin-derived phenolic compounds (after Poole & van Bergen, 2002). This paper focuses on major events in the incorporation of dung carbon, estimated using natural abundance 13C&-slash;labelling technique. This revealed a major bulk input of dung carbon after a period of significant rainfall with a consequent decline in bulk soil δ 13C values until the end of the experiment (Dungait {\\et al.}, submitted). Findings will be presented revealing contribution of plant cell wall polysaccharides and

  20. Innovative Bayesian and Parsimony Phylogeny of Dung Beetles (Coleoptera, Scarabaeidae, Scarabaeinae) Enhanced by Ontology-Based Partitioning of Morphological Characters

    Science.gov (United States)

    Tarasov, Sergei; Génier, François

    2015-01-01

    Scarabaeine dung beetles are the dominant dung feeding group of insects and are widely used as model organisms in conservation, ecology and developmental biology. Due to the conflicts among 13 recently published phylogenies dealing with the higher-level relationships of dung beetles, the phylogeny of this lineage remains largely unresolved. In this study, we conduct rigorous phylogenetic analyses of dung beetles, based on an unprecedented taxon sample (110 taxa) and detailed investigation of morphology (205 characters). We provide the description of morphology and thoroughly illustrate the used characters. Along with parsimony, traditionally used in the analysis of morphological data, we also apply the Bayesian method with a novel approach that uses anatomy ontology for matrix partitioning. This approach allows for heterogeneity in evolutionary rates among characters from different anatomical regions. Anatomy ontology generates a number of parameter-partition schemes which we compare using Bayes factor. We also test the effect of inclusion of autapomorphies in the morphological analysis, which hitherto has not been examined. Generally, schemes with more parameters were favored in the Bayesian comparison suggesting that characters located on different body regions evolve at different rates and that partitioning of the data matrix using anatomy ontology is reasonable; however, trees from the parsimony and all the Bayesian analyses were quite consistent. The hypothesized phylogeny reveals many novel clades and provides additional support for some clades recovered in previous analyses. Our results provide a solid basis for a new classification of dung beetles, in which the taxonomic limits of the tribes Dichotomiini, Deltochilini and Coprini are restricted and many new tribes must be described. Based on the consistency of the phylogeny with biogeography, we speculate that dung beetles may have originated in the Mesozoic contrary to the traditional view pointing to a

  1. Effects of Weed Control and Cow Dung Manure on Growth ...

    African Journals Online (AJOL)

    Field trials were conducted during the 2006, 2007 and 2008 rainy seasons at the Institute for Agricultural Research Samaru, in the Northern guinea savanna zone of Nigeria to evaluate the effects of weed control and cow dung manure treatments on growth of Quality Protein Maize. The trial consisted of factorial ...

  2. Production of biogas from poultry litter mixed with the co-substrate cow dung

    Directory of Open Access Journals (Sweden)

    Mohammad Roman Miah

    2016-07-01

    Full Text Available Poultry litter (a mixture of rice hulls, sawdust and chicken excreta of broilers mixed with the co-substrate cow dung and poultry droppings was evaluated under anaerobic conditions for the production of biogas (methane. Four laboratory scale reactors, R1, R2, R3 and R4, were set up with different proportions of waste poultry litter, cow dung and poultry droppings and had a 6% total solid concentration. Digestion was carried out for 50 days at room temperature, 32 ± 3 °C. Volatile solid degradation and specific gas production in the four reactors was 46%, 51.99%, 51.96%, 43% and 0.263, 0.469, 0.419, 0.221 l/g, respectively, based on the volatile solid (VS feed. The methane yields were 71%, 72.5%, 72.6% and 70%, respectively. The COD reductions were 46.1%, 50.76%, 48.23% and 45.12%, respectively. A kinetic analysis showed that the anaerobic digestion of poultry litter with a co-substrate followed first order kinetics. Among the experimental reactors, R2 (25% cow dung, 75% poultry litter gave the optimum results: a VS reduction of 51.99%, a specific gas yield of 0.469 l/g and a methane yield of 72.5%.

  3. Spectral information as an orientation cue in dung beetles.

    Science.gov (United States)

    El Jundi, Basil; Foster, James J; Byrne, Marcus J; Baird, Emily; Dacke, Marie

    2015-11-01

    During the day, a non-uniform distribution of long and short wavelength light generates a colour gradient across the sky. This gradient could be used as a compass cue, particularly by animals such as dung beetles that rely primarily on celestial cues for orientation. Here, we tested if dung beetles can use spectral cues for orientation by presenting them with monochromatic (green and UV) light spots in an indoor arena. Beetles kept their original bearing when presented with a single light cue, green or UV, or when presented with both light cues set 180° apart. When either the UV or the green light was turned off after the beetles had set their bearing in the presence of both cues, they were still able to maintain their original bearing to the remaining light. However, if the beetles were presented with two identical green light spots set 180° apart, their ability to maintain their original bearing was impaired. In summary, our data show that ball-rolling beetles could potentially use the celestial chromatic gradient as a reference for orientation. © 2015 The Author(s).

  4. The Boron Isotopic Composition of Elephant Dung: Inputs to the Global Boron Budget

    Science.gov (United States)

    Williams, L. B.; Hervig, R. L.

    2011-12-01

    A survey of boron in kerogen showed isotopically light δ11B values (0 to -50%) that are distinctly different from most mineral and natural water B reservoirs. Diagenesis releases this isotopically light B into pore fluids when hydrocarbons are generated, thus enriching oilfield brines in 10B. This observation suggests that borated biomolecules (BM) are primarily tetrahedral favoring 10B, whereas 11B is preferred in trigonal coordination. Plants, with optimal concentrations up to 100ppm, contribute more B than animal remains to sediment. Elephants are one of the largest herbivores on earth, consuming 200 - 250 kg of plant material/day and producing 50 kg of manure/day. They are inefficient at digestion, thus the manure contains >50% undigested plant material. Dung samples are therefore ideal for studying the δ11B of both the food input and digested output of a significant B supply to sedimentary systems. Horse and rabbit manure were studied for comparison to evaluate B isotope variations in the food supply and potential vital effects on the output. B-content and isotopic composition of dung plant material and digested fractions were measured in the solid state by secondary ion mass spectrometry. The digests were rinsed in 1.8% mannitol, a B-complexing agent, to remove surface adsorbed-B, then air dried and Au-coated for charge compensation. Results showed that the elephant diet contains 3-13 ppm B, with an average δ11B of -20 ± 0.8% (1σ), while rabbit food had 88 ppm B with a δ11B of -50 ± 1.3 %. The digested fraction of the elephant dung contains 4-10ppm B with average δ11B values of -12 ± 1.2%. In comparison, horse manure with 11-21 ppm B has a δ11B of -10.7 ± 0.5% and rabbit manure contains 2-3 ppm B with a δ11B of -8.8 ± 1%. Boron isotope compositions of these manures are indistinguishable (within error). Clearly plant material is a major contributor of isotopically light B to sediments. The herbivores studied fractionate their total B intake in

  5. A review and phylogeny of Scarabaeine dung beetle fossils (Coleoptera: Scarabaeidae: Scarabaeinae, with the description of two Canthochilum species from Dominican amber

    Directory of Open Access Journals (Sweden)

    Sergei Tarasov

    2016-05-01

    Full Text Available Despite the increasing rate of systematic research on scarabaeine dung beetles (Coleoptera: Scarabaeidae: Scarabaeinae, their fossil record has remained largely unrevised. In this paper, we review all 33 named scarabaeine fossils and describe two new species from Dominican amber (Canthochilum alleni sp.n., Canthochilum philipsivieorum sp.n.. We provide a catalogue of all fossil Scarabaeinae and evaluate their assignment to this subfamily, based primarily on the original descriptions but also, where possible, by examining the type specimens. We suggest that only 21 fossil taxa can be reliably assigned to the Scarabaeinae, while the remaining 14 should be treated as doubtful Scarabaeinae. The doubtful scarabaeines include the two oldest dung beetle fossils known from the Cretaceous and we suggest excluding them from any assessments of the minimum age of scarabaeine dung beetles. The earliest reliably described scarabaeine fossil appears to be Lobateuchus parisii, known from Oise amber (France, which shifts the minimum age of the Scarabaeinae to the Eocene (53 Ma. We scored the best-preserved fossils, namely Lobateuchus and the two Canthochilum species described herein, into the character matrix used in a recent morphology-based study of dung beetles, and then inferred their phylogenetic relationships with Bayesian and parsimony methods. All analyses yielded consistent phylogenies where the two fossil Canthochilum are placed in a clade with the extant species of Canthochilum, and Lobateuchus is recovered in a clade with the extant genera Ateuchus and Aphengium. Additionally, we evaluated the distribution of dung beetle fossils in the light of current global dung beetle phylogenetic hypotheses, geological time and biogeography. The presence of only extant genera in the late Oligocene and all later records suggests that the main present-day dung beetle lineages had already been established by the late Oligocene–mid Miocene.

  6. Assessment of Mesophilic Co-Digestion of Cow Dung with Lemon ...

    African Journals Online (AJOL)

    The scarcity of energy (fossil) and its attendant pollution menace have provided the avenue to consider alternative sources of energy. A study was carried out on the design and construction of an Anaerobic Digester system using 1mm galvanized steel for the production of biogas from co-digestion of Cow dung and Lemon ...

  7. Role of dung beetle feeding mechanisms in limiting the suitability of species as hosts for the nematode Spirocerca lupi

    DEFF Research Database (Denmark)

    du Toit, C. A.; Holter, P.; Lutermann, H.

    2012-01-01

    Various species of dung beetle serve as intermediate hosts after ingesting the embryonated eggs (1115 x 3037 mu m) of Spirocerca lupi (Spirurida: Spirocercidae) in dog faeces. The feeding mechanisms of coprophagous dung beetles restrict the size of the food particles they can ingest and hence may...

  8. Rates of wood and dung disintegration in arid South African ...

    African Journals Online (AJOL)

    Dead shrubs lying on the soil surface in an arid shrubland in the southern Karoo have half-lives of 9 to 18 years depending on wood density which varies among species. Dung pellets of sheep and springbok can remain intact on the soil surface in Karoo shrubland and desert grassland for five years or more. Highlights the ...

  9. Effects of poultry manure and cow dung on the physical and ...

    African Journals Online (AJOL)

    An experiment was conducted in the Teaching and Research Farm of the Faculty of Agriculture and Veterinary Medicine, Imo State University, Owerri, Nigeria to investigate the potentials of using poultry manure and cow dung as bioremediants for crude oil polluted soils. The experiment was arranged in a Randomized ...

  10. Changes in Soil Chemical Properties and Lettuce Yield Response Following Incorporation of Biochar and Cow Dung to Highly Weathered Acidic Soils

    DEFF Research Database (Denmark)

    Agyei Frimpong, Kwame; Amoakwah, Emmanuel; Osei, Benjamin A

    2016-01-01

    imposed on two highly weathered, acidic soils from the coastal savanna and tropical rainforest agroecological zones of Ghana, respectively, to elucidate their effect on yield of lettuce. The study showed that application of biochar solely or in combination with cow dung increased soil pH, total organic...... carbon, and cation exchange capacity, and temporarily increased soil respiration and microbial biomass carbon. Further, incorporation of combined application of cow dung and biochar increased lettuce yield more than sole incorporation of either amendment. The study demonstrated that corn cob biochar can...... improve soil chemical properties and lettuce yield if applied solely or in combination with cow dung....

  11. Oral direct thrombin inhibitors or oral factor Xa inhibitors for the treatment of deep vein thrombosis.

    Science.gov (United States)

    Robertson, Lindsay; Kesteven, Patrick; McCaslin, James E

    2015-06-30

    Deep vein thrombosis (DVT) is a condition in which a clot forms in the deep veins, most commonly of the leg. It occurs in approximately 1 in 1,000 people. If left untreated, the clot can travel up to the lungs and cause a potentially life-threatening pulmonary embolism (PE). Previously, a DVT was treated with the anticoagulants heparin and vitamin K antagonists. However, two forms of novel oral anticoagulants (NOACs) have been developed: oral direct thrombin inhibitors (DTI) and oral factor Xa inhibitors. The new drugs have characteristics that may be favourable over conventional treatment, including oral administration, a predictable effect, lack of frequent monitoring or re-dosing and few known drug interactions. To date, no Cochrane review has measured the effectiveness and safety of these drugs in the treatment of DVT. To assess the effectiveness of oral DTIs and oral factor Xa inhibitors for the treatment of DVT. The Cochrane Peripheral Vascular Diseases Group Trials Search Co-ordinator searched the Specialised Register (last searched January 2015) and the Cochrane Register of Studies (last searched January 2015). We searched clinical trials databases for details of ongoing or unpublished studies and the reference lists of relevant articles retrieved by electronic searches for additional citations. We included randomised controlled trials in which people with a DVT confirmed by standard imaging techniques, were allocated to receive an oral DTI or an oral factor Xa inhibitor for the treatment of DVT. Two review authors (LR, JM) independently extracted the data and assessed the risk of bias in the trials. Any disagreements were resolved by discussion with the third review author (PK). We performed meta-analyses when we considered heterogeneity low. The two primary outcomes were recurrent VTE and PE. Other outcomes included all-cause mortality and major bleeding. We calculated all outcomes using an odds ratio (OR) with a 95% confidence interval (CI). We included

  12. Hazardous Waste Water Remediation by Ecoresin-Dry Cow Dung Powder

    Science.gov (United States)

    Bagla, Hemlata; Barot, Nisha

    2013-04-01

    Water, the matter, matrix, medium and the mother of our life, is indeed one of the drivers of Nature. Through water cycle only the intra and inter equilibrium is maintained constantly between entire 'green' and 'blue'. Unfortunately, with each successive epoch of industrialization and urbanization, human societies have produced non-biodegradable waste hulk with far beyond handling capacities of mankind. At this juncture the very need is to appreciate and move towards the cost as well as time effective scientific alternatives for the removal of aqueous heavy metal pollutants. Green chemistry advocates the utilization of naturally available bio-resins which are environmentally benign alternative to current synthetic materials and technologies employed for waste water treatment. This explicit investigation aims to explore Dry Cow dung powder, DCP, a natural biosorbent as a green and clean alternative for the aqueous waste water treatment. It is naturally available bio-organic, complex, polymorphic humified fecal matter of cow and is enriched with minerals, carbohydrates, fats, proteins, bile pigments, aliphatic - aromatic species such as 'Humic acid'(HA). The HA has been successfully extracted by authors from DCP and this piece of work has been published in the International Journal [1]. We have developed simple, efficient and eco-friendly method for the removal of aqueous heavy metal pollutant such as Cr(VI) [2], Cd(II), Cr(III) [3] and Hg(II) as well radiotoxic 90Sr(II) [4], employing DCP. DCP is employed without any pre or post treatment. Being freely and easily available DCP has an edge over processed natural adsorbent considering their cost, time and energy efficiency. In nutshell we have to remember that prevention is better than the cure. If we fail to meet this, the situation will surely augment which will drain our water, our life, to slaughters knife..! Reference: 1. H.K.Bagla, N.S.Barot, Soil Amendement by Green Supplement: Dry Cowdung powder, EGUGA - 11

  13. Bioconversion of garden waste, kitchen waste and cow dung into value-added products using earthworm Eisenia fetida.

    Science.gov (United States)

    Wani, K A; Mamta; Rao, R J

    2013-04-01

    Solid waste management is a worldwide problem and it is becoming more and more complicated day by day due to rise in population, industrialization and changes in our life style. Transformation of industrial sludges into vermicompost is of double interest: on the one hand, a waste is converted into value added product, and, on the other, it controls a pollutant that is a consequence of increasing industrialization. Garden waste, kitchen waste and cow dung were subjected to recycle through vermicomposting by using the epigeic earthworm Eisenia fetida under field conditions. The pH, moisture content, total organic carbon, humus, nitrogen, phosphorous and potassium in vermicompost was analysed. It was found that moisture content, total organic carbon, humus, nitrogen, phosphorous and potassium was high in cow dung, followed by kitchen waste and garden waste. This study clearly indicates that vermicomposting of garden waste, kitchen waste and cow dung can not only produce a value added produce (vermicomposting) but at the same time reduce the quantity of waste.

  14. The value of trophic interactions for ecosystem function: dung beetle communities influence seed burial and seedling recruitment in tropical forests.

    Science.gov (United States)

    Griffiths, Hannah M; Bardgett, Richard D; Louzada, Julio; Barlow, Jos

    2016-12-14

    Anthropogenic activities are causing species extinctions, raising concerns about the consequences of changing biological communities for ecosystem functioning. To address this, we investigated how dung beetle communities influence seed burial and seedling recruitment in the Brazilian Amazon. First, we conducted a burial and retrieval experiment using seed mimics. We found that dung beetle biomass had a stronger positive effect on the burial of large than small beads, suggesting that anthropogenic reductions in large-bodied beetles will have the greatest effect on the secondary dispersal of large-seeded plant species. Second, we established mesocosm experiments in which dung beetle communities buried Myrciaria dubia seeds to examine plant emergence and survival. Contrary to expectations, we found that beetle diversity and biomass negatively influenced seedling emergence, but positively affected the survival of seedlings that emerged. Finally, we conducted germination trials to establish the optimum burial depth of experimental seeds, revealing a negative relationship between burial depth and seedling emergence success. Our results provide novel evidence that seed burial by dung beetles may be detrimental for the emergence of some seed species. However, we also detected positive impacts of beetle activity on seedling recruitment, which are probably because of their influence on soil properties. Overall, this study provides new evidence that anthropogenic impacts on dung beetle communities could influence the structure of tropical forests; in particular, their capacity to regenerate and continue to provide valuable functions and services. © 2016 The Author(s).

  15. Geographical Variation in Antibiotic-Resistant Escherichia coli Isolates from Stool, Cow-Dung and Drinking Water

    Science.gov (United States)

    Sahoo, Krushna Chandra; Tamhankar, Ashok J.; Sahoo, Soumyakanta; Sahu, Priyadarshi Soumyaranjan; Klintz, Senia Rosales; Lundborg, Cecilia Stålsby

    2012-01-01

    Little information is available on relationships between the biophysical environment and antibiotic resistance. This study was conducted to investigate the antibiotic resistance pattern of Escherichia coli isolated from child stool samples, cow-dung and drinking water from the non-coastal (230 households) and coastal (187 households) regions of Odisha, India. Susceptibility testing of E. coli isolates (n = 696) to the following antibiotics: tetracycline, ampicillin/sulbactam, cefuroxime, cefotaxime, cefixime, cotrimoxazole, amikacin, ciprofloxacin, norfloxacin and nalidixic acid was performed by the disk diffusion method. Ciprofloxacin minimum inhibitory concentration (MIC) values were determined for ciprofloxacin-resistant isolates (n = 83). Resistance to at least one antibiotic was detected in 90% or more of the E. coli isolates. Ciprofloxacin MIC values ranged from 8 to 32 µg/mL. The odds ratio (OR) of resistance in E. coli isolates from children’s stool (OR = 3.1, 95% CI 1.18–8.01), cow-dung (OR = 3.6, 95% CI 1.59–8.03, P = 0.002) and drinking water (OR = 3.8, 95% CI 1.00–14.44, P = 0.049) were higher in non-coastal compared to coastal region. Similarly, the co-resistance in cow-dung (OR = 2.5, 95% CI 1.39–4.37, P = 0.002) and drinking water (OR = 3.2, 95% CI 1.36–7.41, P = 0.008) as well as the multi-resistance in cow-dung (OR = 2.2, 95% CI 1.12–4.34, P = 0.022) and drinking water (OR = 2.7, 95% CI 1.06–7.07, P = 0.036) were also higher in the non-coastal compared to the coastal region. PMID:22690160

  16. effects of weed control and cow dung manure on growth indices

    African Journals Online (AJOL)

    DR. AMINU

    2012-12-02

    Dec 2, 2012 ... ABSTRACT. Field trials were conducted during the 2006, 2007 and 2008 rainy seasons at the Institute for. Agricultural Research farm Samaru, in the Northern guinea savanna zone of Nigeria to evaluate the effects of weed control and cow dung manure treatments on growth of quality protein maize. The.

  17. Effect of Temperature and PH on Biogas Production from Cow Dung ...

    African Journals Online (AJOL)

    The effect of feed, temperature and pH on biogas production was investigated using 500 ml small scale laboratory flasks. Feed containing cow dung and dog faeces produced the most biogas for small scale experiments. The combinations were scaled up to assess the feasibility of producing biogas from two 150 L ...

  18. L2₁ and XA Ordering Competition in Hafnium-Based Full-Heusler Alloys Hf₂VZ (Z = Al, Ga, In, Tl, Si, Ge, Sn, Pb).

    Science.gov (United States)

    Wang, Xiaotian; Cheng, Zhenxiang; Wang, Wenhong

    2017-10-20

    For theoretical designing of full-Heusler based spintroinc materials, people have long believed in the so-called Site Preference Rule (SPR). Very recently, according to the SPR, there are several studies on XA-type Hafnium-based Heusler alloys X₂YZ, i.e., Hf₂VAl, Hf₂CoZ (Z = Ga, In) and Hf₂CrZ (Z = Al, Ga, In). In this work, a series of Hf₂-based Heusler alloys, Hf₂VZ (Z = Al, Ga, In, Tl, Si, Ge, Sn, Pb), were selected as targets to study the site preferences of their atoms by first-principle calculations. It has been found that all of them are likely to exhibit the L2₁-type structure instead of the XA one. Furthermore, we reveal that the high values of spin-polarization of XA-type Hf₂VZ (Z = Al, Ga, In, Tl, Si, Ge, Sn, Pb) alloys have dropped dramatically when they form the L2₁-type structure. Also, we prove that the electronic, magnetic, and physics nature of these alloys are quite different, depending on the L2₁-type or XA-type structures.

  19. Marker-Assisted Selection of Xa21 Conferring Resistance to Bacterial Leaf Blight in indica Rice Cultivar LT2

    Institute of Scientific and Technical Information of China (English)

    Hue Thi NGUYEN; Trung Nguyen DINH; Nakano TOSHITSUGU; Liet Van VU; Quang Hong VU; Tan Van MAI; Thu Thi NGUYEN; Lam Duc VU; Tung Thanh NGUYEN; Long Viet NGUYEN; Hien Thu Thi VU; Hue Thi NONG

    2018-01-01

    Bacterial leaf blight of rice (BLB), caused by Xanthomonas oryzae pv. oryzae, is one of the most destructive diseases in Asian rice fields. A high-quality rice variety, LT2, was used as the recipient parent. IRBB21, which carries the Xa21 gene, was used as the donor parent. The resistance gene Xa21 was introduced into LT2 by marker-assisted backcrossing. Three Xoo races were used to inoculate the improved lines following the clipping method. Eleven BC3F3lines carrying Xa21 were obtained based on molecular markers and agronomic performance. The 11 lines were then inoculated with the three Xoo races. All the 11 improved lines showed better resistance to BLB than the recipient parent LT2. Based on the level of resistance to BLB and their agronomic performance, five lines (BC3F35.1.5.1, BC3F35.1.5.12, BC3F38.5.6.44, BC3F3 9.5.4.1 and BC3F39.5.4.23) were selected as the most promising for commercial release. These improved lines could contribute to rice production in terms of food security.

  20. Study of dung, urine, and milk of selected grazing animals as bioindicators in environmental geoscience--a case study from Mangampeta barite mining area, Kadapa District, Andhra Pradesh, India.

    Science.gov (United States)

    Raghu, V

    2015-01-01

    The ancient scientific Sanskrit texts of Ayurveda (science of longevity) deal with waters, plants, and animals in relation to human health. Based on the studies mentioned in Ayurveda and modern literature, biological responses of grazing animals in Mangampeta barite mining area in Kadapa District, Andhra Pradesh, were studied. A non-mineralized Tirupati area in Chittoor District, Andhra Pradesh, was selected for the purpose of comparison. In these areas, certain animal products of selected grazing animals were studied if they could be used as tools in mineral exploration. Samples of dung, urine, and milk from cow, bullock, she-buffalo, he-buffalo, sheep, and goat were collected from these two areas during winter and summer seasons. Goat dung was found to have lowest moisture content and highest organic matter while goat urine contained highest amounts of organic matter and ash content. All these animal products were analyzed for 11 trace elements. The concentration of trace elements released through dung, urine, and milk widely varied in different animal species with seasonal variations. The elemental concentration was higher in dung and lower in urine, when compared to that of milk. The concentration of all elements in dung, urine, and milk of all animals, in both the areas, was higher in winter than that in summer. Dung represents the metabolic process of the whole animal and reflects the dietary conditions whether fed on natural or inorganic supplement. It can be inferred that dung, urine, and milk of any animal can be used as tools in mineral exploration during winter, while during summer, only dung can be useful. The dung of goat when compared to that of the other cattle serves as a better tool in environmental studies as goat depends almost entirely on natural vegetation without human interference.

  1. Effects of grazing intensity and the use of veterinary medical products on dung beetle biodiversity in the sub-mountainous landscape of Central Italy

    Directory of Open Access Journals (Sweden)

    Mattia Tonelli

    2017-01-01

    Full Text Available Grazing extensification and intensification are among the main problems affecting European grasslands. We analyze the impact of grazing intensity (low and moderate and the use of veterinary medical products (VMPs on the dung beetle community in the province of Pesaro-Urbino (Italy. Grazing intensity is a key factor in explaining the diversity of dung beetles. In the case of the alpha diversity component, sites with a low level of grazing activity—related in a previous step to the subsequent abandonment of traditional farming—is characterized by a loss of species richness (q = 0 and a reduction in alpha diversity at the levels q = 1 and q = 2. In the case of beta diversity, sites with a different grazing intensity show remarkable differences in terms of the composition of their species assemblages. The use of VMPs is another important factor in explaining changes in dung beetle diversity. In sites with a traditional use of VMPs, a significant loss of species richness and biomass is observed, as is a notable effect on beta diversity. In addition, the absence of indicator species in sites with a historical use of VMPs corroborates the hypothesis that these substances have a ubiquitous effect on dung beetles. However, the interaction between grazing activity and VMPs when it comes to explaining changes in dung beetle diversity is less significant (or is not significant than the main effects (each factor separately for alpha diversity, biomass and species composition. This may be explained if we consider that both factors affect the various species differently. In other words, the reduction in dung availability affects several larger species more than it does very small species, although this does not imply that the former are more susceptible to injury caused by the ingestion of dung contaminated with VMPs. Finally, in order to prevent negative consequences for dung beetle diversity, we propose the maintenance of a moderate grazing intensity and

  2. Compositional and functional features of humic acid-like fractions from vermicomposting of sewage sludge and cow dung

    Energy Technology Data Exchange (ETDEWEB)

    Li Xiaowei [State Key Laboratory of Pollution Control and Resources Reuse, College of Environmental Science and Engineering, Tongji University, Shanghai 200092 (China); Xing Meiyan, E-mail: xmy5000@163.com [State Key Laboratory of Pollution Control and Resources Reuse, College of Environmental Science and Engineering, Tongji University, Shanghai 200092 (China); Yang Jian; Huang Zhidong [State Key Laboratory of Pollution Control and Resources Reuse, College of Environmental Science and Engineering, Tongji University, Shanghai 200092 (China)

    2011-01-30

    The chemical changes occurring in five different substrates of sewage sludge spiked with different proportions of cow dung after vermicomposting with Eisenia foetida for 90 days were investigated. Their humic acid-like (HAL) fractions were isolated to determine the elemental and functional composition, and structural and functional characteristics using ultraviolet/visible, Fourier transform infrared (FT-IR) and fluorescence spectroscopies and scanning electron microscopy. After vermicomposting, the total organic C and C/N ratio decreased, and the total extractable C and humic acid (HA) C increased in all substrates. In the HAL fractions, the C and H contents, C/N and C/O and aliphatic structures, proteinaceous components and carbohydrates decreased, while the O and N and acidic functional group contents and C/H ratio, aromaticity and polycondensation structures increased. Further, the results suggest that the addition of cow dung to sewage sludge could improve the quality of organic matter humification of the substrates. The structures of HAL fractions in vermicomposts resembled those typical of soil HA, especially the vermicompost of cow dung alone. Scanning electron microscopy showed the microstructure of HAL fraction in final product became close-grained and lumpy. Overall results indicate that vermicomposting was an efficient technology for promoting organic matter (OM) humification in sewage sludge and cow dung alone, as well as in mixtures of both materials, improving their quality and environmental safety as a soil OM resource for utilization as soil amendments.

  3. Compositional and functional features of humic acid-like fractions from vermicomposting of sewage sludge and cow dung.

    Science.gov (United States)

    Li, Xiaowei; Xing, Meiyan; Yang, Jian; Huang, Zhidong

    2011-01-30

    The chemical changes occurring in five different substrates of sewage sludge spiked with different proportions of cow dung after vermicomposting with Eisenia foetida for 90 days were investigated. Their humic acid-like (HAL) fractions were isolated to determine the elemental and functional composition, and structural and functional characteristics using ultraviolet/visible, Fourier transform infrared (FT-IR) and fluorescence spectroscopies and scanning electron microscopy. After vermicomposting, the total organic C and C/N ratio decreased, and the total extractable C and humic acid (HA) C increased in all substrates. In the HAL fractions, the C and H contents, C/N and C/O and aliphatic structures, proteinaceous components and carbohydrates decreased, while the O and N and acidic functional group contents and C/H ratio, aromaticity and polycondensation structures increased. Further, the results suggest that the addition of cow dung to sewage sludge could improve the quality of organic matter humification of the substrates. The structures of HAL fractions in vermicomposts resembled those typical of soil HA, especially the vermicompost of cow dung alone. Scanning electron microscopy showed the microstructure of HAL fraction in final product became close-grained and lumpy. Overall results indicate that vermicomposting was an efficient technology for promoting organic matter (OM) humification in sewage sludge and cow dung alone, as well as in mixtures of both materials, improving their quality and environmental safety as a soil OM resource for utilization as soil amendments. Copyright © 2010 Elsevier B.V. All rights reserved.

  4. Compositional and functional features of humic acid-like fractions from vermicomposting of sewage sludge and cow dung

    International Nuclear Information System (INIS)

    Li Xiaowei; Xing Meiyan; Yang Jian; Huang Zhidong

    2011-01-01

    The chemical changes occurring in five different substrates of sewage sludge spiked with different proportions of cow dung after vermicomposting with Eisenia foetida for 90 days were investigated. Their humic acid-like (HAL) fractions were isolated to determine the elemental and functional composition, and structural and functional characteristics using ultraviolet/visible, Fourier transform infrared (FT-IR) and fluorescence spectroscopies and scanning electron microscopy. After vermicomposting, the total organic C and C/N ratio decreased, and the total extractable C and humic acid (HA) C increased in all substrates. In the HAL fractions, the C and H contents, C/N and C/O and aliphatic structures, proteinaceous components and carbohydrates decreased, while the O and N and acidic functional group contents and C/H ratio, aromaticity and polycondensation structures increased. Further, the results suggest that the addition of cow dung to sewage sludge could improve the quality of organic matter humification of the substrates. The structures of HAL fractions in vermicomposts resembled those typical of soil HA, especially the vermicompost of cow dung alone. Scanning electron microscopy showed the microstructure of HAL fraction in final product became close-grained and lumpy. Overall results indicate that vermicomposting was an efficient technology for promoting organic matter (OM) humification in sewage sludge and cow dung alone, as well as in mixtures of both materials, improving their quality and environmental safety as a soil OM resource for utilization as soil amendments.

  5. Regional and local influence of grazing activity on the diversity of a semi-arid dung beetle community

    DEFF Research Database (Denmark)

    Lobo, Jorge M.; Hortal, Joaquín; Cabrero-Sañudo, Francisco J.

    2006-01-01

    richness variance. A cluster analysis of localities identified two main groups, one characterized by a lower abundance and species richness that can be considered a nested subsample of the species-rich group. The mean and maximum amount of sheep dung in the sites separated by less than 2 km are the only...... could be affecting the population dynamics and dispersion of dung beetles within a locality, sites with larger populations, and greater species numbers would not be able to exercise enough influence as to bring about a complete local faunistic homogenization....

  6. Maternal effects on male weaponry: female dung beetles produce major sons with longer horns when they perceive higher population density

    Directory of Open Access Journals (Sweden)

    Buzatto Bruno A

    2012-07-01

    Full Text Available Abstract Background Maternal effects are environmental influences on the phenotype of one individual that are due to the expression of genes in its mother, and are expected to evolve whenever females are better capable of assessing the environmental conditions that their offspring will experience than the offspring themselves. In the dung beetle Onthophagus taurus, conditional male dimorphism is associated with alternative reproductive tactics: majors fight and guard females whereas minors sneak copulations. Furthermore, variation in dung beetle population density has different fitness consequences for each male morph, and theory predicts that higher population density might select for a higher frequency of minors and/or greater expenditure on weaponry in majors. Because adult dung beetles provide offspring with all the nutritional resources for their development, maternal effects strongly influence male phenotype. Results Here we tested whether female O. taurus are capable of perceiving population density, and responding by changing the phenotype of their offspring. We found that mothers who were reared with other conspecifics in their pre-mating period produced major offspring that had longer horns across a wider range of body sizes than the major offspring of females that were reared in isolation in their pre-mating period. Moreover, our results indicate that this maternal effect on male weaponry does not operate through the amount of dung provided by females to their offspring, but is rather transmitted through egg or brood mass composition. Finally, although theory predicts that females experiencing higher density might produce more minor males, we found no support for this, rather the best fitting models were equivocal as to whether fewer or the same proportions of minors were produced. Conclusions Our study describes a new type of maternal effect in dung beetles, which probably allows females to respond to population density adaptively

  7. Generation of biogas from coffee-pulp and cow-dung co-digestion: Infrared studies of postcombustion emissions

    International Nuclear Information System (INIS)

    Corro, Grisel; Paniagua, Laura; Pal, Umapada; Bañuelos, Fortino; Rosas, Minerva

    2013-01-01

    Graphical abstract: Batch digester with coffee pulp/cow dung produced high amounts of methane for 8 months. The FTIR gas spectroscopy analysis revealed the presence of over 70 chemical compounds in biogas generated after 4 months of coffee pulp and cow dung mixture co-digestion, several being hazardous to environment and human and animal health (e.g. isocyanic acid, bromomethane). Biogas produced was burned in a laboratory combustor. The FTIR gas spectroscopy analysis showed that combustion emissions contained: CH 4 , C 3 H 8 , CO, SO 2 , HI, and probably Br 2 which are strongly harmful to human and animal health. - Highlights: • Batch digester with coffee pulp/cow dung produced high amounts of methane for 8 months. • Biogas from coffee pulp/cow dung codigestion contained 60% methane and 20% propane. • Biogas FTIR analysis revealed the presence of isocyanic acid and bromomethane. • Biogas FTIR analysis showed also the presence of HI. • Biogas combustion emissions contained CH 4 , HI, SO 2 and probably Br 2 . - Abstract: Biogas could be produced by the co-digestion of coffee-pulp and cow-dung mixture under solar radiation. Gas chromatography and FTIR spectroscopy were used to analyze the chemical compositions of the generated biogas and its postcombustion emissions. From the first month of co-digestion at mesophylic conditions, methane content in the biogas attains 50% of the yield. This content increased up to 60% and remained almost constant for at least 8 months of further digestion. The FTIR gas spectroscopy analysis revealed the presence of over 70 chemical compounds in the biogas generated after 4 months of co-digestion along with several compounds hazardous to environment and animal health like isocyanic acid, and bromomethane. Combustion emission of the biogas contained several components like CH 4 , C 3 H 8 , CO, SO 2 , HI, and probably Br 2 which are strongly harmful to human and animal health. Results presented in this work indicate that if the

  8. Bioconversion of garden waste, kitchen waste and cow dung into value-added products using earthworm Eisenia fetida

    Science.gov (United States)

    Wani, K.A.; Mamta; Rao, R.J.

    2013-01-01

    Solid waste management is a worldwide problem and it is becoming more and more complicated day by day due to rise in population, industrialization and changes in our life style. Transformation of industrial sludges into vermicompost is of double interest: on the one hand, a waste is converted into value added product, and, on the other, it controls a pollutant that is a consequence of increasing industrialization. Garden waste, kitchen waste and cow dung were subjected to recycle through vermicomposting by using the epigeic earthworm Eisenia fetida under field conditions. The pH, moisture content, total organic carbon, humus, nitrogen, phosphorous and potassium in vermicompost was analysed. It was found that moisture content, total organic carbon, humus, nitrogen, phosphorous and potassium was high in cow dung, followed by kitchen waste and garden waste. This study clearly indicates that vermicomposting of garden waste, kitchen waste and cow dung can not only produce a value added produce (vermicomposting) but at the same time reduce the quantity of waste. PMID:23961230

  9. Response of fed dung composted with rock phosphate on yield and ...

    African Journals Online (AJOL)

    Field experiment was conducted on silty clay loam soil at the research farm of Khyber Pakhtunkhwa Agricultural University, Peshawar to study the effect of RP fed dung composted with RP on the yield, yield components and P uptake of maize (Zea mays. L. Azam). The fertilizers, N, P and K, were applied at the rate of 120- ...

  10. Marker-Assisted Selection of Xa21 Conferring Resistance to Bacterial Leaf Blight in indica Rice Cultivar LT2

    Directory of Open Access Journals (Sweden)

    Hue Thi Nguyen

    2018-01-01

    Full Text Available Bacterial leaf blight of rice (BLB, caused by Xanthomonas oryzae pv. oryzae, is one of the most destructive diseases in Asian rice fields. A high-quality rice variety, LT2, was used as the recipient parent. IRBB21, which carries the Xa21 gene, was used as the donor parent. The resistance gene Xa21 was introduced into LT2 by marker-assisted backcrossing. Three Xoo races were used to inoculate the improved lines following the clipping method. Eleven BC3F3 lines carrying Xa21 were obtained based on molecular markers and agronomic performance. The 11 lines were then inoculated with the three Xoo races. All the 11 improved lines showed better resistance to BLB than the recipient parent LT2. Based on the level of resistance to BLB and their agronomic performance, five lines (BC3F3 5.1.5.1, BC3F3 5.1.5.12, BC3F3 8.5.6.44, BC3F3 9.5.4.1 and BC3F3 9.5.4.23 were selected as the most promising for commercial release. These improved lines could contribute to rice production in terms of food security.

  11. Nontarget effects of ivermectin residues on earthworms and springtails dwelling beneath dung of treated cattle in four countries.

    Science.gov (United States)

    Scheffczyk, Adam; Floate, Kevin D; Blanckenhorn, Wolf U; Düring, Rolf-Alexander; Klockner, Andrea; Lahr, Joost; Lumaret, Jean-Pierre; Salamon, Jörg-Alfred; Tixier, Thomas; Wohde, Manuel; Römbke, Jörg

    2016-08-01

    The authorization of veterinary medicinal products requires that they be assessed for nontarget effects in the environment. Numerous field studies have assessed these effects on dung organisms. However, few studies have examined effects on soil-dwelling organisms, which might be exposed to veterinary medicinal product residues released during dung degradation. The authors compared the abundance of earthworms and springtails in soil beneath dung from untreated cattle and from cattle treated 0 d, 3 d, 7 d, 14 d, and 28 d previously with ivermectin. Study sites were located in different ecoregions in Switzerland (Continental), The Netherlands (Atlantic), France (Mediterranean), and Canada (Northern Mixed Grassland). Samples were collected using standard methods from 1 mo to 12 mo after pat deposition. Ivermectin concentrations in soil beneath dung pats ranged from 0.02 mg/kg dry weight (3 mo) to typically Earthworms were abundant and species-rich at the Swiss and Dutch sites, less common with fewer species at the French site, and essentially absent at the Canadian site. Diverse but highly variable communities of springtails were present at all sites. Overall, results showed little effect of residues on either earthworms or springtails. The authors recommend that inclusion of soil organisms in field studies to assess the nontarget effects of veterinary medicinal products be required only if earthworms or springtails exhibit sensitivity to the product in laboratory tests. Environ Toxicol Chem 2016;35:1959-1969. © 2015 SETAC. © 2015 SETAC.

  12. RNA-Seq analysis reveals insight into enhanced rice Xa7-mediated bacterial blight resistance at high temperature.

    Directory of Open Access Journals (Sweden)

    Stephen P Cohen

    Full Text Available Plant disease is a major challenge to agriculture worldwide, and it is exacerbated by abiotic environmental factors. During some plant-pathogen interactions, heat stress allows pathogens to overcome host resistance, a phenomenon which could severely impact crop productivity considering the global warming trends associated with climate change. Despite the importance of this phenomenon, little is known about the underlying molecular mechanisms. To better understand host plant responses during simultaneous heat and pathogen stress, we conducted a transcriptomics experiment for rice plants (cultivar IRBB61 containing Xa7, a bacterial blight disease resistance (R gene, that were infected with Xanthomonas oryzae, the bacterial blight pathogen of rice, during high temperature stress. Xa7-mediated resistance is unusual relative to resistance mediated by other R genes in that it functions better at high temperatures. Using RNA-Seq technology, we identified 8,499 differentially expressed genes as temperature responsive in rice cultivar IRBB61 experiencing susceptible and resistant interactions across three time points. Notably, genes in the plant hormone abscisic acid biosynthesis and response pathways were up-regulated by high temperature in both mock-treated plants and plants experiencing a susceptible interaction and were suppressed by high temperature in plants exhibiting Xa7-mediated resistance. Genes responsive to salicylic acid, an important plant hormone for disease resistance, were down-regulated by high temperature during both the susceptible and resistant interactions, suggesting that enhanced Xa7-mediated resistance at high temperature is not dependent on salicylic acid signaling. A DNA sequence motif similar to known abscisic acid-responsive cis-regulatory elements was identified in the promoter region upstream of genes up-regulated in susceptible but down-regulated in resistant interactions. The results of our study suggest that the plant

  13. Effects of weed control and cow dung manure on growth indices of ...

    African Journals Online (AJOL)

    Field trials were conducted during the 2006, 2007 and 2008 rainy seasons at the Institute for Agricultural Research farm Samaru, in the Northern guinea savanna zone of Nigeria to evaluate the effects of weed control and cow dung manure treatments on growth of quality protein maize. The trials consisted of factorial ...

  14. Oral direct thrombin inhibitors or oral factor Xa inhibitors for the treatment of pulmonary embolism.

    Science.gov (United States)

    Robertson, Lindsay; Kesteven, Patrick; McCaslin, James E

    2015-12-04

    Pulmonary embolism is a potentially life-threatening condition in which a clot can travel from the deep veins, most commonly in the leg, up to the lungs. Previously, a pulmonary embolism was treated with the anticoagulants heparin and vitamin K antagonists. Recently, however, two forms of direct oral anticoagulants (DOACs) have been developed: oral direct thrombin inhibitors (DTI) and oral factor Xa inhibitors. The new drugs have characteristics that may be favourable over conventional treatment, including oral administration, a predictable effect, lack of frequent monitoring or re-dosing and few known drug interactions. To date, no Cochrane review has measured the effectiveness and safety of these drugs in the long-term treatment (minimum duration of three months) of pulmonary embolism. To assess the effectiveness of oral DTIs and oral factor Xa inhibitors for the long-term treatment of pulmonary embolism. The Cochrane Vascular Trials Search Co-ordinator searched the Specialised Register (last searched January 2015) and the Cochrane Register of Studies (last searched January 2015). Clinical trials databases were also searched for details of ongoing or unpublished studies. We searched the reference lists of relevant articles retrieved by electronic searches for additional citations. We included randomised controlled trials in which patients with a pulmonary embolism confirmed by standard imaging techniques were allocated to receive an oral DTI or an oral factor Xa inhibitor for the long-term (minimum duration three months) treatment of pulmonary embolism. Two review authors (LR, JM) independently extracted the data and assessed the risk of bias in the trials. Any disagreements were resolved by discussion with the third author (PK). We used meta-analyses when we considered heterogeneity low. The two primary outcomes were recurrent venous thromboembolism and pulmonary embolism. Other outcomes included all-cause mortality and major bleeding. We calculated all outcomes

  15. Ivermectin excreted in cattle dung after subcutaneous injection or pour-on treatment

    DEFF Research Database (Denmark)

    Sommer, C.; Steffansen, B.; Nielsen, B. Overgaard

    1992-01-01

    Heifers were treated with the recommended doses of ivermectin: 0.2 mg/kg bw by subcutaneous injection or 0.5 mg/kg bw by pour-on. An analytic procedure is described and used for the detection of ivermectin residues excreted in dung. A large amount of the higher pour-on dose was excreted during th...

  16. Composting of cow dung and crop residues using termite mounds as bulking agent.

    Science.gov (United States)

    Karak, Tanmoy; Sonar, Indira; Paul, Ranjit K; Das, Sampa; Boruah, R K; Dutta, Amrit K; Das, Dilip K

    2014-10-01

    The present study reports the suitability of termite mounds as a bulking agent for composting with crop residues and cow dung in pit method. Use of 50 kg termite mound with the crop residues (stover of ground nut: 361.65 kg; soybean: 354.59 kg; potato: 357.67 kg and mustard: 373.19 kg) and cow dung (84.90 kg) formed a good quality compost within 70 days of composting having nitrogen, phosphorus and potassium as 20.19, 3.78 and 32.77 g kg(-1) respectively with a bulk density of 0.85 g cm(-3). Other physico-chemical and germination parameters of the compost were within Indian standard, which had been confirmed by the application of multivariate analysis of variance and multivariate contrast analysis. Principal component analysis was applied in order to gain insight into the characteristic variables. Four composting treatments formed two different groups when hierarchical cluster analysis was applied. Copyright © 2014 Elsevier Ltd. All rights reserved.

  17. Transgenic expression of the rice Xa21 pattern-recognition receptor in banana (Musa sp.) confers resistance to Xanthomonas campestris pv. musacearum.

    Science.gov (United States)

    Tripathi, Jaindra N; Lorenzen, Jim; Bahar, Ofir; Ronald, Pamela; Tripathi, Leena

    2014-08-01

    Banana Xanthomonas wilt (BXW), caused by the bacterium Xanthomonas campestris pv. musacearum (Xcm), is the most devastating disease of banana in east and central Africa. The spread of BXW threatens the livelihood of millions of African farmers who depend on banana for food security and income. There are no commercial chemicals, biocontrol agents or resistant cultivars available to control BXW. Here, we take advantage of the robust resistance conferred by the rice pattern-recognition receptor (PRR), XA21, to the rice pathogen Xanthomonas oryzae pv. oryzae (Xoo). We identified a set of genes required for activation of Xa21-mediated immunity (rax) that were conserved in both Xoo and Xcm. Based on the conservation, we hypothesized that intergeneric transfer of Xa21 would confer resistance to Xcm. We evaluated 25 transgenic lines of the banana cultivar 'Gonja manjaya' (AAB) using a rapid bioassay and 12 transgenic lines in the glasshouse for resistance against Xcm. About 50% of the transgenic lines showed complete resistance to Xcm in both assays. In contrast, all of the nontransgenic control plants showed severe symptoms that progressed to complete wilting. These results indicate that the constitutive expression of the rice Xa21 gene in banana results in enhanced resistance against Xcm. Furthermore, this work demonstrates the feasibility of PRR gene transfer between monocotyledonous species and provides a valuable new tool for controlling the BXW pandemic of banana, a staple food for 100 million people in east Africa. © 2014 Society for Experimental Biology, Association of Applied Biologists and John Wiley & Sons Ltd.

  18. Molecular composition of particulate matter emissions from dung and brushwood burning household cookstoves in Haryana, India

    Science.gov (United States)

    Fleming, Lauren T.; Lin, Peng; Laskin, Alexander; Laskin, Julia; Weltman, Robert; Edwards, Rufus D.; Arora, Narendra K.; Yadav, Ankit; Meinardi, Simone; Blake, Donald R.; Pillarisetti, Ajay; Smith, Kirk R.; Nizkorodov, Sergey A.

    2018-02-01

    Emissions of airborne particles from biomass burning are a significant source of black carbon (BC) and brown carbon (BrC) in rural areas of developing countries where biomass is the predominant energy source for cooking and heating. This study explores the molecular composition of organic aerosols from household cooking emissions with a focus on identifying fuel-specific compounds and BrC chromophores. Traditional meals were prepared by a local cook with dung and brushwood-fueled cookstoves in a village in Palwal district, Haryana, India. Cooking was done in a village kitchen while controlling for variables including stove type, fuel moisture, and meal. Fine particulate matter (PM2.5) emissions were collected on filters, and then analyzed via nanospray desorption electrospray ionization-high-resolution mass spectrometry (nano-DESI-HRMS) and high-performance liquid chromatography-photodiode array-high-resolution mass spectrometry (HPLC-PDA-HRMS) techniques. The nano-DESI-HRMS analysis provided an inventory of numerous compounds present in the particle phase. Although several compounds observed in this study have been previously characterized using gas chromatography methods a majority of the species in the nano-DESI spectra were newly observed biomass burning compounds. Both the stove (chulha or angithi) and the fuel (brushwood or dung) affected the composition of organic aerosols. The geometric mean of the PM2.5 emission factor and the observed molecular complexity increased in the following order: brushwood-chulha (7.3 ± 1.8 g kg-1 dry fuel, 93 compounds), dung-chulha (21.1 ± 4.2 g kg-1 dry fuel, 212 compounds), and dung-angithi (29.8 ± 11.5 g kg-1 dry fuel, 262 compounds). The mass-normalized absorption coefficient (MACbulk) for the organic-solvent extractable material for brushwood PM2.5 was 3.7 ± 1.5 and 1.9 ± 0.8 m2 g-1 at 360 and 405 nm, respectively, which was approximately a factor of two higher than that for dung PM2.5. The HPLC-PDA-HRMS analysis

  19. Correlations between physicochemical properties of PAHs and their distribution in soil, moss and reindeer dung at Ny-Alesund of the Arctic

    Energy Technology Data Exchange (ETDEWEB)

    Wang Zhen; Ma Xindong; Na Guangshui; Lin Zhongsheng [National Marine Environmental Monitoring Center, Dalian 116023 (China); Ding Qian [Environmental Science and Engineering College, Dalian Maritime University, Dalian 116026 (China); Yao Ziwei, E-mail: zwyao@nmemc.gov.c [National Marine Environmental Monitoring Center, Dalian 116023 (China)

    2009-11-15

    Concentrations of 16 polycyclic aromatic hydrocarbons (PAHs) in soil, moss and reindeer dung collected at Ny-Alesund of the Arctic were measured to investigate their accumulation trends and distribution in the three compartments. Compared with the other regions, the proportions of 2 + 3 ring PAHs to the total PAHs were higher, whereas the proportions of 5 + 6 ring PAHs were lower in the three compartments at Ny-Alesund. Significant log/log-linear relationship was observed between the sub-cooled liquid vapor pressure (p{sub L}{sup o}) and the soil/moss quotient (Q{sub SM}). The relation was similar to the relationship between the gas/particle partition coefficient (K{sub P}) and p{sub L}{sup o} of PAHs, implying Q{sub SM} would be a 'mirror image' of K{sub P}. Excellent log/log-linear relationships were observed between Q{sub SM} and K{sub OA} as well as between the moss/dung quotient (Q{sub MD}) and K{sub OW}. The results presented here indicate the physicochemical properties are suitable for characterizing the distribution of PAHs in soil, moss and reindeer dung. - The physicochemical properties of PAHs are suitable for characterizing their distribution in soil, moss and reindeer dung.

  20. 78 FR 24677 - Safety Zone; XA The Experimental Agency Fireworks, Pier 34, East River, NY

    Science.gov (United States)

    2013-04-26

    ... Final Rule This rule establishes a temporary safety zone on the navigable waters of the East River, in... Fireworks, Pier 34, East River, NY. (a) Regulated Area. The following area is a temporary safety zone: all... 1625-AA00 Safety Zone; XA The Experimental Agency Fireworks, Pier 34, East River, NY AGENCY: Coast...

  1. Effect of the application of cattle urine with or without the nitrification inhibitor DCD, and dung on greenhouse gas emissions from a UK grassland soil.

    Science.gov (United States)

    Cardenas, L M; Misselbrook, T M; Hodgson, C; Donovan, N; Gilhespy, S; Smith, K A; Dhanoa, M S; Chadwick, D

    2016-11-01

    Emissions of nitrous oxide (N 2 O) from soils from grazed grasslands have large uncertainty due to the great spatial variability of excreta deposition, resulting in heterogeneous distribution of nutrients. The contribution of urine to the labile N pool, much larger than that from dung, is likely to be a major source of emissions so efforts to determine N 2 O emission factors (EFs) from urine and dung deposition are required to improve the inventory of greenhouse gases from agriculture. We investigated the effect of the application of cattle urine and dung at different times of the grazing season on N 2 O emissions from a grassland clay loam soil. Methane emissions were also quantified. We assessed the effect of a nitrification inhibitor, dicyandiamide (DCD), on N 2 O emissions from urine application and also included an artificial urine treatment. There were significant differences in N 2 O EFs between treatments in the spring (largest from urine and lowest from dung) but not in the summer and autumn applications. We also found that there was a significant effect of season (largest in spring) but not of treatment on the N 2 O EFs. The resulting EF values were 2.96, 0.56 and 0.11% of applied N for urine for spring, summer and autumn applications, respectively. The N 2 O EF values for dung were 0.14, 0.39 and 0.10% for spring, summer and autumn applications, respectively. The inhibitor was effective in reducing N 2 O emissions for the spring application only. Methane emissions were larger from the dung application but there were no significant differences between treatments across season of application.

  2. Quantifying responses of dung beetles to fire disturbance in tropical forests: the importance of trapping method and seasonality.

    Science.gov (United States)

    de Andrade, Rafael Barreto; Barlow, Jos; Louzada, Julio; Vaz-de-Mello, Fernando Zagury; Souza, Mateus; Silveira, Juliana M; Cochrane, Mark A

    2011-01-01

    Understanding how biodiversity responds to environmental changes is essential to provide the evidence-base that underpins conservation initiatives. The present study provides a standardized comparison between unbaited flight intercept traps (FIT) and baited pitfall traps (BPT) for sampling dung beetles. We examine the effectiveness of the two to assess fire disturbance effects and how trap performance is affected by seasonality. The study was carried out in a transitional forest between Cerrado (Brazilian Savanna) and Amazon Forest. Dung beetles were collected during one wet and one dry sampling season. The two methods sampled different portions of the local beetle assemblage. Both FIT and BPT were sensitive to fire disturbance during the wet season, but only BPT detected community differences during the dry season. Both traps showed similar correlation with environmental factors. Our results indicate that seasonality had a stronger effect than trap type, with BPT more effective and robust under low population numbers, and FIT more sensitive to fine scale heterogeneity patterns. This study shows the strengths and weaknesses of two commonly used methodologies for sampling dung beetles in tropical forests, as well as highlighting the importance of seasonality in shaping the results obtained by both sampling strategies.

  3. Effect of composting of palm oil mill wastes and cow dung or poultry ...

    African Journals Online (AJOL)

    Objective: To evaluate the effect of shelter and different type of manure on degradation of palm oil mills wastes during composting and on growth and yield of African spinach (Amaranthus hybridus) grown on acrisol . Methodology and results: Palm oil mills wastes were composted, with poultry manure or cow dung with and ...

  4. Annotated checklist of dung-associated beetles of the Savanna Ecosystem Project study area, Nylsvley

    CSIR Research Space (South Africa)

    Endrody-Younga, S

    1982-09-01

    Full Text Available A study of the composition, biology and impact of the arthropod fauna associated with dung and other decaying matter was carried out on the Nylsvley Nature Reserve and on a neighbouring farm from June 1975 to July 1976. A total of 100 638 specimens...

  5. Nutrient intake in the third instar larvae of Anomala cuprea and Protaetia orientalis submarmorea (Coleoptera; Scarabaeidae) from a mixture of cow dung and wood chips: Results from stable isotope analyses of nitrogen and carbon

    International Nuclear Information System (INIS)

    Koyama, Masahito; Iwata, Ryutaro; Yamane, Akiomi; Katase, Takao; Ueda, Shingo

    2003-01-01

    The nutrient intake of the third instar larvae of Anomala cuprea (Ac) and Protaerita orientalis submarmorea (Pos) (Colepotera: Scarabaeidae) from a mixture of cow dung and wood chips of two wood species (Cryptomeria japonica and Quercus mongolica), was assayed by the stable isotope technique. The values of δ 15 N and δ 13 C (deviations of 15 N/ 14 N and 13 C/ 12 C from the standard materials) were measured in the following samples: (1) the integument plus the head of the 3rd instar larvae of both species reared in 1999 autumn fed with a mixture of cow dung and wood chips or with leaf mold, (2) cow dung, (3) wood ships, and (4) leaf mold as the larval food before onset of rearing. The δ values of bodies of larvae fed with leaf mold differed with the beetle species. The δ 15 N values of the larval bodies of both species fed with the mixture were close to those of cow dung, whereas the δ 13 C values were in between those of cow dung and wood chips. Therefore, both species were presumed to obtain almost all their nitrogen from cow dung, and their carbon from both dung and wood chips. (author)

  6. The effects of fouled anion resin on condensate polishing plant performance at Dungeness B power station

    International Nuclear Information System (INIS)

    Bates, Chris

    2008-01-01

    The return to power, after an outage, at Dungeness B Power Station was delayed because of problems in achieving an in-specification feedwater acid conductivity. Dungeness B has a full flow cation/mixed bed condensate polishing plant (CPP). Investigations showed that the acid conductivity was produced by carbon dioxide and organic impurities both by-passing the CPP and slipping through it. Resin analysis showed that the anion resin had severely impaired sulfate removal kinetics. The paper covers the work done to try and identify the nature and source of the organics and their effect on the anion resin. One significant finding was that the carbonate removal kinetics were as impaired as those for sulfate removal; this had not been previously experienced in the CPP at any British Energy plant. (orig.)

  7. A ΩXaV motif in the Rift Valley fever virus NSs protein is essential for degrading p62, forming nuclear filaments and virulence.

    Science.gov (United States)

    Cyr, Normand; de la Fuente, Cynthia; Lecoq, Lauriane; Guendel, Irene; Chabot, Philippe R; Kehn-Hall, Kylene; Omichinski, James G

    2015-05-12

    Rift Valley fever virus (RVFV) is a single-stranded RNA virus capable of inducing fatal hemorrhagic fever in humans. A key component of RVFV virulence is its ability to form nuclear filaments through interactions between the viral nonstructural protein NSs and the host general transcription factor TFIIH. Here, we identify an interaction between a ΩXaV motif in NSs and the p62 subunit of TFIIH. This motif in NSs is similar to ΩXaV motifs found in nucleotide excision repair (NER) factors and transcription factors known to interact with p62. Structural and biophysical studies demonstrate that NSs binds to p62 in a similar manner as these other factors. Functional studies in RVFV-infected cells show that the ΩXaV motif is required for both nuclear filament formation and degradation of p62. Consistent with the fact that the RVFV can be distinguished from other Bunyaviridae-family viruses due to its ability to form nuclear filaments in infected cells, the motif is absent in the NSs proteins of other Bunyaviridae-family viruses. Taken together, our studies demonstrate that p62 binding to NSs through the ΩXaV motif is essential for degrading p62, forming nuclear filaments and enhancing RVFV virulence. In addition, these results show how the RVFV incorporates a simple motif into the NSs protein that enables it to functionally mimic host cell proteins that bind the p62 subunit of TFIIH.

  8. Cow dung extract: a medium for the growth of pseudomonads enhancing their efficiency as biofertilizer and biocontrol agent in rice.

    Science.gov (United States)

    Srivastava, Rashmi; Aragno, Michel; Sharma, A K

    2010-09-01

    Some pseudomands are being utilized as biofertilizers and biopesticides because of their role in plant growth promotion and plant protection against root parasites, respectively. Two strains of Pseudomonas, P. jessenii LHRE62 and P. synxantha HHRE81, recovered from wheat rhizosphere, have shown their potential in field bioinoculation tests under rice-wheat and pulse-wheat rotation systems. Normally, pseudomonads are cultivated on synthetic media-like King's B and used for inoculation on seeds/soil drench with talcum or charcoal as carrier material. Cow dung is being used for different purposes from the ancient time and has a significant role in crop growth because of the content in humic compounds and fertilizing bioelements available in it. Here, cow dung extract was tested as a growth medium for strains LHRE62 and HHRE81, in comparison with growth in King's B medium. The log phase was delayed by 2 h as compared to growth in King's B medium. The bacterial growth yield, lower in plain cow dung extract as compared to King's B medium, was improved upon addition of different carbon substrates. Growth of rice var. Pant Dhan 4 in pot cultures was increased using liquid formulation of cow dung extract and bacteria as foliar spray, compared to their respective controls. Biocontrol efficacy of the bioagents was assessed by challenging rice crop with Rhizoctonia solani, a sheath blight pathogen. The growth promotion and biocontrol efficiencies were more pronounced in the case of mixed inocula of strains LHRE62 and HHRE81.

  9. What is the importance of open habitat in a predominantly closed forest area to the dung beetle (Coleoptera, Scarabaeinae assemblage?

    Directory of Open Access Journals (Sweden)

    Fábio C. Costa

    2013-09-01

    Full Text Available What is the importance of open habitat in a predominantly closed forest to the dung beetle assemblage? The Atlantic Forest in Brazil is one of the most highly disturbed ecosystems and is mainly represented by fragmented areas. However, in places where human disturbances have ceased, certain areas are showing a natural regeneration pattern. The aim of the present study was to determine how the dung beetle assemblage responds to distinct habitat structures in a fragment of Atlantic Forest. For such, open and closed forest areas were sampled in a fragment of the Atlantic Forest in the northeastern region of Brazil. Pitfall traps baited with excrement and carrion were used to collect the beetles. A total of 7,267 individuals belonging to 35 species were captured. Canthon chalybaeus and C. mutabilis were restricted to open areas. Nearly 90% of the individuals of C. aff. simulans and Deltochilum aff. irroratum were identified in these areas. A higher percentage (> 50% of Canthon staigi, Dichotomius aff. depressicolis and D. aff. sericeus occurred in closed areas. Abundance differed between areas, with higher values in closed areas. Richness was not influenced by the habitat structure. NMDS ordination exhibited the segregation of areas and ANOSIM confirmed that this variable explained the assemblage of dung beetle species. The findings of the present study validate that open areas are associated to more restrictive conditions, limiting a higher abundance of dung beetle. Although situated near preserved fragments, the studied open areas increase the heterogeneity of the general landscape.

  10. XaNSoNS: GPU-accelerated simulator of diffraction patterns of nanoparticles

    Directory of Open Access Journals (Sweden)

    V.S. Neverov

    2017-01-01

    Full Text Available XaNSoNS is an open source software with GPU support, which simulates X-ray and neutron 1D (or 2D diffraction patterns and pair-distribution functions (PDF for amorphous or crystalline nanoparticles (up to ∼107 atoms of heterogeneous structural content. Among the multiple parameters of the structure the user may specify atomic displacements, site occupancies, molecular displacements and molecular rotations. The software uses general equations nonspecific to crystalline structures to calculate the scattering intensity. It supports four major standards of parallel computing: MPI, OpenMP, Nvidia CUDA and OpenCL, enabling it to run on various architectures, from CPU-based HPCs to consumer-level GPUs.

  11. XaNSoNS: GPU-accelerated simulator of diffraction patterns of nanoparticles

    Science.gov (United States)

    Neverov, V. S.

    XaNSoNS is an open source software with GPU support, which simulates X-ray and neutron 1D (or 2D) diffraction patterns and pair-distribution functions (PDF) for amorphous or crystalline nanoparticles (up to ∼107 atoms) of heterogeneous structural content. Among the multiple parameters of the structure the user may specify atomic displacements, site occupancies, molecular displacements and molecular rotations. The software uses general equations nonspecific to crystalline structures to calculate the scattering intensity. It supports four major standards of parallel computing: MPI, OpenMP, Nvidia CUDA and OpenCL, enabling it to run on various architectures, from CPU-based HPCs to consumer-level GPUs.

  12. Experimental studies on effect of cow dung ash (pozzolanic binder) and coconut fiber on strengthproperties of concrete

    Science.gov (United States)

    Venkatasubramanian, C.; Muthu, D.; Aswini, G.; Nandhini, G.; Muhilini, K.

    2017-07-01

    The studies on durability of concrete have attracted attention in the recent years and its long term strength depends on quality of ingredients used in production of concrete. Now a days, the availability of ingredients is limited and in order to overcome this problem, research studies focuses on some alternate materials in the concrete production process. Also, Incorporation of waste materials consumes less energy leading to reduction of emission of green house gases. The application of fly ash and cow dung ash as a pozzolanic binder instead of cement and coir fibers finds extensive application in the manufacturing process of building materials. In this project an attempt has been made to utilize cow dung ash and coconut fiber as a replacement material of cement in the production of concrete. The cement is partially replaced with cow dung ash by about 2.5, 3 & 3.5 % by weight and with 1% of coconut fiber. The Compressive and Tensile strengths of concrete were found at different curing periods (7,14 & 28 days). From this study, it is inferred that these replacements will have a reasonable improvement in the strength properties of concrete by about 55-70%. The substitution of CDA, CF is economical in terms of cost and this usage eliminates the problem of landfills, reducing the environmental risk, maintaining the ecological balance, which is very much required for our nation.

  13. A Dung Beetle-like Leg and its Adaptive Neural Control

    DEFF Research Database (Denmark)

    Di Canio, Giuliano; Stoyanov, Stoyan; Larsen, Jørgen Christian

    2016-01-01

    Dung beetles show fascinating locomotion abilities. They can use their legs to not only walk but also manipulate objects. Furthermore, they can perform their leg movements at a proper frequency with respect to their biomechanical properties and quickly adapt the movements to deal with external pe...... also apply adaptive neural control, based on a central pattern generator (CPG) circuit with synaptic plasticity, to autonomously generate a proper stepping frequency of the leg. The controller can also adapt the leg movement to deal with external perturbations within a few steps....

  14. The role of cow dung and kitchen manure composts and their non-aerated compost teas in reducing the incidence of foliar diseases of Lycopersicon esculentum (Mill

    Directory of Open Access Journals (Sweden)

    A. Ngakou

    2014-06-01

    Full Text Available Compost teas are fermented watery extracts of composted materials used for their beneficial effect on plants. A study was conducted in the field to compare the efficacy of cow dung and kitchen manure composts and their derived non-aerated compost teas on disease symptoms expression and severity of Lycopersicon esculentum. The experimental layout was a complete randomised block design comprising six treatments, each of which was repeated three times: the negative control plot (Tm-; the positive control or fungicide plot (Tm+; the cow dung compost plot (Cpi; the kitchen manure compost plot (Cpii; the compost tea derived cow dung plot (Tci; and the compost tea derived kitchen manure plot (Tcii. Compost tea derived cow dung was revealed to be richer in elemental nutrients (N, P, K than compost tea from kitchen manure, and significantly (p < 0.0001 enhanced fruit yield per plant. Similarly, the two composts and their derived compost teas significantly (p < 0.0001 reduced the incidence and severity of disease symptoms compared to the controls, with the highest efficacy accounting for cow dung compost and compost tea. Although the non-aerated compost teas were not amended with micro-organisms, these results suggest that the two compost teas in use were rich enough in microbial pathogen antagonists, and therefore, are perceived as potential alternatives to synthetic chemical fungicides. Future work will attempt to identify these microbial antagonists with highly suppressive activity in the non-aerated compost teas.

  15. Impacts of feedlot floor condition, deposition frequency, and inhibitors on N2O and CH4 emissions from feedlot dung and urine patches.

    Science.gov (United States)

    Liao, Wenhua; Liu, Chunjing; Gao, Zhiling

    2018-04-09

    Patches of dung and urine are major contributors to the feedlot gas emissions. This study investigated the impacts of dung deposition frequency (partly reflecting animal stocking density of a feedlot), dairy feedlot floor conditions (old floor indicated with the presence of consolidated manure pad [CMP] vs. new floor with the absence of consolidated manure pad [CMPn]), and application of dicyandiamide (DCD) and hydroquinone (HQ) on nitrous oxide (N 2 O) and methane (CH 4 ) emissions from patches in the laboratory, and the integrative impacts were expressed in terms of global warming potential (CO 2 -equivalent). Dung deposition frequency, feedlot floor condition, and application of inhibitors showed inverse impacts on N 2 O and CH 4 emissions from patches. Greenhouse gas (GHG) emissions from the dung, urine, and dung+urine patches on the CMP feedlot surface were approximately 7.48, 87.35, and 7.10 times those on the CMPn feedlot surface (P emissions from CMP and CMPn feedlot surfaces under high deposition frequency condition were approximately 10 and 1.7 times those under low-frequency condition. Moreover, application of HQ slightly reduced the GHG emission from urine patches, by 14.9% (P > 0.05), while applying DCD or DCD+HQ significantly reduced the GHG, by 60.3% and 65.0%, respectively (P emission factors for feedlots. In the future, field measurements to quantitatively evaluate the relative contribution of nitrification and denitrification to the N 2 O emissions of feedlot surfaces are highly required for effective N 2 O control. This study shows that feedlot CH 4 and N 2 O emissions inversely respond to the dicyandiamide (DCD) application. Applying DCD significantly reduces GHG emissions of feedlot urine patches. Feedlot floor condition and stocking density strongly impact feedlot GHG emissions. Including feedlot floor condition and stocking density in the feedlot EF determining process is necessary.

  16. Analysis of nucleotide diversity among alleles of the major bacterial blight resistance gene Xa27 in cultivars of rice (Oryza sativa) and its wild relatives.

    Science.gov (United States)

    Bimolata, Waikhom; Kumar, Anirudh; Sundaram, Raman Meenakshi; Laha, Gouri Shankar; Qureshi, Insaf Ahmed; Reddy, Gajjala Ashok; Ghazi, Irfan Ahmad

    2013-08-01

    Xa27 is one of the important R-genes, effective against bacterial blight disease of rice caused by Xanthomonas oryzae pv. oryzae (Xoo). Using natural population of Oryza, we analyzed the sequence variation in the functionally important domains of Xa27 across the Oryza species. DNA sequences of Xa27 alleles from 27 rice accessions revealed higher nucleotide diversity among the reported R-genes of rice. Sequence polymorphism analysis revealed synonymous and non-synonymous mutations in addition to a number of InDels in non-coding regions of the gene. High sequence variation was observed in the promoter region including the 5'UTR with 'π' value 0.00916 and 'θ w ' = 0.01785. Comparative analysis of the identified Xa27 alleles with that of IRBB27 and IR24 indicated the operation of both positive selection (Ka/Ks > 1) and neutral selection (Ka/Ks ≈ 0). The genetic distances of alleles of the gene from Oryza nivara were nearer to IRBB27 as compared to IR24. We also found the presence of conserved and null UPT (upregulated by transcriptional activator) box in the isolated alleles. Considerable amino acid polymorphism was localized in the trans-membrane domain for which the functional significance is yet to be elucidated. However, the absence of functional UPT box in all the alleles except IRBB27 suggests the maintenance of single resistant allele throughout the natural population.

  17. Anti-Diabetic Effects of Dung Beetle Glycosaminoglycan on db Mice and Gene Expression Profiling.

    Science.gov (United States)

    Ahn, Mi Young; Kim, Ban Ji; Yoon, Hyung Joo; Hwang, Jae Sam; Park, Kun-Koo

    2018-04-01

    Anti-diabetes activity of Catharsius molossus (Ca, a type of dung beetle) glycosaminoglycan (G) was evaluated to reduce glucose, creatinine kinase, triglyceride and free fatty acid levels in db mice. Diabetic mice in six groups were administrated intraperitoneally: Db heterozygous (Normal), Db homozygous (CON), Heuchys sanguinea glycosaminoglycan (HEG, 5 mg/kg), dung beetle glycosaminoglycan (CaG, 5 mg/kg), bumblebee ( Bombus ignitus ) queen glycosaminoglycan (IQG, 5 mg/kg) and metformin (10 mg/kg), for 1 month. Biochemical analyses in the serum were evaluated to determine their anti-diabetic and anti-inflammatory actions in db mice after 1 month treatment with HEG, CaG or IQG treatments. Blood glucose level was decreased by treatment with CaG. CaG produced significant anti-diabetic actions by inhiting creatinine kinase and alkaline phosphatase levels. As diabetic parameters, serum glucose level, total cholesterol and triglyceride were significantly decreased in CaG5-treated group compared to the controls. Dung beetle glycosaminoglycan, compared to the control, could be a potential therapeutic agent with anti-diabetic activity in diabetic mice. CaG5-treated group, compared to the control, showed the up-regulation of 48 genes including mitochondrial yen coded tRNA lysine (mt-TK), cytochrome P450, family 8/2, subfamily b, polypeptide 1 (Cyp8b1), and down-regulation of 79 genes including S100 calcium binding protein A9 (S100a9) and immunoglobulin kappa chain complex (Igk), and 3-hydroxy-3-methylglutaryl-CoenzymeAsynthase1 (Hmgcs1). Moreover, mitochondrial thymidine kinase (mt-TK), was up-regulated, and calgranulin A (S100a9) were down-regulated by CaG5 treatment, indicating a potential therapeutic use for anti-diabetic agent.

  18. Ammonia volatilization from artificial dung and urine patches measured by the equilibrium concentration technique (JTI method)

    Science.gov (United States)

    Saarijärvi, K.; Mattila, P. K.; Virkajärvi, P.

    The aim of this study was to investigate the dynamics of ammonia (NH 3) volatilization from intensively managed pastures on a soil type typical of the dairy production area in Finland and to clarify the effect of rainfall on NH 3 volatilization. The study included two experiments. In Experiment 1 the total amount of NH 3-N emitted was calculated based on the annual surface coverage of dung (4%) and urine (17%). The application rate of total N in the simulated dung and urine patches was approximately 47 g N m -2 and 113 g N m -2, respectively. In Experiment 1 the general level of NH 3 emissions from the urine patches was high and the peak volatilization rate was 0.54 g NH 3-N m -2 h -1. As expected, emissions from the dung pats were clearly lower with a maximum rate of 0.10 g NH 3-N m -2 h -1. The total emission calculated for the whole pasture area (stocking rate four cows ha -1 y -1, urine coverage 17% and dung coverage 4%) was 16.1 kg NH 3-N ha -1. Approximately 96% of the total emission originated from urine. In Experiment 2 we measured the emissions from urine only and the treatments on the urine patches were: (1) no irrigation, (2) 5+5 mm and (3) 20 mm irrigation. The peak emission rates were 0.13, 0.09 and 0.04 g NH 3-N m -2 h -1 and the total emissions were 6.9, 3.0 and 1.7 kg NH 3-N ha -1, for treatments (1), (2) and (3), respectively. In both measurements over 80% of the total emission occurred during the first 48 h and there was a clear diurnal rhythm. Increasing rainfall markedly decreased NH 3 emission. Volatilization was highest with dry and warm soil. The JTI method appeared to be suitable for measuring NH 3 volatilization in this kind of experiment. According to our results, the importance of pastures as a source of NH 3 emission in Finland is minor.

  19. Daboxin P, a Major Phospholipase A2 Enzyme from the Indian Daboia russelii russelii Venom Targets Factor X and Factor Xa for Its Anticoagulant Activity.

    Directory of Open Access Journals (Sweden)

    Maitreyee Sharma

    Full Text Available In the present study a major protein has been purified from the venom of Indian Daboia russelii russelii using gel filtration, ion exchange and Rp-HPLC techniques. The purified protein, named daboxin P accounts for ~24% of the total protein of the crude venom and has a molecular mass of 13.597 kDa. It exhibits strong anticoagulant and phospholipase A2 activity but is devoid of any cytotoxic effect on the tested normal or cancerous cell lines. Its primary structure was deduced by N-terminal sequencing and chemical cleavage using Edman degradation and tandem mass spectrometry. It is composed of 121 amino acids with 14 cysteine residues and catalytically active His48 -Asp49 pair. The secondary structure of daboxin P constitutes 42.73% of α-helix and 12.36% of β-sheet. It is found to be stable at acidic (pH 3.0 and neutral pH (pH 7.0 and has a Tm value of 71.59 ± 0.46°C. Daboxin P exhibits anticoagulant effect under in-vitro and in-vivo conditions. It does not inhibit the catalytic activity of the serine proteases but inhibits the activation of factor X to factor Xa by the tenase complexes both in the presence and absence of phospholipids. It also inhibits the tenase complexes when active site residue (His48 was alkylated suggesting its non-enzymatic mode of anticoagulant activity. Moreover, it also inhibits prothrombinase complex when pre-incubated with factor Xa prior to factor Va addition. Fluorescence emission spectroscopy and affinity chromatography suggest the probable interaction of daboxin P with factor X and factor Xa. Molecular docking analysis reveals the interaction of the Ca+2 binding loop; helix C; anticoagulant region and C-terminal region of daboxin P with the heavy chain of factor Xa. This is the first report of a phospholipase A2 enzyme from Indian viper venom which targets both factor X and factor Xa for its anticoagulant activity.

  20. Stage- and sex-specific heat tolerance in the yellow dung fly Scathophaga stercoraria

    OpenAIRE

    Blanckenhorn Wolf U.; Gautier Roland; Nick Marcel; Puniamoorthy Nalini; Schäfer Martin A.

    2014-01-01

    Thermal tolerance varies at all hierarchical levels of biological organization: among species populations individuals and even within individuals. Age or developmental stage and sex specific thermal effects have received relatively little attention in the literature despite being crucial for understanding thermal adaptation in nature and responses to global warming. We document stage and sex specific heat tolerance in the yellow dung fly Scathophaga stercoraria (Diptera: Scathophagidae) a...

  1. Identification of potent orally active factor Xa inhibitors based on conjugation strategy and application of predictable fragment recommender system.

    Science.gov (United States)

    Ishihara, Tsukasa; Koga, Yuji; Iwatsuki, Yoshiyuki; Hirayama, Fukushi

    2015-01-15

    Anticoagulant agents have emerged as a promising class of therapeutic drugs for the treatment and prevention of arterial and venous thrombosis. We investigated a series of novel orally active factor Xa inhibitors designed using our previously reported conjugation strategy to boost oral anticoagulant effect. Structural optimization of anthranilamide derivative 3 as a lead compound with installation of phenolic hydroxyl group and extensive exploration of the P1 binding element led to the identification of 5-chloro-N-(5-chloro-2-pyridyl)-3-hydroxy-2-{[4-(4-methyl-1,4-diazepan-1-yl)benzoyl]amino}benzamide (33, AS1468240) as a potent factor Xa inhibitor with significant oral anticoagulant activity. We also reported a newly developed Free-Wilson-like fragment recommender system based on the integration of R-group decomposition with collaborative filtering for the structural optimization process. Copyright © 2014 Elsevier Ltd. All rights reserved.

  2. Diversity and community structure of dung beetles (Coleoptera: Scarabaeinae associated with semi-urban fragmented agricultural land in the Malabar coast in southern India

    Directory of Open Access Journals (Sweden)

    K.S. Venugopal

    2012-07-01

    Full Text Available An evaluation of the diversity and community structure of dung beetles associated with semiurban agricultural land in the Malabar coast of southern India revealed that urbanization has led to decreased diversity compared to regional forests, and has affected the community status of dung beetles. However, contrary to expectations, species richness was observed to be equivalent to rural agricultural fields in the region. Low abundance of prominent agricultural habitat species indicates that the study area has changed as a result of habitat modification/urbanization, and the prevailing conditions are not ideal for the establishment of the most common species in agriculture belts. Prominence of two less common species, Tiniocellus spinipes and Caccobius vulcanus, indicates these generalist urban adaptable (synanthropic species have become increasingly widespread and locally abundant. The low abundance of tunnelers and rollers is attributed to fragmentation of the urban agricultural belt, low mammalian diversity and dung availability, and the hard nature of the laterite soil in the Malabar coast region.

  3. Changes in the chemical characteristics of water-extracted organic matter from vermicomposting of sewage sludge and cow dung.

    Science.gov (United States)

    Xing, Meiyan; Li, Xiaowei; Yang, Jian; Huang, Zhidong; Lu, Yongsen

    2012-02-29

    The chemical changes of water-extractable organic matter (WEOM) from five different substrates of sewage sludge enriched with different proportions of cow dung after vermicomposting with Eisenia fetida were investigated using various analytical approaches. Results showed that dissolved organic carbon, chemical oxygen demand, and C/N ratio of the substrates decreased significantly after vermicomposting process. The aromaticity of WEOM from the substrates enhanced considerably, and the amount of volatile fatty acids declined markedly, especially for the cow dung substrate. Gel filtration chromatography analysis showed that the molecular weight fraction between 10(3) and 10(6) Da became the main part of WEOM in the final product. 1H nuclear magnetic resonance spectra revealed that the proportion of H moieties in the area of 0.00-3.00 ppm decreased, while increasing at 3.00-4.25 ppm after vermicomposting. Fluorescence spectra indicated that vermicomposting caused the degradation of protein-like groups, and the formation of fulvic and humic acid-like compounds in the WEOM of the substrates. Overall results indicate clearly that vermicomposting promoted the degradation and transformation of liable WEOM into biological stable substances in sewage sludge and cow dung alone, as well as in mixtures of both materials, and testing the WEOM might be an effective way to evaluate the biological maturity and chemical stability of vermicompost. Copyright © 2011 Elsevier B.V. All rights reserved.

  4. Does selective logging stress tropical forest invertebrates? Using fat stores to examine sublethal responses in dung beetles.

    Science.gov (United States)

    França, Filipe; Barlow, Jos; Araújo, Bárbara; Louzada, Julio

    2016-12-01

    The increased global demand for tropical timber has driven vast expanses of tropical forests to be selectively logged worldwide. While logging impacts on wildlife are predicted to change species distribution and abundance, the underlying physiological responses are poorly understood. Although there is a growing consensus that selective logging impacts on natural populations start with individual stress-induced sublethal responses, this literature is dominated by investigations conducted with vertebrates from temperate zones. Moreover, the sublethal effects of human-induced forest disturbance on tropical invertebrates have never been examined. To help address this knowledge gap, we examined the body fat content and relative abundance of three dung beetle species (Coleoptera: Scarabaeinae) with minimum abundance of 40 individuals within each examined treatment level. These were sampled across 34 plots in a before-after control-impact design (BACI) in a timber concession area of the Brazilian Amazon. For the first time, we present evidence of logging-induced physiological stress responses in tropical invertebrates. Selective logging increased the individual levels of fat storage and reduced the relative abundance of two dung beetle species. Given this qualitative similarity, we support the measurement of body fat content as reliable biomarker to assess stress-induced sublethal effects on dung beetles. Understanding how environmental modification impacts the wildlife has never been more important. Our novel approach provides new insights into the mechanisms through which forest disturbances impose population-level impacts on tropical invertebrates.

  5. First Steps in the Direction of Synthetic, Allosteric, Direct Inhibitors of Thrombin and Factor Xa

    OpenAIRE

    Verghese, Jenson; Liang, Aiye; Sidhu, Preet Pal Singh; Hindle, Michael; Zhou, Qibing; Desai, Umesh R.

    2009-01-01

    Designing non-saccharide functional mimics of heparin is a major challenge. In this work, a library of small, aromatic molecules based on the sulfated DHP scaffold was synthesized and screened against thrombin and factor Xa. The results reveal that i) selected monomeric benzofuran derivatives inhibit the two enzymes, albeit weakly; ii) the two enzymes recognize different structural features in the benzofurans studied suggesting significant selectivity of recognition; and iii) the mechanism of...

  6. Anaerobic Co-digestion of Cow Dung and Rice Straw to Produce Biogas using Semi-Continuous Flow Digester: Effect of Urea Addition

    Science.gov (United States)

    Haryanto, A.; Sugara, B. P.; Telaumbanua, M.; Rosadi, R. A. B.

    2018-05-01

    The objective this research was to investigate the effect of urea addition on the biogas yield from co-digestion of rice straw and cow dung using semi-continuous anaerobic digester. The experiment was conducted by using self-made semi-continuous anaerobic digester having a working volume of 30 L. Cow dung was provided from Department of Animal Husbandry, University of Lampung; while rice straw was collected from farmer at Way Galih, Tanjung Bintang, South Lampung. Rice straw was sun-dried to about 12% of moisture content and then ground into fine particles. Cow dung and ground straw were mixed at a dung-to-straw ratio of 3:1 based on total solid (TS) and four different urea additions (0, 0.25, 0.65, and 1.30 g/L) were applied to have a C/N ratio between 20 and 30. The mixture was diluted with water to create TS content of 10%. As much as 30 L of the substrate mixture was introduced into the digester as a starting load. The same substrate was added daily at a loading rate of 0.5 L/d. The experiment was made in triplicate and observation was performed for two months. Total and volatile solids of influent and effluent and daily biogas production were observed. The biogas quality was measured by its methane content using gas chromatography. Results showed that urea addition influenced the biogas yield and its quality. Substrate mixture with urea addition of 0.25 g/L (C/N ratio of 27.3) was the best in terms of biogas yield (434.2 L/kgVSr), methane content (50.12%), and methane yield (217.6 L/kgVSr).

  7. The night and day of dung beetles (Coleoptera, Scarabaeidae in the Serra do Japi, Brazil: elytra colour related to daily activity

    Directory of Open Access Journals (Sweden)

    Malva Isabel Medina Hernández

    2002-01-01

    Full Text Available In the present study 387 dung beetles (Coleoptera: Scarabaeidae were surveyed at the Serra do Japi, in the Atlantic Forest in São Paulo State, with four baited pitfall traps during the months of December, 1998, and January, 1999 during eight 24 hour cycles. A total of 30 species were identified and temporal variation in activity patterns among the species shows a specialization in the use of food resources: 9 species were classified as nocturnal and 13 as diurnal. The daily activity pattern of dung beetles does not necessarily correspond to the taxonomic classification, but is strongly related to the colouring of species, determined by predominant elytra colour: nocturnal species have 89 % more chances of being black as opposed to colourful. Black nocturnal species might have evolved as an interspecific adaptation to avoid predation (cryptic colouring. Among the colourful diurnal dung beetles, measure of body length of each species shows that development of bright colouring was more often found in medium to large species, which suggests that colouring evolved as a response to intraspecific pressures, important in agonistic encounters among males.

  8. Variations in dung beetles assemblages (Coleoptera: Scarabaeidae within two rain forest habitats in French Guiana

    Directory of Open Access Journals (Sweden)

    François Feer

    2013-06-01

    Full Text Available The structure of dung beetle communities inhabiting tropical forests are known to be sensitive to many kinds of environmental changes such as microclimate related to vegetation structure. I examined Scarabaeinae assemblages in two sites of undisturbed high forest and two sites of low forest forming a transitional zone with the open habitat of an inselberg in French Guiana. Sampling was made with pitfall and flight interception traps during 2003 and 2004. The driest and warmest conditions characterized the low forest sites. Across two years we obtained 2 927 individuals from 61 species with pitfall traps and 1 431 individuals from 85 species with flight interception traps. Greater species richness and abundance characterized all sites sampled with pitfall traps during 2003 more than 2004. In 2003 no differences were detected among sites by rarefaction analyses. In 2004 the species richest high forest site was significantly different from one of the low forest sites. For both years Clench model asymptotes for species richness were greater in high forest than in low forest sites. For both years, mean per-trap species richness, abundance and biomass among high forest sites were similar and higher than in low forest sites, especially where the lowest humidity and the highest temperature were recorded. Within the two low forest sites, species richness and abundance recorded during the second year, decreased with distance to edge. Different dominant roller species characterized the pitfall samples in one site of low forest and in other sites. Small variations in microclimatic conditions correlated to canopy height and openness likely affected dung beetle assemblages but soil depth and the presence of large mammals providing dung resource may also play a significant role.

  9. Anaerobic Biodegradability and Methane Potential of Crop Residue Co-Digested with Buffalo Dung

    Directory of Open Access Journals (Sweden)

    Abdul Razaque Sahito

    2013-07-01

    Full Text Available ABD (Anaerobic Biodegradability and BMP (Biochemical Methane Potential of banana plant waste, canola straw, cotton stalks, rice straw, sugarcane trash and wheat straw co-digested with buffalo dung was evaluated through AMPTS (Automatic Methane Potential Test System. The substrates were analyzed for moisture, TS (Total Solids and VS (Volatile Solids, ultimate analysis (CHONS, pH and TA (Total Alkalinity. The BMPobserved during incubation of 30 days at the temperature of 37±0.2°C was 322 Nml CH4/g VSadd for wheat straw followed by 260, 170, 149, 142 and 138 Nml CH4/gVSadd for canola straw, rice straw, cotton stalks, banana plant waste and sugarcane trash respectively, whereas the maximum theoretical BMP was 481 Nml CH4/gVSadd for cotton stalks, followed by 473, 473, 446, 432 and 385 Nml CH4/gVSadd for wheat straw, banana plant waste, canola straw, rice straw and sugarcane trash respectively. The percentage ABD values were in the range of 68-30%. In addition to this, the effect of lignin content in the crop residue was evaluated on the ABD. The results of this study indicate that, the co-digestion of the crop residues with buffalo dung is feasible for production of renewable methane

  10. Contribution of Alpha and Beta Diversity Across Land-Use Type to the Regional Diversity of Dung Beetles in Central Sulawesi

    Directory of Open Access Journals (Sweden)

    SHAHABUDDIN

    2013-06-01

    Full Text Available The importance of spatial scale has been acknowledged as one of determining factors of species diversity in local and regional diversity. The aim of this study was to evaluate contribution of alpha (α and beta (β diversity across land-use type to gamma (γ diversity at the margins of tropical forest in Central Sulawesi using dung beetles (Coleoptera: Scarabaeidae as a focal group. Baited pitfall traps set in four land-use types ranging from natural forest through cacao agroforestry systems to open areas during two years of sampling (2009 and 2012. A total of 28 dung beetle species belonging to four genera were captured during the study period. The results showed that contribution of β diversity was higher than that of α diversity of dung beetles. Each land-use type contributed about 56.5 to 62.5% of the total species richness (γ diversity. The similar pattern of biodiversity between each spatial scale and during the two sampling years emphasized the large contribution of each land-use type to maintaining a high portion of the regional species richness. It suggests the importance of managing other land-use types, such as secondary forest and agroforestry as well as protecting the remaining natural forests.

  11. Finding refuge: the estuarine distribution of the nemertean egg predator Carcinonemertes errans on the Dungeness crab, Cancer magister

    DEFF Research Database (Denmark)

    Dunn, Paul; Young, Craig

    2013-01-01

    Parasites can significantly impact ecosystems by altering the distributions and population sizes of their host organisms. Some hosts are thought to find refuge from parasitism by entering habitats where their parasites cannot survive. The nemertean worm Carcinonemertes errans is an egg predator...... that infects the Dungeness crab, Cancer magister, throughout the host’s range. To determine if C. magister experiences a refuge from C. errans within estuarine environments, we examined the distribution of C. errans on Dungeness crabs within Oregon’s Coos Bay Estuary. Year-round sampling over a three......-year period also allowed us to test for temporal variation in the parasite’s distribution.We found that parasite prevalence, mean intensity, and parasite density of C. errans infecting C. magister varied along a clear estuarine gradient, with crabs nearest the ocean carrying the heaviest parasite loads...

  12. State Equation Determination of Cow Dung Biogas

    Science.gov (United States)

    Marzuki, A.; Wicaksono, L. B.

    2017-08-01

    A state function is a thermodynamic function which relates various macroscopically measurable properties of a system (state variable) describing the state of matter under a given set of physical conditions. A good understanding of a biogas state function plays a very important role in an effort to maximize biogas processes and to help predicting combation performance. This paper presents a step by step process of an experimental study aimed at determining the equation of state of cow dung biogas. The equation was derived from the data obtained from the experimental results of compressibility (κ) and expansivity (β) following the general form of gas state equation dV = βdT + κdP. In this equation, dV is gas volume variation, dT is temperature variation, and dP is pressure variation. From these results, we formulated a unique state equation from which the biogas critical temperature (Tc) and critical pressure were then determined (Tc = 266.7 K, Pc = 5096647.5 Pa).

  13. Effects of ivermectin application on the diversity and function of dung and soil fauna: Regulatory and scientific background information

    DEFF Research Database (Denmark)

    Adler, Nicole; Blanckenhorn, Wolf U; Bachmann, Jean

    2016-01-01

    for veterinary medicinal products in the European Union includes a requirement for higher-tier tests when adverse effects on dung organisms are observed in single-species toxicity tests. However, no guidance documents for the performance of higher-tier tests are available. Hence, an international research...... on communities of dung-breeding insects and soil fauna under field conditions, the test method meets the requirements of a higher-tier test as mandated by the European Union. The present study provides contextual information on authorization requirements for veterinary medicinal products and on the structure...... project was undertaken to develop and validate a proposed test method under varying field conditions of climate, soil, and endemic coprophilous fauna at Lethbridge (Canada), Montpellier (France), Zurich (Switzerland), and Wageningen (The Netherlands). The specific objectives were to determine if fecal...

  14. Sorption of activation products on London clay and Dungeness aquifer gravel

    International Nuclear Information System (INIS)

    Baston, G.M.N.; Berry, J.A.; Littleboy, A.K.; Pilkington, N.J.

    1992-01-01

    The sortpion of a series of activation-product radionuclides onto London clay and Dungeness aquifer gravel from the nuclear reactor sites at Bradwell and Dungeness, has been examined. Batch sorption and through-diffusion experiments with clay determined chlorine as the chloride ion to be effectively non-sorbing; calcium to be weakly sorbing, whereas cobalt, nickel, niobium and samarium were moderately to strongly sorbing and silver was strongly sorbing. Distribution ratios (R D values) for Nb, Sm and Ag were found to have a strong dependence on the liquid-solid separation technique employed. The presence of high concentrations of calcium hydroxide led to lower values of R D for radioactive Ca but higher R D values for Sm and Ag. The sorption of Ni showed no apparent dependence on groundwater composition at low levels of dissolved organic carbon (DOC). The values of R D for Co decreased as the DOC content was increased by addition of humic materials. Batch sorption studies with aquifer gravel demonstrated that Ca is weakly sorbing whereas Nb, Ag and Eu are moderately to strongly sorbing. R D values for Ca and for Ag under neutral pH conditions show little sensitivity to the liquid/solid separation technique used. However, R D values for Nb and Eu under neutral pH conditions and for Ag in alkaline solution (pH = 11 - 12) show a marked effect. The aquifer gravel was found to be highly inhomogeneous unlike the clay and sorption was greatest on samples with a high proportion of sand, reflecting the clay mineral content. (orig.)

  15. Seasonality in the dung beetle community in a Brazilian tropical dry forest: Do small changes make a difference?

    Science.gov (United States)

    Medina, Anderson Matos; Lopes, Priscila Paixão

    2014-01-01

    Dung beetle (Coleoptera: Scarabaeoidea: Scarabaeinae) activity is influenced by rainfall seasonality. We hypothesized that rainfall might also play a major role in regulating the community structure of this group. In this study, we describe seasonal changes in the richness, composition, and structure of the Scarabaeinae community in a Brazilian tropical dry forest. A fragment of arboreal Caatinga was sampled using baited pitfall traps during the early dry season (EDS), late dry season (LDS), early wet season (EWS), and middle wet season (MWS). We compared the dung beetle community in each season in relationship to species richness, rank-dominance, curves, and composition. We collected 1352 Scarabaeinae individuals , belonging to 15 species. Dichotomius aff. laevicollis Felsche (Coleoptera: Scarabaeidae) was the dominant species, representing 73.89% of the individuals. There were no seasonal changes in the rank dominance curves; all had a single dominant species and a few species with low abundance, typical for arid areas. Estimated richness was highest in MWS, followed by EWS. Dry-season samples (EDS and LDS) had lower richness, with no significant difference between the dry seasons. Although species richness increased as the habitat became wetter, the difference between the wet and dry seasons was small, which differs completely from the findings of other studies in Neotropical dry forests, where almost all species cease activities in the dry season. Species composition changes were found in non-metric multidimensional scaling and sustained by analysis of similarity. All the seasons had pairwise differences in composition, with the exception of EDS and MWS, which indicates that the dung beetle community in this fragment requires more than three months of drought to trigger changes in species composition; this is probably due to small changes in the forest canopy. There was no difference in composition between EDS and MWS. As in other tropical dry forests, although

  16. Dung beetles in a Caatinga Natural Reserve: a threatened Brazilian dry-forest with high biological value

    Directory of Open Access Journals (Sweden)

    Letícia Vieira

    2017-12-01

    Full Text Available ABSTRACT The Caatinga is an endemic and threatened dry-forest biome distributed across northern Brazil. We evaluated the conservation value of a Caatinga Natural Reserve (NR - Floresta Nacional (FLONA Contendas do Sincorá - using Scarabaeinae dung beetles as a biodiversity indicator. Specifically, we contrasted two zones impacted by two distinct intensity of selective logging that happened inside the NR until 1997. Dung beetles were collected 14 years after logging, using baited pitfall traps within three main habitats (riparian forest, regenerating Caatinga or arboreal Caatinga found in two zones (Preservation and Management Zones. A total of 1,214 individuals from 21 species were sampled. The two zones presented distinct species composition, although the habitats did not exhibit such differences. Our results indicated that the secondary areas are in a conservation status similar to arboreal Caatinga and riparian forest, 14 y after logging. Furthermore, we identified seven habitat-indicator species, two of them typical to Caatinga biome, highlighting the importance of updates in NR management plan considering the Scarabaeinae regional diversity management.

  17. Assessment of anti-factor Xa activity of enoxaparin for venous thromboembolism prophylaxis in morbidly obese surgical patients

    Directory of Open Access Journals (Sweden)

    Nouf Al Otaib

    2017-01-01

    Conclusions: Weight-based enoxaparin dose led to the anticipated peak anti-Xa levels (0.2–0.6 IU/mL in most of the morbidly obese study patients undergoing surgery without any evidence of major side effects. The weight-based dosing of enoxaparin was also effective in preventing VTE in all patients. Although these results are promising, further comparative trials are needed in the setting of morbidly obese surgical patients.

  18. Anaerobic biodegradability and methane potential of crop residue co-digested with buffalo dung

    International Nuclear Information System (INIS)

    Sahito, A.R.; Mahar, R.B.; Brohi, K.M.

    2013-01-01

    ABD (Anaerobic Biodegradability) and BMP (Biochemical Methane Potential) of banana plant waste, canola straw, cotton stalks, rice straw, sugarcane trash and wheat straw co-digested with buffalo dung was evaluated through AMPTS (Automatic Methane Potential Test System). The substrates were analyzed for moisture, TS (Total Solids) and VS (Volatile Solids), ultimate analysis (CHONS), pH and TA (Total Alkalinity). The BMP/sub observed/ during incubation of 30 days at the temperature of 37+-0.2+-degree C was 322 Nml CH4/g VSadd for wheat straw followed by 260, 170, 149, 142 and 138 Nml CH4/gVS/sub add/ for canola straw, rice straw, cotton stalks, banana plant waste and sugarcane trash respectively, whereas the maximum theoretical BMP was 481 Nml CH/sub 4//gVS/sub add/ for cotton stalks, followed by 473, 473, 446, 432 and 385 Nml CH/sub 4//gVS/sub add/ for wheat straw, banana plant waste, canola straw, rice straw and sugarcane trash respectively. The percentage ABD values were in the range of 68-30%. In addition to this, the effect of lignin content in the crop residue was evaluated on the ABD. The results of this study indicate that, the co-digestion of the crop residues with buffalo dung is feasible for production of renewable methane. (author)

  19. Tubers, grains, dung and wood: studying hearth contents at the early Natufian Shubayqa 1 (north-eastern Jordan)

    DEFF Research Database (Denmark)

    Otaegui, Amaia Arranz; Richter, Tobias

    macroremains found in situ in two stone-made hearth structures dating to the early Natufian. The content of the hearths includes a large variety of plant macroremains comprising more than 45,000 rhizome tuber remains, wild plant seeds, including wild wheat and barley, dung remains and large numbers of wood...

  20. Scale-Dependence of Processes Structuring Dung Beetle Metacommunities Using Functional Diversity and Community Deconstruction Approaches

    Science.gov (United States)

    da Silva, Pedro Giovâni; Hernández, Malva Isabel Medina

    2015-01-01

    Community structure is driven by mechanisms linked to environmental, spatial and temporal processes, which have been successfully addressed using metacommunity framework. The relative importance of processes shaping community structure can be identified using several different approaches. Two approaches that are increasingly being used are functional diversity and community deconstruction. Functional diversity is measured using various indices that incorporate distinct community attributes. Community deconstruction is a way to disentangle species responses to ecological processes by grouping species with similar traits. We used these two approaches to determine whether they are improvements over traditional measures (e.g., species composition, abundance, biomass) for identification of the main processes driving dung beetle (Scarabaeinae) community structure in a fragmented mainland-island landscape in southern Brazilian Atlantic Forest. We sampled five sites in each of four large forest areas, two on the mainland and two on the island. Sampling was performed in 2012 and 2013. We collected abundance and biomass data from 100 sampling points distributed over 20 sampling sites. We studied environmental, spatial and temporal effects on dung beetle community across three spatial scales, i.e., between sites, between areas and mainland-island. The γ-diversity based on species abundance was mainly attributed to β-diversity as a consequence of the increase in mean α- and β-diversity between areas. Variation partitioning on abundance, biomass and functional diversity showed scale-dependence of processes structuring dung beetle metacommunities. We identified two major groups of responses among 17 functional groups. In general, environmental filters were important at both local and regional scales. Spatial factors were important at the intermediate scale. Our study supports the notion of scale-dependence of environmental, spatial and temporal processes in the distribution

  1. Alboserpin, a Factor Xa Inhibitor from the Mosquito Vector of Yellow Fever, Binds Heparin and Membrane Phospholipids and Exhibits Antithrombotic Activity

    Czech Academy of Sciences Publication Activity Database

    Calvo, E.; Mizurini, D.M.; Sa-Nunes, A.; Ribeiro, J.M.C.; Andersen, J. F.; Mans, B.J.; Monteiro, R.Q.; Kotsyfakis, Michalis; Francischetti, I.M.B.

    2011-01-01

    Roč. 286, č. 32 (2011), 27998-28010 ISSN 0021-9258 Institutional research plan: CEZ:AV0Z60220518 Keywords : serpin * mosquito * Aedes albopictus * phospholipids * Factor Xa * heparin * binding affinity * coagulation * thrombus * bleeding Subject RIV: GJ - Animal Vermins ; Diseases, Veterinary Medicine Impact factor: 4.773, year: 2011

  2. Sorption of activation products on London clay and Dungeness aquifer gravel

    Energy Technology Data Exchange (ETDEWEB)

    Baston, G.M.N.; Berry, J.A.; Littleboy, A.K.; Pilkington, N.J. (AEA Decommissioning and Radwaste, Harwell Lab. (United Kingdom))

    1992-01-01

    The sortpion of a series of activation-product radionuclides onto London clay and Dungeness aquifer gravel from the nuclear reactor sites at Bradwell and Dungeness, has been examined. Batch sorption and through-diffusion experiments with clay determined chlorine as the chloride ion to be effectively non-sorbing; calcium to be weakly sorbing, whereas cobalt, nickel, niobium and samarium were moderately to strongly sorbing and silver was strongly sorbing. Distribution ratios (R[sub D] values) for Nb, Sm and Ag were found to have a strong dependence on the liquid-solid separation technique employed. The presence of high concentrations of calcium hydroxide led to lower values of R[sub D] for radioactive Ca but higher R[sub D] values for Sm and Ag. The sorption of Ni showed no apparent dependence on groundwater composition at low levels of dissolved organic carbon (DOC). The values of R[sub D] for Co decreased as the DOC content was increased by addition of humic materials. Batch sorption studies with aquifer gravel demonstrated that Ca is weakly sorbing whereas Nb, Ag and Eu are moderately to strongly sorbing. R[sub D] values for Ca and for Ag under neutral pH conditions show little sensitivity to the liquid/solid separation technique used. However, R[sub D] values for Nb and Eu under neutral pH conditions and for Ag in alkaline solution (pH = 11 - 12) show a marked effect. The aquifer gravel was found to be highly inhomogeneous unlike the clay and sorption was greatest on samples with a high proportion of sand, reflecting the clay mineral content. (orig.).

  3. First steps in the direction of synthetic, allosteric, direct inhibitors of thrombin and factor Xa.

    Science.gov (United States)

    Verghese, Jenson; Liang, Aiye; Sidhu, Preet Pal Singh; Hindle, Michael; Zhou, Qibing; Desai, Umesh R

    2009-08-01

    Designing non-saccharide functional mimics of heparin is a major challenge. In this work, a library of small, aromatic molecules based on the sulfated DHP scaffold was synthesized and screened against thrombin and factor Xa. The results reveal that (i) selected monomeric benzofuran derivatives inhibit the two enzymes, albeit weakly; (ii) the two enzymes recognize different structural features in the benzofurans studied suggesting significant selectivity of recognition; and (iii) the mechanism of inhibition is allosteric. The molecules represent the first allosteric small molecule inhibitors of the two enzymes.

  4. First Steps in the Direction of Synthetic, Allosteric, Direct Inhibitors of Thrombin and Factor Xa

    Science.gov (United States)

    Verghese, Jenson; Liang, Aiye; Sidhu, Preet Pal Singh; Hindle, Michael; Zhou, Qibing; Desai, Umesh R.

    2009-01-01

    Designing non-saccharide functional mimics of heparin is a major challenge. In this work, a library of small, aromatic molecules based on the sulfated DHP scaffold was synthesized and screened against thrombin and factor Xa. The results reveal that i) selected monomeric benzofuran derivatives inhibit the two enzymes, albeit weakly; ii) the two enzymes recognize different structural features in the benzofurans studied suggesting significant selectivity of recognition; and iii) the mechanism of inhibition is allosteric. The molecules represent the first allosteric small molecule inhibitors of the two enzymes. PMID:19540113

  5. POTENCY OF LIGNOCELLULOSE DEGRADING BACTERIA ISOLATED FROM BUFFALO AND HORSE GASTROINTESTINAL TRACT AND ELEPHANT DUNG FOR FEED FIBER DEGRADATION

    Directory of Open Access Journals (Sweden)

    A. Wahyudi

    2014-10-01

    Full Text Available Lignin is limiting factor for cellulose and hemicellulose degradation in rumen. Isolation andselection bacteria from buffalo and horse gastrointestinal tract and elephant dung could be foundbacteria that have superiority to degrade lignin, xylan, and cellulose. Those animals were chosenbecause they were herbivores that consume low quality crude fiber as their main energy sources.Lignocellulose degrading bacteria were isolated by Hungate selective media, by using lignin (tannicacid, xylan, and cellulose as selective substrates. The morphological identification used an enrichmentmedia by measuring color, colony size, diffusion zone, clear zone, and biochemical identification usingproduction of ligninase, xylanase, and cellulase enzymes. The best lignocellulose degrading bacteriathen was determined by the morphological and biochemical character. This study showed thatlignocellulose degrading bacteria could be found in gastrointestinal tract of buffalo and horse, andelephant dung. Highest number colony was found in samples from buffalo's colon (376, followed byhorse's cecum (203, elephant’s dung (46, buffalo’s cecum (23, buffalo's rumen (9 and horse’s colon(7. The highest isolates activity of lignolytic, xylanolytic, and cellulolytic were reached by buffalo’scecum (7.64, horse's cecum (6.27, and buffalo’s colon (2.48. Meanwhile the highest enzymesproductivities were: buffalo’s cecum (0.0400 µmol, horse’s cecum (1.3912 µmol and buffalo’s colon(0.1971 µmol. Based on morphologycal character and biochemical test, it could be concluded thatlignolytic from buffalo’s cecum, xylanolytic from horse’s cecum, and cellulolytic from buffalo’s colonwere the superior isolates and they were 99% analyzed as Enterococcus casseliflavus/gallinarumspecies.

  6. Practices and developments in spent fuel burnup credit applications. Proceedings of a technical committee meeting

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    2003-10-01

    The International Atomic Energy Agency convened a technical committee Meeting on Requirements, Practices and Developments in Burnup Credit (BUC) Applications in Madrid, Spain, from 22 to 26 April 2002. The purpose of this meeting was to explore the progress and status of international activities related to the BUC applications for spent nuclear fuel. This meeting was the third major meeting on the uses of BUC for spent fuel management systems held since the IAEA began to monitor the uses of BUC in spent fuel management systems in 1997. The first major meeting was an Advisory Group meeting (AGM), which was held in Vienna, in October 1997. The second major meeting was a technical committee meeting (TCM), which was held in Vienna, in July 2000. Several consultants meetings were held since 1997 to advise and assist the IAEA in planning and conducting its BUC activities. The proceedings of the 1997 AGM were published as IAEA-TECDOC-1013, and the proceedings of the 2000 TCM as IAEA-TECDOC-1241. BUC for wet and dry storage systems, spent fuel transport, reprocessing and final disposal is needed in many Member States to allow for increased enrichment, and to increase storage capacities, cask capacities and dissolver capacities avoiding the need for extensive modifications. The use of BUC is a necessity for spent fuel disposal.

  7. Dung beetle community and functions along a habitat-disturbance gradient in the Amazon: a rapid assessment of ecological functions associated to biodiversity.

    Directory of Open Access Journals (Sweden)

    Rodrigo F Braga

    Full Text Available Although there is increasing interest in the effects of habitat disturbance on community attributes and the potential consequences for ecosystem functioning, objective approaches linking biodiversity loss to functional loss are uncommon. The objectives of this study were to implement simultaneous assessment of community attributes (richness, abundance and biomass, each calculated for total-beetle assemblages as well as small- and large-beetle assemblages and three ecological functions of dung beetles (dung removal, soil perturbation and secondary seed dispersal, to compare the effects of habitat disturbance on both sets of response variables, and their relations. We studied dung beetle community attributes and functions in five land-use systems representing a disturbance gradient in the Brazilian Amazon: primary forest, secondary forest, agroforestry, agriculture and pasture. All response variables were affected negatively by the intensification of habitat disturbance regimes, but community attributes and ecological functions did not follow the same pattern of decline. A hierarchical partitioning analysis showed that, although all community attributes had a significant effect on the three ecological functions (except the abundance of small beetles on all three ecological functions and the biomass of small beetles on secondary dispersal of large seed mimics, species richness and abundance of large beetles were the community attributes with the highest explanatory value. Our results show the importance of measuring ecological function empirically instead of deducing it from community metrics.

  8. Growth and reproductive potential of Eisenia foetida (Sav) on various zoo animal dungs after two methods of pre-composting followed by vermicomposting.

    Science.gov (United States)

    Pérez-Godínez, Edmundo Arturo; Lagunes-Zarate, Jorge; Corona-Hernández, Juan; Barajas-Aceves, Martha

    2017-06-01

    Disposal of animal manure without treatment can be harmful to the environment. In this study, samples of four zoo animal dungs and one horse dung were pre-composted in two ways: (a) traditional composting and (b) bokashi pre-composting for 1month, followed by vermicomposting for 3months. The permanence (PEf) and reproductive potential (RP) of Eisenia foetida as well as the quality of vermicompost were evaluated. The PEf values and RP index of E. foetida were higher for samples pre-composted using the traditional composting method (98.7-88% and 31.85-16.27%, respectively) followed by vermicomposting (92.7-72.7% and 22.96-13.51%, respectively), when compared with those for bokashi pre-composted samples followed by vermicomposting, except for the horse dung sample (100% for both the parameters). The values of electrical conductivity (EC), cation exchange capacity (CEC), organic C, total N, available P, C/N ratio, and pH showed that both treatments achieved the norms of vermicompost (bokashi pre-composting followed by vermicomposting produced the highest values (98.7-70.7%, 97.67-96.65%, and 2.7-1.97%, respectively), when compared with the other method adapted in this study. Nevertheless, further studies with plants for plant growth evaluation are needed to assess the benefits and limitations of these two pre-composting methods prior to vermicomposting. Copyright © 2017 Elsevier Ltd. All rights reserved.

  9. Changes in the chemical characteristics of water-extracted organic matter from vermicomposting of sewage sludge and cow dung

    Energy Technology Data Exchange (ETDEWEB)

    Xing, Meiyan, E-mail: xingmeiyan@tongji.edu.cn [State Key Laboratory of Pollution Control and Resources Reuse, College of Environmental Science and Engineering, Tongji University, Shanghai 200092 (China); Li, Xiaowei; Yang, Jian; Huang, Zhidong; Lu, Yongsen [State Key Laboratory of Pollution Control and Resources Reuse, College of Environmental Science and Engineering, Tongji University, Shanghai 200092 (China)

    2012-02-29

    Highlights: Black-Right-Pointing-Pointer Vermicomposting causes an increase in the aromaticity of WEOM from the substrates. Black-Right-Pointing-Pointer Vermicomposting homogenizes the molecular weight of WEOM from the substrates. Black-Right-Pointing-Pointer The WEOM from the vermicompost is characterized by high O-containing groups. Black-Right-Pointing-Pointer The WEOM from the vermicompost includes small aliphatic and protein-like groups. Black-Right-Pointing-Pointer The WEOM test is a good way to evaluate the biological maturity of vermicompost. - Abstract: The chemical changes of water-extractable organic matter (WEOM) from five different substrates of sewage sludge enriched with different proportions of cow dung after vermicomposting with Eisenia fetida were investigated using various analytical approaches. Results showed that dissolved organic carbon, chemical oxygen demand, and C/N ratio of the substrates decreased significantly after vermicomposting process. The aromaticity of WEOM from the substrates enhanced considerably, and the amount of volatile fatty acids declined markedly, especially for the cow dung substrate. Gel filtration chromatography analysis showed that the molecular weight fraction between 10{sup 3} and 10{sup 6} Da became the main part of WEOM in the final product. {sup 1}H nuclear magnetic resonance spectra revealed that the proportion of H moieties in the area of 0.00-3.00 ppm decreased, while increasing at 3.00-4.25 ppm after vermicomposting. Fluorescence spectra indicated that vermicomposting caused the degradation of protein-like groups, and the formation of fulvic and humic acid-like compounds in the WEOM of the substrates. Overall results indicate clearly that vermicomposting promoted the degradation and transformation of liable WEOM into biological stable substances in sewage sludge and cow dung alone, as well as in mixtures of both materials, and testing the WEOM might be an effective way to evaluate the biological maturity and

  10. Changes in the chemical characteristics of water-extracted organic matter from vermicomposting of sewage sludge and cow dung

    International Nuclear Information System (INIS)

    Xing, Meiyan; Li, Xiaowei; Yang, Jian; Huang, Zhidong; Lu, Yongsen

    2012-01-01

    Highlights: ► Vermicomposting causes an increase in the aromaticity of WEOM from the substrates. ► Vermicomposting homogenizes the molecular weight of WEOM from the substrates. ► The WEOM from the vermicompost is characterized by high O-containing groups. ► The WEOM from the vermicompost includes small aliphatic and protein-like groups. ► The WEOM test is a good way to evaluate the biological maturity of vermicompost. - Abstract: The chemical changes of water-extractable organic matter (WEOM) from five different substrates of sewage sludge enriched with different proportions of cow dung after vermicomposting with Eisenia fetida were investigated using various analytical approaches. Results showed that dissolved organic carbon, chemical oxygen demand, and C/N ratio of the substrates decreased significantly after vermicomposting process. The aromaticity of WEOM from the substrates enhanced considerably, and the amount of volatile fatty acids declined markedly, especially for the cow dung substrate. Gel filtration chromatography analysis showed that the molecular weight fraction between 10 3 and 10 6 Da became the main part of WEOM in the final product. 1 H nuclear magnetic resonance spectra revealed that the proportion of H moieties in the area of 0.00–3.00 ppm decreased, while increasing at 3.00–4.25 ppm after vermicomposting. Fluorescence spectra indicated that vermicomposting caused the degradation of protein-like groups, and the formation of fulvic and humic acid-like compounds in the WEOM of the substrates. Overall results indicate clearly that vermicomposting promoted the degradation and transformation of liable WEOM into biological stable substances in sewage sludge and cow dung alone, as well as in mixtures of both materials, and testing the WEOM might be an effective way to evaluate the biological maturity and chemical stability of vermicompost.

  11. Cow dung is an ideal fermentation medium for amylase production in solid-state fermentation by Bacillus cereus

    Directory of Open Access Journals (Sweden)

    Ponnuswamy Vijayaraghavan

    2015-12-01

    Full Text Available Amylase production by Bacillus cereus IND4 was investigated by solid state fermentation (SSF using cow dung substrate. The SSF conditions were optimized by using one-variable-at-a-time approach and two level full factorial design. Two level full factorial design demonstrated that moisture, pH, fructose, yeast extract and ammonium sulphate have significantly influenced enzyme production (p < 0.05. A central composite design was employed to investigate the optimum concentration of these variables affecting amylase production. Maximal amylase production of 464 units/ml of enzyme was observed in the presence of 100% moisture, 0.1% fructose and 0.01% ammonium sulphate. The enzyme production increased three fold compared to the original medium. The optimum pH and temperature for the activity of amylase were found to be 8.0 and 50 °C, respectively. This enzyme was highly stable at wide pH range (7.0–9.0 and showed 32% enzyme activity after initial denaturation at 50 °C for 1 h. This is the first detailed report on the production of amylase by microorganisms using cow dung as the low cost medium.

  12. Dungeness 'A' Nuclear Power Station. The findings of NII's assessment of Nuclear Electric's long term safety review

    International Nuclear Information System (INIS)

    1994-01-01

    The assessment is reported of Nuclear Electrics' Long Term Safety Reviews (LTSR) of the Dungeness A magnox reactors. The assessment was undertaken by the Health and Safety Executive's Nuclear Installations Inspectorate (NII) which is responsible for regulating the safety of nuclear installations in the United Kingdom. This was one of a programme of LTSRs for all the UK magnox reactors. The LTSR for each plant was proceeded by a Generic Issues programme. The results of both the LTSR and the Generic Issues programme have been used by NII in forming the conclusions of this assessment. Overall the safety case for Dungeness A is satisfactory for continued operation. A programme of additional modifications and inspections has been put in place which further enhances the safety justification. Reactor operations will continue to be monitored and regulated in accordance with the inspections required under the licensing arrangements. Provided these requirements and the agreed further analysis, improvements and inspections give satisfactory results it is expected that the station will be able to operate safely till each reactor is at least 30 years old. Beyond this point a further Periodic Safety Review will be required. (UK)

  13. [Sampling optimization for tropical invertebrates: an example using dung beetles (Coleoptera: Scarabaeinae) in Venezuela].

    Science.gov (United States)

    Ferrer-Paris, José Rafael; Sánchez-Mercado, Ada; Rodríguez, Jon Paul

    2013-03-01

    The development of efficient sampling protocols is an essential prerequisite to evaluate and identify priority conservation areas. There are f ew protocols for fauna inventory and monitoring in wide geographical scales for the tropics, where the complexity of communities and high biodiversity levels, make the implementation of efficient protocols more difficult. We proposed here a simple strategy to optimize the capture of dung beetles, applied to sampling with baited traps and generalizable to other sampling methods. We analyzed data from eight transects sampled between 2006-2008 withthe aim to develop an uniform sampling design, that allows to confidently estimate species richness, abundance and composition at wide geographical scales. We examined four characteristics of any sampling design that affect the effectiveness of the sampling effort: the number of traps, sampling duration, type and proportion of bait, and spatial arrangement of the traps along transects. We used species accumulation curves, rank-abundance plots, indicator species analysis, and multivariate correlograms. We captured 40 337 individuals (115 species/morphospecies of 23 genera). Most species were attracted by both dung and carrion, but two thirds had greater relative abundance in traps baited with human dung. Different aspects of the sampling design influenced each diversity attribute in different ways. To obtain reliable richness estimates, the number of traps was the most important aspect. Accurate abundance estimates were obtained when the sampling period was increased, while the spatial arrangement of traps was determinant to capture the species composition pattern. An optimum sampling strategy for accurate estimates of richness, abundance and diversity should: (1) set 50-70 traps to maximize the number of species detected, (2) get samples during 48-72 hours and set trap groups along the transect to reliably estimate species abundance, (3) set traps in groups of at least 10 traps to

  14. Changes with time after treatment in the concentrations of ivermectin in fresh cow dung and in cow pats aged in the field

    DEFF Research Database (Denmark)

    Sommer, C; Steffansen, B

    1993-01-01

    An analytical procedure for detection of ivermectin in plasma samples was modified and used for measuring ivermectin concentrations in dung samples. The residues were quantified by high-performance liquid chromatography and fluorescence detection after extraction, purification, and derivatization...

  15. Anaerobic digestion of buffalo dung: simulation of process kinetics

    International Nuclear Information System (INIS)

    Sahito, A.R.

    2015-01-01

    Assessment of kinetic of AD (Anaerobic Digestion) is a beneficial practice to forecast the performance of the process. It is helpful in the design of AD vessels, substrate feeding and digestate exit systems. The aim of this work was to assess the kinetics of anaerobically digested buffalo dung at different quantities of water added. It comprises the assessment of the specific methane production on the basis of VS (Volatile Solids) added in each reactor by using three first order models, i.e. the modified Gompertz model, the Cone model and the Exponential Curve Factor model. The analysis was tested by using the three statistical parameters, i.e. the coefficient of multiple determinations, the standard deviation of residuals and the Akaike's Information Criteria. The result reveals that the Exponential Curve Factor model was the best model that described the experimental data well. Moreover, there was not a direct or indirect relation between the kinetic coefficients of the AD process with the varying total or volatile solid content. (author)

  16. Isolation and determination of ivermectin in post-mortem and in vivo tissues of dung beetles using a continuous solid phase extraction method followed by LC-ESI+-MS/MS.

    Directory of Open Access Journals (Sweden)

    Antonio J Ortiz

    Full Text Available A new analytical method based on solvent extraction, followed by continuous solid-phase extraction (SPE clean-up using a polymeric sorbent, was demonstrated to be applicable for the detection of ivermectin in complex biological matrices of dung beetles (hemolymph, excreta or dry tissues using liquid chromatography combined with positive electrospray ionization tandem mass spectrometry (LC/ESI+-MS/MS. Using a signal-to-noise ratio of 3:1, the limit of detection (LOD in the insect matrices at trace levels was 0.01 ng g-1 and the limit of quantification (LOQ was 0.1 ng g-1. The proposed method was successfully used to quantitatively determine the levels of ivermectin in the analysis of small samples in in vivo and post mortem samples, demonstrating the usefulness for quantitative analyses that are focused on future pharmacokinetic and bioavailability studies in insects and the establishment of a new protocol to study the impact of ivermectin on non-target arthropods such as dung beetles and other insects that are related with the "dung community". Because satisfactory precision and accuracy values were obtained in both in vivo matrices, we suggest that the method can be consistently used for quantitative determinations that are focused on future pharmacokinetic and bioavailability studies in insects. Furthermore, this new analytical method was successfully applied to biological samples of dead dung beetles from the field suggesting that the method can be used to establish a new routine analysis of ivermectin residues in insect carcasses that is applied to complement typical mortality tests.

  17. Geographic variation in responses of European yellow dung flies to thermal stress.

    Science.gov (United States)

    Bauerfeind, Stephanie S; Sørensen, Jesper G; Loeschcke, Volker; Berger, David; Broder, E Dale; Geiger, Madeleine; Ferrari, Manuela; Blanckenhorn, Wolf U

    2018-04-01

    Climatic conditions can be very heterogeneous even over small geographic scales, and are believed to be major determinants of the abundance and distribution of species and populations. Organisms are expected to evolve in response to the frequency and magnitude of local thermal extremes, resulting in local adaptation. Using replicate yellow dung fly (Scathophaga stercoraria; Diptera: Scathophagidae) populations from cold (northern Europe) and warm climates (southern Europe), we compared 1) responses to short-term heat and cold shocks in both sexes, 2) heat shock protein (Hsp70) expression in adults and eggs, and 3) female reproductive traits when facing short-term heat stress during egg maturation. Contrary to expectations, thermal traits showed minor geographic differentiation, with weak evidence for greater heat resistance of southern flies but no differentiation in cold resistance. Hsp70 protein expression was little affected by heat stress, indicating systemic rather than induced regulation of the heat stress response, possibly related to this fly group's preference for cold climes. In contrast, sex differences were pronounced: males (which are larger) endured hot temperatures longer, while females featured higher Hsp70 expression. Heat stress negatively affected various female reproductive traits, reducing first clutch size, overall reproductive investment, egg lipid content, and subsequent larval hatching. These responses varied little across latitude but somewhat among populations in terms of egg size, protein content, and larval hatching success. Several reproductive parameters, but not Hsp70 expression, exhibited heritable variation among full-sib families. Rather than large-scale clinal geographic variation, our study suggests some local geographic population differentiation in the ability of yellow dung flies to buffer the impact of heat stress on reproductive performance. Copyright © 2018 Elsevier Ltd. All rights reserved.

  18. Investigation of Vermiwash Obtained from California Red Worm Which Fed Cow Dung in terms of Trace and Nutrient Elements

    Directory of Open Access Journals (Sweden)

    Turan Yüksek

    2017-08-01

    Full Text Available One of the most important problems facing sustainable agriculture is the supply of quality fertilizers and the problems encountered in the application of fertilizers. In the last years, while trying to increase the amount of fertilizers obtained by natural methods, On the other hand it has been observed that studies for obtaining different types (solid natural, liquid natural, bio-natural etc. of fertilizer have continued increasing. The aim of this study is to determine time depend (30 days, 31-60 days changes of some nutrients and metals in vermiwash obtained from Eisenia fetida fed with fermented natural cow dung. For this purpose, Eisenia fetida were fed with fermented cow dung which obtained from cows grazing in natural habitat and obtained vermiwash were analyzed to determined some macro and micronutrient elements. As a result of the study, while the values of N, K, Ca, Mg, Na, Fe, Ni, Cu, Zn, Hg, Sb in vermiwash decreased at a statistically significant level depending on the time; Co, As, Ag, Cd, Pb, Al, Se, Mo, Li and Be were increased at statistically significant levels.

  19. The Gut Microbiomes of Two Pachysoma MacLeay Desert Dung Beetle Species (Coleoptera: Scarabaeidae: Scarabaeinae Feeding on Different Diets.

    Directory of Open Access Journals (Sweden)

    Philippa Z N Franzini

    Full Text Available Micro-organisms inhabiting animal guts benefit from a protected and nutrient-rich environment while assisting the host with digestion and nutrition. In this study we compare, for the first time, the bacterial and fungal gut communities of two species of the small desert dung beetle genus Pachysoma feeding on different diets: the detritivorous P. endroedyi and the dry-dung-feeding P. striatum. Whole-gut microbial communities from 5 individuals of each species were assessed using 454 pyrosequencing of the bacterial 16S rRNA gene and fungal ITS gene regions. The two bacterial communities were significantly different, with only 3.7% of operational taxonomic units shared, and displayed intra-specific variation. The number of bacterial phyla present within the guts of P. endroedyi and P. striatum individuals ranged from 6-11 and 4-7, respectively. Fungal phylotypes could only be detected within the gut of P. striatum. Although the role of host phylogeny in Pachysoma microbiome assembly remains unknown, evidence presented in this study suggests that host diet may be a deterministic factor.

  20. RUBY-1: a randomized, double-blind, placebo-controlled trial of the safety and tolerability of the novel oral factor Xa inhibitor darexaban (YM150) following acute coronary syndrome

    DEFF Research Database (Denmark)

    Steg, Ph Gabriel; Mehta, Shamir R; Jukema, J Wouter

    2011-01-01

    To establish the safety, tolerability and most promising regimen of darexaban (YM150), a novel, oral, direct factor Xa inhibitor, for prevention of ischaemic events in acute coronary syndrome (ACS)....

  1. The effects of seed ingestion by livestock, dung fertilization, trampling, grass competition and fire on seedling establishment of two woody plant species

    CSIR Research Space (South Africa)

    Tjelele, J

    2015-02-01

    Full Text Available the objectives of an agricultural enterprise. The objectives of this study were to determine the effects of gut passage (goats, cattle), dung (nutrients), fire, grass competition and trampling on establishment of A. nilotica and D. cinerea seedlings. Germination...

  2. Finding refuge: The estuarine distribution of the nemertean egg predator Carcinonemertes errans on the Dungeness crab, Cancer magister

    Science.gov (United States)

    Dunn, Paul H.; Young, Craig M.

    2013-12-01

    Parasites can significantly impact ecosystems by altering the distributions and population sizes of their host organisms. Some hosts are thought to find refuge from parasitism by entering habitats where their parasites cannot survive. The nemertean worm Carcinonemertes errans is an egg predator that infects the Dungeness crab, Cancer magister, throughout the host's range. To determine if C. magister experiences a refuge from C. errans within estuarine environments, we examined the distribution of C. errans on Dungeness crabs within Oregon's Coos Bay Estuary. Year-round sampling over a three-year period also allowed us to test for temporal variation in the parasite's distribution. We found that parasite prevalence, mean intensity, and parasite density of C. errans infecting C. magister varied along a clear estuarine gradient, with crabs nearest the ocean carrying the heaviest parasite loads. Larger crabs were more heavily infected with worms, and seasonal infection patterns were observed at some sites within the bay. Crabs sampled from coastal waters near the estuary carried significantly more worms than did crabs from the bay, suggesting that the estuary is acting as a spatiotemporal parasite refuge for this important fishery species.

  3. Suppression of Escherichia coli O157:H7 by Dung Beetles (Coleoptera: Scarabaeidae using the lowbush blueberry agroecosystem as a model system.

    Directory of Open Access Journals (Sweden)

    Matthew S Jones

    Full Text Available Wildlife as a source of microbial contamination is a food safety concern. Deer feces (scat have been determined as a point source for Escherichia coli O157:H7 contamination of fresh produce. The ecological role of the scooped scarab (Onthophagus hecate (Panzer, a generalist dung beetle species common in Maine blueberry fields, was explored as a biological control agent and alternatively as a pathogen vector between deer scat and food. A large-scale field survey of wildlife scat indicated that pathogenic E. coli O157:H7 was present, albeit at a low prevalence (1.9% of samples, n = 318, in the Maine lowbush blueberry agroecosystem. A manipulative field experiment verified that, should contact occur between deer scat and blueberry plants and fruit during the summer, contamination with E. coli O157:H7 can occur and persist for more than 72 h. For both the positive control and an experimental scat inoculation treatment, the levels of the bacterial population decreased over time, but at different rates (treatment x time interaction: F (1.9,18.8 = 358.486, P < 0.0001. The positive control inoculation, which resulted in a higher initial E. coli level on fruit, decayed at a faster rate than inoculation of fruit via scat in the experimental treatment. We conducted 2 laboratory studies to elucidate aspects of dung beetle feeding ecology as it relates to suppression of E. coli O157:H7 from deer scat to lowbush blueberry fruit. In both experiments, dung beetles buried the same amount of scat whether or not the scat was inoculated with the pathogen (F(1,6 = 0.001; P = 0.999 and (F (2,17 = 4.10, P = 0.147. Beetles feeding on E. coli inoculated deer scat were not found to vector the pathogen to fruit. In two studies, beetles lowered the amount of pathogenic E. coli persisting in soils compared to soils without beetles (F (2,9 = 7.757; P = 0.05 and F (2,17 = 8.0621, P = 0.004. Our study suggests that the dung beetle species, Onthophagus hecate, has the potential

  4. Species of Spalangia (Hymenoptera: Pteromalidae collected from buffalo dung in Itumbiara, Goias, Brazil

    Directory of Open Access Journals (Sweden)

    Michel E. V. Milhomem

    2004-11-01

    Full Text Available This study had the objective of determining the species of Spalangia in pupae of muscoid Diptera present in buffalo dung, collected in the municipality of Itumbiara, GO, from May to December 2003. The dipterous pupae were obtained by the flotation method. They were individually placed in gelatin capsules until the emergence of the flies and/or their parasitoids. The overall prevalence of parasitism was 2.59%. The prevalences of parasitism presented by the parasitoid species Spalangia cameroni (Perkins, Spalangia drosophilae (Ashmead, Spalangia endius (Walker, Spalangia nigra (Letraille and Spalangia nigroaenea (Curtis were 0.53%, 1.37%, 0.15%, 0.04% and 0.49%, respectively.

  5. Salinity and Temperature Tolerance of the Nemertean Worm Carcinonemertes errans, an Egg Predator of the Dungeness Crab.

    Science.gov (United States)

    Dunn, Paul H; Young, Craig M

    2015-04-01

    Estuaries can be harsh habitats for the marine animals that enter them, but they may also provide these species with sub-saline refuges from their parasites. The nemertean egg predator Carcinonemertes errans is known to occur less frequently and in smaller numbers on its host, the Dungeness crab Metacarcinus magister, when the hosts are found within estuaries. We examined the temperature and salinity tolerances of C. errans to determine if this observed distribution represents a true salinity refuge. We monitored the survival of juvenile and larval worms exposed to ecologically relevant salinities (5-30) and temperatures (8-20 °C) over the course of several days under laboratory conditions. Juvenile worms were unaffected by the experimental temperature levels and exhibited robustness to salinity treatments 25 and 30. However, significant mortality was seen at salinity treatments 20 and below. Larvae were less tolerant than juveniles to lowered salinity and were also somewhat more susceptible to the higher temperatures tested. Given that the Dungeness crab can tolerate forays into mesohaline (salinity 5-18) waters for several days at a time, our findings suggest that salinity gradients play an important role in creating a parasite refuge for this species within the estuaries of the Pacific Northwest. © 2015 Marine Biological Laboratory.

  6. Knockdown of long non-coding RNA Taurine Up-Regulated 1 inhibited doxorubicin resistance of bladder urothelial carcinoma via Wnt/β-catenin pathway.

    Science.gov (United States)

    Xie, Dalong; Zhang, Hui; Hu, Xuanhao; Shang, Chao

    2017-10-24

    In genitourinary system, bladder cancer (BC) is the most common and lethal malignant tumor, which most common type is bladder urothelial carcinoma (BUC). Long non-coding RNA (lncRNA) Taurine Up-Regulated 1 (TUG1) gene is high-expressed in several malignant tumors, including BC. In this study, over-expression of TUG1 was found in BUC tissues and cell line resistant to doxorubicin (Dox). Knockdown of TUG1 inhibited the Dox resistance and promoted the cytotoxicity induced by Dox in T24/Dox cells. TUG1 knockdown also depressed the Wnt/β-catenin pathway, and the activation the Wnt/β-catenin pathway partly reversed the inhibitory effects of TUG1 knockdown on Dox resistance in T24/Dox cells. In conclusion, up-regulation of lncRNA TUG1 was related with the poor response of BUC patients to Dox chemotherapy, knockdown of TUG1 inhibited the Dox resistance of BUC cells via Wnt/β-catenin pathway. These findings might assist in the discovery of novel potential diagnostic and therapeutic target for BUC, thereby improve the effects of clinical treatment in patients.

  7. Biogas production from pretreated coffee-pulp waste by mixture of cow dung and rumen fluid in co-digestion

    Science.gov (United States)

    Juliastuti, Sri Rachmania; Widjaja, Tri; Altway, Ali; Iswanto, Toto

    2017-05-01

    Coffee is an excellent commodity in Indonesia that has big problem in utilizing its wastes. As the solution, the abundant coffee pulp waste from processing of coffee bean industry has been used as a substrate of biogas production. Coffee pulp waste (CPW) was approximately 48% of total weight, consisting 42% of the coffee pulp and 6% of the seed coat. CPW holds good composition as biogas substrate that is consist of cellulose (63%), hemicellulose (2.3%) and protein (11.5%). Methane production from coffee pulp waste still has much problems because of toxic chemicals content such as caffeine, tannin, and total phenol which can inhibit the biogas production. In this case, CPW was pretreated by ethanol/water (50/50, v/v) at room temperature to remove those inhibitors. This study was to compare the methane production by microbial consortium of cow dung and rumen fluid mixture coffee pulp waste as a substrate with and without pretreatment. The pretreated CPW was fermented with mixture of Cow Dung (CD) and Rumen Fluid (RF) in anaerobic co-digestion for 30 days at mesophilic temperature (30-40°C) and the pH was maintained from 6.8 to 7.2 on a reactor with working volume of 3.6 liters. There were two reactors with each containing the mixture of CPW without pretreatment, cow dung and rumen fluid (CD+RF+CPW) and then compared with the CPW with pretreatment (CD+RF+PCPW) reactor. The measured parameters included the decreasing of inhibitor compound concentration, Volatile Fatty Acids (VFAs), Chemical Oxygen Demand (COD), Total Solid (TS), Volatile Solid (VS), Methane and the Calorific value of gas (heating value) were studied as well. The result showed a decrease in inhibitor component concentration due to methanol pretreatment was 90% of caffeine; 78% of polyphenols (total phenol) and 66% of tannins. The highest methane content in biogas was produced in CD+RF+PCPW digester with concentration amounted of 44.56% with heating value of 27,770 BTU/gal.

  8. [Dung beetles (Coleoptera: Scarabaeinae) of the northwestern slope of the Sierra Nevada of Santa Marta, Colombia].

    Science.gov (United States)

    Martínez, Neis J; García, Héctor; Pulido, Luz A; Ospino, Deibi; Harváez, Juan C

    2009-01-01

    The community structure of dung beetles in the middle and lower river basin of the Gaira river, Sierra Nevada de Santa Marta, Colombia, is described. Four sites were selected along an altitudinal gradient of 50-940 m for sampling from June to October, 2004. Dung beetles were captured using modified pitfall traps and manual recollections. We captured 7,872 individuals belonging to 29 species, distributed in 15 genera and five tribes of Scarabaeinae. Canthon and Onthophagus were the most diverse genera, each represented by six species. The sampled sites shared the following species: Onthophagus acuminatus Harold, O. clypeatus Blanchard, O. marginicollis Harold. Bocatoma was the most diverse site with 23 species; whereas Port Mosquito presented the highest abundance, with 3,262 individuals. Seven species represented 89% of all captures: Canthidium sp., Dichotomius sp., Uroxys sp. 1, Uroxys sp. 2, O. marginicollis, O. clypeatus and O. acuminatus. Of the 29 captured species, 17 belonged to the functional group of diggers and 10 were ball-rollers. We did not observe significant among-site differences in community structure. Abiotic factors such as altitude, temperature and humidity cannot explain observed variation in community structure across sites, indicating other variables such as vegetation cover, density of the vegetation and soil type may play a role in the community structure of these insects.

  9. Treatment of proximal deep vein thrombosis with a novel synthetic compound (SR90107A/ORG31540) with pure anti-factor Xa activity - A phase II evaluation

    NARCIS (Netherlands)

    Buller, HR; Cariou, R; Gallus, A; Gent, M; Ginsberg, J; Prins, MH; Lensing, A; Levi, M; Nurmohammed, N; Hirsh, J; Roberts, R; ten Cate, JW; Decousus, H; Mismetti, P; Buchmuller, A; Charlet, [No Value; Viallon, A; van der Meer, J; Meinardi, [No Value; Meijer, K; Piovella, F; Barone, M; Beltrametti, C; Serafini, S; Kraaijenhagen, RA; Koopman, MMW; Jagt, HHT; Muller, MBR; Kooy, MV; Nauta, S; Gallus, AS; Coghlan, D; Rich, C; Prandoni, P; Scudeller, A; Scarano, L; Girolami, A; Baker, R; Tan, E; Cooney, J; Eikelboom, J; Ninet, J; Dolmazon, C; Madoux, MHG; Coppere, B; Nenci, GG; Agnelli, G; Falcinelli, F; Morini, M; d'Angelo, A

    2000-01-01

    Background-Patients with venous thromboembolism require initial treatment with an immediate-acting anticoagulant, low-molecular-weight heparin. We evaluated a novel synthetic factor Xa inhibitor (SR90107a/ORG31540) as an alternative treatment. Methods and Results-A randomized-parallel-group, phase

  10. Determination of rivaroxaban in patient’s plasma samples by anti-Xa chromogenic test associated to High Performance Liquid Chromatography tandem Mass Spectrometry (HPLC-MS/MS)

    Science.gov (United States)

    Derogis, Priscilla Bento Matos; Sanches, Livia Rentas; de Aranda, Valdir Fernandes; Colombini, Marjorie Paris; Mangueira, Cristóvão Luis Pitangueira; Katz, Marcelo; Faulhaber, Adriana Caschera Leme; Mendes, Claudio Ernesto Albers; Ferreira, Carlos Eduardo dos Santos; França, Carolina Nunes; Guerra, João Carlos de Campos

    2017-01-01

    Rivaroxaban is an oral direct factor Xa inhibitor, therapeutically indicated in the treatment of thromboembolic diseases. As other new oral anticoagulants, routine monitoring of rivaroxaban is not necessary, but important in some clinical circumstances. In our study a high-performance liquid chromatography-tandem mass spectrometry (HPLC-MS/MS) method was validated to measure rivaroxaban plasmatic concentration. Our method used a simple sample preparation, protein precipitation, and a fast chromatographic run. It was developed a precise and accurate method, with a linear range from 2 to 500 ng/mL, and a lower limit of quantification of 4 pg on column. The new method was compared to a reference method (anti-factor Xa activity) and both presented a good correlation (r = 0.98, p highly correlated and should be used as clinical tools for drug monitoring. The method was applied successfully in a group of 49 real-life patients, which allowed an accurate determination of rivaroxaban in peak and trough levels. PMID:28170419

  11. Análise e identificação das antocianinas de couve rôxa (Brassica spp.)

    OpenAIRE

    Lopes, Dulce; Jesus, Benvinda; Cabrita, Luís

    2004-01-01

    A couve rôxa é uma espécie comestível com uma composição em antocianinas rica e complexa. Sabe-se que contem antocianinas poliglicosiladas, aciladas com um ou mesmo dois grupos acilo aromáticos, nomeadamente com ácidos coumárico e caféico. Este padrão de acilação é particularmente interessante, porque confere estabilidade às antocianinas e aumenta o seu potencial de utilização em aplicações famacêuticas, alimentares e cosméticas. Este estudo tem por objectivo determinar a...

  12. Novel Bacillus subtilis IND19 cell factory for the simultaneous production of carboxy methyl cellulase and protease using cow dung substrate in solid-substrate fermentation.

    Science.gov (United States)

    Vijayaraghavan, Ponnuswamy; Arun, Arumugaperumal; Al-Dhabi, Naif Abdullah; Vincent, Samuel Gnana Prakash; Arasu, Mariadhas Valan; Choi, Ki Choon

    2016-01-01

    Hydrolytic enzymes, such as cellulases and proteases, have various applications, including bioethanol production, extraction of fruit and vegetable juice, detergent formulation, and leather processing. Solid-substrate fermentation has been an emerging method to utilize low-cost agricultural residues for the production of these enzymes. Although the production of carboxy methyl cellulase (CMCase) and protease in solid state fermentation (SSF) have been studied extensively, research investigating multienzyme production in a single fermentation process is limited. The production of multienzymes from a single fermentation system could reduce the overall production cost of enzymes. In order to achieve enhanced production of enzymes, the response surface methodology (RSM) was applied. Bacillus subtilis IND19 utilized cow dung substrates for the production of CMCase and protease. A central composite design and a RSM were used to determine the optimal concentrations of peptone, NaH2PO4, and medium pH. Maximum productions of CMCase and protease were observed at 0.9 % peptone, 0.78 % NaH2PO4, and medium pH of 8.41, and 1 % peptone, 0.72 % NaH2PO4, and medium pH of 8.11, respectively. Under the optimized conditions, the experimental yield of CMCase and protease reached 473.01 and 4643 U/g, which were notably close to the predicted response (485.05 and 4710 U/g). These findings corresponded to an overall increase of 2.1- and 2.5-fold in CMCase and protease productions, respectively. Utilization of cow dung for the production of enzymes is critical to producing multienzymes in a single fermentation step. Cow dung is available in large quantity throughout the year. This report is the first to describe simultaneous production of CMCase and protease using cow dung. This substrate could be directly used as the culture medium without any pretreatment for the production of these enzymes at an industrial scale.

  13. Selected beetle assemblages captured in pitfall traps baited with deer dung or meat in balsam fir and sugar maple forests of central Quebec.

    Science.gov (United States)

    Brousseau, Pierre-Marc; Cloutier, Conrad; Hébert, Christian

    2010-08-01

    Vertebrate dung and carrion are rich and strongly attractive resources for numerous beetles that are often closely linked to them. The presence and abundance of beetles exploiting such resources are influenced by various ecological factors including climate and forest cover vegetation. We studied selected assemblages of coprophilous and necrophagous beetles in Quebec along a 115-km north-south transect in three balsam fir (Abies balsamea (L.) Miller) forest sites and in a fourth forest site dominated by sugar maple (Acer saccharum Marshall), close to the southern fir site. Beetle abundance was estimated using a sampling design comprising replicated pitfall traps baited with red deer meat or dung in each site. A total of 8,511 beetles were caught and identified to family level, 95.7% of which belonged to families with known coprophilous or necrophagous behavior. Meat-baited pitfall traps caught nearly 15 times as many beetles as dung-baited traps. All Histeridae, Hydrophilidae, Scarabaeidae, and Silphidae were identified to species to examine specific diversity variation among sites. For the beetles caught in the meat-baited traps (majority of captures), decreases in abundance and species richness were observed from south to north along the fir forest transect, with evidence of decreasing specific diversity as measured by the Shannon index of diversity. Strong differences in species assemblages were also observed between the southern maple and fir forest sites. The Silphidae and Histeridae were more abundant in the maple forest, whereas the Hydrophilidae and Ptilidae were more abundant in the fir forest.

  14. Determination of rivaroxaban in patient's plasma samples by anti-Xa chromogenic test associated to High Performance Liquid Chromatography tandem Mass Spectrometry (HPLC-MS/MS).

    Science.gov (United States)

    Derogis, Priscilla Bento Matos; Sanches, Livia Rentas; de Aranda, Valdir Fernandes; Colombini, Marjorie Paris; Mangueira, Cristóvão Luis Pitangueira; Katz, Marcelo; Faulhaber, Adriana Caschera Leme; Mendes, Claudio Ernesto Albers; Ferreira, Carlos Eduardo Dos Santos; França, Carolina Nunes; Guerra, João Carlos de Campos

    2017-01-01

    Rivaroxaban is an oral direct factor Xa inhibitor, therapeutically indicated in the treatment of thromboembolic diseases. As other new oral anticoagulants, routine monitoring of rivaroxaban is not necessary, but important in some clinical circumstances. In our study a high-performance liquid chromatography-tandem mass spectrometry (HPLC-MS/MS) method was validated to measure rivaroxaban plasmatic concentration. Our method used a simple sample preparation, protein precipitation, and a fast chromatographic run. It was developed a precise and accurate method, with a linear range from 2 to 500 ng/mL, and a lower limit of quantification of 4 pg on column. The new method was compared to a reference method (anti-factor Xa activity) and both presented a good correlation (r = 0.98, p plasma samples for rivaroxaban measurement by HPLC-MS/MS without interferences. The chromogenic and HPLC-MS/MS methods were highly correlated and should be used as clinical tools for drug monitoring. The method was applied successfully in a group of 49 real-life patients, which allowed an accurate determination of rivaroxaban in peak and trough levels.

  15. Three two-dimensional coordination polymers constructed from transition metals and 2,3-norbornanedicarboxylic acid: Hydrothermal synthesis, crystal structures and photocatalytic properties

    Science.gov (United States)

    Zhang, Jia; Wang, Chong-Chen

    2017-02-01

    Three novel coordination polymers based on transition metals like Co(II), Cu(II) and Mn(II), namely [Co2(bpy)2(nbda)2(H2O)2]·2H2O (denoted as BUC-1), [Cu2(bpy)2(nbda)2(H2O)2]·2H2O (BUC-2), [Mn2(bpy)2(nbda)2(H2O)2]·2H2O (BUC-3), (where bpy = 4,4‧-bipyridine, H2nbda = 2,3-norbornanedicarboxylic acid, BUC = Beijing University of Civil Engineering and Architecture), were synthesized under hydrothermal conditions, and characterized by CNH elemental analyses (EA), Fourier Transform infrared spectroscopy (FTIR), and single crystal X-ray diffraction (SCXRD). BUC 1-3 were isostructural and crystallized in the monoclinic space group C2/c, in which the corresponding metal atoms were linked by typical bidentate bpy ligands into two adjacent 1D [M1(bpy)]n2n+ and [M2(bpy)]n2n+ (M = Co(II), Cu(II), Mn(II)), further joined by versatile nbda2- ligands into 2D [M2(bpy)2(nbda)2]n sheets. Finally, three-dimensional supramolecular frameworks were constructed with the aid of the intermolecular hydrogen bonding interactions. BUC 1-3 exhibited different photocatalytic degradation ability to decompose methylene blue (MB) and methyl orange (MO) under UV light irradiation. Additionally, a possible photocatalytic mechanism HOMO-LUMO was proposed and discussed, which was further confirmed by radicals trapping experiments using isopropanol as radical scavenger.

  16. Effects of maternal and offspring environmental conditions on growth, development and diapause in latitudinal yellow dung fly populations

    OpenAIRE

    Scharf, Inon; Bauerfeind, Stephanie S; Blanckenhorn, Wolf U; Schäfer, Martin A

    2010-01-01

    Extensive phenotypic plasticity can allow populations to persist in changing environments. Maternal effects represent one important but often neglected source of phenotypic plasticity. Mothers and offspring of 2 high- (northern Norway and central Sweden) and 2 low- (northern and southern Spain) latitude yellow dung fly Scathophaga stercoraria (Diptera: Scathophagidae) populations were exposed to cold (12 degrees C) and warm (18 degrees C) temperatures and to short (8 h light: 16 h dark) and l...

  17. Green ambrosia for Soil- Dry Cow Dung Powder: Rhexistasy to Biostasy

    Science.gov (United States)

    Bagla, Hemlata; Barot, Nisha

    2013-04-01

    "Greener ambrosia for Soil - Dry cow dung powder: Rhexistasy to Biostasy" Pedosphere, the soil with its biotic and abiotic component, is produced by lithosphere`s interactions with atmosphere, hydrosphere and biosphere. The theory of Biorhexistasy proposed by pedologist H. Erhart [1], describes two crucial climatic phases of soil i.e. Biostasy, period of soil formation and Rhexistasy, periods of soil erosion. Humus, the organic matter in soil, permits better aeration, enhances the absorption and releases nutrients, and makes the soil less susceptible to leaching and erosion [2], thus the agent of soil`s vitality. Mismanagement of soil, leads to the degradation of millions of acres of land through erosion, compaction, salinization and acidification. Among these threats salinity is a major abiotic stress reducing the yield of wide variety of crops all over the world [3]. It is been proved that Humic Acid (HA) treatment can ameliorate the deleterious effects of salt stress by increasing root growth, altering mineral uptake, and decreasing membrane damage, thus inducing salt tolerance in plants [4]. HA can be inexpensively incorporated into soils via different biowastes. Dry cow dung powder (DCP), is naturally available bio-organic, complex, polymorphic humified fecal matter, enriched with minerals, carbohydrates, fats, proteins, bile pigments, aliphatic - aromatic species such as HA, Fulvic Acid (FA) etc [5]. The microbial consortium enables DCP with considerable potentials for biodegradation and biotransformation of even saline soil and further contributes to many biogeochemical processes, boosting humus content of soil. Due to unambiguous biological, microbiological as well as chemical inert properties of DCP, it has been successfully utilized as a fertilizer and soil conditioner since ages in India, one of the leading agrarian countries of the world. Thus we summarize that DCP is one of the best contenders for the biostasy and desaliner of soil, aptly, soil

  18. PERAN MIKROBA STARTER DALAM DEKOMPOSISI KOTORAN TERNAK DAN PERBAIKAN KUALITAS PUPUK KANDANG (The Role of Microbial Starter in Animal Dung Decomposition and Manure Quality Improvement

    Directory of Open Access Journals (Sweden)

    Cahyono Agus

    2014-10-01

    microbial decomposer population and requires a condusive environment. Those two factors influence on the  rate of organic material decomposition and limites the negative impact of this organic fertilizer on the aspect of social, ethic, and health of living organism. Cow dung was used as the material for decomposition of organic fertilizer. Two treatments were applied: with or without microbial decomposer (microbial starter followed by incubation in the dark condition under room temperature. The cow dung was sampled in 0, 6, and 24 hours after microbial starter application.The cow dung pH, color, smell, water content, and electrical conductivity were analyzed.  Furthermore, microbial pathogen (Eschericia coli and Salmonella, cow dung total nutrition (C,N,P,K,Ca,Mg,Na,S,Cd,Cr,B,Fe,Cu,Zn, and available N (NH4 dan NO3 were also determined. Amonia emision (NH3, oxygen (O2, carbon monoxide (CO, carbon dioxide (CO2, methane (CH4, NOx, NO, and SO2were analyzed as well. The result showed that microbial starter contained of important microbial for the process of cow dung decomposition. Application of microbial starter in cow dung reduced E. coli dan Salmonella sp. by the length of incubation time.Variation of nutrition, i.a. P, K, Mg, Fe, Cu, and heavy metal, i.a. Cr was found during incubation, both in chicken and cow manure.Application of microbial starter reduced sulfur in organic matter to be SO2 without smell, and inhibited H2S production. Decomposition by application of microbial starter should be conducted in aerob condition to reduce H2S production.  This research implied that application of microbial starter is crucially important in improving manure nutrition and quality.

  19. Suppression of Escherichia coli O157:H7 by Dung Beetles (Coleoptera: Scarabaeidae) using the lowbush blueberry agroecosystem as a model system.

    Science.gov (United States)

    Jones, Matthew S; Tadepalli, Shravani; Bridges, David F; Wu, Vivian C H; Drummond, Frank

    2015-01-01

    Wildlife as a source of microbial contamination is a food safety concern. Deer feces (scat) have been determined as a point source for Escherichia coli O157:H7 contamination of fresh produce. The ecological role of the scooped scarab (Onthophagus hecate (Panzer)), a generalist dung beetle species common in Maine blueberry fields, was explored as a biological control agent and alternatively as a pathogen vector between deer scat and food. A large-scale field survey of wildlife scat indicated that pathogenic E. coli O157:H7 was present, albeit at a low prevalence (1.9% of samples, n = 318), in the Maine lowbush blueberry agroecosystem. A manipulative field experiment verified that, should contact occur between deer scat and blueberry plants and fruit during the summer, contamination with E. coli O157:H7 can occur and persist for more than 72 h. For both the positive control and an experimental scat inoculation treatment, the levels of the bacterial population decreased over time, but at different rates (treatment x time interaction: F (1.9,18.8) = 358.486, P blueberry fruit. In both experiments, dung beetles buried the same amount of scat whether or not the scat was inoculated with the pathogen (F(1,6) = 0.001; P = 0.999 and (F (2,17) = 4.10, P = 0.147). Beetles feeding on E. coli inoculated deer scat were not found to vector the pathogen to fruit. In two studies, beetles lowered the amount of pathogenic E. coli persisting in soils compared to soils without beetles (F (2,9) = 7.757; P = 0.05 and F (2,17) = 8.0621, P = 0.004). Our study suggests that the dung beetle species, Onthophagus hecate, has the potential to contribute to the suppression of E. coli O157:H7 in agricultural landscapes.

  20. Integrated biological and advanced oxidation based treatment of hexamine bearing wastewater: Effect of cow-dung as a co-substrate

    Energy Technology Data Exchange (ETDEWEB)

    Gupta, Mandeep Kumar; Mittal, Atul K., E-mail: akmittal@civil.iitd.ac.in

    2016-05-05

    Highlights: • Treatment by biological process and Fenton’s reagent. • Cow dung as co-substrate. • Hydrolysis of wastewater improved treatment. - Abstract: This work examines the treatment of hexamethylenetetramine (HMT) bearing effluent from N, N-dinitroso pentamethylene tetra-mine producing industrial plants in India. Chemical treatment using Fenton’s reagent and aerobic treatment using batch reactors with co-substrate were investigated. Aerobic batch reactors integrated with advanced oxidation process of Fenton’s reagent provides effective treatment of HMT effluents. Influence of Fenton’s reagent dose reaction/contact and effect of varying co-substrate with effluent initial concentration was observed. Higher dose 100 mL of Fenton’s reagent with higher reaction time 20 h resulted better degradation (34.88%) of wastewater. HMT hydrolyzes in acidic environment to ammonia and formaldehyde. Formaldehyde under normal conditions is toxic for biological treatment processes. When hydrolysis and acidification in the reactors are accompanied by low pH, aerobic batch reactors with use of co-substrates glucose, sucrose, and cow-dung extract separately in different proportion to wastewater ranging from 0.67 to 4.00, degraded wastewater effectively. Higher proportion of co-substrate to wastewater resulted better degradation. The relationships between nitrate, pH, turbidity and COD are discussed.

  1. Integrated biological and advanced oxidation based treatment of hexamine bearing wastewater: Effect of cow-dung as a co-substrate

    International Nuclear Information System (INIS)

    Gupta, Mandeep Kumar; Mittal, Atul K.

    2016-01-01

    Highlights: • Treatment by biological process and Fenton’s reagent. • Cow dung as co-substrate. • Hydrolysis of wastewater improved treatment. - Abstract: This work examines the treatment of hexamethylenetetramine (HMT) bearing effluent from N, N-dinitroso pentamethylene tetra-mine producing industrial plants in India. Chemical treatment using Fenton’s reagent and aerobic treatment using batch reactors with co-substrate were investigated. Aerobic batch reactors integrated with advanced oxidation process of Fenton’s reagent provides effective treatment of HMT effluents. Influence of Fenton’s reagent dose reaction/contact and effect of varying co-substrate with effluent initial concentration was observed. Higher dose 100 mL of Fenton’s reagent with higher reaction time 20 h resulted better degradation (34.88%) of wastewater. HMT hydrolyzes in acidic environment to ammonia and formaldehyde. Formaldehyde under normal conditions is toxic for biological treatment processes. When hydrolysis and acidification in the reactors are accompanied by low pH, aerobic batch reactors with use of co-substrates glucose, sucrose, and cow-dung extract separately in different proportion to wastewater ranging from 0.67 to 4.00, degraded wastewater effectively. Higher proportion of co-substrate to wastewater resulted better degradation. The relationships between nitrate, pH, turbidity and COD are discussed.

  2. The effect of a nematode parasite on feeding and dung-burying behavior of an ecosystem engineer.

    Science.gov (United States)

    Boze, Broox G V; Moore, Janice

    2014-07-01

    Dung beetles (genus Phanaeus) consume feces in both their larval and adults forms and because of their unique dietary niche, and behaviors associated with the burial of feces, are considered ecosystem engineers. In addition, because these insects subsist on a diet composed exclusively of feces, it is likely they encounter parasitic propagules more frequently than other animals do. Parasites often alter their host's behavior, so we set out to test whether Physocephalus sexalatus (a cosmopolitan nematode parasite of ungulates) does so in ways that affect the dung beetle's role as an ecosystem engineer and/or its predator-prey relationships (transmission of the parasite). Classic tests of anti-predator behavior did not reveal behavioral differences based on the beetles' infection status. However, this parasite did alter the beetles' behaviors in ways that could be critical for its role in fecal processing and therefore ecosystem engineering. Infected beetles exhibited anorexic behavior and consumed only half the amount of feces ingested by similar uninfected beetles. Infected beetles also buried less feces and did so in tunnels that were significantly shorter than those created by uninfected beetles. Fecal burial is naturally beneficial because it aerates the soil, incorporates nitrogenous compounds, and increases the flow of water thereby making soil and pastureland more productive. We showed that the nematode parasite P. sexalatus itself becomes an ecosystem engineer as it modifies the behavior of its already influential intermediate host. © The Author 2014. Published by Oxford University Press on behalf of the Society for Integrative and Comparative Biology. All rights reserved. For permissions please email: journals.permissions@oup.com.

  3. Validation of a standard field test method in four countries to assess the toxicity of residues in dung of cattle treated with veterinary medical products

    NARCIS (Netherlands)

    Floate, Kevin D.; Düring, Rolf Alexander; Hanafi, Jamal; Jud, Priska; Lahr, Joost; Lumaret, Jean Pierre; Scheffczyk, Adam; Tixier, Thomas; Wohde, Manuel; Römbke, Jörg; Sautot, Lucille; Blanckenhorn, Wolf U.

    2016-01-01

    Registration of veterinary medical products includes the provision that field tests may be required to assess potential nontarget effects associated with the excretion of product residues in dung of treated livestock (phase II, tier B testing). However, regulatory agencies provide no guidance on

  4. Elevational Distribution and Conservation Biogeography of Phanaeine Dung Beetles (Coleoptera: Scarabaeinae) in Bolivia

    Science.gov (United States)

    Herzog, Sebastian K.; Hamel-Leigue, A. Caroli; Larsen, Trond H.; Mann, Darren J.; Soria-Auza, Rodrigo W.; Gill, Bruce D.; Edmonds, W. D.; Spector, Sacha

    2013-01-01

    Insect macroecology and conservation biogeography studies are disproportionately scarce, especially in the Neotropics. Dung beetles are an ideal focal taxon for biodiversity research and conservation. Using distribution and body size data on the ecologically important Phanaeini, the best-known Neotropical dung beetle tribe, we determined elevational patterns of species richness, endemism, body size, and elevational range in Bolivia, specifically testing Bergmann’s and Rapoport’s rule. Richness of all 39 species and of 15 ecoregional endemics showed a hump-shaped pattern peaking at 400 m, but overall declined strongly with elevation up to 4000 m. The relationship between endemic and total species richness appeared to be curvilinear, providing only partial support for the null hypothesis that species-rich areas are more likely to be centers of endemism by chance alone. An elevational increase in the proportion of ecoregional endemics suggests that deterministic factors also appear to influence endemism in the Andes. When controlling for the effect of area using different species-area relationships, the statistically significant richness peak became more pronounced and shifted upslope to 750 m. Larger species did not have higher elevational mid-points, and mean body size decreased significantly with elevation, contradicting Bergmann’s rule. Rapoport’s rule was supported: species with higher elevational mid-points had broader elevational ranges, and mean elevational range increased significantly with elevation. The elevational decrease of phanaeine richness is in accordance with studies that demonstrated the combined influence of temperature and water availability on species diversity, but also is consistent with niche conservatism. For invertebrates, confirmation of Rapoport’s and refutation of Bergmann’s rule appear to be scale-invariant general patterns. Analyses of biogeographic patterns across elevational gradients can provide important insights for

  5. Mesostigmatic Mites (Acari) Associated with Ground, Burying, Roving Carrion and Dung Beetles (Coleoptera) in Sapporo and Tomakomai, Hokkaido, Northern Japan

    OpenAIRE

    Takaku, Gen; Katakura, Haruo; Yoshida, Nobuyo

    1994-01-01

    A total of 19 species belonging to 5 families of mesostigmatic mites were collected in Sapporo and Tomakomai, northern Japan, on four groups of beetles, i.e., ground beetles (Carabinae, Carabidae), burying beetles (Nicrophorini, Silphinae, Silphidae), roving carrion beetles (Silphini, Silphinae, Silphidae) and dung beetles (Scarabaeidae and Geotrupidae), all of which mainly forage on the ground surface. No mite species was found on more than one group of beetles except for Poecilochirus carab...

  6. Mesostigmatic Mites (Acari) Associated with Ground, Burying, Roving Carrion and Dung Beetles (Coleoptera) in Sapporo and Tomakomai, Hokkaido, Northern Japan

    OpenAIRE

    Gen, Takaku; Haruo, Katakura; Nobuyo, Yoshida; Division of Biological Sciences, Graduate School of Science, Hokkaido University; Division of Biological Sciences, Graduate School of Science, Hokkaido University; Tohoku Agricultural Experiment Station

    1994-01-01

    A total of 19 species belonging to 5 families of mesostigmatic mites were collected in Sapporo and Tomakomai, northern Japan, on four groups of beetles, i. e. , ground beetles (Carabinae, Carabidae), burying beetles (Nicrophorini, Silphinae, Silphidae), roving carrion beetles (Silphini, Silphinae, Silphidae) and dung beetles (Scarabaeidae and Geotrupidae), all of which mainly forage on the ground surface. No mite species was found on more than one group of beetles except for Poecilochirus car...

  7. Local and regional effects on community structure of dung beetles in a mainland-island scenario.

    Directory of Open Access Journals (Sweden)

    Pedro Giovâni da Silva

    Full Text Available Understanding the ecological mechanisms driving beta diversity is a major goal of community ecology. Metacommunity theory brings new ways of thinking about the structure of local communities, including processes occurring at different spatial scales. In addition to new theories, new methods have been developed which allow the partitioning of individual and shared contributions of environmental and spatial effects, as well as identification of species and sites that have importance in the generation of beta diversity along ecological gradients. We analyzed the spatial distribution of dung beetle communities in areas of Atlantic Forest in a mainland-island scenario in southern Brazil, with the objective of identifying the mechanisms driving composition, abundance and biomass at three spatial scales (mainland-island, areas and sites. We sampled 20 sites across four large areas, two on the mainland and two on the island. The distribution of our sampling sites was hierarchical and areas are isolated. We used standardized protocols to assess environmental heterogeneity and sample dung beetles. We used spatial eigenfunctions analysis to generate the spatial patterns of sampling points. Environmental heterogeneity showed strong variation among sites and a mild increase with increasing spatial scale. The analysis of diversity partitioning showed an increase in beta diversity with increasing spatial scale. Variation partitioning based on environmental and spatial variables suggests that environmental heterogeneity is the most important driver of beta diversity at the local scale. The spatial effects were significant only at larger spatial scales. Our study presents a case where environmental heterogeneity seems to be the main factor structuring communities at smaller scales, while spatial effects are more important at larger scales. The increase in beta diversity that occurs at larger scales seems to be the result of limitation in species dispersal

  8. North to Alaska: Evidence for conveyor belt transport of Dungeness crab larvae along the west coast of the United States and Canada

    Science.gov (United States)

    Park, W.; Douglas, David C.; Shirley, Thomas C.

    2007-01-01

    We propose and evaluate the hypothesis that Dungeness crab (Cancer magister) larvae from the northwestern coast of the United States and Canada can be transported northward to southeastern Alaska. Larvae collected in southeastern Alaska during May and June 1997–2004 had abundances and stages that varied seasonally, interannually, and spatially. An unexpected presence of late-stage larvae in spring raises a question regarding their origin, and the most plausible explanation is that they hatched off the northern Washington and British Columbia coasts and were transported to southeastern Alaska. Buoy drift tracks support the hypothesis that larvae released off the northern Washington and British Columbia coasts during the peak hatching season can be physically transported to southeastern Alaska, arriving as late-stage larvae in May and June, when local larvae are only beginning to hatch. A northward spring progression of monthly mean 7°C SST isotherms and phytoplankton blooms provide further evidence that environmental conditions are conducive for larval growth and metabolism during the transport period. The proposed larval transport suggests possible unidirectional gene flow between southern and northern populations of Dungeness crabs in southeastern Alaska.

  9. Optimization of fly ash incorporation into cow dung-waste paper mixtures for enhanced vermidegradation and nutrient release.

    Science.gov (United States)

    Mupambwa, Hupenyu A; Mnkeni, Pearson N S

    2015-05-01

    This study was conducted to establish an appropriate mixture ratio of fly ash (F) to optimized cow dung-waste paper mixtures (CP) to develop a high-quality vermicompost using earthworms (). Fly ash was mixed with cow dung-waste paper mixtures at ratios of (F:CP) 1:1, 1:2, 1:3, 2:1, and 3:1 or CP alone and composted for 14 wk. Olsen P, inorganic N (NO, NO, and NH), C:N ratio, ash content, microbial biomass C, and humification parameters were measured together with scanning electron micrograph images to determine compost maturity. Based on C:N ratio, the extent of vermidegradation of the waste mixtures followed the decreasing order (F:CP) of 1:3 > 1:2 > 1:1 > CP alone > 2:1 > 3:1. Similarly, Olsen P was significantly higher ( percentage increase in extractable P was in the order CP alone > 1:2 > 1:3 > 1:1 > 2:1 > 3:1, with earthworm addition almost doubling P release across the 1:1, 1:2, and CP alone treatments. Fly ash incorporation enhanced conversion of organic N to the plant-available inorganic forms, with the 1:3 treatment resulting in the highest conversion. Scanning electron micrograph images confirmed the extent of vermidegradation reflected by the various humification parameters determined. Fly ash incorporation at the 1:2 ratio proved to be the most appropriate because it allows processing of more fly ash while giving a vermicompost with desirable maturity and nutritional properties. Copyright © by the American Society of Agronomy, Crop Science Society of America, and Soil Science Society of America, Inc.

  10. Distribution and Abundance of Dungeness Crab and Crangon Shrimp and Dredging-Related Mortality of Invertebrates and Fish in Grays Harbor, Washington,

    Science.gov (United States)

    1982-01-01

    to this evidence, crabs may have been more abundant in samples taken from high salinity areas. In this respect the buoy 13 site was an anomaly ...in 1-2 hr. Continued respiration and branchial water movement by Dungeness crab caught in impacted areas of slurried sediment could cause loading of...particulate material among branchial filaments, resulting in impeded oxygen transport and physical abrasion and damage to gills. To 304 our knowledge

  11. Short-term effects of a dung pat on N2 fixation and total N uptake in a perennial ryegrass/white clover mixture

    DEFF Research Database (Denmark)

    Jørgensen, F.V.; Jensen, E.S.

    1997-01-01

    The short-term effects of a simulated cattle dung pat on N-2 fixation and total uptake of N in a perennial ryegrass/white clover mixture was studied in a container experiment using sheep faeces mixed with water to a DM content of 13%. We used a new N-15 cross-labelling technique to determine...

  12. Preliminary Assessment of Potential Impacts to Dungeness Crabs from Disposal of Dredged Materials from the Columbia River

    Energy Technology Data Exchange (ETDEWEB)

    Pearson, Walter H.; Miller, Martin C.; Williams, Greg D.; Kohn, Nancy P.; Skalski, John R.

    2006-02-01

    Dredging of the Columbia River navigation channel has raised concerns about dredging-related impacts on Dungeness crabs (Cancer magister). The overall objectives of this effort are to synthesize what is known about disposal effects on Dungeness crabs (Phase 1) and to offer approaches to quantify the effects, including approaches to gain a population-level perspective on any effects found in subsequent studies (Phase 2). This report documents Phase 1, which included (1) development of a conceptual model to integrate knowledge about crab biology and the physical processes occurring during disposal, (2) application of physics-based numerical modeling of the disposal event to understand the physical forces and processes to which a crab might be exposed during disposal, (3) conduct of a vulnerability analysis to identify the potential mechanisms by which crabs may be injured, and (4) recommendations of topics and approaches for future studies to assess the potential population-level effects of disposal on Dungeness crabs. The conceptual model first recognizes that disposal of dredged materials is a physically dynamic process with three aspects: (1) convective descent and bottom encounter, (2) dynamic collapse and spreading, and (3) mounding. Numerical modeling was used to assess the magnitude of the potentially relevant forces and extent of mounding in single disposal events. The modeling outcomes show that predicted impact pressure, shear stress, and mound depth are greatly reduced by discharge in deep water, and somewhat reduced at longer discharge duration. The analysis of numerical modeling results and vulnerabilities indicate that the vulnerability of crabs to compression forces under any of the disposal scenarios is low. For the deep-water disposal scenarios, the maximum forces and mounding do not appear to be sufficiently high enough to warrant concern for surge currents or burial at the depths involved (over 230 ft). For the shallow-water (45 to 65 ft), short

  13. Chronic arsenic exposure increases TGFalpha concentration in bladder urothelial cells of Mexican populations environmentally exposed to inorganic arsenic

    International Nuclear Information System (INIS)

    Valenzuela, Olga L.; Germolec, Dori R.; Borja-Aburto, Victor H.; Contreras-Ruiz, Jose; Garcia-Vargas, Gonzalo G.; Razo, Luz M. del

    2007-01-01

    Inorganic arsenic (iAs) is a well-established carcinogen and human exposure has been associated with a variety of cancers including those of skin, lung, and bladder. High expression of transforming growth factor alpha (TGF-α) has associated with local relapses in early stages of urinary bladder cancer. iAs exposures are at least in part determined by the rate of formation and composition of iAs metabolites (MAs III , MAs V , DMAs III , DMAs V ). This study examines the relationship between TGF-α concentration in exfoliated bladder urothelial cells (BUC) separated from urine and urinary arsenic species in 72 resident women (18-51 years old) from areas exposed to different concentrations of iAs in drinking water (2-378 ppb) in central Mexico. Urinary arsenic species, including trivalent methylated metabolites were measured by hydride generation atomic absorption spectrometry method. The concentration of TGF-α in BUC was measured using an ELISA assay. Results show a statistically significant positive correlation between TGF-α concentration in BUC and each of the six arsenic species present in urine. The multivariate linear regression analyses show that the increment of TGF-α levels in BUC was importantly associated with the presence of arsenic species after adjusting by age, and presence of urinary infection. People from areas with high arsenic exposure had a significantly higher TGF-α concentration in BUC than people from areas of low arsenic exposure (128.8 vs. 64.4 pg/mg protein; p < 0.05). Notably, exfoliated cells isolated from individuals with skin lesions contained significantly greater amount of TGF-α than cells from individuals without skin lesions: 157.7 vs. 64.9 pg/mg protein (p = 0.003). These results suggest that TGF-α in exfoliated BUC may serve as a susceptibility marker of adverse health effects on epithelial tissue in arsenic-endemic areas

  14. Rivaroxaban-once daily, oral, direct factor Xa inhibition compared with vitamin K antagonism for prevention of stroke and Embolism Trial in Atrial Fibrillation: rationale and design of the ROCKET AF study

    DEFF Research Database (Denmark)

    NN, NN

    2010-01-01

    BACKGROUND: Atrial fibrillation (AF), the most common significant cardiac arrhythmia, increases the risk of stroke, particularly in the elderly. Warfarin is effective in reducing stroke risk but is burdensome to patients and is difficult to control. Rivaroxaban is an oral direct factor Xa inhibit...

  15. Cow dung: a potential biomass substrate for the production of detergent-stable dehairing protease by alkaliphilic Bacillus subtilis strain VV.

    Science.gov (United States)

    Vijayaraghavan, Ponnuswamy; Vijayan, Aija; Arun, Arumugaperumal; Jenisha, John Kennady; Vincent, Samuel Gnana Prakash

    2012-01-01

    Cow dung, a cheap and easily available source of energy, was used as the substrate for the production of alkaline protease by solid-state fermentation using the Bacillus subtilis strain VV. In order to achieve the maximum yield of this enzyme, the following optimum process parameters are needed: fermentation period (72 h), pH (10.0), moisture content (140%), inoculum (25%), temperature (30-40°C), carbon source (2% (w/w) maltose) and nitrogen source (1% (w/w) urea). The protease was stable over a broad temperature range (30-50°C) and pH (8.0-10.0), with maximum activity at 50°C and pH 10.0. Among the divalent ions tested, Ca(2+) (0.01 M) increased enzyme activity. The purified protease, after being subjected to sodium dodecyl sulphate-polyacrylamide gel electrophoresis, was found to have a molecular mass of 38.5 kDa. The enzyme was solvent-and surfactant-stable and showed activity even after 24 h incubation along with various commercially available detergents. This enzyme possessed dehairing properties for animal hide after 16 h of incubation at room temperature. From these results it is evident that cow dung is a potential substrate for the production of a detergent-stable, dehairing protease by B. subtilis. This enzyme has a lot of potential applications in the detergent and leather-processing industries.

  16. Contemporary developments in the discovery of selective factor Xa inhibitors: A review.

    Science.gov (United States)

    Patel, Nirav R; Patel, Dushyant V; Murumkar, Prashant R; Yadav, Mange Ram

    2016-10-04

    Thrombosis is a leading cause of death in cardiovascular diseases such as myocardial infarction (MI), unstable angina and acute coronary syndrome (ACS) in the industrialized world. Venous thromboembolism is observed in about 1 million people every year in United States causing significant morbidity and mortality. Conventional antithrombotic therapy has been reported to have several disadvantages and limitations like inconvenience in oral administration, bleeding risks (heparin analogs), narrow therapeutic window and undesirable interactions with food and drugs (vitamin K antagonist-warfarin). The unmet medical demand for orally active safe anticoagulants has generated widespread interest among the medicinal chemists engaged in this field. To modulate blood coagulation, various enzymes involved in the coagulation process have received great attention as potential targets by various research groups for the development of oral anticoagulants. Among these enzymes, factor Xa (FXa) has remained the centre of attention in the last decade. Intensive research efforts have been made by various research groups for the development of small, safe and orally bioavailable FXa inhibitors. This review is an attempt to compile the research work of various researchers in the direction of development of FXa inhibitors reported since 2010 onward. Copyright © 2016 Elsevier Masson SAS. All rights reserved.

  17. BUC implementation in Slovakia

    International Nuclear Information System (INIS)

    Chrapciak, V.; Vaclav, J.

    2009-01-01

    Improved calculation methods allow one to take credit for the reactivity reduction associated with fuel burnup. This means reducing the analysis conservatism while maintaining an adequate criticality safety margin. Application of burnup credit requires knowledge of the reactivity state of the irradiated fuel for which application of burnup credit is taken. The isotopic inventory and reactivity has to be calculated with validated codes. We use in Slovakia Gd2 fuel with maximal enrichment of fuel pins 4.4%. Our transport and storage basket KZ-48 with boron steel is licensed for fresh fuel with enrichment 4.4%. In near future (2011 or 2012) we will use a new fuel with maximal enrichment of fuel pins 4.9%. For this fuel we plan to use existing KZ-48 with application of burnup credit application. In cooperation with Slovak Nuclear Regulatory Authority we have started several years ago process of application of burnup credit implementation in Slovakia for WWER-440 reactors. We have already prepared methodology according IAEA methodology. We have validated computational systems (SCALE 5.1 already, SCALE 6 in progress). Slovak Nuclear Regulatory Authority will prepare regulation about application of burnup credit application in Slovakia. Last item is preparation of safety reports (for transport and storage) for the new fuel with average enrichment 4.87% in basket KZ-48 with application of burnup credit application. (Authors)

  18. Overexpression of high mobility group box 1 contributes to progressive clinicopathological features and poor prognosis of human bladder urothelial carcinoma

    Directory of Open Access Journals (Sweden)

    Huang CK

    2018-04-01

    Full Text Available Changkun Huang,* Zhichao Huang,* Xiaokun Zhao, Yinhuai Wang, Hongqing Zhao, Zhaohui Zhong, Lang Wang Department of Urology, The Second Xiangya Hospital, Central South University, Changsha, Hunan, People’s Republic of China *These authors contributed equally to this work Background: High mobility group box 1 (HMGB1, a versatile protein with intranuclear and extracellular functions, plays an important role in a variety of human cancers. However, the clinical/prognostic significance of HMGB1 expression in human bladder urothelial carcinoma (BUC remains unclear. The aim of this study was to investigate the HMGB1 expression in human BUC with regard to its clinical and prognostic significance.Patients and methods: HMGB1 mRNA and protein expressions in tumor and paired normal bladder tissues were detected in 20 BUC cases by quantitative real-time polymerase chain reaction (qRT-PCR and Western blot. HMGB1 protein expression in 165 primary BUC tissues was evaluated by immunohistochemistry (IHC, and its correlations with clinicopathological characteristics and prognosis were also analyzed. Student’s t-test, χ2 test, Kaplan–Meier plots, and Cox proportional hazard regression model were performed to analyze the data. Results: By using qRT-PCR and Western blot, the upregulated expression of HMGB1 mRNA and protein was detected in BUC, compared with paired normal tissue (P<0.05. By using IHC, high HMGB1 expression was examined in 84 of 165 (51.0% BUC cases. High HMGB1 expression was significantly correlated with poorer differentiation and higher T and N classification (all P<0.05. Univariate analysis showed that high HMGB1 expression was significantly associated with a shortened patients’ overall survival (OS and disease-free survival (DFS; both P<0.001. In different subgroups of BUC patients, HMGB1 expression was a prognostic factor in patients with different histological grades or T classification (all P<0.05, pN− (both P<0.001 for OS and DFS, and

  19. Trivial topological phase of CaAgP and the topological nodal-line transition in CaAg (P1 -xA sx)

    Science.gov (United States)

    Xu, N.; Qian, Y. T.; Wu, Q. S.; Autès, G.; Matt, C. E.; Lv, B. Q.; Yao, M. Y.; Strocov, V. N.; Pomjakushina, E.; Conder, K.; Plumb, N. C.; Radovic, M.; Yazyev, O. V.; Qian, T.; Ding, H.; Mesot, J.; Shi, M.

    2018-04-01

    By performing angle-resolved photoemission spectroscopy and first-principles calculations, we address the topological phase of CaAgP and investigate the topological phase transition in CaAg (P1 -xA sx) . We reveal that in CaAgP, the bulk band gap and surface states with a large bandwidth are topologically trivial, in agreement with hybrid density functional theory calculations. The calculations also indicate that application of "negative" hydrostatic pressure can transform trivial semiconducting CaAgP into an ideal topological nodal-line semimetal phase. The topological transition can be realized by partial isovalent P/As substitution at x =0.38 .

  20. Emergência de Haematobia irritans em fezes bovinas no município de Seropédica, Rio de Janeiro Emergence of Haematobia irritans in cattle dung pats in Seropédica county, Rio de Janeiro

    Directory of Open Access Journals (Sweden)

    Douglas Marques de Macedo

    2001-06-01

    Full Text Available O presente trabalho teve como objetivo estudar a emergência de Haematobia irritans em fezes de bovinos mantidas a campo e em laboratório, além de observar a presença de outros dípteros associados às massas fecais. Foram utilizados dois grupos de fezes bovinas, um à campo e outro em laboratório, sendo cada grupo formado por cinco bolos fecais frescos de tamanho mediano (cerca de 30 cm de diâmetro, aparência opaca, cor esverdeada, presença de fina crosta externa e consistência firme. As fezes foram cobertas com gaiolas de emergência de formato piramidal, apresentando na parte superior um orifício onde foi acoplado um frasco removível; a substituição das fezes foi realizada quinzenalmente. Foram coletados um total de 355 espécimens de H. irritans, sendo 151 provenientes das gaiolas mantidas no campo e 204 em laboratório. Estas diferenças deveram-se provavelmente à menores oscilações de temperatura verificadas no laboratório do que àquelas ocorridas no campo, além da ação de artrópodes predadores, competidores e parasitóides que, provavelmente, interferiram na emergência de H. irritans nas fezes bovinas mantidas no campo. Foi observado maior número de fêmeas em comparação com machos em ambas as condições investigadas. Além de H. irritans, obteve-se outros dípteros associados às fezes bovinas, pertencentes as seguintes famílias: Aulacigastridae, Muscidae, Psychodidae, Sarcophagidae, Sepsidae, Tachinidae e Ulidiidae. Sepsidae foi a mais abundante, com 5.224 exemplares do total de 8.928 dípteros obtidos, seguida por Sarcophagidae com 2.235 espécimens coletados, Muscidae com 1.357, Aulacigastridae com 54, Psychodidae com 46, Ulidiidae com 6 e Tachinidae com 5 exemplares.This study was carried out in order to investigate the emergence of adult flies of Haematobia irritans in cattle dung maintained in the field and in the laboratory, as well as other flies associated with dung pats. Two groups of cattle dung were

  1. The novel kinetics expression of Cadmium (II) removal using green adsorbent horse dung humic acid (Hd-Ha)

    Science.gov (United States)

    Basuki, Rahmat; Santosa, Sri Juari; Rusdiarso, Bambang

    2017-03-01

    Humic acid from dry horse dung powder has been prepared and this horse dung humic acid (HD-HA) was then applied as a sorbent to adsorb Cadmium(II) from a solution. Characterization of HD-HA was conducted by detection of its functional group, UV-Vis spectra, ash level, and total acidity. Result of the work showed that HD-HA had similar character compared with peat soil humic acid (PS-HA) and previous researchers. The adsorption study of this work was investigated by batch experiment in pH 5. The thermodynamics parameters in this work were determined by the Langmuir isotherm model for monolayer sorption and Freundlich isotherm model multilayer sorption. Monolayer sorption capacity (b) for HD-HA was 1.329 × 10-3 mol g-1, equilibrium constant (K) was 5.651 (mol/L)-1, and multilayer sorption capacity was 2.646 × 10-2 mol g-1. The kinetics parameters investigated in this work were determined by the novel kinetics expression resulted from the mathematical derivation the availability of binding sites of sorbent. Adsorption rate constant (ka) from this novel expression was 43.178 min-1 (mol/L)-1 and desorption rate constant (kd) was 1.250 × 10-2 min-1. Application of the kinetics model on sorption Cd(II) onto HD-HA showed the nearly all of models gave a good linearity. However, only this proposed kinetics expression has good relation with Langmuir model. The novel kinetics expression proposed in this paper seems to be more realistic and reasonable and close to the experimental real condition because the value of ka/kd (3452 (mol/L)-1) was fairly close with K from Langmuir isotherm model (5651 (mol/L)-1). Comparison of this novel kinetics expression with well-known Lagergren pseudo-first order kinetics and Ho pseudo-second order kinetics was also critically discussed in this paper.

  2. Escarabajos estercoleros (Coleoptera: Scarabaeidae: Scarabaeinae de ranchos ganaderos de Yucatán, México Dung beetles (Coleoptera: Scarabaeidae: Scarabaeinae from cattle ranches of Yucatán, Mexico

    Directory of Open Access Journals (Sweden)

    Gertrudis Basto-Estrella

    2012-06-01

    Full Text Available Este estudio describe la fauna de escarabajos estercoleros (Scarabaeidae: Scarabaeinae en ranchos ganaderos del trópico subhúmedo. De enero a diciembre de 2010 se recolectaron 93 274 escarabajos estercoleros pertenecientes a 17 especies de la subfamilia Scarabaeinae con trampas de caída libre cebadas con excremento de ganado bovino en 4 ranchos ganaderos del oriente del estado de Yucatán, México. Las especies más abundantes fueron Onthophagus landolti, seguida por Canthon indigaceus chevrolati, Digitonthophagus gazella, C. leechi y Pseudocanthon perplexus. Se observó que las especies cavadoras tuvieron mayor abundancia y riqueza; las diurnas de talla pequeña tuvieron menor riqueza pero fueron más abundantes en todo el estudio. El conocimiento de la composición faunística de escarabajos estercoleros de la región es un punto de partida para desarrollar estudios del impacto de las actividades humanas y las prácticas de producción ganadera sobre la diversidad de estos insectos.This study describes the fauna of dung beetles (Scarabaeidae: Scarabaeinae in tropical sub-humid cattle ranches. Insects were collected with pitfall traps baited with cattle manure from January to December 2010 in four cattle ranches of eastern state of Yucatán, Mexico. 93 274 dung beetles were collected from 17 species of the subfamily Scarabaeinae. The most abundant species were Onthophagus landolti, followed by Canthon indigaceus chevrolati, Digitonthophagus gazella, C. leechi y Pseudocanthon perplexus. Observations showed that burrowing species had greater abundance and species richness. Diurnal species of small size had lower richness, but were more abundant. Knowledge of the composition of dung beetle fauna of the region is a starting point to develop studies of the impact of human activities and livestock production practices on the diversity of these insects.

  3. Cleavage of spike protein of SARS coronavirus by protease factor Xa is associated with viral infectivity

    International Nuclear Information System (INIS)

    Du, Lanying; Kao, Richard Y.; Zhou, Yusen; He, Yuxian; Zhao, Guangyu; Wong, Charlotte; Jiang, Shibo; Yuen, Kwok-Yung; Jin, Dong-Yan; Zheng, Bo-Jian

    2007-01-01

    The spike (S) protein of SARS coronavirus (SARS-CoV) has been known to recognize and bind to host receptors, whose conformational changes then facilitate fusion between the viral envelope and host cell membrane, leading to viral entry into target cells. However, other functions of SARS-CoV S protein such as proteolytic cleavage and its implications to viral infection are incompletely understood. In this study, we demonstrated that the infection of SARS-CoV and a pseudovirus bearing the S protein of SARS-CoV was inhibited by a protease inhibitor Ben-HCl. Also, the protease Factor Xa, a target of Ben-HCl abundantly expressed in infected cells, was able to cleave the recombinant and pseudoviral S protein into S1 and S2 subunits, and the cleavage was inhibited by Ben-HCl. Furthermore, this cleavage correlated with the infectivity of the pseudovirus. Taken together, our study suggests a plausible mechanism by which SARS-CoV cleaves its S protein to facilitate viral infection

  4. Rapid recovery of Dungeness crab within spatial fishery closures declared under indigenous law in British Columbia

    Directory of Open Access Journals (Sweden)

    Alejandro Frid

    2016-04-01

    Full Text Available Canada’s constitution grants indigenous people priority access to marine resources, yet indigenous, commercial and recreational fishers target the same species. Avoiding conflict between different users, therefore, requires evidence-based policies that manage fisheries for conservation while respecting indigenous rights. From 2006 to 2015, Canada’s Conservative government demoted the role of science in resource management, stifling research by federal agencies like Fisheries and Oceans Canada. To address ensuing data gaps, during 2014–2015 the Heiltsuk, Kitasoo/Xai’Xais, Nuxalk, and Wuikinuxv First Nations conducted coordinated research on Dungeness crab (Cancer magister, a culturally-significant resource. These indigenous groups are experiencing declining catch rates of Dungeness crab and postulate that commercial and recreational fisheries are primary causes of local declines. Accordingly, they applied indigenous laws and declared spatial fishery closures for commercial and recreational fishers at 10 sites (closed while allowing exploitation by all users to continue at 10 other sites (open. Sampling occurred repeatedly over time and analyses compared temporal trends in population characteristics between closed and open sites. Results were consistent with the hypothesis that fisheries decrease the abundance and size of exploited species, but spatial protection can reverse these effects. The body size and catch-per-unit effort of legal-sized males increased over time at closed sites but declined at open sites. Importantly, fishery status did not affect temporal changes in the relative abundance of unfished classes of crab–sublegal males and females–which is logically consistent with the hypothesis. Our study demonstrates that indigenous governance can create spatial closures for conservation and research when Canada’s government fails to do so. Long-term solutions, however, require collaboration in research and management between

  5. Removal of Co(II) from waste water using dry cow dung powder : a green ambrosia to soil

    Science.gov (United States)

    Bagla, Hemlata; Khilnani, Roshan

    2015-04-01

    Co(II) is one of the hazardous products found in the waste streams. The anthropogenic activities are major sources of Co(II) in our environment. Some of the well-established processes such as chemical precipitation, membrane process, liquid extraction and ion exchange have been applied as a tool for the removal of this metal ion [1]. All the above methods are not considered to be greener due to some of their shortcomings such as incomplete metal ion removal, high requirement of energy and reagents, generation of toxic sludge or other waste materials which in turn require further treatments for their cautious disposal. The present investigation entails the application of dry cow dung powder (DCP) as an indigenous, inexpensive and eco-friendly material for the removal of Co(II) from aqueous medium. DCP, is naturally available bio-organic, complex, polymorphic humified fecal matter of cow and is enriched with minerals, carbohydrates, fats, proteins, bile pigments, aliphatic-aromatic species such as 'Humic acid' (HA), Fulvic acid, Ulmic acid [2,3]. Batch biosorption experiments were conducted employing 60Co(II) as a tracer and effect of various process parameters such as pH (1-8), temperature (283-363K), amount of biosorbent (5-40 g/L), time of equilibration (0-30 min), agitation speed (0-4000 rpm), concentration of initial metal ions (0.5-20 mg/mL) and interfering effect of different organic as well as inorganic salts were studied. The Kinetic studies were carried out employing various models but the best fitting was given by Lagergren Pseudo-second order model [4] with high correlation coefficient R2 value of 0.999 and adsorption capacity of 2.31 mg/g. The thermodynamic parameters for biosorption were also evaluated which indicated spontaneous and exothermic process with high affinity of DCP for Co(II). Many naturally available materials are used for biosorption of hazardous metal pollutants, where most of them are physically or chemically modified. In this research

  6. Evidence for environmental conditions during the last 20 000 years in Southern Africa from C-13 in fossil hyrax dung

    CSIR Research Space (South Africa)

    Scott, L

    2000-11-01

    Full Text Available .elsevier.comrlocatergloplacha Evidence for environmental conditions during the last 20 000 years in Southern Africa from 13C in fossil hyrax dung L. Scott a,), J.C. Vogel b a Department of Botany and Genetics, Uni?ersity of the Orange Free State, PO Box 339, Bloemfontein 9300, South... in the studied hyrax middens, provide evidence that changes oc- curred on a regional scale. This is partly supported 13 by the d C sequences in stalagmite Talma and .Vogel, 1992 . In areas with summer-rains where AsweetB grass is likely to develop, d13C values...

  7. Attractivity of omnivore, carnivore and herbivore mammalian dung to Scarabaeinae (Coleoptera, Scarabaeidae in a tropical Atlantic rainforest remnant Atratividade de Scarabaeinae (Coleoptera: Scarabaeidae por fezes de mamíferos onívoros, carnívoros e herbívoros em um remanescente de Floresta Tropical Atlântica

    Directory of Open Access Journals (Sweden)

    Bruno K. C. Filgueiras

    2009-01-01

    Full Text Available In this study, performed in a remnant of Brazilian Atlantic Forest, three types of dung from animals with distinct alimentary habits were utilized, in order to verify possible differences of attractivity of these dungs to the Scarabaeinae and the influence of seasonality in the attractivity. Three habitats were sampled: edge, clearing and forest core, each with 40 pitfall traps. A total of 2,137 beetles were collected from August 2005 to July 2006. Canthidium sp. 1 (43% and Dichotomius sericeus (41% were the most abundant species. From the total number of beetles collected, 80.5% were attracted to human dung, 11% to jaguar dung, 7.8% to waterbuck dung and 0.7% to the control. The species Canthidium sp.1, Canthidium sp. 2, Ateuchus sp., Canthon nigripenne, Canthonella sp. and D. sericeus came to all three bait types. Eight species were found in the baits with human dung, where Canthidium sp.1 (49% and D. sericeus (39% were the most common. A significant difference in attractiveness of the different baits was observed; the highest abundance found in traps baited with human dung (F = 36.59; g.l. = 3; p Nesse estudo, realizado em um remanescente de Floresta Atlântica Brasileira, três tipos de fezes de animais com distintos hábitos alimentares foram utilizados para verificar possíveis diferenças de atratividade dessas fezes por Scarabaeinae e a influência da sazonalidade nessa atratividade. Três habitats foram amostrados: borda, clareira e núcleo da floresta, cada um com 40 armadilhas de queda ("pitfall". Um total de 2137 besouros foi coletado de agosto de 2005 a julho de 2006. Canthidium sp. 1 (43% e Dichotomius sericeus (41% foram as espécies mais abundantes. Do número total de besouros coletados, 80,5% foram atraídos para fezes humanas, 11% para fezes de jaguar, 7,8% para fezes de cobo e 0,7% para o controle. As espécies Canthidium sp.1, Canthidium sp. 2, Ateuchus sp., Canthon nigripenne, Canthonella sp. e D. sericeus foram aos tr

  8. Additional danger of arsenic exposure through inhalation from burning of cow dung cakes laced with arsenic as a fuel in arsenic affected villages in Ganga-Meghna-Brahmaputra plain.

    Science.gov (United States)

    Pal, Arup; Nayak, Bishwajit; Das, Bhaskar; Hossain, M Amir; Ahamed, Sad; Chakraborti, Dipankar

    2007-10-01

    In arsenic contaminated areas of the Ganga-Meghna-Brahmaputra (GMB) plain (area 569,749 sq. km; population over 500 million) where traditionally cow dung cake is used as a fuel in unventilated ovens for cooking purposes, people are simply exposed to 1859.2 ng arsenic per day through direct inhalation, of which 464.8 ng could be absorbed in respiratory tract.

  9. Bioassay-directed fractionation of a blood coagulation factor Xa inhibitor, betulinic acid from Lycopus lucidus

    Directory of Open Access Journals (Sweden)

    Tan Yin-Feng

    2018-03-01

    Full Text Available Thrombosis is a major cause of morbidity and mortality worldwide and plays a pivotal role in the pathogenesis of several cardiovascular disorders, including acute coronary syndrome, unstable angina, myocardial infarction, sudden cardiac death, peripheral arterial occlusion, ischemic stroke, deep-vein thrombosis, and pulmonary embolism. Anticoagulants, antiplatelet agents, and fibrinolytics can reduce the risks of these clinical events. Especially, the blood coagulation factor Xa (FXa inhibitor is a proven anticoagulant. Promoting blood circulation, using traditional Chinese medicine (TCM, for the treatment of these diseases has been safely used for thousands of years in clinical practice. Therefore, highly safe and effective anticoagulant ingredients, including FXa inhibitors, could be found in TCM for activating the blood circulation. One FXa inhibitor, a pentacyclic triterpene (compound 1, betulinic acid characterized by IR, MS and NMR analyses, was isolated from the ethyl acetate fraction of Lycopus lucidus by bioassay-directed fractionation. Compound 1 exhibited an inhibitory effect on FXa with IC50 25.05 μmol/L and reduced the thrombus weight in an animal model at 25-100 mg/kg. These results indicate that betulinic acid could be the potential for anticoagulant therapy.

  10. Identification of key pathways and genes influencing prognosis in bladder urothelial carcinoma

    Directory of Open Access Journals (Sweden)

    Ning X

    2017-03-01

    Full Text Available Xin Ning, Yaoliang Deng Department of Urology, The First Affiliated Hospital of Guangxi Medical University, Nanning, Guangxi Province, People’s Republic of China Background: Genomic profiling can be used to identify the predictive effect of genomic subsets for determining prognosis in bladder urothelial carcinoma (BUC after radical cystectomy. This study aimed to investigate potential gene and pathway markers associated with prognosis in BUC.Methods: A microarray dataset of BUC was obtained from The Cancer Genome Atlas database. Differentially expressed genes (DEGs were identified by DESeq of the R platform. Kaplan–Meier analysis was applied for prognostic markers. Key pathways and genes were identified using bioinformatics tools, such as gene set enrichment analysis, gene ontology, the Kyoto Encyclopedia of Genes and Genomes, gene multiple association network integration algorithm (GeneMANIA, Search Tool for the Retrieval of Interacting Genes/Proteins, and Molecular Complex Detection.Results: A comparative gene set enrichment analysis of tumor and adjacent normal tissues suggested BUC tumorigenesis resulted mainly from enrichment of cell cycle and DNA damage and repair-related biological processes and pathways, including TP53 and mitotic recombination. Two hundred and fifty-six genes were identified as potential prognosis-related DEGs. Gene ontology and Kyoto Encyclopedia of Genes and Genomes analyses showed that the potential prognosis-related DEGs were enriched in angiogenesis, including the cyclic adenosine monophosphate biosynthetic process, cyclic guanosine monophosphate-protein kinase G, mitogen-activated protein kinase, Rap1, and phosphoinositide-3-kinase-AKT signaling pathway. Nine hub genes, TAGLN, ACTA2, MYH11, CALD1, MYLK, GEM, PRELP, TPM2, and OGN, were identified from the intersection of protein–protein interaction and GeneMANIA networks. Module analysis of protein–protein interaction and GeneMANIA networks mainly showed

  11. Dungeness Crab Dredging Entrainment Studies in the Lower Columbia River, 2002 – 2004: Loss Projections, Salinity Model, and Scenario Analysis

    Energy Technology Data Exchange (ETDEWEB)

    Pearson, Walter H.; Williams, Greg D.; Skalski, John R.

    2005-01-01

    Dungeness crab studies conducted in 2002 for the Portland District of the U.S. Army Corps of Engineers (Corps) constituted a major step forward in quantifying crab entrainment through statistical projections of adult equivalent loss (AEL) and loss to the fishery (LF) from proposed construction and maintenance dredging in the Columbia River navigation channel (Pearson et al. 2002, 2003). These studies also examined the influence of bottom salinity on crab abundance and entrainment rates. Additional sampling was conducted in 2004 to tighten loss projections, further develop the crab salinity model, and apply the model to assess correlations of entrainment rates and projected losses with seasonal salinity changes.

  12. The gas forming potential of dry chicken dung in biogas production; Das Gasbildungspotenzial von Huehnertrockenkot bei der Biogasgewinnung

    Energy Technology Data Exchange (ETDEWEB)

    Weissbach, Friedrich

    2012-07-01

    In order to utilize substrates for biogas production efficiently, the knowledge of their gas forming potential is crucial. Until now, sufficiently precise data has been lacking for poultry excrements without bedding. These excrements are usually referred to as dry chicken dung (DCD). It has not been determined as to whether differences exist in quality between different batches and which laboratory analyses are meaningful to cover them. The aim of this study was, therefore, to address the differences in composition of DCD. Based on data from digestibility measurements in sheep, the content of fermentable organic matter (FOM) was calculated. Additionally, the potential gas yield per kg FOM of DCD was determined, and recommendations were made regarding quality assurance of DCD. (orig.)

  13. Dungeness crab survey for the Southwest Ocean Disposal Site off Grays Harbor, Washington, June 1990

    Energy Technology Data Exchange (ETDEWEB)

    Higgins, B.J.; Pearson, W.H. (Battelle/Marine Sciences Lab., Sequim, WA (United States))

    1991-09-01

    As part of the Grays Harbor Navigation Improvement Project, the Seattle District of the US Army Corps of Engineers has begun active use of the Southwest Ocean Disposal Site off Grays Harbor, Washington. This survey was to verify that the location of the area of high crab density observed during site selection surveys has not shifted into the Southeast Ocean Disposal Site. In June 1990, mean densities of juvenile Dungeness crab were 146 crab/ha within the disposal site and 609 crab/ha outside ad north of the disposal site. At nearshore locations outside the disposal site, juvenile crab density was 3275 crab/ha. Despite the low overall abundance, the spatial distribution of crab was such that the high crab densities in 1990 have remained outside the Southwest Ocean Disposal Site. The survey data have confirmed the appropriateness of the initial selection of the disposal site boundaries and indicated no need to move to the second monitoring tier. 8 refs., 9 figs., 2 tabs.

  14. Tranexamic Acid Failed to Reverse the Anticoagulant Effect and Bleeding by an Oral Direct Factor Xa Inhibitor Edoxaban.

    Science.gov (United States)

    Honda, Yuko; Furugohri, Taketoshi; Morishima, Yoshiyuki

    2018-01-01

    Agents to reverse the anticoagulant effect of edoxaban, an oral direct factor Xa inhibitor, would be desirable in emergency situations. The aim of this study is to determine the effect of tranexamic acid, an antifibrinolytic agent, on the anticoagulant activity and bleeding by edoxaban in rats. A supratherapeutic dose of edoxaban (3 mg/kg) was intravenously administered to rats. Three minutes after dosing, tranexamic acid (100 mg/kg) was given intravenously. Bleeding was induced by making an incision with a blade on the planta 8 min after edoxaban injection and bleeding time was measured. Prothrombin time (PT) and clot lysis were examined. A supratherapeutic dose of edoxaban significantly prolonged PT and bleeding time. Tranexamic acid did not affect PT or bleeding time prolonged by edoxaban, although tranexamic acid significantly inhibited clot lysis in rat plasma. An antifibrinolytic agent tranexamic acid failed to reverse the anticoagulant effect and bleeding by edoxaban in rats. © 2017 S. Karger AG, Basel.

  15. High variability of dung beetle diversity patterns at four mountains of the Trans-Mexican Volcanic Belt

    Directory of Open Access Journals (Sweden)

    Alfonsina Arriaga-Jiménez

    2018-02-01

    Full Text Available Insect diversity patterns of high mountain ecosystems remain poorly studied in the tropics. Sampling dung beetles of the subfamilies Aphodiinae, Scarabaeinae, and Geotrupinae was carried out at four volcanoes in the Trans-Mexican Volcanic Belt (TMVB in the Mexican transition zone at 2,700 and 3,400 MASL, and on the windward and leeward sides. Sampling units represented a forest–shrubland–pasture (FSP mosaic typical of this mountain region. A total of 3,430 individuals of 29 dung beetle species were collected. Diversity, abundance and compositional similarity (CS displayed a high variability at all scales; elevation, cardinal direction, or FSP mosaics did not show any patterns of higher or lower values of those measures. The four mountains were different regarding dispersion patterns and taxonomic groups, both for species and individuals. Onthophagus chevrolati dominated all four mountains with an overall relative abundance of 63%. CS was not related to distance among mountains, but when O. chevrolati was excluded from the analysis, CS values based on species abundance decreased with increasing distance. Speciation, dispersion, and environmental instability are suggested as the main drivers of high mountain diversity patterns, acting together at different spatial and temporal scales. Three species new to science were collected (>10% of all species sampled. These discoveries may indicate that speciation rate is high among these volcanoes—a hypothesis that is also supported by the elevated number of collected species with a restricted montane distribution. Dispersion is an important factor in driving species composition, although naturally limited between high mountains; horizontal colonization events at different time scales may best explain the observed species composition in the TMVB, complemented by vertical colonization events to a lesser extent. Environmental instability may be the main factor causing the high variability of diversity

  16. High variability of dung beetle diversity patterns at four mountains of the Trans-Mexican Volcanic Belt.

    Science.gov (United States)

    Arriaga-Jiménez, Alfonsina; Rös, Matthias; Halffter, Gonzalo

    2018-01-01

    Insect diversity patterns of high mountain ecosystems remain poorly studied in the tropics. Sampling dung beetles of the subfamilies Aphodiinae, Scarabaeinae, and Geotrupinae was carried out at four volcanoes in the Trans-Mexican Volcanic Belt (TMVB) in the Mexican transition zone at 2,700 and 3,400 MASL, and on the windward and leeward sides. Sampling units represented a forest-shrubland-pasture (FSP) mosaic typical of this mountain region. A total of 3,430 individuals of 29 dung beetle species were collected. Diversity, abundance and compositional similarity (CS) displayed a high variability at all scales; elevation, cardinal direction, or FSP mosaics did not show any patterns of higher or lower values of those measures. The four mountains were different regarding dispersion patterns and taxonomic groups, both for species and individuals. Onthophagus chevrolati dominated all four mountains with an overall relative abundance of 63%. CS was not related to distance among mountains, but when O. chevrolati was excluded from the analysis, CS values based on species abundance decreased with increasing distance. Speciation, dispersion, and environmental instability are suggested as the main drivers of high mountain diversity patterns, acting together at different spatial and temporal scales. Three species new to science were collected (>10% of all species sampled). These discoveries may indicate that speciation rate is high among these volcanoes-a hypothesis that is also supported by the elevated number of collected species with a restricted montane distribution. Dispersion is an important factor in driving species composition, although naturally limited between high mountains; horizontal colonization events at different time scales may best explain the observed species composition in the TMVB, complemented by vertical colonization events to a lesser extent. Environmental instability may be the main factor causing the high variability of diversity and abundance patterns

  17. Rhodococcus antrifimi sp. nov., isolated from dried bat dung of a cave.

    Science.gov (United States)

    Ko, Kwan Su; Kim, Youngju; Seong, Chi Nam; Lee, Soon Dong

    2015-11-01

    A Gram-reaction-positive, high DNA G+C content, non-motile actinobacterium, strain D7-21T, was isolated from dried bat dung inside a natural cave and its taxonomic status was examined by using a polyphasic approach. The 16S rRNA gene sequence study showed that the isolate belonged to the genus Rhodococcus and formed a cluster with Rhodococcus defluvii (98.98 % gene similarity), Rhodococcus equi (98.62 %) and Rhodococcus kunmingensis (97.66 %). Whole-cell hydrolysates contained meso-diaminopimelic acid, arabinose and galactose as the diagnostic diamino acid and sugars. MK-8(H2) was the predominant menaquinone. The major polar lipids were diphosphatidylglycerol, phosphatidylethanolamine, phosphatidylglycerol, phosphatidylinositol, phosphatidylinositol mannoside, an unknown phosphoglycolipid and an unknown glycolipid. Mycolic acids were present. The major fatty acids were C16 : 0, C18 : 1ω9c and 10-methyl C18 : 0. The DNA G+C content was 70.1 mol%. A battery of phenotypic features and DNA-DNA relatedness data support that strain D7-21T ( = KCTC 29469T = DSM 46727T) represents a novel species of the genus Rhodococcus, for which Rhodococcus antrifimi sp. nov. is proposed.

  18. Thrombin and factor Xa link the coagulation system with liver fibrosis.

    Science.gov (United States)

    Dhar, Ameet; Sadiq, Fouzia; Anstee, Quentin M; Levene, Adam P; Goldin, Robert D; Thursz, Mark R

    2018-05-08

    Thrombin activates hepatic stellate cells via protease-activated receptor-1. The role of Factor Xa (FXa) in hepatic fibrosis has not been elucidated. We aimed to evaluate the impact of FXa and thrombin in vitro on stellate cells and their respective inhibition in vivo using a rodent model of hepatic fibrosis. HSC-LX2 cells were incubated with FXa and/or thrombin in cell culture, stained for αSMA and relative gene expression and gel contraction calculated. C57BL/6 J mice were administered thioacetamide (TAA) for 8 weeks with Rivaroxaban (n = 15) or Dabigatran (n = 15). Control animals received TAA alone (n = 15). Fibrosis was scored and quantified using digital image analysis and hepatic tissue hydroxyproline estimated. Stellate cells treated with FXa and thrombin demonstrated upregulation of procollagen, TGF-beta, αSMA and significant cell contraction (43.48%+/- 4.12) compared to culturing with FXa or thrombin alone (26.90%+/- 8.90, p = 0.02; 13.1%+/- 9.84, p < 0.001). Mean fibrosis score, percentage area of fibrosis and hepatic hydroxyproline content (2.46 vs 4.08, p = 0.008; 2.02% vs 3.76%, p = 0.012; 276.0 vs 651.3, p = 0.0001) were significantly reduced in mice treated with the FXa inhibitor compared to control mice. FXa inhibition was significantly more effective than thrombin inhibition in reducing percentage area of fibrosis and hepatic hydroxyproline content (2.02% vs 3.70%,p = 0.031; 276.0 vs 413.1,p = 0.001). FXa promotes stellate cell contractility and activation. Early inhibition of coagulation using a FXa inhibitor significantly reduces TAA induced murine liver fibrosis and may be a viable treatment for liver fibrosis in patients.

  19. Eco-friendly waste water treatment by cow dung powder (adsorption studies of Cr(III), Cr(VI) and Cd(II) using tracer technique)

    International Nuclear Information System (INIS)

    Bagla, Hemlata; Barot, Nisha

    2010-01-01

    A rising quality of life with high rate of resource consumption have an unintended and negative impact on environment, generating waste hulk with far beyond handling capacities of mankind. The threat of water famine looms greatest as our rivers are poisoned due to urbanization and industrialization. To combat against water pollution and to find sustainable solution for the same, globally, we have embraced Green chemistry approach which is one of the Waste Management and Treatment Strategies. In the present investigation we have studied different parameters for the effective adsorption of heavy metal pollutant employing dry cow dung powder as a natural adsorbent. (author)

  20. French fission products experiments performed in Cadarache and Valduc. Results comparison

    International Nuclear Information System (INIS)

    Anno, Jacques; Barreau, Anne; Hudelot, Jean Pascal; Girault, Emmanuel; Fouillaud, Patrick; Toubon, Herve

    2003-01-01

    Cofunded by Cogema, two complementary experimental programmes on burn up credit (BUC) related to fission products (FPs) are performed by CEA and IRSN at Cadarache and Valduc. After shortly recalling the main characteristics of each experiment, a first comparison of some results is presented, especially the energy range in which most part of cross section absorption are qualified. Both experiments exhibit great quality and accurate results, giving a high degree of confidence to the whole experimental French process of qualification devoted to BUC. (author)

  1. Burnup Credit of French PWR-MOx fuels: methodology and associated conservatisms with the JEFF-3.1.1 evaluation

    International Nuclear Information System (INIS)

    Chambon, A.

    2013-01-01

    Considering spent fuel management (storage, transport and reprocessing), the approach using 'fresh fuel assumption' in criticality-safety studies results in a significant conservatism in the calculated value of the system reactivity. The concept of Burnup Credit (BUC) consists in considering the reduction of the spent fuel reactivity due to its burnup. A careful BUC methodology, developed by CEA in association with AREVA-NC was recently validated and written up for PWR-UOx fuels. However, 22 of 58 French reactors use MOx fuel, so more and more irradiated MOx fuels have to be stored and transported. As a result, why industrial partners are interested in this concept is because taking into account this BUC concept would enable for example a load increase in several fuel cycle devices. Recent publications and discussions within the French BUC Working Group highlight the current interest of the BUC concept in PWR-MOx spent fuel industrial applications. In this case of PWR-MOx fuel, studies show in particular that the 15 FPs selected thanks to their properties (absorbing, stable, non-gaseous) are responsible for more than a half of the total reactivity credit and 80% of the FPs credit. That is why, in order to get a conservative and physically realistic value of the application k eff and meet the Upper Safety Limit constraint, calculation biases on these 15 FPs inventory and individual reactivity worth should be considered in a criticality-safety approach. In this context, thanks to an exhaustive literature study, PWR-MOx fuels particularities have been identified and by following a rigorous approach, a validated and physically representative BUC methodology, adapted to this type of fuel has been proposed, allowing to take fission products into account and to determine the biases related to considered isotopes inventory and to reactivity worth. This approach consists of the following studies: - isotopic correction factors determination to guarantee the criticality

  2. Advances in applications of burnup credit to enhance spent fuel transportation, storage, reprocessing and disposition. Proceedings of a technical meeting

    International Nuclear Information System (INIS)

    2007-05-01

    Given a trend towards higher burnup power reactor fuel, the IAEA began an active programme in burnup credit (BUC) with major meetings in 1997 (IAEA-TECDOC-1013), 2000 (IAEA-TECDOC-1241) and 2002 (IAEA-TECDOC-1378) exploring worldwide interest in using BUC in spent fuel management systems. This publication contains the proceedings of the IAEA's 4th major BUC meeting, held in London. Sixty participants from 18 countries addressed calculation methodology, validation and criticality, safety criteria, procedural compliance with safety criteria, benefits of BUC applications, and regulatory aspects in BUC. This meeting encouraged the IAEA to continue its activities on burnup credit including dissemination of related information, given the number of Member States having to deal with increased spent fuel quantities and extended durations. A 5th major meeting on burnup credit is planned 2008. Burnup credit is a concept that takes credit for the reduced reactivity of fuel discharged from the reactor to improve loading density of irradiated fuel assemblies in storage, transportation, and disposal applications, relative to the assumption of fresh fuel nuclide inventories in loading calculations. This report has described a general four phase approach to be considered in burnup credit implementation. Much if not all of the background research and data acquisition necessary for successful burnup credit development in preparation for licensing has been completed. Many fuel types, facilities, and analysis methods are encompassed in the public knowledge base, such that in many cases this guidance will provide a means for rapid development of a burnup credit program. For newer assembly designs, higher enrichment fuels, and more extensive nuclide credit, additional research and development may be necessary, but even this work can build on the foundation that has been established to date. Those, it is hoped that this report will serve as a starting point with sufficient reference to

  3. Novel direct factor Xa inhibitory compounds from Tenebrio molitor with anti-platelet aggregation activity.

    Science.gov (United States)

    Lee, Wonhwa; Kim, Mi-Ae; Park, InWha; Hwang, Jae Sam; Na, MinKyun; Bae, Jong-Sup

    2017-11-01

    Tenebrio molitor is an edible insect that has antimicrobial, anticancer, and antihypertensive effects. The aim of this study was to identify the unreported bioactive compounds from T. molitor larvae with inhibitory activities against factor Xa (FXa) and platelet aggregation. Isolated compounds were evaluated for their anti-FXa and anti-platelet aggregation properties by monitoring clotting time, platelet aggregation, FXa activity, and thrombus formation. A diketopiperazine (1, cyclo( L -Pro- L -Tyr)) and a phenylethanoid (2, N-acetyltyramine) were isolated and inhibited the catalytic activity of FXa in a mixed inhibition model and inhibited platelet aggregation induced by adenosine diphosphate (ADP) and U46619. They inhibited ADP- and U46619-induced phosphorylation of myristoylated alanine-rich C kinase substrate (MARCKS) and the expression of P-selectin and PAC-1 in platelets. They also improved the production of nitric oxide and inhibited the oversecretion of endothelin-1 compared to that of the ADP- or U46619-treated group. In an animal model of arterial and pulmonary thrombosis, the isolated compounds showed enhanced antithrombotic effects. They also elicited anticoagulant effects in mice. Compounds 1-2 inhibited ADP-, collagen-, or U46619-induced platelet aggregation and showed similar anti-thrombotic efficacy to rivaroxaban, a positive control. Therefore, 1-2 could serve as candidates and provide scaffolds for the development of new anti-FXa and anti-platelet drugs. Copyright © 2017 Elsevier Ltd. All rights reserved.

  4. The Factor of Structure and Mechanical Properties in the Production of Critical Fixing Hardware 38XA

    Directory of Open Access Journals (Sweden)

    G.V. Pachurin

    2016-09-01

    Full Text Available Fixing hardware made of carbon, high-carbon, and alloyed wires is one of the widespread critical parts in mechanical engineering. The characteristics of fixtures and fasteners and their performance figures are assessed at all stages of steel-making operation, from the choice of burden stock for metal smelting to the method of preparing calibrated rolled metal parts and upsetting end products. Material used for producing long high-duty bolts must be both sufficiently strong and ductile, have homogeneous mechanical properties and chemistry, and no inner or surface defects. When manufacturing fasteners, hot-rolled metal is often plastically deformed by drafting before cold upsetting, and all unacceptable defects are removed by the expensive procedure of lathe-turning. Moreover, this technology of metal processing entails losses of up to 5.5 % in chips. This paper suggests a resource-efficient and environmentally friendlier fabrication method for calibrated rolled metal items made of steel 38XA, 9.65 mm diameter, for cold die-forging of high-duty bolts used in automotive engines, which helps spare expensive lathe-machining processes. Moreover, rolled steel produced using this technology is characterized by high resistance to plastic deformation when cold, which leads to increase n wear-resistance of tools in cold die-forging of bolts.

  5. A practical approach to burn-up credit use in package design approval for PWR uranium oxide spent fuel assemblies

    International Nuclear Information System (INIS)

    Kroger, H.; Reiche, I.

    2009-01-01

    TN International has applied for a license for the TN 24 E transport and storage cask with the German competent authority using a new Burn-up Credit (BUC) approach for PWR uranium oxide fuel assemblies based on actinides and six selected fission products. In order to enable the use of BUC for fission products, various experimental data have to be provided for the two important aspects of the criticality calculation. Firstly, post-irradiation examination (PIE) experiments for the verification of the calculated fission product concentrations have to be provided for each selected fission product. These data are then used to validate the depletion calculations. Secondly, experimental data for the criticality calculations in the form of critical benchmark experiments have to be provided. The submitted data will be investigated for their applicability to the TN 24 E transport and storage cask. Since the application is limited to six fission products only, the conservatism of the BUC approach can be further justified, as the reduction in reactivity from the remaining fission products (about 190) is not taken credit for. (authors)

  6. Needs of reliable nuclear data and covariance matrices for Burnup Credit in JEFF-3 library

    International Nuclear Information System (INIS)

    Chambon, A.; Santamarina, A.; Riffard, C.; Lavaud, F.; Lecarpentier, D.

    2013-01-01

    Burnup Credit (BUC) is the concept which consists in taking into account credit for the reduction of nuclear spent fuel reactivity due to its burnup. In the case of PWR-MOx spent fuel, studies pointed out that the contribution of the 15 most absorbing, stable and non-volatile fission products selected to the credit is as important as the one of the actinides. In order to get a 'best estimate' value of the keff, biases of their inventory calculation and individual reactivity worth should be considered in criticality safety studies. This paper enhances the most penalizing bias towards criticality and highlights possible improvements of nuclear data for the 15 fission products (FPs) of PWR-MOx BUC. Concerning the fuel inventory, trends in function of the burnup can be derived from experimental validation of the DARWIN-2.3 package (using the JEFF- 3.1.1/SHEM library). Thanks to the BUC oscillation programme of separated FPs in the MINERVE reactor and fully validated scheme PIMS, calculation over experiment ratios can be accurately transposed to tendencies on the FPs integral cross sections. (authors)

  7. Using cow dung and spent coffee grounds to enhance the two-stage co-composting of green waste.

    Science.gov (United States)

    Zhang, Lu; Sun, Xiangyang

    2017-12-01

    The objective of this study was to determine the effects of cow dung (CD) (at 0%, 20%, and 35%) and/or spent coffee grounds (SCGs) (at 0%, 30%, and 45%) as amendments in the two-stage co-composting of green waste (GW); the percentages refer to grams of amendment per 100g of GW based on dry weights. The combined addition of CD and SCGs improved the conditions during co-composting and the quality of the compost product in terms of composting temperature; particle-size distribution; mechanical properties; nitrogen changes; low-molecular weight compounds; humic substances; the degradation of lignin, cellulose, and hemicellulose; enzyme activities; the contents of total Kjeldahl nitrogen, total phosphorus, and total potassium; and the toxicity to germinating seeds. The combined addition of 20% CD and 45% SCGs to GW resulted in the production of the highest quality compost product and did so in only 21days. Copyright © 2017 Elsevier Ltd. All rights reserved.

  8. Transporting existing VSC-24 canisters using a risk-based licensing approach

    Energy Technology Data Exchange (ETDEWEB)

    Srinivasan, R.; Sisley, S.E.; Hopf, J.E. [BNFL Fuel Solutions, Campbell, CA (United States)

    2004-07-01

    The eventual disposition of the spent fuel assemblies loaded in canisters and casks currently designed and licensed only for on-site storage is an industry-wide issue. The canister-specific BUC evaluation approach developed by BFS can be used to license many of these storage canisters and casks for transportation. This will allow these storage canisters and casks to be transported intact to a long-term storage facility or repository, thereby minimizing fuel handling operations, impact on plant operations, and occupational exposure, as well as total infrastructure costs. Application of the proposed canister-specific BUC analysis approach to a preliminary evaluation of the 58 loaded MSBs demonstrates the benefits of this approach. The results of this preliminary evaluation show that a more rigorous analysis based on the known characteristics of the loaded spent fuel, rather than the design-basis fuel parameters, produces significantly lower maximum keff values and can be used to qualify many of the existing loaded storage canisters for transportation. Transportation certification for storage canisters having more reactive spent fuel payloads may require reliance on BUC approaches that are more aggressive than current NRC guidelines allow. Credit may be required for fission- product isotopes that do not have sufficient chemical assay data for benchmarking. In addition, reduced criticality safety margins may be required. For these more-aggressive BUC approaches, a risk assessment should be provided to support the NRC-approval basis. The risk assessment should evaluate the possibility and consequences of an accidental criticality event based upon inaccuracies in the characterization of the spent-fuel payloads.

  9. Transporting existing VSC-24 canisters using a risk-based licensing approach

    International Nuclear Information System (INIS)

    Srinivasan, R.; Sisley, S.E.; Hopf, J.E.

    2004-01-01

    The eventual disposition of the spent fuel assemblies loaded in canisters and casks currently designed and licensed only for on-site storage is an industry-wide issue. The canister-specific BUC evaluation approach developed by BFS can be used to license many of these storage canisters and casks for transportation. This will allow these storage canisters and casks to be transported intact to a long-term storage facility or repository, thereby minimizing fuel handling operations, impact on plant operations, and occupational exposure, as well as total infrastructure costs. Application of the proposed canister-specific BUC analysis approach to a preliminary evaluation of the 58 loaded MSBs demonstrates the benefits of this approach. The results of this preliminary evaluation show that a more rigorous analysis based on the known characteristics of the loaded spent fuel, rather than the design-basis fuel parameters, produces significantly lower maximum keff values and can be used to qualify many of the existing loaded storage canisters for transportation. Transportation certification for storage canisters having more reactive spent fuel payloads may require reliance on BUC approaches that are more aggressive than current NRC guidelines allow. Credit may be required for fission- product isotopes that do not have sufficient chemical assay data for benchmarking. In addition, reduced criticality safety margins may be required. For these more-aggressive BUC approaches, a risk assessment should be provided to support the NRC-approval basis. The risk assessment should evaluate the possibility and consequences of an accidental criticality event based upon inaccuracies in the characterization of the spent-fuel payloads

  10. Enhanced biohydrogen production from oat straw co-digested with cow dung / sewage sludge by combined aerobic digestion and anaerobic fermentation

    Directory of Open Access Journals (Sweden)

    Loretta Li

    2016-03-01

    Full Text Available Hydrogen was produced from oat straw by combined aerobic and anaerobic fermentation with fungi and cow dung. With aerobic pre-digestion, the maximum hydrogen production rate reached 133 ml/g volatile suspended solids per hour. The maximum hydrogen yield was 71.5 ml/g straw in 6 days by biological process. The lignocellulosic conversion of oak-straw waste was 39%, with the complex component converting 68% of the hemi-cellulose and 61% of the cellulose, but only 34% of lignin conversion. Aerobic pre-digestion by Trichoderma viride and Saccharomyces cerevisiae was significantly effective for lignin degradation.  Combining aerobic and anaerobic fermentation is a promising low-cost efficient and environmentally friendly method, compared with hydrogen fermentation, not only for hydrogen production, but also for converting straw biomass.

  11. Isolation and evaluation of a high H{sub 2}-producing lab isolate from cow dung

    Energy Technology Data Exchange (ETDEWEB)

    Pandey, Anjana; Sinha, Pallavi [Nanotechnology and Molecular Biology Lab, Department of Biotechnology, University of Allahabad, Allahabad-211002, Uttar Pradesh (India); Kotay, Shireen Meher; Das, Debabrata [Department of Biotechnology, Indian Institute of Technology, Kharagpur-721302, West Bengal (India)

    2009-09-15

    Hydrogen producing bacterial strain was isolated from Indian cow dung and identified of the bacterial family Enterobacteriaceae. This lab isolate was differentiated from Citrobacter Y-19 at molecular level by using RAPD, PCR based technique, and OPO-03{sub 460} and OPO-17{sub 800} RAPD marker for this specific strain (lab isolate) was identified. Fermentative studies were investigated for important parameters, starting with pH of the culture, temperature, inoculum age and inoculum volume, initial substrate concentration and different substrates. Among different substrates, dextrose and sucrose were the preferred substrates for hydrogen production. The optimal starting pH of the culture was found to be 5.0. The H{sub 2} production increased with increase in temperature up to 30 C. The maximum value of H{sub 2} production was recorded when inoculum volume was 12.5% of the culture broth and inoculum age was 14 h. Under batch fermentation conditions, the maximum hydrogen production rate and yield were 355.2 ml l{sup -1} h{sup -1} and 2.1 mol/mol glucose (conversion 35%), respectively. These results indicate that this lab isolate is an ideal hydrogen producer. (author)

  12. Isolation of fungi from dung of wild herbivores for application in bioethanol production.

    Science.gov (United States)

    Makhuvele, Rhulani; Ncube, Ignatious; Jansen van Rensburg, Elbert Lukas; La Grange, Daniël Coenrad

    Producing biofuels such as ethanol from non-food plant material has the potential to meet transportation fuel requirements in many African countries without impacting directly on food security. The current shortcomings in biomass processing are inefficient fermentation of plant sugars, such as xylose, especially at high temperatures, lack of fermenting microbes that are able to resist inhibitors associated with pre-treated plant material and lack of effective lignocellulolytic enzymes for complete hydrolysis of plant polysaccharides. Due to the presence of residual partially degraded lignocellulose in the gut, the dung of herbivores can be considered as a natural source of pre-treated lignocellulose. A total of 101 fungi were isolated (36 yeast and 65 mould isolates). Six yeast isolates produced ethanol during growth on xylose while three were able to grow at 42°C. This is a desirable growth temperature as it is closer to that which is used during the cellulose hydrolysis process. From the yeast isolates, six isolates were able to tolerate 2g/L acetic acid and one tolerated 2g/L furfural in the growth media. These inhibitors are normally generated during the pre-treatment step. When grown on pre-treated thatch grass, Aspergillus species were dominant in secretion of endo-glucanase, xylanase and mannanase. Copyright © 2017 Sociedade Brasileira de Microbiologia. Published by Elsevier Editora Ltda. All rights reserved.

  13. An assessment of noise and vibration measurements taken during the commissioning of Dungeness B

    International Nuclear Information System (INIS)

    Bickers, B.H.

    1983-01-01

    The design of the Dungeness B Advanced Gas Cooled Reactor took into account, from an early stage, the vibrational response of structures within the pressure vessel to noise generated by the gas circulators. Theoretical estimates indicated that the circulators, which absorb 13000HP each in circulating the CO 2 coolant at 30 atmospheres around the gas circuit, could produce potentially damaging noise levels. These estimates were backed up with scale model circulator tests and at a later stage with noise transmission tests in the actual reactor vessel and finally by running the circulators in air under atmospheric conditions. The response of the structural components was predicted initially by theoretical methods, such as the Statistical Energy Method, which was used basically as a sorting technique to identify problem areas which could then be tested in acoustic chambers using representative test specimens to give a more reliable estimate of response. Any items of structure for which a significant level of response was predicted, or where representative testing was not possible, were instrumented so that the vibrational response could be measured during the unfuelled pressurized commissioning tests. Some of the more interesting aspects of the results of these tests are discussed together with a comparison of the results with predictions. (author)

  14. Low-temperature magnetic ordering in the perovskites Pr 1-xA xCoO 3 (A=Ca, Sr)

    Science.gov (United States)

    Deac, Iosif G.; Tetean, Romulus; Balasz, Istvan; Burzo, Emil

    2010-05-01

    The magnetic and electrical properties of polycrystalline Pr 1-xA xCoO 3 cobaltites with A=Ca, Sr and 0≤ x≤0.5 were studied in the temperature range 4 K≤ T≤1000 K and field up to 7 T. The X-ray analyses show the presence of only one phase having monoclinic or orthorhombic symmetry. The magnetic measurements indicate that the Ca-doped samples have at low temperatures, similar properties to the frustrated magnetic materials. PrCoO 3 is a paramagnetic insulator in the range from 4 to 1000 K. The Sr-doped cobaltites exhibit two phase transitions: a paramagnetic-ferromagnetic (or magnetic phase separated state) phase transition at about 240 K and a second one at about 100 K. The magnetic measurements suggest the presence of magnetic clusters and a change in the nature of magnetic coupling between Co ions at low temperatures. A semiconducting type behavior and high negative magnetoresistance was found for the Ca-doped samples, while the Sr-doped ones were metallic and with negligible magnetoresistance. The results are analyzed in the frame of a phase separation scenario in the presence of the spin-state transitions of Co ions.

  15. Effects of initiating anaerobic digestion of layer-hen poultry dung at sub-atmospheric pressure

    Directory of Open Access Journals (Sweden)

    Chima C. Ngumah

    2013-12-01

    Full Text Available This study investigated the effects of initiating anaerobic digestion (AD of dry layer-hen poultry dung at the sub-atmospheric pressure of -30 cmHg on biodegradation, biogasification, and biomethanation. The setup was performed as a batch process at an average ambient temperature of 29±2 0C and a retention time of 15 days. Comparisons were made with two other experiments which were both begun at ambient atmospheric pressure; one was inoculated with digestate from a previous layer-hen dung AD, while the other was not inoculated. The bioreactors initiated at sub-atmospheric pressure, ambient atmospheric pressure without inoculum, and ambient atmospheric pressure with inoculum showed the following for biogas and biomethane yields respectively: 16.8 cm3 g-1 VS and 15.46 cm3 g 1 VS, 25.10 cm3 g-1 VS and 12.85 cm3 g-1 VS, 21.44 cm3 g-1 VS and 14.88 cm3 g 1 VS. In the same order, after AD, the following values were recorded for volatile solids and total viable counts (prokaryotes and fungi in the digestates: 40.33% and 23.22 x 106 cfu mL-1, 43.42% and 22.17 x 106 cfu mL-1, 41.11% and 13.3 x 106 cfu mL-1. The feedstock showed values of 83.93% and 3.98 x 106 cfu mL-1 for volatile solids and total viable count respectively. There was a slight difference in the volatile solids of the digestates of the three bioreactors after AD. The pH recorded for the feedstock slurry before AD was 7.9 at 30oC, while after AD, the digestates from all the three bioreactors showed the same pH of 5.9 at 29 0C. Statistical analysis using ANOVA showed no significant difference in biogas yields of the feedstock for the three bioreactors (A, B, C. ANOVA showed no significant difference for biomethane yields in the bioreactors initiated at sub-atmospheric pressure and for those initiated at ambient atmospheric pressure with inoculums. However, it showed significant difference in the bioreactor initiated at sub-atmospheric pressure and that initiated at ambient atmospheric

  16. Isolation and partial purification of antimicrobial peptides/proteins from dung beetle, Onthophagus taurus immune hemolymph

    International Nuclear Information System (INIS)

    Vasanth Patil, H.B.; Sathish Kumar, B.Y.

    2012-01-01

    Antimicrobial peptides are important in the first line of the host defense system of all insect species. In the present study antimicrobial peptide(s) were isolated from the hemolymph of the dung beetle Onthophagus taurus. Both non induced and immune induced hemolymphs were tested for their antimicrobial activity against different bacterial strains and C. albicans. Induction was done by injecting E. coli into the abdominal cavity of the O. taurus. The non induced hemolymph did not show activity against any of the tested fungal and bacterial strains where as induced hemolymph showed activity against all tested bacterial strains but no activity against C. albicans. The induced hemolymph was subjected to non reducing SDS-PAGE and UV wavelength scan was performed to detect the presence of peptides. The immune induced hemolymph was purified by gel filtration chromatography to separate the proteins responsible for the antibacterial activity. The fractions within the peak were tested against those bacteria which previously showed sensitivity to the crude immune induced hemolymph. All fractions were found to be active against all tested bacteria with difference in zone of inhibition. The peptides are active against prokaryotes and not against eukaryotes. These properties reveal its unique characteristics and therapeutic application. (author)

  17. Nepal Ambient Monitoring and Source Testing Experiment (NAMaSTE): Emissions of particulate matter from garbage burning, wood and dung cooking fires, motorcycles and brick kilns

    Science.gov (United States)

    Jayarathne, T. S.; Rathnayake, C.; Stockwell, C.; Daugherty, K.; Islam, R. M.; Christian, T. J.; Bhave, P.; Praveen, P. S.; Panday, A. K.; Adhikari, S.; Rasmi, M.; Goetz, D.; DeCarlo, P. F.; Saikawa, E.; Yokelson, R. J.; Stone, E. A.

    2016-12-01

    The Nepal Ambient Monitoring and Source Testing Experiment (NAMASTE) field campaign targeted the in-situ characterization of widespread and under-sampled combustion sources in South Asia by determining emission factors (EF) for fine particulate matter (PM2.5), organic carbon (OC), elemental carbon, inorganic ions, trace metals, and organic species. Garbage burning had the highest EF PM2.5 among the sampled sources ranging 7-124 g kg-1, with maximum EFs for garbage burned under higher moisture conditions. Garbage burning emissions contained high concentrations of polycyclic aromatic compounds (PAHs) and heavy metals (Pb, Cd, Zn) that are associated with acute and chronic health effects. Triphenylbenzene and antimony (Sb) were unique to garbage burning are good candidates for tracing this source. Cook stove emissions varied largely by stove technology (traditional mud stove, 3-stone cooking fire, chimney stove, etc.) and biomass fuel (dung, hardwood, twigs, and mixtures thereof). Burning dung consistently emitted more PM2.5 than burning wood and contained characteristic fecal sterols and stanols. Motorcycle emissions were evaluated before and after servicing, which decreased EF PM2.5 from 8.8 g kg-1 to 0.7 g kg-1. Organic species analysis indicated that this reduction in PM2.5­ is largely due to a decrease in emission of motor oil. For brick kilns, the forced draft zig-zag kilns had higher EF PM2.5 (12-19 g kg-1) compared to clamp kilns (8-13 g kg-1) and also exhibited chemical differences. PM2.5 emitted from the zig-zag kiln were mainly OC (7%), sulfate (32%) and uncharacterized chemical components (60%), while clamp kiln emissions were dominated by OC (64%) and ammonium sulfate (36%). The quantitative emission factors developed in this study may be used for source apportionment and to update regional emission inventories.

  18. Extracellular digestion during hyposaline exposure in the Dungeness crab, Cancer magister, and the blue crab, Callinectes sapidus.

    Science.gov (United States)

    Curtis, Daniel L; van Breukelen, Frank; McGaw, Iain J

    2013-12-01

    Extracellular digestive processes were examined in the Dungeness crab, Cancer magister and the blue crab, Callinectes sapidus, during hyposaline exposure. Both species are found in estuaries as adults, but vary in their ability to balance the cardiovascular and respiratory demands of concurrent osmoregulation and digestion. The weak osmoregulator, C. magister, is unable to balance the demands of osmoregulation and digestion. Concordant with observed decreases in oxygen consumption and mechanical digestion, proteolytic digestion within the foregut and hepatopancreas was delayed, resulting in a relative reduction of circulating amino acids post-feeding in low salinity. In contrast, the efficient osmoregulator, C. sapidus, balances the demands of osmoregulation and digestion, and mechanical digestion continues unabated in low salinity. Protease activity in the gut fluid and hepatopancreas showed either no change or a reduction over time. The transport of amino acids into the cells post-feeding is opposed by an efflux of amino acids at the cellular level, and resulted in a build up of amino acids in the hemolymph. Despite differences in the extracellular responses to low salinity exposure following feeding, both species were able to maintain high digestive efficiencies. © 2013.

  19. The Effect of Teaching Critical Thinking on Al-Buraimi University College students’ Writing Skills: A Case Study

    Directory of Open Access Journals (Sweden)

    Yahia Ashour Mohammed AlKhoudary

    2015-11-01

    Full Text Available This study explores the role of writing in developing students’ critical thinking. It also sheds light on traditional writing assignments which fail to help students develop their comprehension of course content and evaluate their writing products critically. Moreover, this probe is to discover learners and teachers’ attitude towards the role of critical thinking in promoting the writing skills at AlBuraimi University College (BUC. The result of this study focuses on the effect of integrating critical thinking on learners’ performance. The procedure of this investigation is based on a combination of qualitative, quantitative (1 one hundred students who are taking writing course are selected randomly and divided into two groups; (2 pre- and posttests conducted to both groups; (3 twenty teachers were selected randomly (10 males and 10 females; questionnaires are administered to EFL teachers at BUC. The findings of this study illustrate that students who write critically are mostly motivated and their performance is affected positively. It also reveals that there are significant differences in posttest scores between treatment and controlled group. Moreover, teachers’ response to questionnaire supports the idea of integrating critical thinking in teaching the writing skills at BUC. Thus, is recommended that teachers should use thinking skills to enhance students’ writing performance and creativity.

  20. Pathotype profile of Xanthomonas oryzae pv. oryzae isolates from North Sumatera

    Science.gov (United States)

    Noer, Z.; Hasanuddin; Lisnawita; Suryanto, D.

    2018-02-01

    The Bacterial blight disease caused by Xanthomonas oryzae pv. oryzae (Xoo) is one of the most important diseases and has caused crop failure in rice crops. This pathogen infects the leaves in all plant growth phases. The purpose of this study is to investigation 10 Xoo isolates pathotype obtained from North Sumatra based on their interactions with 10 near-isogenic rice lines (NIL) of IRRI. The results showed that there are 6 pathotypes of virulence in North Sumatra, they are; pathotype I with incompatible interaction to all Xa genes, pathotype II with compatible interaction to Xa1 and Xa3 genes, while it has incompatible interaction to other genes, pathotype III with compatible interaction to Xa1, Xa5, Xa7, Xa8, Xa10 and Xa11 genes, but it has incompatible interaction to other genes, pathotype IV with compatible interaction to all Xa genes, pathotype V with compatible interaction to Xa1 gene and incompatible interaction to other genes, and pathotype VI with compatible interaction to Xa3 gene and incompatible interaction to other genes. Based on the resistant genes in each individual Xa2, Xa4, and Xa21 genes are the combination of Xa genes which are most suitable for use in the development of rice cultivars in North Sumatra.

  1. Complete genome sequence of Bacillus velezensis LM2303, a biocontrol strain isolated from the dung of wild yak inhabited Qinghai-Tibet plateau.

    Science.gov (United States)

    Chen, Liang

    2017-06-10

    Bacillus velezensis LM2303 is a biocontrol strain with a broad inhibitory spectrum against plant pathogens, isolated from the dung of wild yak inhabited Qinghai-Tibet plateau, China. Here we present its complete genome sequence, which consists of a single, circular chromosome of 3,989,393bp with a 46.68% G+C content. Genome analysis revealed genes encoding specialized functions for the biosynthesis of antifungal metabolites and antibacterial metabolites, the promotion of plant growth, the alleviation of oxidative stress and nutrient utilization. And the biosynthesis of antimicrobial metabolites in strain LM2303 was confirmed by biochemical analysis, while its plant growth promoting traits were confirmed by inoculation tests. Our results will establish a better foundation for further studies and biocontrol application of B. velezensis LM2303. Copyright © 2017 Elsevier B.V. All rights reserved.

  2. Co-digestion of rice straw and cow dung to supply cooking fuel and fertilizers in rural India: Impact on human health, resource flows and climate change.

    Science.gov (United States)

    Sfez, Sophie; De Meester, Steven; Dewulf, Jo

    2017-12-31

    Anaerobic digestion of cow dung with new feedstock such as crop residues to increase the biogas potential is an option to help overcoming several issues faced by India. Anaerobic digestion provides biogas that can replace biomass cooking fuels and reduce indoor air pollution. It also provides digestate, a fertilizer that can contribute to compensate nutrient shortage on agricultural land. Moreover, it avoids the burning of rice straw in the fields which contributes to air pollution in India and climate change globally. Not only the technical and economical feasibility but also the environmental sustainability of such systems needs to be assessed. The potential effects of implementing community digesters co-digesting cow dung and rice straw on carbon and nutrients flows, human health, resource efficiency and climate change are analyzed by conducting a Substance Flow Analysis and a Life Cycle Assessment. The implementation of the technology is considered at the level of the state of Chhattisgarh. Implementing this scenario reduces the dependency of the rural community to nitrogen and phosphorus from synthetic fertilizers only by 0.1 and 1.6%, respectively, but the dependency of farmers to potassium from synthetic fertilizers by 31%. The prospective scenario returns more organic carbon to agricultural land and thus has a potential positive effect on soil quality. The implementation of the prospective scenario can reduce the health impact of the local population by 48%, increase the resource efficiency of the system by 60% and lower the impact on climate change by 13%. This study highlights the large potential of anaerobic digestion to overcome the aforementioned issues faced by India. It demonstrates the need to couple local and global assessments and to conduct analyses at the substance level to assess the sustainability of such systems. Copyright © 2017 Elsevier B.V. All rights reserved.

  3. Purification and characterization of a serine protease (CPM-2) with fibrinolytic activity from the dung beetles.

    Science.gov (United States)

    Ahn, Mi Young; Hahn, Bum-Soo; Ryu, Kang Sun; Hwang, Jae Sam; Kim, Yeong Shik

    2005-07-01

    Catharsius protease-2 (CPM-2) was isolated from the body of dung beetles, Catharsius molossus, using a three step purification process (ammonium sulfate fractionation, gel filtration on Bio-Gel P-60, and affinity chromatography on DEAE Affi-Gel blue). The purified CPM-2, having a molecular weight of 24 kDa, was assessed homogeneously by SDS-polyacrylamide gel electrophoresis. The N-terminal amino acid sequence of CPM-2 was composed of X Val Gln Asp Phe Val Glu Glu Ile Leu. CPM-2 was inactivated by Cu2+ and Zn2+ and strongly inhibited by typical serine proteinase inhibitors such as TLCK, soybean trypsin inhibitor, aprotinin, benzamidine, and alpha1-antitrypsin. However, EDTA, EGTA, cysteine, beta-mercaptoethanol, E64, and elastatinal had little effect on enzyme activity. In addition, antiplasmin and antithrombin III were not sensitive to CPM-2. Based on the results of a fibrinolytic activity test, CPM-2 readily cleaved Aalpha- and Bbeta-chains of fibrinogen and fibrin, and gamma-chain of fibrinogen more slowly. The nonspecific action of the enzyme resulted in extensive hydrolysis, releasing a variety of fibrinopeptides of fibrinogen and fibrin. Polyclonal antibodies of CPM-2 were reactive to the native form of antigen. The ELISA was applied to detect quantities, in nanograms, of the antigen in CPM-2 protein.

  4. Production of Biogas from wastes Blended with CowDung for Electricity generation-A Case study

    Science.gov (United States)

    Muthu, D.; Venkatasubramanian, C.; Ramakrishnan, K.; Sasidhar, Jaladanki

    2017-07-01

    The country’s production of solid waste generation is piling up year after year and the generation of Bio-Gas finds a fruitful solution to overcome this problem. This technology can contribute to energy conservation if the economic viability and social acceptance of this technology are favorable. Our campus has a number of hostel buildings which generates large quantum of kitchen waste and sewage per day. This research will have process ofcarrying out survey, characterization of kitchen waste from several kitchens & Canteens and knowing the potential for biogas production. The waste generated from kitchen and sewage from the hostels is given as feedstock to produce 600 m3 of biogas per day with cow dung as byproduct. The methane gas generated from Biogas is purified and this is used for power generation. Two biogas engine generators of 30 kVA and 50 kVA were installed. This power is used for backup power for girl’s hostel lighting load. From this study it is concluded that the generation of Biogas production and its usage for power production is the best option to handle these large quantum of sewage, kitchen waste generated from various buildings and also treated effluent from biogas plant and the biomass generated is a wealth for doing agriculture for any community ultimately it protects the environment.

  5. Anticoagulant effects of inhaled unfractionated heparin in the dog as determined by partial thromboplastin time and factor Xa activity.

    Science.gov (United States)

    Manion, Jill S; Thomason, John M; Langston, Vernon C; Claude, Andrew K; Brooks, Marjory B; Mackin, Andrew J; Lunsford, Kari V

    2016-01-01

    To evaluate the anticoagulant effects of inhaled heparin in dogs. This study was conducted in 3 phases. In phase 1, bronchoalveolar lavage fluid (BALf) was collected to generate an in vitro calibration curve to relate heparin concentration to the activated partial thromboplastin time (aPTT). In phase 2, heparin was administered via nebulization to determine the threshold dose needed to prolong systemic aPTT. In phase 3, the local anticoagulant activity of inhaled heparin was determined by measurement of BALf anti-Xa activity and aPTT. University teaching hospital. Six healthy intact female Walker Hounds were used in this study. Two dogs were used for each phase. Inhaled unfractionated sodium heparin was administered in doses ranging from 50,000 to 200,000 IU. In vitro addition of heparin to BALf caused a prolongation in aPTT. Inhaled heparin at doses as high as 200,000 IU failed to prolong systemic aPTT, and a threshold dose could not be determined. No significant local anticoagulant effects were detected. Even at doses higher than those known to be effective in people, inhaled heparin appears to have no detectable local or systemic anticoagulant effects in dogs with the current delivery method. © Veterinary Emergency and Critical Care Society 2015.

  6. The Role of RaxST, a Prokaryotic Sulfotransferase, and RaxABC, a Putative Type I Secretion System, in Activation of the Rice XA21-Mediated Immune Response

    Directory of Open Access Journals (Sweden)

    Pamela C. Ronald

    2014-01-01

    Full Text Available Tyrosine sulfation is an important posttranslational modification that determines the outcome of serious diseases in plants and animals. We have recently demonstrated that the plant pathogen Xanthomonas oryzae pv. oryzae (Xoo carries a functional sulfotransferase (RaxST. raxST is required for activation of rice Xa21-mediated immunity indicating the critical, but unknown, function of raxST in mediating the Xoo/rice interaction. The raxST gene resides in the same operon (raxSTAB as components of a predicted type I secretion and processing system (RaxA and RaxB. These observations suggest a model where RaxST sulfates a molecule that contains a leader peptide, which is cleaved by the peptidase domain of the RaxB protein and secreted outside the bacterial cell by the RaxABC T1SS.

  7. Good genes and sexual selection in dung beetles (Onthophagus taurus: genetic variance in egg-to-adult and adult viability.

    Directory of Open Access Journals (Sweden)

    Francisco Garcia-Gonzalez

    2011-01-01

    Full Text Available Whether species exhibit significant heritable variation in fitness is central for sexual selection. According to good genes models there must be genetic variation in males leading to variation in offspring fitness if females are to obtain genetic benefits from exercising mate preferences, or by mating multiply. However, sexual selection based on genetic benefits is controversial, and there is limited unambiguous support for the notion that choosy or polyandrous females can increase the chances of producing offspring with high viability. Here we examine the levels of additive genetic variance in two fitness components in the dung beetle Onthophagus taurus. We found significant sire effects on egg-to-adult viability and on son, but not daughter, survival to sexual maturity, as well as moderate coefficients of additive variance in these traits. Moreover, we do not find evidence for sexual antagonism influencing genetic variation for fitness. Our results are consistent with good genes sexual selection, and suggest that both pre- and postcopulatory mate choice, and male competition could provide indirect benefits to females.

  8. Computational investigation of potential dosing schedules for a switch of medication from warfarin to rivaroxaban-an oral, direct Factor Xa inhibitor.

    Science.gov (United States)

    Burghaus, Rolf; Coboeken, Katrin; Gaub, Thomas; Niederalt, Christoph; Sensse, Anke; Siegmund, Hans-Ulrich; Weiss, Wolfgang; Mueck, Wolfgang; Tanigawa, Takahiko; Lippert, Jörg

    2014-01-01

    The long-lasting anticoagulant effect of vitamin K antagonists can be problematic in cases of adverse drug reactions or when patients are switched to another anticoagulant therapy. The objective of this study was to examine in silico the anticoagulant effect of rivaroxaban, an oral, direct Factor Xa inhibitor, combined with the residual effect of discontinued warfarin. Our simulations were based on the recommended anticoagulant dosing regimen for stroke prevention in patients with atrial fibrillation. The effects of the combination of discontinued warfarin plus rivaroxaban were simulated using an extended version of a previously validated blood coagulation computer model. A strong synergistic effect of the two distinct mechanisms of action was observed in the first 2-3 days after warfarin discontinuation; thereafter, the effect was close to additive. Nomograms for the introduction of rivaroxaban therapy after warfarin discontinuation were derived for Caucasian and Japanese patients using safety and efficacy criteria described previously, together with the coagulation model. The findings of our study provide a mechanistic pharmacologic rationale for dosing schedules during the therapy switch from warfarin to rivaroxaban and support the switching strategies as outlined in the Summary of Product Characteristics and Prescribing Information for rivaroxaban.

  9. Computational investigation of potential dosing schedules for a switch of medication from warfarin to rivaroxaban—an oral, direct Factor Xa inhibitor

    Science.gov (United States)

    Burghaus, Rolf; Coboeken, Katrin; Gaub, Thomas; Niederalt, Christoph; Sensse, Anke; Siegmund, Hans-Ulrich; Weiss, Wolfgang; Mueck, Wolfgang; Tanigawa, Takahiko; Lippert, Jörg

    2014-01-01

    The long-lasting anticoagulant effect of vitamin K antagonists can be problematic in cases of adverse drug reactions or when patients are switched to another anticoagulant therapy. The objective of this study was to examine in silico the anticoagulant effect of rivaroxaban, an oral, direct Factor Xa inhibitor, combined with the residual effect of discontinued warfarin. Our simulations were based on the recommended anticoagulant dosing regimen for stroke prevention in patients with atrial fibrillation. The effects of the combination of discontinued warfarin plus rivaroxaban were simulated using an extended version of a previously validated blood coagulation computer model. A strong synergistic effect of the two distinct mechanisms of action was observed in the first 2–3 days after warfarin discontinuation; thereafter, the effect was close to additive. Nomograms for the introduction of rivaroxaban therapy after warfarin discontinuation were derived for Caucasian and Japanese patients using safety and efficacy criteria described previously, together with the coagulation model. The findings of our study provide a mechanistic pharmacologic rationale for dosing schedules during the therapy switch from warfarin to rivaroxaban and support the switching strategies as outlined in the Summary of Product Characteristics and Prescribing Information for rivaroxaban. PMID:25426077

  10. Data of evolutionary structure change: 1BUCA-3MDEA [Confc[Archive

    Lifescience Database Archive (English)

    Full Text Available 1BUCA-3MDEA 1BUC 3MDE A A -MDFNLTDIQQDFLKLAHDFGEKKLAPTVTERDHKGIYD...ENVLTGEGAGFKIAMGTFDKTRPPVAAGAVGLAQRALDEATKYALERKTFGKLLAEHQGISFLLADMAMKVELARLSYQRAAWEIDSGRRNTYYASIAKAYAADIANQ...> A 3MDEA RSDPDPKAPAS...E A 3MDEA IEANT-LGQVP 2 3MDE A 3MDEA

  11. Studies on biosorption of Cr(VI) on a green resin: dry cow dung powder and tracer technique

    International Nuclear Information System (INIS)

    Barot, N.S.; Bagla, H.K.

    2012-01-01

    The present investigation entails the application of dry cow dung powder (DCP) as an indigenous, inexpensive and eco-friendly material for the removal of Cr(VI) from aqueous medium. Batch biosorption experiments were conducted employing 51 Cr(VI) as a tracer and the effect of various process parameters such as optimum pH, temperature, amount of resin, time of equilibration, agitation speed, concentration of metal ions and interfering effect of different salts etc. were studied. The kinetic studies were carried out employing various models but the best fitting was given by Lagergren Pseudo-second order model with high correlation coefficient R 2 value of 0.997 and adsorption capacity of 10.20 mg/g. The thermodynamic parameters for biosorption were evaluated as ΔG = -2.837 kJ/mol, ΔH = -4.757 kJ/mol and ΔS = 16.64 J/mol K, which indicated spontaneous and exothermic process with high affinity of DCP for Cr(VI). Many naturally available materials are used for the biosorption of heavy metal pollutants, where most of them are physically or chemically modified. In this research work, DCP has been utilized without any pre or post chemical treatment. Thus it manifests the principle of green chemistry and proves to be an eco-friendly resin. (orig.)

  12. Studies on biosorption of Cr(VI) on a green resin: dry cow dung powder and tracer technique

    Energy Technology Data Exchange (ETDEWEB)

    Barot, N.S.; Bagla, H.K. [Kishinchand Chellaram College, Mumbai (India). Nuclear and Radiochemistry Dept.

    2012-07-01

    The present investigation entails the application of dry cow dung powder (DCP) as an indigenous, inexpensive and eco-friendly material for the removal of Cr(VI) from aqueous medium. Batch biosorption experiments were conducted employing {sup 51}Cr(VI) as a tracer and the effect of various process parameters such as optimum pH, temperature, amount of resin, time of equilibration, agitation speed, concentration of metal ions and interfering effect of different salts etc. were studied. The kinetic studies were carried out employing various models but the best fitting was given by Lagergren Pseudo-second order model with high correlation coefficient R{sup 2} value of 0.997 and adsorption capacity of 10.20 mg/g. The thermodynamic parameters for biosorption were evaluated as {Delta}G = -2.837 kJ/mol, {Delta}H = -4.757 kJ/mol and {Delta}S = 16.64 J/mol K, which indicated spontaneous and exothermic process with high affinity of DCP for Cr(VI). Many naturally available materials are used for the biosorption of heavy metal pollutants, where most of them are physically or chemically modified. In this research work, DCP has been utilized without any pre or post chemical treatment. Thus it manifests the principle of green chemistry and proves to be an eco-friendly resin. (orig.)

  13. The Impact of Operating Parameters and Correlated Parameters for Extended BWR Burnup Credit

    Energy Technology Data Exchange (ETDEWEB)

    Ade, Brian J. [Oak Ridge National Lab. (ORNL), Oak Ridge, TN (United States); Marshall, William B. J. [Oak Ridge National Lab. (ORNL), Oak Ridge, TN (United States); Ilas, Germina [Oak Ridge National Lab. (ORNL), Oak Ridge, TN (United States); Betzler, Benjamin R. [Oak Ridge National Lab. (ORNL), Oak Ridge, TN (United States); Bowman, Stephen M. [Oak Ridge National Lab. (ORNL), Oak Ridge, TN (United States)

    2017-06-01

    Applicants for certificates of compliance for spent nuclear fuel (SNF) transportation and dry storage systems perform analyses to demonstrate that these systems are adequately subcritical per the requirements of Title 10 of the Code of Federal Regulations (10 CFR) Parts 71 and 72. For pressurized water reactor (PWR) SNF, these analyses may credit the reduction in assembly reactivity caused by depletion of fissile nuclides and buildup of neutron-absorbing nuclides during power operation. This credit for reactivity reduction during depletion is commonly referred to as burnup credit (BUC). US Nuclear Regulatory Commission (NRC) staff review BUC analyses according to the guidance in the Division of Spent Fuel Storage and Transportation Interim Staff Guidance (ISG) 8, Revision 3, Burnup Credit in the Criticality Safety Analyses of PWR Spent Fuel in Transportation and Storage Casks.

  14. Exoskeleton may influence the internal body temperatures of Neotropical dung beetles (Col. Scarabaeinae

    Directory of Open Access Journals (Sweden)

    Valentina Amore

    2017-05-01

    Full Text Available The insect exoskeleton is a multifunctional coat with a continuum of mechanical and structural properties constituting the barrier between electromagnetic waves and the internal body parts. This paper examines the ability of beetle exoskeleton to regulate internal body temperature considering its thermal permeability or isolation to simulated solar irradiance and infrared radiation. Seven Neotropical species of dung beetles (Coleoptera, Scarabaeinae differing in colour, surface sculptures, size, sexual dimorphism, period of activity, guild category and altitudinal distribution were studied. Specimens were repeatedly subjected to heating trials under simulated solar irradiance and infrared radiation using a halogen neodymium bulb light with a balanced daylight spectrum and a ceramic infrared heat emitter. The volume of exoskeleton and its weight per volume unit were significantly more important for the heating rate at the beginning of the heating process than for the asymptotic maximum temperature reached at the end of the trials: larger beetles with relatively thicker exoskeletons heated more slowly. The source of radiation greatly influences the asymptotic temperature reached, but has a negligible effect in determining the rate of heat gain by beetles: they reached higher temperatures under artificial sunlight than under infrared radiation. Interspecific differences were negligible in the heating rate but had a large magnitude effect on the asymptotic temperature, only detectable under simulated sun irradiance. The fact that sun irradiance is differentially absorbed dorsally and transformed into heat among species opens the possibility that differences in dorsal exoskeleton would facilitate the heat gain under restrictive environmental temperatures below the preferred ones. The findings provided by this study support the important role played by the exoskeleton in the heating process of beetles, a cuticle able to act passively in the thermal

  15. Exoskeleton may influence the internal body temperatures of Neotropical dung beetles (Col. Scarabaeinae).

    Science.gov (United States)

    Amore, Valentina; Hernández, Malva I M; Carrascal, Luis M; Lobo, Jorge M

    2017-01-01

    The insect exoskeleton is a multifunctional coat with a continuum of mechanical and structural properties constituting the barrier between electromagnetic waves and the internal body parts. This paper examines the ability of beetle exoskeleton to regulate internal body temperature considering its thermal permeability or isolation to simulated solar irradiance and infrared radiation. Seven Neotropical species of dung beetles (Coleoptera, Scarabaeinae) differing in colour, surface sculptures, size, sexual dimorphism, period of activity, guild category and altitudinal distribution were studied. Specimens were repeatedly subjected to heating trials under simulated solar irradiance and infrared radiation using a halogen neodymium bulb light with a balanced daylight spectrum and a ceramic infrared heat emitter. The volume of exoskeleton and its weight per volume unit were significantly more important for the heating rate at the beginning of the heating process than for the asymptotic maximum temperature reached at the end of the trials: larger beetles with relatively thicker exoskeletons heated more slowly. The source of radiation greatly influences the asymptotic temperature reached, but has a negligible effect in determining the rate of heat gain by beetles: they reached higher temperatures under artificial sunlight than under infrared radiation. Interspecific differences were negligible in the heating rate but had a large magnitude effect on the asymptotic temperature, only detectable under simulated sun irradiance. The fact that sun irradiance is differentially absorbed dorsally and transformed into heat among species opens the possibility that differences in dorsal exoskeleton would facilitate the heat gain under restrictive environmental temperatures below the preferred ones. The findings provided by this study support the important role played by the exoskeleton in the heating process of beetles, a cuticle able to act passively in the thermal control of body

  16. Electricity generation from cattle dung using microbial fuel cell technology during anaerobic acidogenesis and the development of microbial populations.

    Science.gov (United States)

    Zhao, Guang; Ma, Fang; Wei, Li; Chua, Hong; Chang, Chein-Chi; Zhang, Xiao-Jun

    2012-09-01

    A microbial fuel cell (MFC) was constructed to investigate the possible generation of electricity using cattle dung as a substrate. After 30 days of operation, stable electricity was generated, and the maximum volumetric power density was 0.220 W/m(3). The total chemical oxygen demand (TCOD) removal and coulombic efficiency (CE) of the MFC reached 73.9±1.8% and 2.79±0.6%, respectively, after 120 days of operation. Acetate was the main metabolite in the anolyte, and other volatile fatty acids (VFAs) (propionate and butyrate) were present in minor amounts. The PCR-DGGE analysis indicated that the following five groups of microbes were present: Proteobacteria, Bacteroides, Chloroflexi, Actinobacteria and Firmicutes. Proteobacteria and Firmicutes were the dominant phyla in the sample; specifically, 36.3% and 24.2% of the sequences obtained were Proteobacteria and Firmicutes, respectively. Clostridium sp., Pseudomonas luteola and Ochrobactrum pseudogrignonense were the most dominant groups during the electricity generation process. The diversity of archaea dramatically decreased after 20 days of operation. The detected archaea were hydrogenotrophic methanogens, and the Methanobacterium genus disappeared during the periods of stable electricity generation via acidogenesis. Copyright © 2012 Elsevier Ltd. All rights reserved.

  17. Data of evolutionary structure change: 1BUCB-3MDEA [Confc[Archive

    Lifescience Database Archive (English)

    Full Text Available 1BUCB-3MDEA 1BUC 3MDE B A -MDFNLTDIQQDFLKLAHDFGEKKLAPTVTERDHKGIYD...ENVLTGEGAGFKIAMGTFDKTRPPVAAGAVGLAQRALDEATKYALERKTFGKLLAEHQGISFLLADMAMKVELARLSYQRAAWEIDSGRRNTYYASIAKAYAADIANQ...pdbID> A 3MDEA RSDPDP...in> 3MDE A 3MDEA IEANT-LGQVPA 3MDEA AEKKG-DEYII

  18. Improving Methane Production through Co-Digestion of Canola Straw and Buffalo Dung by H2O2 Pretreatment

    Directory of Open Access Journals (Sweden)

    ALTAF ALAM NOONARI

    2017-01-01

    Full Text Available In this study an effect of acidic pre-treatment on the CS (Canola Straw and BD (Buffalo Dung by anaerobic co-digestion was investigated. H2O2 (Hydrogen Peroxide is a mainly accustomed reagent, used as a bleaching agent in the different industries such as paper and wood. In the present study, it was used as a pre-treatment chemical at varying concentrations in batch reactors. The co-digestion of CS and BD was carried out in SAMPTS (Semi-Automatic Methane Potential Test System at mesophilic (37±1oC conditions. The CS was pretreated in glass bottles with different concentrations of the H2O2 for seven days. The inoculum used in the present study was an effluent of the CSTR (Continuous Stirred Tank Reactor, which was treating BD at mesophilic conditions. The specific methane production from the codigestion of canola straw and BD, by the pre-treatment of H2O2 at concentrations of 0.5, 1.0, and 1.5% were 530.8, 544.5, and 510.3 NmL CH4 g/VS, respectively. The significant reduction in the volatile solids of CS was observed at the optimum pre-treatment of 1.0% H2O2.

  19. Modeling the reduction of gross lithium erosion observed under high-flux deuterium bombardment

    NARCIS (Netherlands)

    Abrams, T.; Jaworski, M. A.; Kaita, R.; Nichols, J. H.; Stotler, D. P.; De Temmerman, G.; van den Berg, M. A.; van der Meiden, H. J.; Morgan, T. W.

    2015-01-01

    Abstract Both thin (<1&#xa0;μm) and thick (∼500&#xa0;μm) lithium films under high-flux deuterium and neon plasma bombardment were studied in the linear plasma device Magnum-PSI at ion fluxes >1024&#xa0;m−2&#xa0;s−1 and surface temperatures <700&#xa0;°C.

  20. Deuterium-induced nanostructure formation on tungsten exposed to high-flux plasma

    NARCIS (Netherlands)

    Xu, H.Y.; De Temmerman, G.; Luo, G. N.; Jia, Y. Z.; Yuan, Y.; Fu, B. Q.; Godfrey, A.; Liu, W.

    2015-01-01

    Surface topography of polycrystalline tungsten (W) have been examined after exposure to a low-energy (38&#xa0;eV/D), high-flux (∼1.1–1.5&#xa0;×&#xa0;1024&#xa0;m−2&#xa0;s−1) deuterium plasma in the Pilot-PSI linear plasma device. The methods used were scanning electron microscopy

  1. Anticoagulant activity in salivary glands of the insect vector Culicoides variipennis sonorensis by an inhibitor of factor Xa.

    Science.gov (United States)

    Pérez de León, A A; Valenzuela, J G; Tabachnick, W J

    1998-02-01

    Blood feeding by the insect vector Culicoides variipennis sonorensis involves laceration of superficial host tissues, an injury that would be expected to trigger the coagulation cascade. Accordingly, the salivary glands of C.v. sonorensis were examined for the presence of an antihemostatic that prevents blood coagulation. Assays using salivary gland extracts showed a delay in the recalcification time of plasma devoid of platelets, indicating the presence of anticoagulant activity. Retardation in the formation of a fibrin clot was also observed after the addition of tissue factor to plasma that was preincubated with salivary gland extracts. Similarly, an inhibitory effect by salivary gland extracts was detected in assays that included factors of the intrinsic pathway. Inhibition of the catalytic activity of purified factor Xa toward its chromogenic substrate suggested that it was the target of the salivary anticoagulant of C.v. sonorensis. This was corroborated by the coincidence of anticoagulant and anti-FXa activities obtained by reverse-phase HPLC. The depletion of anti-FXa activity from salivary glands during blood feeding suggests that the FXa inhibitor functions as anticoagulant. Molecular sieving HPLC yielded an apparent molecular mass of 28 kDa for the salivary FXa inhibitor of C.v. sonorensis. Preventing the formation of thrombin through the inhibition of FXa likely facilitates blood feeding by maintaining the pool of blood fluid at the feeding site. The salivary FXa inhibitor of C.v. sonorensis could impair the network of host-defense mechanisms in the skin microenvironment by avoiding blood coagulation at the site of feeding.

  2. The potential of Arachis pintoi biomass to improve quality of soil continuously used for cassava cropping

    OpenAIRE

    N. Muddarisna; S. Prijono

    2014-01-01

    A field experiment that was aimed to elucidate the effects of application of Arachis pintoi biomass and animal dung on quality of soil continuously used for cassava cropping was conducted at Jatikerto Village, Kromengan District of Malang Regency. Eight treatments tested were 100% NPK inorganic fertilizer, 100 kg N Arachis pintoi/ha, (3) 100 kg N chicken dung / ha, 100 kg N cow dung /ha, 100 kg N goat dung /ha, 100 kg N Arachis pintoi + chicken dung /ha, 100 kg N Arachis pintoi + cow dung /h...

  3. Nucleotide diversity analysis of three major bacterial blight resistance genes in rice.

    Directory of Open Access Journals (Sweden)

    Waikhom Bimolata

    Full Text Available Nucleotide sequence polymorphisms among R gene alleles influence the process of co-evolutionary interaction between host and pathogen by shaping the response of host plants towards invading pathogens. Here, we present the DNA sequence polymorphisms and diversities present among natural alleles of three rice bacterial blight resistance genes, Xa21, Xa26 and xa5. The diversity was examined across different wild relatives and cultivars of Oryza species. Functional significance of selected alleles was evaluated through semi-quantitative reverse transcription polymerase chain reaction and real time PCR. The greatest nucleotide diversity and singleton variable sites (SVS were present in Xa26 (π = 0.01958; SVS = 182 followed by xa5 and Xa21 alleles. The highest frequency of single nucleotide polymorphisms were observed in Xa21 alleles and least in xa5. Transition bias was observed in all the genes and 'G' to 'A' transitions were more favored than other form of transitions. Neutrality tests failed to show the presence of selection at these loci, though negative Tajima's D values indicate the presence of a rare form of polymorphisms. At the interspecies level, O. nivara exhibited more diversity than O. sativa. We have also identified two nearly identical resistant alleles of xa5 and two sequentially identical alleles of Xa21. The alleles of xa5 showed basal levels of expression while Xa21 alleles were functionally not expressed.

  4. Biogas properties and enzymatic analysis during anaerobic fermentation of Phragmites australis straw and cow dung: influence of nickel chloride supplement.

    Science.gov (United States)

    Tian, Yonglan; Zhang, Huayong; Chai, Yang; Wang, Lijun; Mi, Xueyue; Zhang, Luyi; Ware, Maxwell Adam

    2017-02-01

    The importance of nickel (added as NiCl 2 ) on mesophilic anaerobic fermentation of Phragmites australis straw and cow dung was demonstrated by investigating the biogas properties, pH values, organic matter degradation [chemical oxygen demand (COD)] and enzyme activities (cellulase, protease and dehydrogenase) during the fermentation process. The results showed that Ni 2+ addition increased the cumulative biogas yields by >18 % by improving the efficiency of first peak stage and bringing forward the second peak stage. The pH values were not significantly influenced by Ni 2+ addition (p > 0.05). Biogas yields were associated with variations in COD concentrations rather than momentary concentrations. At the start-up stage of fermentation (4th day), the biogas yields increased gradually together with the increase of dehydrogenase activities at elevated Ni 2+ concentrations when cellulase and protease activities were similar in all test groups. It is suggested that Ni 2+ addition was mainly dependent on the methanogenic stage. After the start-up stage, the impact of Ni 2+ addition on biogas production was mainly dependent on its effect on cellulase activities, rather than protease or dehydrogenase activities.

  5. Pilobolus species found on herbivore dung from the São Paulo Zoological Park, Brazil Espécies de Pilobolus encontradas em fezes de herbívoros do Parque Zoológico de São Paulo, Brasil

    Directory of Open Access Journals (Sweden)

    Aírton Viriato

    2008-09-01

    Full Text Available A study of Pilobolus species from 168 dung samples of various herbivoresous animals, collected in the São Paulo Zoological Park, was carried out. Ten species were found, illustrated, described, and a key for their identification is provided.Para o estudo de espécies de Pilobolus, foram coletadas 168 amostras de fezes de animais herbívoros no Parque Zoológico da cidade de São Paulo. Dez espécies foram verificadas, ilustradas e descritas e uma chave de identificação é apresentada.

  6. Reduction of Tat-interacting Protein 30 Expression Could be a Prognostic Marker in Bladder Urothelial Cancer

    Directory of Open Access Journals (Sweden)

    Ye-Ping Li

    2018-01-01

    Conclusions: TIP30 expression was associated with clinical tumor stage in BUC, suggesting that it might play an important role in disease progression. Furthermore, TIP30 might predict postoperative OS. Thus, its evaluation might be useful for predicting prognosis.

  7. Free vibration of elastically supported thin cylinders including gyroscopic effects

    CSIR Research Space (South Africa)

    Loveday, PW

    1998-10-29

    Full Text Available [ The equations D[R[ 747723 JSV 106:2 "Issue# MS 1560 VIBRATION OF THIN CYLINDERS 442 required for this procedure\\ including the gyroscopic terms\\ are included in Appendix A[ The displacement functions can then be written as follows] W"x# C0 cosh a0xa C1 sinh a0... xa C2 cos g1xa C3 sin g1xa epx:a0C4 cos qxa C5 sin qxa 1 e px:a0C6 cos qxa C7 sin qxa 1 "6a# V"x# A0C0 cosh a0xa A0C1 sinh a0xa A2C2 cos g1xa A2C3 sin g1xa epx:a$"A4C4 A5C5# cos qxa "A4C5 A5C4# sin qxa % e px:a$"A4C6 A5C7# cos...

  8. Stage- and sex-specific heat tolerance in the yellow dung fly Scathophaga stercoraria.

    Science.gov (United States)

    Blanckenhorn, Wolf U; Gautier, Roland; Nick, Marcel; Puniamoorthy, Nalini; Schäfer, Martin A

    2014-12-01

    Thermal tolerance varies at all hierarchical levels of biological organization: among species, populations, individuals, and even within individuals. Age- or developmental stage- and sex-specific thermal effects have received relatively little attention in the literature, despite being crucial for understanding thermal adaptation in nature and responses to global warming. We document stage- and sex- specific heat tolerance in the yellow dung fly Scathophaga stercoraria (Diptera: Scathophagidae), a species common throughout the northern hemisphere that generally favours cool climates. Exposure of eggs to temperatures up to 32°C did not affect larval hatching rate, but subsequent egg-to-adult survival at a benign temperature was reduced. Permanent transfer from benign (18°C) to hot temperatures (up to 31°C) at different larval and pupal stages strongly decreased egg-to-adult survival, though survival continuously improved the later the transfer occurred. Temporary transfer for only two days increased mortality more weakly, survival being lowest when temperature stress was imposed early during the larval or pupal stages. Adult flies provided with sugar and water tolerated 31°C longer than previously thought (5 days in males to 9 days in females). Eggs were thus less susceptible to thermal stress than larvae, pupae or adults, in agreement with the hypothesis that more mobile stages require less physiological protection against heat because they can behaviourally thermoregulate. The probability of mating, of laying a clutch, and hatching success were generally independently reduced by exposure of females or males to warm temperatures (24°C) during the juvenile or adult stages, with some interactions evident. High temperature stress thus affects survival differentially depending on when it occurs during the juvenile or the pre-reproductive adult life stage, and affects reproductive success via the mating behaviour of both sexes, female physiology in terms of

  9. Backup control airstart performance on a digital electronic engine control-equipped F100-engine

    Science.gov (United States)

    Johnson, J. B.

    1984-01-01

    The air start capability of a backup control (BUC) was tested for a digital electronic engine control (DEEC) equipped F100 engine, which was installed in an F-15 aircraft. Two air start schedules were tested. Using the group 1 start schedule, based on a 40 sec timer, an air speed of 300 knots was required to ensure successful 40 and 25% BUC mode spooldown airstarts. If core rotor speed (N2) was less than 40% a stall would occur when the start bleed closed, 40 sec after initiation of the air start. All jet fuel starter (JFS) assisted air starts were successful with the group 1 start schedule. For the group 2 schedule, the time between pressurization and start bleed closure ranged between 50 sec and 72 sec. Idle rps was lower than the desired 65% for air starts at higher altitudes and lower air speeds.

  10. Activated factor X signaling via protease-activated receptor 2 suppresses pro-inflammatory cytokine production from LPS-stimulated myeloid cells.

    LENUS (Irish Health Repository)

    Gleeson, Eimear M

    2013-07-19

    Vitamin K-dependent proteases generated in response to vascular injury and infection enable fibrin clot formation, but also trigger distinct immuno-regulatory signaling pathways on myeloid cells. Factor Xa, a protease crucial for blood coagulation, also induces protease-activated receptor-dependent cell signaling. Factor Xa can bind both monocytes and macrophages, but whether factor Xa-dependent signaling stimulates or suppresses myeloid cell cytokine production in response to Toll-like receptor activation is not known. In this study, exposure to factor Xa significantly impaired pro-inflammatory cytokine production from lipopolysaccharide-treated peripheral blood mononuclear cells, THP-1 monocytic cells and murine macrophages. Furthermore, factor Xa inhibited nuclear factor-kappa B activation in THP-1 reporter cells, requiring phosphatidylinositide 3-kinase activity for its anti-inflammatory effect. Active-site blockade, γ-carboxyglutamic acid domain truncation and a peptide mimic of the factor Xa inter-epidermal growth factor-like region prevented factor Xa inhibition of lipopolysaccharide-induced tumour necrosis factor-α release. In addition, factor Xa anti-inflammatory activity was markedly attenuated by the presence of an antagonist of protease-activated receptor 2, but not protease-activated receptor 1. The key role of protease-activated receptor 2 in eliciting factor Xa-dependent anti-inflammatory signaling on macrophages was further underscored by the inability of factor Xa to mediate inhibition of tumour necrosis factor-α and interleukin-6 release from murine bone marrow-derived protease-activated receptor 2-deficient macrophages. We also show for the first time that, in addition to protease-activated receptor 2, factor Xa requires a receptor-associated protein-sensitive low-density lipoprotein receptor to inhibit lipopolysaccharide-induced cytokine production. Collectively, this study supports a novel function for factor Xa as an endogenous, receptor

  11. Improving methane production through co-digestion of canola straw and buffalo dung by H/sub 2/O/sub 2/ pretreatment

    International Nuclear Information System (INIS)

    Noonari, A.A.; Sahito, A.R.; Brohi, K.M.

    2017-01-01

    In this study an effect of acidic pre-treatment on the CS (Canola Straw) and BD (Buffalo Dung) by anaerobic co-digestion was investigated. H2O2 (Hydrogen Peroxide) is a mainly accustomed reagent, used as a bleaching agent in the different industries such as paper and wood. In the present study, it was used as a pre-treatment chemical at varying concentrations in batch reactors. The co-digestion of CS and BD was carried out in SAMPTS (Semi-Automatic Methane Potential Test System) at mesophilic (37+-1oC) conditions. The CS was pretreated in glass bottles with different concentrations of the H2O2 for seven days. The inoculum used in the present study was an effluent of the CSTR (Continuous Stirred Tank Reactor), which was treating BD at mesophilic conditions. The specific methane production from the codigestion of canola straw and BD, by the pre-treatment of H2O2 at concentrations of 0.5, 1.0, and 1.5% were 530.8, 544.5, and 510.3 NmL CH4 g/VS, respectively. The significant reduction in the volatile solids of CS was observed at the optimum pre-treatment of 1.0% H2O2. (author)

  12. Xanthium italicum, Xanthium strumarium and Arctium lappa as new hosts for Diaporthe helianthi.

    Science.gov (United States)

    Vrandecic, Karolina; Jurkovic, Drazenka; Riccioni, Luca; Cosic, Jasenka; Duvnjak, Tomislav

    2010-07-01

    Sunflower (Helianthus annuus) stem canker caused by Diaporthe helianthi is one of the most important sunflower diseases in Croatia. Until recently, sunflower was the only known host for D. helianthi. In our research carried out in the area of Eastern Croatia, isolates of Diaporthe/Phomospis were collected from Xanthium italicum, X. strumarium and Arctium lappa. Using morphological, cultural and molecular ITS rDNA data, isolates from these weeds were identified as D. helianthi. The following isolates were used in the pathogenicity test: one isolate originated from sunflower (Su5/04), three from X. italicum (Xa2, Xa3 and Xa5), two from X. strumarium (Xa9 and Xa12), one from Xanthium sp. (Xa13) and one from A. lappa (Ar3). According to the results, it was determined that isolate Xa5 (originated from X. italicum) was the most pathogenic to sunflower stems. The average length of the lesion was 11.3 cm. The lowest level of pathogenicity was found in Xa9 (isolated from X. strumarium). The length of the lesion was 0.1 cm.

  13. The effects of blood feeding and exogenous supply of tryptophan on the quantities of xanthurenic acid in the salivary glands of Anopheles stephensi (Diptera: Culicidae).

    Science.gov (United States)

    Okech, Bernard; Arai, Meiji; Matsuoka, Hiroyuki

    2006-03-24

    Xanthurenic acid (XA), produced as a byproduct during the biosynthesis of insect eye pigment (ommochromes), is a strong inducer of Plasmodium gametogenesis at very low concentrations. In previous studies, it was shown that XA is present in Anopheles stephensi (Diptera: Culicidae) mosquito salivary glands and that during blood feeding the mosquitoes ingested their own saliva into the midgut. Considering these two facts together, it is therefore likely that XA is discharged with saliva during blood feeding and is swallowed into the midgut where it exerts its effect on Plasmodium gametocytes. However, the quantities of XA in the salivary glands and midgut are unknown. In this study, we used high performance liquid chromatography with electrochemical detection to detect and quantify XA in the salivary glands and midgut. Based on the results of this study, we found 0.28+/-0.05 ng of XA in the salivary glands of the mosquitoes, accounting for 10% of the total XA content in the mosquito whole body. The amounts of XA in the salivary glands reduced to 0.13+/-0.06 ng after mosquitoes ingested a blood meal. Approximately 0.05+/-0.01 ng of XA was detected in the midgut of nonblood fed An. stephensi mosquitoes. By adding synthetic tryptophan as a source of XA into larval rearing water (2 mM) or in sugar meals (10 mM), we evaluated whether XA levels in the mosquito (salivary glands, midgut, and whole body) were boosted and the subsequent effect on infectivity of Plasmodium berghei in the treated mosquito groups. A female specific increase in XA content was observed in the whole body and in the midgut of mosquito groups where tryptophan was added either in the larval water or sugar meals. However, XA in the salivary glands was not affected by tryptophan addition to larval water, and surprisingly it reduced when tryptophan was added to sugar meals. The P. berghei oocyst loads in the mosquito midguts were lower in mosquitoes fed tryptophan treated sugar meals than in mosquitoes

  14. Functional Marker Assisted Improvement of Stable Cytoplasmic Male Sterile Lines of Rice for Bacterial Blight Resistance

    Directory of Open Access Journals (Sweden)

    Jegadeesan Ramalingam

    2017-06-01

    Full Text Available Bacterial blight (BB, caused by Xanthomonas oryzae pv.oryzae is one among the major diseases in rice, which in severe condition cause losses up to 60% in total yield. Marker assisted pyramiding of three broad spectrum BB resistance genes (xa5, xa13, and Xa21 in prominent rice varieties is the most economical and effective strategy for the management of the BB disease. We report here the pyramiding of three genes (xa5, xa13, and Xa21 in maintainer lines (CO 2B, CO 23B, and CO 24B of three promising wild abortive cytoplasmic male sterile lines (CO 2A, CO 23A, and CO 24A through functional markers assisted back cross breeding. IRBB60 with xa5, xa13, and Xa21 genes is used as a donor parent. BC2F1 and BC2F2 generations from a cross of CO 2B, CO 23B, and CO 24B with IRBB60 were evaluated for bacterial blight and non-fertility restoration. In BC2F1, plants with all three resistance genes (xa5, xa13, and Xa21 and high parent genome recovery was identified. In BC2F2, plants with all resistance genes and without fertility restorer (Rf3 and Rf4 were selected. Based on agronomic traits, BB resistance and maintenance of sterility, two plants each in CO 2B × IRBB60, CO 24B × IRBB60 and one plant in CO 23B × IRBB60 combinations were identified. The identified lines were crossed with respective male sterile lines for conversion of improved B line into CMS line through back-crossing, in addition to selfing. The plants with high recurrent genome and phenotypically similar to parental lines and sterile are being used for the hybrid rice development program. Currently, using these lines (improved CMS line, test crosses were made to develop new rice hybrids. Hybrids combinations viz., CO 23A × AD08009R and CO 24A × IET20898R were found to be stable at different locations with high yield. The R line used in this study has been introgressed with xa5, xa13, and Xa21 genes in a separate breeding program. These new hybrids with resistance against bacterial blight

  15. Sexual selection accounts for the geographic reversal of sexual size dimorphism in the dung fly, sepsis punctum (Diptera: Sepsidae).

    Science.gov (United States)

    Puniamoorthy, Nalini; Schäfer, Martin A; Blanckenhorn, Wolf U

    2012-07-01

    Sexual size dimorphism (SSD) varies widely across and within species. The differential equilibrium model of SSD explains dimorphism as the evolutionary outcome of consistent differences in natural and sexual selection between the sexes. Here, we comprehensively examine a unique cross-continental reversal in SSD in the dung fly, Sepsis punctum. Using common garden laboratory experiments, we establish that SSD is male-biased in Europe and female-biased in North America. When estimating sexual (pairing success) and fecundity selection (clutch size of female partner) on males under three operational sex ratios (OSRs), we find that the intensity of sexual selection is significantly stronger in European versus North American populations, increasing with male body size and OSR in the former only. Fecundity selection on female body size also increases strongly with egg number and weakly with egg volume, however, equally on both continents. Finally, viability selection on body size in terms of intrinsic (physiological) adult life span in the laboratory is overall nil and does not vary significantly across all seven populations. Although it is impossible to prove causality, our results confirm the differential equilibrium model of SSD in that differences in sexual selection intensity account for the reversal in SSD in European versus North American populations, presumably mediating the ongoing speciation process in S. punctum. © 2012 The Author(s).

  16. 76 FR 32989 - Request for Certification of Compliance-Rural Industrialization Loan and Grant Program

    Science.gov (United States)

    2011-06-07

    ... real estate and construction of a new location of Buc-ee's (gas station and convenience store), which...: 447110 (gasoline stations with convenience stores). DATES: All interested parties may submit comments in... Department of Agriculture to make or guarantee loans or grants to finance industrial and business activities...

  17. The potential of Arachis pintoi biomass to improve quality of soil continuously used for cassava cropping

    Directory of Open Access Journals (Sweden)

    N. Muddarisna

    2014-01-01

    Full Text Available A field experiment that was aimed to elucidate the effects of application of Arachis pintoi biomass and animal dung on quality of soil continuously used for cassava cropping was conducted at Jatikerto Village, Kromengan District of Malang Regency. Eight treatments tested were 100% NPK inorganic fertilizer, 100 kg N Arachis pintoi/ha, (3 100 kg N chicken dung/ ha, 100 kg N cow dung /ha, 100 kg N goat dung /ha, 100 kg N Arachis pintoi + chicken dung /ha, 100 kg N Arachis pintoi + cow dung /ha, and 100 kg N Arachis pintoi + goat dung /ha. Monitoring quality of top soil (0-20 cm was carried out at planting time and 3 months after planting. Soil samples were collected and analyzed for chemical and physical properties. Yield of cassava was measured at 6 months after planting. Results of this study showed that application of organic fertilizer in forms of green manure (Arachis pintoi biomass, and animal dung significantly improved physical and chemical properties of soil. Application of 50% NPK combined with organic manures did not significantly gave different tuber yield with that of 100% NPK.

  18. Burn-up credit applications for UO2 and MOX fuel assemblies in AREVA/COGEMA

    International Nuclear Information System (INIS)

    Toubon, H.; Riffard, C.; Batifol, M.; Pelletier, S.

    2003-01-01

    For the last seven years, AREVA/COGEMA has been implementing the second phase of its burn-up credit program (the incorporation of fission products). Since the early nineties, major actinides have been taken into account in criticality analyses first for reprocessing applications, then for transport and storage of fuel assemblies Next year (2004) COGEMA will take into account the six main fission products (Rh103, Cs133, Nd143, Sm149, Sm152 and Gd155) that make up 50% of the anti-reactivity of all fission products. The experimental program will soon be finished. The new burn-up credit methodology is in progress. After a brief overview of BUC R and D program and COGEMA's application of the BUC, this paper will focus on the new burn-up measurement for UO2 and MOX fuel assemblies. It details the measurement instrumentation and the measurement experiments on MOX fuels performed at La Hague in January 2003. (author)

  19. Prolonged Cerebral Circulation Time Is the Best Parameter for Predicting Vasospasm during Initial CT Perfusion in Subarachnoid Hemorrhagic Patients.

    Directory of Open Access Journals (Sweden)

    Chun Fu Lin

    Full Text Available We sought to imitate angiographic cerebral circulation time (CCT and create a similar index from baseline CT perfusion (CTP to better predict vasospasm in patients with subarachnoid hemorrhage (SAH.Forty-one SAH patients with available DSA and CTP were retrospectively included. The vasospasm group was comprised of patients with deterioration in conscious functioning and newly developed luminal narrowing; remaining cases were classified as the control group. The angiography CCT (XA-CCT was defined as the difference in TTP (time to peak between the selected arterial ROIs and the superior sagittal sinus (SSS. Four arterial ROIs were selected to generate four corresponding XA-CCTs: the right and left anterior cerebral arteries (XA-CCTRA2 and XA-CCTLA2 and right- and left-middle cerebral arteries (XA-CCTRM2 and XA-CCTLM2. The CCTs from CTP (CT-CCT were defined as the differences in TTP from the corresponding arterial ROIs and the SSS. Correlations of the different CCTs were calculated and diagnostic accuracy in predicting vasospasm was evaluated.Intra-class correlations ranged from 0.96 to 0.98. The correlations of XA-CCTRA2, XA-CCTRM2, XA-CCTLA2, and XA-CCTLM2 with the corresponding CT-CCTs were 0.64, 0.65, 0.53, and 0.68, respectively. All CCTs were significantly prolonged in the vasospasm group (5.8-6.4 s except for XA-CCTLA2. CT-CCTA2 of 5.62 was the optimal cut-off value for detecting vasospasm with a sensitivity of 84.2% and specificity 82.4.CT-CCTs can be used to interpret cerebral flow without deconvolution algorithms, and outperform both MTT and TTP in predicting vasospasm risk. This finding may help facilitate management of patients with SAH.

  20. Cost-effectiveness of counselling, graded-exercise and usual care for chronic fatigue: evidence from a randomised trial in primary care

    Directory of Open Access Journals (Sweden)

    Sabes-Figuera Ramon

    2012-08-01

    Full Text Available Abstract Background Fatigue is common and has been shown to result in high economic costs to society. The aim of this study is to compare the cost-effectiveness of two active therapies, graded-exercise (GET and counselling (COUN with usual care plus a self-help booklet (BUC for people presenting with chronic fatigue. Methods A randomised controlled trial was conducted with participants consulting for fatigue of over three months’ duration recruited from 31 general practices in South East England and allocated to one of three arms. Outcomes and use of services were assessed at 6-month follow-up. The main outcome measure used in the economic evaluation was clinically significant improvements in fatigue, measured using the Chalder fatigue scale. Cost-effectiveness was assessed using the net-benefit approach and cost-effectiveness acceptability curves. Results Full economic and outcome data at six months were available for 163 participants; GET = 51, COUN = 58 and BUC = 54. Those receiving the active therapies (GET and COUN had more contacts with care professionals and therefore higher costs, these differences being statistically significant. COUN was more expensive and less effective than the other two therapies. The incremental cost-effectiveness ratio of GET compared to BUC was equal to £987 per unit of clinically significant improvement. However, there was much uncertainty around this result. Conclusion This study does not provide a clear recommendation about which therapeutic option to adopt, based on efficiency, for patients with chronic fatigue. It suggests that COUN is not cost-effective, but it is unclear whether GET represents value for money compared to BUC. Clinical Trial Registration number at ISRCTN register: 72136156

  1. Bone scintigraphy on chronic hemodialyzed patients

    International Nuclear Information System (INIS)

    Koizumi, Yoshiko

    1990-01-01

    Patients with renal osteodystrophy (ROD) are classified into four types (secondary hyperparathyroidism: HPT, osteomalasia, ectopic calcification and normal bone scintigram type) according to findings of whole body bone scintigrams. Markedly high accumulations of Tc-99m-MDP are seen in the skull, especially in patients with HPT. For a quantitative evaluation of bone mineral dynamics, factor analysis (FA) was performed on bone scintigraphy in 36 patients with ROD and in 17 controls. Four were examined before and after parathyroidectomy (PTX). In the early phase (20 min) of bone scintigraphy, the bone factor was clearly extracted by FA. Two original parameters were calculated, one is bone radionuclide (RN) uptake count (BUC), the product of the total RN uptake count of the head and the contribution ratio, the other is bone RN uptake count ratio (BUR) derived by the time activity curve (physiological component of bone) of FA. Bone factor shown by FA is significantly different among patients with HPT, osteomalasia and controls. The value of BUC in patients with HPT is high compared to findings in the controls. The results of FA of ROD correlate well with planar images of bone scintigrams and with data on bone minerals, measured by quantitative methods such as single photon absorptiometry, CT attenuation number of the frontal bone, RN activity ratio ([frontal bone]/[brain]), using SPECT of bone scan. In the cases of PTX, the value of BUC was improved compared to preoperative data. FA of bone scintigraphy is a sensitive and useful method for quantitative evaluation of bone mineral dynamics and to assess the therapeutic effects in ROD. (author)

  2. Xanthomonas oryzae pv. oryzae TALE proteins recruit OsTFIIAγ1 to compensate for the absence of OsTFIIAγ5 in bacterial blight in rice.

    Science.gov (United States)

    Ma, Wenxiu; Zou, Lifang; Ji, Zhiyuan; Xu, Xiameng; Xu, Zhengyin; Yang, Yangyang; Alfano, James R; Chen, Gongyou

    2018-04-28

    Xanthomonas oryzae pv. oryzae (Xoo), causal agent of bacterial blight (BB) of rice, uses transcription activator-like effectors (TALEs) to interact with the basal transcription factor gama subunit OsTFIIAγ5 (Xa5) and activates transcription of host genes. However, how OsTFIIAγ1, the other OsTFIIAγ protein, functions in the presence of TALEs remains unclear. In this study, we show that OsTFIIAγ1 plays a compensatory role in the absence of Xa5. The expression of OsTFIIAγ1, which is activated by TALE PthXo7, increased the expression of host genes targeted by avirulent and virulent TALEs. Defective OsTFIIAγ1 rice lines showed reduced expression of the TALE-targeted susceptibility (S) genes, OsSWEET11 and OsSWEET14, which resulted in increased BB resistance. Selected TALEs (PthXo1, AvrXa7, and AvrXa27) were evaluated for interactions with OsTFIIAγ1, Xa5 and xa5 (naturally-occurring mutant form of Xa5) using biomolecular fluorescence complementation (BiFC) and microscale thermophoresis (MST). BiFC and MST demonstrated that the three TALEs bind Xa5 and OsTFIIAγ1 with a stronger affinity than xa5. These results provide insight into the complex roles of OsTFIIAγ1 and OsTFIIAγ5 in TALE-mediated host gene transcription. This article is protected by copyright. All rights reserved. © 2018 BSPP and John Wiley & Sons Ltd.

  3. Malaria infectivity of xanthurenic acid-deficient anopheline mosquitoes produced by TALEN-mediated targeted mutagenesis.

    Science.gov (United States)

    Yamamoto, Daisuke S; Sumitani, Megumi; Hatakeyama, Masatsugu; Matsuoka, Hiroyuki

    2018-02-01

    Anopheline mosquitoes are major vectors of malaria parasites. When the gametocytes of the malaria parasite are transferred from a vertebrate to mosquitoes, they differentiate into gametes, and are fertilized in the midguts of mosquitoes. Xanthurenic acid (XA), a waste product of the ommochrome synthesis pathway, has been shown to induce exflagellation during microgametogenesis in vitro; however, it currently remains unclear whether endogenous XA affects the infectivity of anopheline mosquitoes to malaria parasites in vivo due to the lack of appropriate experimental systems such as a XA-deficient line. In the present study, we produced a XA-deficient line in Anopheles stephensi using transcription activator-like effector nuclease (TALEN)-mediated gene targeting (knockout) of the kynurenine 3-monooxygenase (kmo) gene, which encodes an enzyme that participates in the ommochrome synthesis pathway. The knockout of kmo resulted in the absence of XA, and oocyst formation was inhibited in the midguts of these XA-deficient mosquitoes, which, in turn, reduced sporozoite numbers in their salivary glands. These results suggest that endogenous XA stimulates exflagellation, and enhances the infectivity of anopheline mosquitoes to malaria parasites in vivo. The XA-deficient line of the anopheline mosquito provides a useful system for analyzing and understanding the associated factors of malaria gametogenesis in the mosquito midgut.

  4. Vasorelaxing Action of the Kynurenine Metabolite, Xanthurenic Acid: The Missing Link in Endotoxin-Induced Hypotension?

    Directory of Open Access Journals (Sweden)

    Carmine Vecchione

    2017-05-01

    Full Text Available The kynurenine pathway of tryptophan metabolism is activated by pro-inflammatory cytokines. L-kynurenine, an upstream metabolite of the pathway, acts as a putative endothelium-derived relaxing factor, and has been hypothesized to play a causative role in the pathophysiology of inflammation-induced hypotension. Here, we show that xanthurenic acid (XA, the transamination product of 3-hydroxykynurenine, is more efficacious than L-kynurenine in causing relaxation of a resistance artery, but fails to relax pre-contracted aortic rings. In the mesenteric artery, XA enhanced activating phosphorylation of endothelial nitric oxide synthase (NOS, and the relaxing action of XA was abrogated by pharmacological inhibition of NOS and endothelial-derived hyperpolarizing factor. Systemic injection of XA reduced blood pressure in mice, and serum levels of XA increased by several fold in response to a pulse with the endotoxin, lipopolysaccharide (LPS. LPS-induced hypotension in mice was prevented by pre-treatment with the kynurenine monooxygenase (KMO inhibitor, Ro-618048, which lowered serum levels of XA but enhanced serum levels of L-kynurenine. UPF 648, another KMO inhibitor, could also abrogate LPS-induced hypotension. Our data identify XA as a novel vasoactive compound and suggest that formation of XA is a key event in the pathophysiology of inflammation-induced hypotension.

  5. Biomonitoring of the genotoxic effects and oxidative potentials of commercial edible dung beetles (Onitis sp.), grasshopper (Caelifera sp.) and mole crickets (Gryllotalpa sp.) in vitro.

    Science.gov (United States)

    Koc, Kubra; Incekara, Umit; Turkez, Hasan

    2014-09-01

    In this investigation, the genotoxic and oxidative effects of water soluble extracts of dung beetles, flying grasshopper and mole crickets have been assessed on cultured human blood cells. The extracts were added to the culture tubes at 12 different concentrations (0-2000 ppm). Micronucleus test was used to monitor the DNA and the chromosomal damage produced by aqueous extracts in vitro. In addition, to assess the oxidative effects, total antioxidant capacity (TAC) and total oxidant status (TOS) levels were also measured. Our results indicated that these extracts did not show genotoxic effects at the tested concentrations. However, the extracts caused dose-dependent alterations in both TAC and TOS levels. Based on the findings, it was concluded that the studied insects can be consumed safely, but it is necessary to consider the cellular damages which are likely to appear depending on oxidative stress at higher concentrations. It has also been suggested that this in vitro approach for oxidative and genotoxicity assessments may be useful to evaluate the potential health risks of edible insects. © The Author(s) 2014.

  6. Etika Jual Beli Kotoran Sapi dalam Pandangan Islam di Desa Pandanarum Kecamatan Tempeh Lumajang

    Directory of Open Access Journals (Sweden)

    Maisyarofah Maisyarofah

    2017-10-01

    Full Text Available Islam is the only perfect religion that governs all human life and the universe including human economic activities are also regulated in Islam with the Divine principle. In the world of business, in Indonesia there is often a sale and purchase of dirt, while animal waste is basically a dirty object that is not desirable, but with the advancement of science and technology, it turns out that animal dung has many benefits. Based on the above facts, the author wants to examine and discuss and know the problem and then compiled it into a scientific work entitled: "ethics of buying cow dung in the Islamic view in the Village Pandanarum Kecamtan Tempeh" This research uses Descriptive Qualitative Method, with case study approach. Techniques of collecting data using interviews, observation and documentation. The data analysis using field descriptive analysis. The conclusion of the research is: 1 The results of the research that the author did in the ethics of buying and selling cow dung that is happening in the Village pandanarum, do not apply the ethics of buying cow dung karna in this case there are still people who sell sell cattle dung. 2 The sale and purchase of cow dung in the view of Islam is in accordance with Islamic Shari'ah because in this case the community has granted or menysugahkan cow dung 3 Ethical sale of cow dung in the view of Islam in the Village Pandanraum kecamtan Tempeh not apply the ethics of buying and selling cow dung because in this case masyarakt still do not know about the ethics in accordance with the teachings of Islam.   Keywords: ethics of buying and selling, cow dung, Islamic views.

  7. Evaluation of Lagergren Kinetics Equation by Using Novel Kinetics Expression of Sorption of Zn2+ onto Horse Dung Humic Acid (HD-HA

    Directory of Open Access Journals (Sweden)

    Bambang Rusdiarso

    2016-12-01

    Full Text Available Extraction and purification of humic acid from dry horse dung powder (HD-HA was performed successfully and the purified HD-HA was then applied as sorbent to adsorb Zn2+. Extraction and purification were performed based on procedure of Stevenson (1994 under atmospheric air. Parameters investigated in this work consist of effect of medium sorption acidity, sorption rate (ka and desorption rate constant (kd, Langmuir (monolayer and Freundlich (multilayer sorption capacities, and energy (E of sorption. The ka and kd were determined according to the kinetic model of second order sorption reaching equilibrium, monolayer sorption capacity (b and energy (E were determined according to Langmuir isotherm model, and multilayer sorption capacity (B was determined based on Freundlich isotherm model. Sorption of Zn2+ on purified HD-HA was maximum at pH 5.0. The novel kinetic expression resulted from proposed kinetic model has been shown to be more applicable than the commonly known Lagergren equation obtained from the pseudo-first order sorption model. The application of the equation revealed that the intercept of Lagergren equation, ln qe was more complex function of initial concentration of Zn2+ (a, Langmuir sorption capacity (b, and sorbed Zn2+ at equilibrium (xe.

  8. Metabolite profiles of rice cultivars containing bacterial blight-resistant genes are distinctive from susceptible rice

    Institute of Scientific and Technical Information of China (English)

    Jiao Wu; Haichuan Yu; Haofu Dai; Wenli Mei; Xin Huang; Shuifang Zhu; Ming Peng

    2012-01-01

    The metabolic changes of bacterial blight-resistant line C418/Xa23 generated by molecular marker-assisted selection (n =12),transgenic variety C418-Xa21 generated by using the Agrobacterium-mediated system (n =12),and progenitor cultivar C418 (n =12) were monitored using gas chromatography/mass spectrometry.The validation,discrimination,and establishment of correlative relationships between metabolite signals were performed by cluster analysis,principal component analysis,and partial least squares-discriminant analysis.Significant and unintended changes were observed in 154 components in C418/Xa23 and 48 components in C418-Xa21 compared with C418 (P < 0.05,Fold change > 2.0).The most significant decreases detected (P< 0.001) in both C418/Xa23 and C418-Xa21 were in three amino acids: glycine,tyrosine,and alanine,and four identified metabolites: malic acid,ferulic acid,succinic acid,and glycerol.Linoleic acid was increased specifically in C418/Xa23 which was derived from traditional breeding.This line,possessing a distinctive metabolite profile as a positive control,shows more differences vs.the parental than the transgenic line.Only succinic acid that falls outside the boundaries of natural variability between the two non-transgenic varieties C418 and C418/Xa23 should be further investigated with respect to safety or nutritional impact.

  9. (Biodegradable Ionomeric Polyurethanes Based on Xanthan: Synthesis, Properties, and Structure

    Directory of Open Access Journals (Sweden)

    T. V. Travinskaya

    2017-01-01

    Full Text Available New (biodegradable environmentally friendly film-forming ionomeric polyurethanes (IPU based on renewable biotechnological polysaccharide xanthan (Xa have been obtained. The influence of the component composition on the colloidal-chemical and physic-mechanical properties of IPU/Xa and based films, as well as the change of their properties under the influence of environmental factors, have been studied. The results of IR-, PMS-, DMA-, and X-ray scattering study indicate that incorporation of Xa into the polyurethane chain initiates the formation of a new polymer structure different from the structure of the pure IPU (matrix: an amorphous polymer-polymer microdomain has occurred as a result of the chemical interaction of Xa and IPU. It predetermines the degradation of the IPU/Xa films as a whole, unlike the mixed polymer systems, and plays a key role in the improvement of material performance. The results of acid, alkaline hydrolysis, and incubation into the soil indicate the increase of the intensity of degradation processes occurring in the IPU/Xa in comparison with the pure IPU. It has been shown that the introduction of Xa not only imparts the biodegradability property to polyurethane, but also improves the mechanical properties.

  10. Changes in food resources and conservation of scarab beetles

    DEFF Research Database (Denmark)

    Carpaneto, Giuseppe Maria; Mazziotta, Adriano; Piattella, Emanuele

    2005-01-01

    to dog dung, an impoverishment of the total richness was observed (from 19 to 9 species) together with an increase of individuals (by 7 times). Dog dung harboured 20% of the current scarab dung beetle fauna of Rome, probably as a consequence of the dog mixed diet, rich in cellulose. Both the communities...... showed a high percentage of tunnellers, probably because of the food shortage and, for dog scats, of the high dehydration rate. A comparison with other Roman scarab communities enhanced that: (1) the change in food resource determined a higher difference in species composition respect to other parameters......The aim of the research was to show how a change in land use influences the structure of a dung beetle assemblage and affect its conservation. In the Pineto Urban Regional Park (Rome), dog dung is the sole food resource currently available for scarab dung beetles, after the recent removal of wild...

  11. Avaliação comparativa das propriedades de xantanas produzidas pelo patovar pruni e clairana com xantana comercial para predição de uso Comparative evaluation of xanthans properties produced by pathovar pruni and clairana with commercial xanthan to predict their uses

    Directory of Open Access Journals (Sweden)

    Patrícia D. Oliveira

    2013-01-01

    Full Text Available O presente trabalho teve como objetivo determinar a adequabilidade de três amostras de biopolímero xantana (Xa 06, Xa 82 e Xa 106 e uma clairana como viscosificantes de fluidos de perfuração de poços de petróleo, comparando com uma amostra de xantana comercial, Xanvis®. Foram realizadas análises reológicas, determinados os conteúdos de acetil, piruvato e íons Na+ K+ e Ca2+, e avaliada a capacidade viscosificante segundo norma específica da Petrobras. Os conteúdos de grupos acetil e piruvato para as xantanas e clairana diferiram significativamente entre si, mas foram compatíveis com valores preconizados ou citados na literatura concernente. Com relação ao conteúdo de íons, a xantana comercial apresentou quantidade de cálcio superior, as amostras Xa 06, Xa 82 e Xa 106 tiveram maior teor de potássio e a clairana maior teor de sódio. A viscosidade e a viscoelasticidade da amostra de xantana comercial foram superiores às demais amostras analisadas. Na análise como viscosificante para fluidos de perfuração as amostras de xantana comercial e Xa 106 atingiram os requisitos estabelecidos para os parâmetros n, K e força gel da norma Petrobras N-2605. Com a interpretação conjunta dos resultados obtidos pode-se inferir que apenas as xantanas Xanvis® e Xa 106 apresentam características adequadas à utilização como viscosificante em fluido de perfuração de petróleo. As demais amostras possuem características reológicas adequadas à utilização como espessantes ou estabilizantes em outros segmentos industriais, como em alimentos, tintas e cosméticos.The aim of this study was to determine the suitability of three xanthans (Xa 06, Xa 82 and Xa 106 and a clairana biopolymer for use as drilling fluid thickeners and comparing them against a commercial sample, Xanvis®. Rheological analyses were performed to determine the acetyl, pyruvate and Na+ K+ and Ca2+ ion content and their thickening ability, according to Petrobras

  12. Comparative evaluation of direct thrombin and factor Xa inhibitors with antiplatelet agents under flow and static conditions: an in vitro flow chamber model.

    Directory of Open Access Journals (Sweden)

    Kazuya Hosokawa

    Full Text Available Dabigatran and rivaroxaban are novel oral anticoagulants that specifically inhibit thrombin and factor Xa, respectively. The aim of this study is to elucidate antithrombotic properties of these anticoagulant agents under arterial and venous shear conditions. Whole blood samples treated with dabigatran or rivaroxaban at 250, 500, and 1000 nM, with/without aspirin and AR-C66096, a P2Y12 antagonist, were perfused over a microchip coated with collagen and tissue thromboplastin at shear rates of 240 and 600 s(-1. Fibrin-rich platelet thrombus formation was quantified by monitoring flow pressure changes. Dabigatran at higher concentrations (500 and 1000 nM potently inhibited thrombus formation at both shear rates, whereas 1000 nM of rivaroxaban delayed, but did not completely inhibit, thrombus formation. Dual antiplatelet agents weakly suppressed thrombus formation at both shear rates, but intensified the anticoagulant effects of dabigatran and rivaroxaban. The anticoagulant effects of dabigatran and rivaroxaban were also evaluated under static conditions using thrombin generation (TG assay. In platelet-poor plasma, dabigatran at 250 and 500 nM efficiently prolonged the lag time (LT and moderately reduce peak height (PH of TG, whereas rivaroxaban at 250 nM efficiently prolonged LT and reduced PH of TG. In platelet-rich plasma, however, both anticoagulants efficiently delayed LT and reduced PH of TG. Our results suggest that dabigatran and rivaroxaban may exert distinct antithrombotic effects under flow conditions, particularly in combination with dual antiplatelet therapy.

  13. How China Wins: A Case Study of the 1979 Sino-Vietnamese War

    Science.gov (United States)

    2015-06-12

    better to smell the dung of the French than to eat Chinese dung all one’s life. ―Ho Chi Minh, Quoted in Jean Sainteny, Ho Chi Minh and His Vietnam...Minh, resentful of China’s betrayal at the victor’s table said, “Far better to smell the dung of the French than to eat Chinese dung all one’s life... dinner that included an informal meeting with former President Richard Nixon, followed by a night of entertainment at the Kennedy Center. The next

  14. Abnormal X : autosome ratio, but normal X chromosome inactivation in human triploid cultures

    Directory of Open Access Journals (Sweden)

    Norwood Thomas H

    2006-07-01

    Full Text Available Abstract Background X chromosome inactivation (XCI is that aspect of mammalian dosage compensation that brings about equivalence of X-linked gene expression between females and males by inactivating one of the two X chromosomes (Xi in normal female cells, leaving them with a single active X (Xa as in male cells. In cells with more than two X's, but a diploid autosomal complement, all X's but one, Xa, are inactivated. This phenomenon is commonly thought to suggest 1 that normal development requires a ratio of one Xa per diploid autosomal set, and 2 that an early event in XCI is the marking of one X to be active, with remaining X's becoming inactivated by default. Results Triploids provide a test of these ideas because the ratio of one Xa per diploid autosomal set cannot be achieved, yet this abnormal ratio should not necessarily affect the one-Xa choice mechanism for XCI. Previous studies of XCI patterns in murine triploids support the single-Xa model, but human triploids mostly have two-Xa cells, whether they are XXX or XXY. The XCI patterns we observe in fibroblast cultures from different XXX human triploids suggest that the two-Xa pattern of XCI is selected for, and may have resulted from rare segregation errors or Xi reactivation. Conclusion The initial X inactivation pattern in human triploids, therefore, is likely to resemble the pattern that predominates in murine triploids, i.e., a single Xa, with the remaining X's inactive. Furthermore, our studies of XIST RNA accumulation and promoter methylation suggest that the basic features of XCI are normal in triploids despite the abnormal X:autosome ratio.

  15. Pathways to Adolescent Substance Use among Sexually Abused Girls.

    Science.gov (United States)

    Bailey, Jennifer A.; McCloskey, Laura Ann

    2005-01-01

    This study examined the link between childhood sexual abuse and adolescent substance use among girls, and evaluated depressive self-concept and behavioral under-control (BUC) as pathways to substance use for sexually abused girls. Participants (n = 150) were drawn from a longitudinal study of the impact of domestic violence on the lives of women…

  16. Influence of tungsten microstructure and ion flux on deuterium plasma-induced surface modifications and deuterium retention

    NARCIS (Netherlands)

    Buzi, L.; De Temmerman, G.; Unterberg, B.; M. Reinhart,; Dittmar, T.; Matveev, D.; Linsmeier, C.; Breuer, U.; Kreter, A.; Van Oost, G.

    2015-01-01

    The influence of surface temperature, particle flux density and material microstructure on the surface morphology and deuterium retention was studied by exposing tungsten targets (20&#xa0;μm and 40&#xa0;μm grain size) to deuterium plasma at the same particle fluence (1026&#xa0;m−2) and

  17. Sp. Radicis-Lycopersici Using Mixture of Vegetable and Posidonia oceanica Compost

    Directory of Open Access Journals (Sweden)

    S. Kouki

    2012-01-01

    Full Text Available A compost of vegetable waste and Posidonia oceanica mixture (70 : 30% vol : vol was tested in vitro and in vivo for its efficacy against Fusarium oxysporum f.sp radicis-lycopersici (Forl, the causal agent of Fusarium wilt of Tomato (Lycopersicon esculentum cv. chourouk.The incorporation of non-sterilized VPC in the culture medium showed potent antifungal activity against Forl and complete inhibition of mycelium growth was observed for all the tested compost rates (0.5, 1, 2, 4, 6, 8, 10, 15 and 20%. However, only the highest rates (15 and 20% of a sterilized suspension of VPC were effective in preventing mycelial growth. Nine indigenous bacterial strains isolated from VPC exhibited antagonism against Forl. Based on 16S rDNA sequence analysis, the isolates were assigned to Bacillus sphaericus (B12 and BS2, Pseudomonas putida PPS7 and Burkholderia gladioli BuC16. Under green house condition, seed inoculation by B12, BS2, PP7 and BuC16 strains protected significantly tomato against Fusarium oxysporum f.sp radicis-lycopersici (Forl attacks.

  18. Pump out the volume--The effect of tracheal and subelytral pressure pulses on convective gas exchange in a dung beetle, Circellium bacchus (Fabricus).

    Science.gov (United States)

    Duncan, Frances D; Förster, Thomas D; Hetz, Stefan K

    2010-05-01

    Many flightless beetles like the large apterous dung beetle Circellium bacchus, possess a subelytral cavity (SEC) providing an extra air space below the elytra which connects to the tracheal system (TS) via metathoracic and abdominal spiracles. By measuring subelytral and intratracheal pressure as well as body movements and gas exchange simultaneously in a flow-through setup, we investigated the contribution of convection on Circellium respiratory gas exchange. No constriction phase was observed. TS and SEC pressures were always around atmospheric values. During interburst phase open abdominal spiracles and a leaky SEC led to small CO(2)-peaks on a continuous CO(2) baseline, driven by intermittent positive tracheal pressure peaks in anti-phase with small negative subelytral pressure peaks caused by dorso-ventral tergite action. Spiracle opening was accompanied by two types of body movements. Higher frequency telescoping body movements at the beginning of opening resulted in high amplitude SEC and TS pressure peaks. High frequency tergite movements caused subelytral pressure peaks and led to a saw tooth like CO(2) release pattern in a burst. We propose that during the burst open mesothoracic spiracles increase the compliance of the subelytral cavity allowing big volumes of tracheal air being pulled out by convection. Copyright 2009 Elsevier Ltd. All rights reserved.

  19. Hepatoprotective Effects of Chinese Medicine Herbs Decoction on Liver Cirrhosis in Rats

    Directory of Open Access Journals (Sweden)

    Nor Aziyah Mat-Rahim

    2017-01-01

    Full Text Available Hepatoprotective and curative activities of aqueous extract of decoction containing 10 Chinese medicinal herbs (HPE-XA-08 were evaluated in Sprague–Dawley albino rats with liver damage induced by thioacetamide (TAA. These activities were assessed by investigating the liver enzymes level and also histopathology investigation. Increases in alkaline phosphatase (ALP and gamma-glutamyl transferase (GGT levels were observed in rats with cirrhotic liver. No significant alterations of the liver enzymes were observed following treatment with HPE-XA-08. Histopathology examination of rats treated with HPE-XA-08 at 250 mg/kg body weight, however, exhibited moderate liver protective effects. Reduced extracellular matrix (ECM proteins within the hepatocytes were noted in comparison to the cirrhotic liver. The curative effects of HPE-XA-08 were observed with marked decrease in the level of ALP (more than 3x and level of GGT (more than 2x in cirrhotic rat treated with 600 mg/kg body weight HPE-XA-08 in comparison to cirrhotic rat treated with just water diluent. Reversion of cirrhotic liver to normal liver condition in rats treated with HPE-XA-08 was observed. Results from the present study suggest that HPE-XA-08 treatment assisted in the protection from liver cirrhosis and improved the recovery of cirrhotic liver.

  20. Qualitative and quantitative analysis of biogas generated from co-digestion of cow dung, municipal sewage and kitchen waste

    Directory of Open Access Journals (Sweden)

    M Mahmoodi-Eshkaftaki

    2017-05-01

    Full Text Available Introduction As reported by Sabetghadam (2005, 53.4, 36.3, 1.1, 8.9, and 0.2% of total energy consumption in Iran consisted of oil products, natural gas, coal, electricity energy, and modern energy sources, respectively. The modern energies included solar, biomass, wind and nuclear. The energy mix has been evolving towards clean energies. From 1966–2005, the contribution of natural gas increased from 1.3% to 36.3% and the contribution of electricity was doubled from 4.1% to 8.9%. The share of oil products in domestic consumption has dropped from 84.3% to 53.4%. Iran has abundant renewable energy resources, including solar energy, wind power, geothermal energy, and biomass, as well as the ability to manufacture the relatively labor-intensive systems that harness these. By developing such energy sources developing countries can reduce their dependence on oil and natural gas, creating energy portfolios that are less vulnerable to price rises. In many circumstances, these investments can be less expensive than fossil fuel energy systems. Over the past ten years some researches on solar and biomass energy have resulted in development and the establishment of a few small- and medium-scale electricity generation plants, powered via solar and biomass energy. There has also been the development of digesters to increase biogas production. Renewable energy is new to Iran and there is a long way to go. Except for the few afore mentioned projects, small-scale technologies to bring power to remote villages have a better chance of being adopted than those implemented at the national level. Materials and Methods In this research the amount of generated methane (methane content of biogas % from co-digestion of municipal sewage, kitchen waste, and cow dung was measured in 7 different combinations (treatment. Two important parameters affecting methane production such as volatile solid (VS and total solid (TS were measured according to Method 1684 and CEN

  1. Cross System Extensions (CSE) experience

    International Nuclear Information System (INIS)

    Johnston, T.Y.

    1990-08-01

    Cross System Extension (CSE) provides VM/XA systems with the ability to share minidisks and spool in loosely coupled environment. CSE will also cooperate with the VM/HPO Inter System Facility (ISF) in sharing minidisks between VM/XA and VM/HPO to XA, reliability of CSE, and some operational considerations when running with it

  2. Effect of mixing digested slurry on the rate of biogas production from dairy manure in batch fermenter

    Energy Technology Data Exchange (ETDEWEB)

    Kalia, A.K.; Singh, S.P.

    2001-09-01

    Forty kilograms of pure cattle dung and cattle dung mixed with 10% digested slurry obtained from a field biogas plant was batch fermented in horizontal biogas digesters for 15 weeks under field conditions with mean ambient temperature 20-23{sup o}C. Compared to 821 l of biogas from digester I, containing cattle dung alone, 1457 l of biogas was obtained from digester II, containing cattle dung mixed with 10% digested slurry. Mixing of slurry not only speeded up the gas production but also enhanced its rate from 108 l/kg dry matter to 158 l/kg dry matter. It also resulted in 36.1% distraction of total volatile solid in digester II, compared to 23.93% observed in digester I. Mixing digested slurry is recommended for raising biogas production from cattle dung in dry fermenters. (author)

  3. Evidence for a saturable mechanism of disappearance of standard heparin in rabbits

    International Nuclear Information System (INIS)

    Boneu, B.; Caranobe, C.; Gabaig, A.M.; Dupouy, D.; Sie, P.; Buchanan, M.R.; Hirsh, J.

    1987-01-01

    This work demonstrates that after bolus intravenous injection standard heparin (SH) disappearance results from the combination of a saturable and a non saturable mechanism. Pharmacokinetics and pharmacodynamics of SH were studied by measuring the disappearance of increasing doses (5 - 500 anti-factor Xa U/kg) of 125 I-heparin and of its biological effects. CPM curves allowed the determination of the half lives of heparin according to the dose injected. The half lives were clearly dose dependent and reached a plateau over 100 anti-factor Xa U/kg. The complex curve which describes the amount of heparin cleared per time unit after any given dose has been resolved into its two components reflecting a saturable and a non saturable mechanism of disappearance. For the doses less than 100 anti-factor Xa U/kg the saturable mechanism was preeminent and the anti-factor Xa activity disappearance followed an exponential pattern; for the doses less than 100 anti-factor Xa U/kg the contribution of the non saturable mechanism becomes more important and the anti-factor Xa activity disappearance followed a concave-convex pattern. Further experiments showed that the heparin half life shortened as the circulating anti-factor Xa activity decreased; this phenomenon may explain the concave-convex pattern of the curve of the anticoagulant effect observed after injection of large doses of SH

  4. Alternative dosing of prophylactic enoxaparin in the trauma patient: is more the answer?

    Science.gov (United States)

    Kopelman, Tammy R; O'Neill, Patrick J; Pieri, Paola G; Salomone, Jeffrey P; Hall, Scott T; Quan, Asia; Wells, Jordan R; Pressman, Melissa S

    2013-12-01

    Inadequate anti-factor Xa levels and increased venous thromboembolic events occur in trauma patients receiving standard prophylactic enoxaparin dosing. The aim of this study was to test the hypothesis that higher dosing (40 mg twice daily) would improve peak anti-Xa levels and decrease venous thromboembolism. A retrospective review was performed of trauma patients who received prophylactic enoxaparin and peak anti-Xa levels over 27 months. Patients were divided on the basis of dose: group A received 30 mg twice daily, and group B received 40 mg twice daily. Demographics and rates of venous thromboembolism were compared between dose groups and patients with inadequate or adequate anti-Xa levels. One hundred twenty-four patients were included, 90 in group A and 34 in group B. Demographics were similar, except that patients in group B had a higher mean body weight. Despite this, only 9% of group B patients had inadequate anti-Xa levels, compared with 33% of those in group A (P = .01). Imaging studies were available in 69 patients and revealed 8 venous thromboembolic events (P = NS, group A vs group B) with significantly more venous thromboembolic events occurring in patients with low anti-Xa levels (P = .02). Although higher dosing of enoxaparin led to improved anti-Xa levels, this did not equate to a statistical decrease in venous thromboembolism. Copyright © 2013 Elsevier Inc. All rights reserved.

  5. Enhancing the understanding of earthworm feeding behaviour via the use of fatty acid delta13C values determined by gas chromatography-combustion-isotope ratio mass spectrometry.

    Science.gov (United States)

    Dungait, Jennifer A J; Briones, Maria J I; Bol, Roland; Evershed, Richard P

    2008-06-01

    Litter-dwelling (epigeic) Lumbricus rubellus and soil-dwelling (endogeic) Allolobophora chlorotica earthworms were observed aggregating under C(3) (delta(13)C = -31.3 per thousand; delta(15)N = 10.7 per thousand) and C(4) (delta(13)C = -12.6 per thousand; delta(15)N = 7.5 per thousand) synthetic dung pats applied to a temperate grassland (delta(13)C = -30.3 per thousand; delta(15)N = 5.7 per thousand) in an experiment carried out for 372 days. Bulk delta(13)C values of earthworms collected from beneath either C(3) or C(4) dung after 28, 56, 112 and 372 days demonstrated that (i) L. rubellus beneath C(4) dung were significantly (13)C-enriched after 56 days (delta(13)C = -23.8 per thousand) and 112 days (delta(13)C = -22.4 per thousand) compared with those from C(3) dung treatments (56 days, delta(13)C = -26.5 per thousand; 112 days, delta(13)C = -27.0 per thousand), and (ii) A. chlorotica were 2.1 per thousand (13)C-enriched (delta(13)C = -24.2 per thousand) relative to those from C(3) dung (delta(13)C = -26.3 per thousand) treatments after 372 days. Bulk delta(15)N values did not suggest significant uptake of dung N by either species beneath C(3) or C(4) dung, but showed that the endogeic species (total mean delta(15)N = 3.3 per thousand) had higher delta(15)N values than the epigeic species (total mean delta(15)N = 5.4 per thousand). Although the two species exhibited similar fatty acid profiles, individual fatty acid delta(13)C values revealed extensive routing of dietary C into body tissue of L. rubellus, but minor incorporation into A. chlorotica. In particular, the direct incorporation of microbial biomarker fatty acids (iC(17:0), aC(17:0)) from (13)C-labelled dung in situ, the routing of dung C into de novo synthesised compounds (iC(20:4)(omega)(6),C(20:5)(omega)(3), and the assimilation of essential fatty acids ((C(18:1)(omega)(9), C(18:1)(omega(7), C(18:2)(omega(6), C(18:3)(omega)(3)) derived from dung, were determined. John Wiley & Sons, Ltd

  6. Overexpression of Rice Auxilin-Like Protein, XB21, Induces Necrotic Lesions, up-Regulates Endocytosis-Related Genes, and Confers Enhanced Resistance to Xanthomonas oryzae pv. oryzae.

    Science.gov (United States)

    Park, Chang-Jin; Wei, Tong; Sharma, Rita; Ronald, Pamela C

    2017-12-01

    The rice immune receptor XA21 confers resistance to the bacterial pathogen, Xanthomonas oryzae pv. oryzae (Xoo). To elucidate the mechanism of XA21-mediated immunity, we previously performed a yeast two-hybrid screening for XA21 interactors and identified XA21 binding protein 21 (XB21). Here, we report that XB21 is an auxilin-like protein predicted to function in clathrin-mediated endocytosis. We demonstrate an XA21/XB21 in vivo interaction using co-immunoprecipitation in rice. Overexpression of XB21 in rice variety Kitaake and a Kitaake transgenic line expressing XA21 confers a necrotic lesion phenotype and enhances resistance to Xoo. RNA sequencing reveals that XB21 overexpression results in the differential expression of 8735 genes (4939 genes up- and 3846 genes down-regulated) (≥2-folds, FDR ≤0.01). The up-regulated genes include those predicted to be involved in 'cell death' and 'vesicle-mediated transport'. These results indicate that XB21 plays a role in the plant immune response and in regulation of cell death. The up-regulation of genes controlling 'vesicle-mediated transport' in XB21 overexpression lines is consistent with a functional role for XB21 as an auxilin.

  7. Cytological diagnosis of xanthogranulomatous appendicitis

    Directory of Open Access Journals (Sweden)

    Rajni Kaushik

    2017-01-01

    Full Text Available Xanthogranulomatous reaction can occur in any organ but the most common sites are kidney and gallbladder. Xanthogranulomatous appendicitis (XA is a rare clinical entity. There are a few case reports of XA diagnosed on histopathology but none on cytology. Here we report a case of a 47-year-old lady who presented with acute abdomen and was found to have a mass lesion in the right iliac fossa. She was diagnosed with XA intraoperatively on imprint cytology that was subsequently confirmed on histopathological examination. Due to the rarity of XA itself and the use of imprint cytology for intraoperative diagnosis the case is being presented.

  8. Los antípodas de la Bucólica VI

    Directory of Open Access Journals (Sweden)

    Rubén Florio

    1989-12-01

    Full Text Available This paper tries to prove the subtle relationship between the prologue and the epilogue in Virgil’s Sixth Bucolic. Each of those parts —in different but complementary ways— manifests leading ideas of Virgil’s poetical ideology, and the spirit of a traditional artistic conception.

  9. Bounding approach in BUC implementation in pool at WWER-440

    International Nuclear Information System (INIS)

    Havluj, F.

    2006-01-01

    As new fuel designs (with higher enrichment) are introduced, spent fuel storage facilities might not fulfill criticality safety criteria when using fresh fuel approach to the criticality analyses. Since optimum moderation conditions evaluation even in wet storage systems is required by some regulatory bodies, any credit for soluble boron cannot be taken. Thus, the only suitable way to prove subcriticality of the given spent fuel system with higher enriched/burnt fuel is burnup credit implementation. This paper outlines burnup credit implementation methodology as demonstrated on criticality evaluation of WWER-440 reactor pool at NPP Dukovany. Operational history effects, isotopic set choice, as well as computational issues (SCALE 4.4a was used both for depletion and criticality calculations) are discussed, maintaining strictly conservative approach. Bounding approach in operational history treatment was carefully examined. Criticality evaluation using selection of (as expected) conservative values of operational parameters (specific power, fuel and moderator temperatures, boron content in moderator,..) was compared to criticality evaluation of real fuel assemblies from the NPP database. Therefore, bounding approach was justified and it was shown that it is not excessively conservative. Presented methodology can be applied on any similar spent fuel facility. Suggestions for future research are noted (mainly end-effect evaluation and consideration of profiled fuel) and urgent need of validation of depletion codes for WWER systems is emphasized (Authors)

  10. Nepal Ambient Monitoring and Source Testing Experiment (NAMaSTE): Emissions of particulate matter from wood and dung cooking fires, brick kilns, generators, trash and crop residue burning

    Science.gov (United States)

    Stone, Elizabeth; Jayarathne, Thilina; Stockwell, Chelsea; Christian, Ted; Bhave, Prakash; Siva Praveen, Puppala; Panday, Arnico; Adhikari, Sagar; Maharjan, Rashmi; Goetz, Doug; DeCarlo, Peter; Saikawa, Eri; Yokelson, Robert

    2016-04-01

    The Nepal Ambient Monitoring and Source Testing Experiment (NAMASTE) field campaign targeted the in situ characterization of widespread and under-sampled combustion sources. In Kathmandu and the Terai, southern Nepal's flat plains, samples of fine particulate matter (PM2.5) were collected from wood and dung cooking fires (n = 22), generators (n = 2), groundwater pumps (n = 2), clamp kilns (n = 3), zig-zag kilns (n = 3), trash burning (n = 4), one heating fire, and one crop residue fire. Co-located measurements of carbon dioxide, carbon monoxide, and volatile organic compounds allowed for the application of the carbon mass balance approach to estimate emission factors for PM2.5, elemental carbon, organic carbon, and water-soluble inorganic ions. Organic matter was chemically speciated using gas chromatography - mass spectrometry for polycyclic aromatic hydrocarbons, sterols, n-alkanes, hopanes, steranes, and levoglucosan, which accounted for 2-8% of the measured organic carbon. These data were used to develop molecular-marker based profiles for use in source apportionment modeling. This study provides quantitative emission factors for particulate matter and its constituents for many important combustion sources in Nepal and South Asia.

  11. Response of Coprophagus Beetles (Coleoptera: Scarabaeidae on changes of vegetation structure in various habitat types at Lore Lindu National Park, Central Sulawesi

    Directory of Open Access Journals (Sweden)

    CHRISTIAN H. SCHULZE

    2007-01-01

    Full Text Available This study analysed the response of dung beetles − a group of beetles which play a major role in decomposition of dung and animal carcasses − to changes of vegetation structure due to forest conversion to different human-made habitat types at the margin of Lore Lindu National Park. Therefore, dung beetles were sampled at natural forest, cacao agroforestry systems and open area. A total of 28 species of coprophagus beetle species were recorded from the sampled sites. Species richness and abundance of dung beetles, particularly of large species, decreased from forest towards agroforestry systems and open areas. However, more than 80 % of the species recorded in natural forest were found in cacao agroforestry systems Of the measured habitat parameters, particularly the number of tree species, air temperature, and canopy cover had a significant power for explaining changes in dung beetle ensembles along the gradient of land-use intensity.

  12. Effect of MCM09, an active site-directed inhibitor of factor Xa, on B16-BL6 melanoma lung colonies in mice.

    Science.gov (United States)

    Rossi, C; Hess, S; Eckl, R W; di Lena, A; Bruno, A; Thomas, O; Poggi, A

    2006-03-01

    Treatment with anticoagulant drugs has shown potential inhibitory effect on tumor invasion, although the relationship with clotting inhibition was not clear. The aim of our study was to evaluate the potential antitumor activity of MCM09, a newly developed, active site-directed, small molecule inhibitor of factor Xa (FXa) [WO0216312], and to relate the findings to anticlotting potency. MCM09 (0.1-10 mg kg(-1)) or heparin (H; 10 mg kg(-1)) was injected intravenously (i.v.), with 5 x 10(4) B16-BL6 melanoma cells, in C57BL/6 mice. Mice were killed after 18 days, to count lung colonies. Ex vivo anticoagulant activity was measured by activated partial thromboplastin time (APTT) on mouse plasma. MCM09, a selective inhibitor of FXa (IC-50 = 2.4 nm against human FXa), inhibited in a dose-dependent manner B16-BL6 melanoma lung colonies in mice. Mean lung metastasis number was 20.9 +/- 4.8 in controls (n = 10), 1.2 +/- 0.4 in mice treated with H, 10 mg kg(-1) i.v. (P < 0.01), 0.9 +/- 0.3, 9.2 +/- 2.2 and 15.5 +/- 2.6 in mice treated with MCM09, at 10 (P < 0.01), 1 (P < 0.05) and 0.1 mg kg(-1) i.v. (ns), respectively. MCM09 (10 mg kg(-1) i.v.) significantly prolonged APTT (57.1 +/- 10.2 s) 30 min after i.v. injection when compared with controls (25.3 +/- 1.6 s; P < 0.05). Lung colonies were 74.2-72.6% reduced by MCM09 (10 mg kg(-1)) given 60 or 120 min before cells, but not by MCM09 given 60 min thereafter, suggesting a direct cell interaction as a mechanism underlying antitumor activity.

  13. EFFECT OF VERMIWASH OF DIFFERENT VERMICOMPOSTS ON THE KHARIF CROPS

    Directory of Open Access Journals (Sweden)

    GORAKH NATH

    2012-06-01

    Full Text Available Use of vermiwash extracted from vermicomposts of different combination of animal agro and kitchen wastes, is one of the effective liquid biofertilizer for growth and productivity of crops. The present study assesses that it has caused significant effect on the growth and productivity of paddy (Oryza sativa, maize (Zea mays and millet (Penisetum typhoides crops. The 10mg/m2 of vermiwash buffalo dung with straw shows significant growth (89.2±2.7cm and 30mg/m2 concentration of similar combination shows highly significant growth in paddy crops(102.6±2.3cm after 75 days. The 10mg/m2concentration of combination horse dung with gram bran caused significant growth (85.2±4.3cm 50days while at the same time 30mg/m2concentration of combination of straw with buffalo dung and horse dung caused highly significant growth in maize crops. The combinations of buffalo dung with gram bran and with straw; and combination of horse dung with gram bran and with straw have significant growth in millet crops. All the concentrations of different combinations of animal agro and kitchen wastes have significant early start in flowering and enhance the productivity of crops.

  14. Effect of ferrous chloride on biogas production and enzymatic activities during anaerobic fermentation of cow dung and Phragmites straw.

    Science.gov (United States)

    Zhang, Huayong; Tian, Yonglan; Wang, Lijun; Mi, Xueyue; Chai, Yang

    2016-06-01

    The effect of ferrous (added as FeCl2) on the anaerobic co-digestion of Phragmites straw and cow dung was studied by investigating the biogas properties, pH values, organic matter degradation (COD) and enzyme activities (cellulase, protease and dehydrogenase) at different stages of mesophilic fermentation. The results showed that Fe(2+) addition increased the cumulative biogas yields by 18.1 % by extending the peak period with high daily biogas yields. Meanwhile, the methane (CH4) contents in the Fe(2+) added groups were generally higher than the control group before the 15th day. The pH values were not significantly impacted by Fe(2+) concentrations during the fermentation process. The COD concentrations, cellulase, protease and dehydrogenase activities varied with the added Fe(2+) concentrations and the stages of the fermentation process. At the beginning stage of fermentation (4th day), Fe(2+) addition increased the biogas production by improving the cellulase and dehydrogenase activities which caused a decline in COD. At the peak stage of fermentation (8th day), Fe(2+) addition enhanced the cellulase and protease activities, and resulted in lower COD contents than the control group. When the biogas yields decreased again (13th day), the COD contents varied similar with the protease and dehydrogenase activities, whilst cellulase activities were not sensitive to Fe(2+) concentrations. At the end of fermentation (26th day), Fe(2+) addition decreased the cellulase activities, led to lower COD contents and finally resulted the lower biogas yields than the control group. Taking the whole fermentation process into account, the promoting effect of Fe(2+) addition on biogas yields was mainly attributed to the extension of the gas production peak stage and the improvement of cellulase activities.

  15. Extreme Apprenticeship – Emphasising conceptual understanding in undergraduate mathematics

    OpenAIRE

    Rämö , Johanna; Oinonen , Lotta; Vikberg , Thomas

    2015-01-01

    International audience; Extreme Apprenticeship (XA) is an educational method that has been used in teaching undergraduate mathematics in the University of Helsinki. In this paper, we analyse the course assignments and exam questions of a certain lecture course that has recently been reformed to an XA-based course. The results show that the XA method has made it possible to move the emphasis from rote learning towards understanding the concepts behind the procedures.

  16. Assessment of the effects of dalteparin on coagulation variables and determination of a treatment schedule for use in cats.

    Science.gov (United States)

    Schönig, Jette C; Mischke, Reinhard H

    2016-07-01

    OBJECTIVE To determine a treatment protocol for SC administration of dalteparin to cats on the basis of currently available detailed pharmacokinetic data and to assess the effect of SC administration of dalteparin to cats on coagulation variables such as activated partial thromboplastin time (aPTT), thrombin time, and results for thromboelastometry, compared with effects on anti-activated coagulation factor X (anti-Xa) activity. ANIMALS 6 healthy domestic shorthair cats. PROCEDURES Cats received 14 injections of dalteparin (75 anti-Xa U/kg, SC) at 6-hour intervals. Blood samples were collected before and 2 hours after the first and second injections on days 1, 2, and 4. Anti-Xa activity was measured by use of a chromogenic substrate assay, aPTT and thrombin time were measured by use of an automated coagulometer, and viscoelastic measurements were obtained with thromboelastrometry. RESULTS 2 hours after the second injection, the target peak anti-Xa activity range of 0.5 to 1.0 U/mL was achieved in all cats, whereas median trough values remained below this range. Peak anti-Xa activity had only minimal effects on coagulation variables; the maximum median ratio for aPTT (in relationship to the value before the first dalteparin injection) was 1.23. CONCLUSIONS AND CLINICAL RELEVANCE Results of this study indicated that this treatment protocol resulted in reproducible anti-Xa activity in cats that was mostly within the targeted peak range of anti-Xa activity recommended for humans. Treatment in accordance with this protocol may not require routine coagulation monitoring of cats, but this must be confirmed in feline patients.

  17. Upregulation of biotransformation genes in gills of oyster Crassostrea brasiliana exposed in situ to urban effluents, Florianópolis Bay, Southern Brazil.

    Science.gov (United States)

    Pessatti, Tomás B; Lüchmann, Karim H; Flores-Nunes, Fabrício; Mattos, Jacó J; Sasaki, Sílvio T; Taniguchi, Satie; Bícego, Márcia C; Dias Bainy, Afonso Celso

    2016-09-01

    The release of untreated sanitary sewage, combined with unplanned urban growth, are major factors contributing to degradation of coastal ecosystems in developing countries, including Brazil. Sanitary sewage is a complex mixture of chemicals that can negatively affect aquatic organisms. The use of molecular biomarkers can help to understand and to monitor the biological effects elicited by contaminants. The aim of this study was to evaluate changes in transcript levels of genes related to xenobiotic biotransformation in the gills of oysters Crassostrea brasiliana transplanted and kept for 24h at three areas potentially contaminated by sanitary sewage (Bücheller river, BUC; Biguaçu river, BIG; and Ratones island, RAT), one farming area (Sambaqui beach, SAM) and at one reference site (Forte beach, FOR) in the North Bay of Santa Catarina Island (Florianópolis, Brazil). Transcript levels of four cytochrome P450 isoforms (CYP2AU1, CYP3A-like, CYP356A1-like and CYP20A1-like), three glutathione S-transferase (GST alpha-like, GST pi-like and GST microsomal 3-like) and one sulfotransferase gene (SULT-like) were evaluated by means of quantitative reverse transcription PCR (qRT-PCR). Chemical analysis of the sediment from each site were performed and revealed the presence of aliphatic and polycyclic aromatic hydrocarbons, linear alkylbenzenes and fecal sterols in the contaminated areas (BUC and BIG). Water quality analysis showed that these sites had the highest levels of fecal coliforms and other parameters evidencing the presence of urban sewage discharges. Among the results for gene transcription, CYP2AU1 and SULT-like levels were upregulated by 20 and 50-fold, respectively, in the oysters kept for 24h at the most contaminated site (BUC), suggesting a role of these genes in the detoxification of organic pollutants. These data reinforce that gills possibly have an important role in xenobiotic metabolism and highlight the use of C. brasiliana as a sentinel for monitoring

  18. Characterization of a human coagulation factor Xa-binding site on Viperidae snake venom phospholipases A2 by affinity binding studies and molecular bioinformatics

    Directory of Open Access Journals (Sweden)

    Gowda Veerabasappa T

    2007-12-01

    Full Text Available Abstract Background The snake venom group IIA secreted phospholipases A2 (SVPLA2, present in the Viperidae snake family exhibit a wide range of toxic and pharmacological effects. They exert their different functions by catalyzing the hydrolysis of phospholipids (PL at the membrane/water interface and by highly specific direct binding to: (i presynaptic membrane-bound or intracellular receptors; (ii natural PLA2-inhibitors from snake serum; and (iii coagulation factors present in human blood. Results Using surface plasmon resonance (SPR protein-protein interaction measurements and an in vitro biological test of inhibition of prothrombinase activity, we identify a number of Viperidae venom SVPLA2s that inhibit blood coagulation through direct binding to human blood coagulation factor Xa (FXa via a non-catalytic, PL-independent mechanism. We classify the SVPLA2s in four groups, depending on the strength of their binding. Molecular electrostatic potentials calculated at the surface of 3D homology-modeling models show a correlation with inhibition of prothrombinase activity. In addition, molecular docking simulations between SVPLA2 and FXa guided by the experimental data identify the potential FXa binding site on the SVPLA2s. This site is composed of the following regions: helices A and B, the Ca2+ loop, the helix C-β-wing loop, and the C-terminal fragment. Some of the SVPLA2 binding site residues belong also to the interfacial binding site (IBS. The interface in FXa involves both, the light and heavy chains. Conclusion We have experimentally identified several strong FXa-binding SVPLA2s that disrupt the function of the coagulation cascade by interacting with FXa by the non-catalytic PL-independent mechanism. By theoretical methods we mapped the interaction sites on both, the SVPLA2s and FXa. Our findings may lead to the design of novel, non-competitive FXa inhibitors.

  19. Cheaper fuel and higher health costs among the poor in rural Nepal

    Energy Technology Data Exchange (ETDEWEB)

    Pant, Krishna Prasad [Ministry of Agriculture and Cooperatives, Vidhya Lane, Devnagar, Kathmandu (Nepal)], email: kppant@yahoo.com

    2012-03-15

    Biomass fuels are used by the majority of resource poor households in low-income countries. Though biomass fuels, such as dung-briquette and firewood are apparently cheaper than the modern fuels indoor pollution from burning biomass fuels incurs high health costs. But, the health costs of these conventional fuels, mostly being indirect, are poorly understood. To address this gap, this study develops probit regression models using survey data generated through interviews from households using either dung-briquette or biogas as the primary source of fuel for cooking. The study investigates factors affecting the use of dung-briquette, assesses its impact on human health, and estimates the associated household health costs. Analysis suggests significant effects of dung-briquette on asthma and eye diseases. Despite of the perception of it being a cheap fuel, the annual health cost per household due to burning dung-briquette (US$ 16.94) is 61.3% higher than the annual cost of biogas (US$ 10.38), an alternative cleaner fuel for rural households. For reducing the use of dung-briquette and its indirect health costs, the study recommends three interventions: (1) educate women and aboriginal people, in particular, and make them aware of the benefits of switching to biogas; (2) facilitate tree planting in communal as well as private lands; and (3) create rural employment and income generation opportunities.

  20. [Occurrence of quinolone and sulfonamide antibiotics in swine and cattle manures from large-scale feeding operations of Guangdong Province].

    Science.gov (United States)

    Tai, Yi-Ping; Luo, Xiao-Dong; Mo, Ce-Hui; Li, Yan-Wen; Wu, Xiao-Lian; Liu, Xing-Yue

    2011-04-01

    The occurrence and distribution of four quinolones and four sulfonamides in swine and cattle feces sampled from twenty large-scale feeding operations in different areas of Guangdong province were detected using solid phase extraction (SPE) and high performance liquid chromatography (HPLC). Quinolone and sulfonamide compounds were observed in all pig dung samples. Their total concentrations ranged from 24.5 microg/kg to 1516.2 microg/kg (F. W.) with an average of 581.0 microg/kg and ranged from 1925.9-13399.5 microg/kg with an average of 4403.9 microg/kg respectively. The dominant compounds in pig feces were ciprofloxacin and enrofloxacin for quinolones and sulfamerazine and sulfamethoxazole for sulfonamides. Quinolone compounds which dominated with norfloxacin and ciprofloxacin were also observed in all cattle dung samples, its total concentrations ranged from 73.2 microg/kg to 1328.0 microg/kg which averaged 572.9 microg/kg. While the positive rates of sulfonamide compounds detected in cattle dung samples were above 90%, predominated by sulfamethoxazole and sulfamerazine. Concentration and distribution of both quinolone and sulfonamide compounds in swine and cattle dungs of different feeding operations varied greatly. Relatively high concentrations of the two kinds of antibiotics were found in both swine and cattle dungs from Guangzhou area, while sulfameter and sulfamethazine in cattle dungs from Foshan and Shenzhen areas were below the limit of detection.

  1. Integrated Production of Xylonic Acid and Bioethanol from Acid-Catalyzed Steam-Exploded Corn Stover.

    Science.gov (United States)

    Zhu, Junjun; Rong, Yayun; Yang, Jinlong; Zhou, Xin; Xu, Yong; Zhang, Lingling; Chen, Jiahui; Yong, Qiang; Yu, Shiyuan

    2015-07-01

    High-efficiency xylose utilization is one of the restrictive factors of bioethanol industrialization. However, xylonic acid (XA) as a new bio-based platform chemical can be produced by oxidation of xylose with microbial. So, an applicable technology of XA bioconversion was integrated into the process of bioethanol production. After corn stover was pretreated with acid-catalyzed steam-explosion, solid and liquid fractions were obtained. The liquid fraction, also named as acid-catalyzed steam-exploded corn stover (ASC) prehydrolyzate (mainly containing xylose), was catalyzed with Gluconobacter oxydans NL71 to prepare XA. After 72 h of bioconversion of concentrated ASC prehydrolyzate (containing 55.0 g/L of xylose), the XA concentration reached a peak value of 54.97 g/L, the sugar utilization ratio and XA yield were 94.08 and 95.45 %, respectively. The solid fraction was hydrolyzed to produce glucose with cellulase and then fermented with Saccharomyces cerevisiae NL22 to produce ethanol. After 18 h of fermentation of concentrated enzymatic hydrolyzate (containing 86.22 g/L of glucose), the ethanol concentration reached its highest value of 41.48 g/L, the sugar utilization ratio and ethanol yield were 98.72 and 95.25 %, respectively. The mass balance showed that 1 t ethanol and 1.3 t XA were produced from 7.8 t oven dry corn stover.

  2. Phosphatidylserine and Phosphatidylethanolamine Bind to Protein Z Cooperatively and with Equal Affinity.

    Directory of Open Access Journals (Sweden)

    Tanusree Sengupta

    Full Text Available Protein Z (PZ is an anticoagulant that binds with high affinity to Protein Z-dependent protease inhibitor (ZPI and accelerates the rate of ZPI-mediated inhibition of factor Xa (fXa by more than 1000-fold in the presence of Ca2+ and phospholipids. PZ promotion of the ZPI-fXa interaction results from the anchoring of the Gla domain of PZ onto phospholipid surfaces and positioning the bound ZPI in close proximity to the Gla-anchored fXa, forming a ternary complex of PZ/ZPI/fXa. Although interaction of PZ with phospholipid membrane appears to be absolutely crucial for its cofactor activity, little is known about the binding of different phospholipids to PZ. The present study was conceived to understand the interaction of different phospholipids with PZ. Experiments with both soluble lipids and model membranes revealed that PZ binds to phosphatidylserine (PS and phosphatidylethanolamine (PE with equal affinity (Kd~48 μM; further, PS and PE bound to PZ synergistically. Equilibrium dialysis experiments revealed two lipid-binding sites for both PS and PE. PZ binds with weaker affinity to other phospholipids, e.g., phosphatidic acid, phosphatidylglycerol, phosphatidylcholine and binding of these lipids is not synergistic with respect to PS. Both PS and PE -containing membranes supported the formation of a fXa-PZ complex. PZ protection of fXa from antithrombin inhibition were also shown to be comparable in presence of both PS: PC and PE: PC membranes. These findings are particularly important and intriguing since they suggest a special affinity of PZ, in vivo, towards activated platelets, the primary membrane involved in blood coagulation process.

  3. Optimización del muestreo de invertebrados tropicales: Un ejemplo con escarabajos coprófagos (Coleoptera: Scarabaeinae en Venezuela Sampling optimization for tropical invertebrates: An example using dung beetles (Coleoptera: Scarabaeinae in Venezuela

    Directory of Open Access Journals (Sweden)

    José Rafael Ferrer-Paris

    2013-03-01

    Full Text Available El presente trabajo propone una estrategia sencilla de optimización del diseño muestreal para escarabajos coprófagos que puede ser aplicada a muestreos basados en trampas atrayentes en amplias escalas geográficas y generalizada a otros tipos de muestreo. Para ello, analizamos muestras colectadas en ocho localidades con hábitats contrastantes y diferentes características del muestreo entre 2006-2008. Se capturaron 40 337 ejemplares (115 especies/ morfoespecies, de 23 géneros. El número de trampas fue el aspecto del muestreo más importante para obtener estimadores de riqueza confiable. El tiempo de muestreo para generar estimadores precisos de abundancia y la disposición espacial de las trampas para captar adecuadamente la diferencias en composición entre localidades. Sugerimos que una estrategia óptima de muestreo para obtener estimadores precisos de riqueza, abundancia y diversidad consistiría en: (1 colocar 50-70 trampas para maximizar el número de especies detectadas, (2 muestrear entre 48 y 72 hrs y colocar grupos de trampas a lo largo de un transecto para estimar confiablemente la abundancia de las especies, (3 colocar siete grupos de al menos 10 trampas para registrar adecuadamente la composición de cada localidad y (4 separar los grupos de trampas por distancias mayores a 5-10km para minimizar la autocorrelación espacial.The development of efficient sampling protocols is an essential prerequisite to evaluate and identify priority conservation areas. There are few protocols for fauna inventory and monitoring in wide geographical scales for the tropics, where the complexity of communities and high biodiversity levels, make the implementation of efficient protocols more difficult. We proposed here a simple strategy to optimize the capture of dung beetles, applied to sampling with baited traps and generalizable to other sampling methods. We analyzed data from eight transects sampled between 2006-2008 with the aim to develop an

  4. Home treatment of patients with low-risk pulmonary embolism with the oral factor Xa inhibitor rivaroxaban. Rationale and design of the HoT-PE Trial.

    Science.gov (United States)

    Barco, Stefano; Lankeit, Mareike; Binder, Harald; Schellong, Sebastian; Christ, Michael; Beyer-Westendorf, Jan; Duerschmied, Daniel; Bauersachs, Rupert; Empen, Klaus; Held, Matthias; Schwaiblmair, Martin; Fonseca, Cândida; Jiménez, David; Becattini, Cecilia; Quitzau, Kurt; Konstantinides, Stavros

    2016-07-04

    Pulmonary embolism (PE) is a potentially life-threatening acute cardiovascular syndrome. However, more than 95 % of patients are haemodynamically stable at presentation, and among them are patients at truly low risk who may qualify for immediate or early discharge. The Home Treatment of Pulmonary Embolism (HoT-PE) study is a prospective international multicentre single-arm phase 4 management (cohort) trial aiming to determine whether home treatment of acute low-risk PE with the oral factor Xa inhibitor rivaroxaban is feasible, effective, and safe. Patients with confirmed PE, who have no right ventricular dysfunction or free floating thrombi in the right atrium or ventricle, are eligible if they meet none of the exclusion criteria indicating haemodynamic instability, serious comorbidity or any condition mandating hospitalisation, or a familial/social environment unable to support home treatment. The first dose of rivaroxaban is given in hospital, and patients are discharged within 48 hours of presentation. Rivaroxaban is taken for at least three months. The primary outcome is symptomatic recurrent venous thromboembolism or PE-related death within three months of enrolment. Secondary outcomes include quality of life and patient satisfaction, and health care resource utilisation compared to existing data on standard-duration hospital treatment. HoT-PE is planned to analyse 1,050 enrolled patients, providing 80 % power to reject the null hypothesis that the recurrence rate of venous thromboembolism is >3 % with α≤0.05. If the hypothesis of HoT-PE is confirmed, early discharge and out-of-hospital treatment may become an attractive, potentially cost-saving option for a significant proportion of patients with acute PE.

  5. A Foray into Fungal Ecology: Understanding Fungi and Their Functions Across Ecosystems

    Science.gov (United States)

    Francis, N.; Dunkirk, N. C.; Peay, K.

    2015-12-01

    Despite their incredible diversity and importance to terrestrial ecosystems, fungi are not included in a standard high school science curriculum. This past summer, however, my work for the Stanford EARTH High School Internship program introduced me to fungal ecology through experiments involving culturing, genomics and root dissections. The two fungal experiments I worked on had very different foci, both searching for answers to broad ecological questions of fungal function and physiology. The first, a symbiosis experiment, sought to determine if the partners of the nutrient exchange between pine trees and their fungal symbionts could choose one another. The second experiment, a dung fungal succession project, compared the genetic sequencing results of fungal extractions from dung versus fungal cultures from dung. My part in the symbiosis experiment involved dissection, weighing and encapsulation of root tissue samples characterized based on the root thickness and presence of ectomycorrhizal fungi. The dung fungi succession project required that I not only learn how to culture various genera of dung fungi but also learn how to extract DNA and RNA for sequencing from the fungal tissue. Although I primarily worked with dung fungi cultures and thereby learned about their unique physiologies, I also learned about the different types of genetic sequencing since the project compared sequences of cultured fungi versus Next Generation sequencing of all fungi present within a dung pellet. Through working on distinct fungal projects that reassess how information about fungi is known within the field of fungal ecology, I learned not only about the two experiments I worked on but also many past related experiments and inquiries through reading scientific papers. Thanks to my foray into fungal research, I now know not only the broader significance of fungi in ecological research but also how to design and conduct ecological experiments.

  6. Residues of veterinary antibiotics in manures from feedlot livestock in eight provinces of China.

    Science.gov (United States)

    Zhao, Ling; Dong, Yuan Hua; Wang, Hui

    2010-02-01

    The residue levels of selected fluoroquinolones, sulfonamides and tetracyclines in 143 animal dung samples collected in 2007 from large-scale livestock and poultry feedlots in 8 provinces were determined by using ultrasonic extraction and liquid chromatography. Recoveries from spiked pig dung samples (spike level=1mg/kg) ranged from 73.9 to 102.0% for fluoroquinolones, from 81.6 to 92.3% for sulfonamides, and from 57.2 to 72.6% for tetracyclines. Relative standard deviations of the recoveries were less than 10% within the same day. Method quantification limits were measured from 0.031 to 0.150 mg/kg for fluoroquinolones, from 0.023 to 0.082 mg/kg for sulfonamides, and 0.091 to 0.182 mg/kg for tetracyclines in spiked pig manure samples. Analysis of 61 pig, 54 chicken and 28 cow dung samples collected in China revealed that in pig and cow dung, up to 33.98 and 29.59 mg/kg ciprofloxacin, 33.26 and 46.70 mg/kg enrofloxacin, 59.06 and 59.59 mg/kg oxytetracycline, and 21.06 and 27.59 mg/kg chlortetracycline could be detected, respectively. A maximum concentration of 99.43 mg/kg fleroxacin, 225.45 mg/kg norfloxacin, 45.59 mg/kg ciprofloxacin and 1420.76 mg/kg enrofloxacin could be detected in chicken dung. No appreciable sulfonamide antibiotic concentrations (less than 10mg/kg) were found in any animal dung, and only sulfadimidine was observed, at a maximum concentration of 6.04 mg/kg, in chicken dung. Both enrofloxacin and chlortetracycline were detected with a very high occurrence in three animal manure samples. The residue levels for most antibiotics showed significant statistical differences among the sampling districts and the animal species. Copyright 2009 Elsevier B.V. All rights reserved.

  7. Carbon and nitrogen cycling in an integrated soybean-beef cattle production system under different grazing intensities

    Directory of Open Access Journals (Sweden)

    Joice Mari Assmann

    2015-10-01

    Full Text Available Abstract:The objective of this work was to evaluate the effect of grazing intensity on the decomposition of cover crop pasture, dung, and soybean residues, as well as the C and N release rates from these residues in a long-term integrated soybean-beef cattle system under no-tillage. The experiment was initiated in 2001, with soybean cultivated in summer and black oat + Italian ryegrass in winter. The treatments consisted of four sward heights (10, 20, 30, and 40 cm, plus an ungrazed area, as the control. In 2009-2011, residues from pasture, dung, and soybean stems and leaves were placed in nylon-mesh litter bags and allowed to decompose for up to 258 days. With increasing grazing intensity, residual dry matter of the pasture decreased and that of dung increased. Pasture and dung lignin concentrations and C release rates were lower with moderate grazing intensity. C and N release rates from soybean residues are not affected by grazing intensity. The moderate grazing intensity produces higher quality residues, both for pasture and dung. Total C and N release is influenced by the greater residual dry matter produced when pastures were either lightly grazed or ungrazed.

  8. Analgesic effects of an ethanol extract of the fruits of Xylopia aethiopica (Dunal A. Rich (Annonaceae and the major constituent, xylopic acid in murine models

    Directory of Open Access Journals (Sweden)

    Eric Woode

    2012-01-01

    Full Text Available Background: Fruit extracts of Xylopia aethiopica are used traditionally in the management of pain disorders including rheumatism, headache, colic pain, and neuralgia. Little pharmacological data exists in scientific literature of the effect of the fruit extract and its major diterpene, xylopic acid, on pain. The present study evaluated the analgesic properties of the ethanol extract of X. aethiopica (XAE and xylopic acid (XA, in murine models. Materials and Methods: XAE and XA were assessed in chemical (acetic acid-induced abdominal writhing and formalin tests, thermal (Tail-flick and Hargreaves thermal hyperalgesia tests, and mechanical (Randall-Selitto paw pressure test pain models. Results: XAE and XA exhibited significant analgesic activity in all the pain models used. XAE (30-300 mg kg -1 , p.o. and XA (10-100 mg kg -1 , p.o. inhibited acetic acid-induced visceral nociception, formalin- induced paw pain (both neurogenic and inflammatory, thermal pain as well as carrageenan-induced mechanical and thermal hyperalgesia in animals. Morphine (1-10 mg kg -1 , i.p. and diclofenac (1-10 mg kg -1 , i.p., used as controls, exhibited similar anti-nociceptive activities. XAE and XA did not induce tolerance to their respective anti-nociceptive effects in the formalin test after chronic administration. Morphine tolerance did not also cross-generalize to the analgesic effects of XAE or XA. Conclusions: These findings establish the analgesic properties of the ethanol fruit extract of X. aethiopica and its major diterpene, xylopic acid.

  9. Rivaroxaban in patients with a recent acute coronary syndrome

    DEFF Research Database (Denmark)

    Mega, Jessica L; Braunwald, Eugene; Wiviott, Stephen D

    2012-01-01

    Acute coronary syndromes arise from coronary atherosclerosis with superimposed thrombosis. Since factor Xa plays a central role in thrombosis, the inhibition of factor Xa with low-dose rivaroxaban might improve cardiovascular outcomes in patients with a recent acute coronary syndrome....

  10. Apixaban versus enoxaparin for thromboprophylaxis after hip replacement

    DEFF Research Database (Denmark)

    Lassen, Michael Rud; Gallus, Alexander; Raskob, Gary E

    2010-01-01

    There are various regimens for thromboprophylaxis after hip replacement. Low-molecular-weight heparins such as enoxaparin predominantly inhibit factor Xa but also inhibit thrombin to some degree. Orally active, specific factor Xa inhibitors such as apixaban may provide effective thromboprophylaxis...

  11. Edoxaban versus Warfarin for the Treatment of Symptomatic Venous Thromboembolism

    DEFF Research Database (Denmark)

    Büller, Harry R; Décousus, Hervé; Grosso, Michael A

    2013-01-01

    Whether the oral factor Xa inhibitor edoxaban can be an alternative to warfarin in patients with venous thromboembolism is unclear.......Whether the oral factor Xa inhibitor edoxaban can be an alternative to warfarin in patients with venous thromboembolism is unclear....

  12. An ESS treatment of the pattern of female arrival at the mating site in the yellow dung fly scathophaga stercoraria (L.)

    Science.gov (United States)

    Reuter; Ward; Blanckenhorn

    1998-12-07

    In most previous work on the yellow dung fly Scathophaga stercoraria (L.), as on other species, adaptive explanations have been sought for male behaviour whereas female behaviour has not been examined in similar detail. Here, the arrival of females at the mating site, fresh cattle droppings, is investigated. While almost all males are present shortly after pat deposition females arrive at a low, decreasing rate over an interval of about 5 hours. We propose that the distribution of female arrival times represents a mixed Evolutionarily Stable Strategy (ESS), formed by different trade-offs between costs and benefits of early and late arrival. Early arrival could be favoured by advantages due to better conditions for oviposition, faster egg development of reduced larval competition. Late arrival could be favoured by negative effects on females of male-male competition being weaker later after deposition. Computer simulations with distributions of arrival times deviating from the natural one were performed to "measure" the costs for females arriving at different times. These costs were compared with estimated benefits corresponding to the females' arrival times. This procedure revealed that females coming to the pat later in a population of females arriving shortly after deposition would be favoured. In a population arriving according to a uniform distribution, early females would have fitness advantages. Thus, evolution should lead to an intermediate distribution of arrival times, as in nature, i.e. female arrival behaviour is probably adaptive. The simulations also revealed that the intensity of sexual selection though male-male competition is highest with the natural pattern of female arrival. Therefore, natural selection generating this pattern amplifies the intensity of male-male interaction as a by-product. Copyright 1998 Academic Press

  13. On the mild solutions of higher-order differential equations in Banach spaces

    Directory of Open Access Journals (Sweden)

    Nguyen Thanh Lan

    2003-01-01

    Full Text Available For the higher-order abstract differential equation u(n(t=Au(t+f(t, t∈ℝ, we give a new definition of mild solutions. We then characterize the regular admissibility of a translation-invariant subspace ℳ of BUC(ℝ,E with respect to the above-mentioned equation in terms of solvability of the operator equation AX−Xn=C. As applications, periodicity and almost periodicity of mild solutions are also proved.

  14. Potential of endozoochorous seed dispersal by sheep in calcareous grasslands: correlations with seed traits.

    NARCIS (Netherlands)

    Kuiters, A.T.; Huiskes, H.P.J.

    2010-01-01

    Questions: What is the potential of sheep to serve as seed dispersers via ingestion and defecation in calcareous grasslands? Is the presence of viable seeds from dung correlated with specific seed traits? Location: Calcareous grasslands, South Limburg, the Netherlands/Belgium. Methods: Dung samples

  15. Evaluation of Novel Inoculation Strategies for Solid State Anaerobic Digestion of Yam Peelings in Low-Tech Digesters

    DEFF Research Database (Denmark)

    Heiske, Stefan; Jurgutis, Linas; Kádár, Zsófia

    2015-01-01

    (SSAD) can be operated with low process water demands, but the technology involves operational challenges, as e.g., risk of process acidification or low degradation rates. This study aimed at developing simple methods to perform SSAD of yam peelings in low-tech applications by testing different...... inoculation strategies and evaluating the necessity of dung addition as a supportive biomass. In initial lab scale trials 143 +/- 4 mL CH4/g VS (volatile solids) were obtained from a mixture of yam peelings and dung digested in a multi-layer-inoculated batch reactor. In a consecutive incubation cycle in which...... adapted inoculum was applied, bottom inoculated digesters loaded without dung reached a yield of 140 +/- 16 mL CH4/g VS. This indicates that SSAD of yam peelings is possible with simple inoculation methods and dung addition is unnecessary after microbial adaptation. A comparison with a conventional fixed...

  16. Effect of Se-enriched Organic Fertilizers on Selenium Accumulation in Corn and Soil

    Directory of Open Access Journals (Sweden)

    LI Sheng-nan

    2015-12-01

    Full Text Available The effect of two Se-enriched organic fertilizers (cow dung and rice straw biochar on selenium accumulation of corn growing in selenium deficient soil was studied with pot experiment. The results showed that corn accumulated more selenium and the selenium was much easier to convert from root to shoot in the corn plant with the application of Se-enriched cow dung than Se-enriched rice straw biochar. With the application of more organic fertilizer such as 25 t·hm-2 Se-enriched cow dung or 40 t·hm-2 Se-enriched rice straw biochar, the accumulation of selenium and growth status of corn were getting better than the other treatments. At the same time, as the application amount of Se-enriched organic fertilizers (cow dung and rice straw biochar increased, the total selenium content in the soil also increased, which positively correlated with each other.

  17. Statistical analysis of nitrous oxide emission factors from pastoral agriculture field trials conducted in New Zealand

    International Nuclear Information System (INIS)

    Kelliher, F.M.; Cox, N.; Weerden, T.J. van der; Klein, C.A.M. de; Luo, J.; Cameron, K.C.; Di, H.J.; Giltrap, D.; Rys, G.

    2014-01-01

    Between 11 May 2000 and 31 January 2013, 185 field trials were conducted across New Zealand to measure the direct nitrous oxide (N 2 O) emission factors (EF) from nitrogen (N) sources applied to pastoral soils. The log(EF) data were analysed statistically using a restricted maximum likelihood (REML) method. To estimate mean EF values for each N source, best linear unbiased predictors (BLUPs) were calculated. For lowland soils, mean EFs for dairy cattle urine and dung, sheep urine and dung and urea fertiliser were 1.16 ± 0.19% and 0.23 ± 0.05%, 0.55 ± 0.19% and 0.08 ± 0.02% and 0.48 ± 0.13%, respectively, each significantly different from one another (p 12°, mean EFs were significantly lower. Thus, urine and dung EFs should be disaggregated for sheep and cattle as well as accounting for terrain. -- Highlights: • Nitrous oxide emission factors (EFs) for pastoral soils measured in 185 field trials. • For lowland, the mean (±standard error) urea nitrogen fertiliser EF was 0.5 ± 0.1%. • For lowland, mean dairy cattle urine and dung EFs were 1.2 and 0.2%, respectively. • For lowland, mean sheep urine and dung EFs were 0.6 and 0.1%, respectively. • For pastoral soils in terrain with slopes >12°, mean EFs were significantly lower. -- From 185 field trials, mean nitrous oxide emission factors for pastoral soils were 0.1% for sheep dung up to 1.2% for dairy cattle urine, while that for urea fertiliser was 0.5%

  18. Comparative physical mapping of rice BAC clones linked to resistance genes Glh,Bph-3 and xa-5 in Oryza sativa L.and O.granulata Nees et Am.ex Watt.

    Institute of Scientific and Technical Information of China (English)

    XIONG Zhiyong; TAN Guangxuan; YOU Aiqing; HE Guangyuan; SHE Chaowen; LI Lijia; SONG Yunchun

    2004-01-01

    Oryza granulata Nees et Arn. ex Watt. is one of the three wild relatives of rice, which are the most valuable for study and utilization in China. In this study, the homology and physical locations of three rice resistance genes, Glh,Bph-3 and xa-5 are comparatively analyzed between O. sativa and O. granulata by Southern blotting and fluorescence in situ hybridization (FISH). The results of Southern blotting indicate that there exist homologous sequences of the tested RFLP markers in O. granulata. By using three bacterial artificial chromosome (BAC) clones scanned by the tested RFLP as probes, FISH signals are detected on both mitotic and pachytene chromosomes in O. sativa and O. granulata.Dual-color FISH demonstrates that two of the three BAC clones (14E16 and 38J9) are located on the short arm of the same chromosome pair in O. granulata. Additionally, colinearity is shown for the two clones between O. sativa and O.granulata. Another BAC clone 44B4 is located on the end of the short arm of other chromosome pair in these two species.Although the phylogenetic relationship between O. sativa and O. granulata is the most distinct in Oryza and these two species have evidently different biological features and ecological habits, the relative lengths and arm ratios of the detected chromosomes and the relative positions of the tested clone signals on chromosomes in O. granulata are quite similar to those in O. sativa.

  19. Helium effects on tungsten surface morphology and deuterium retention

    NARCIS (Netherlands)

    Ueda, Y.; H. Y. Peng,; H. T. Lee,; N. Ohno,; S. Kajita,; Yoshida, N.; Doerner, R.; De Temmerman, G.; V. Alimov,; G. Wright,

    2013-01-01

    Recent experimental results on tungsten surface morphology, especially nano-structure (fuzz), induced by helium plasma exposure at temperatures between 1000&#xa0;K and 2000&#xa0;K are reviewed. This structure was firstly reported in 2006. In this review, most of experimental results reported

  20. A new peptide (Ruviprase) purified from the venom of Daboia russelii russelii shows potent anticoagulant activity via non-enzymatic inhibition of thrombin and factor Xa.

    Science.gov (United States)

    Thakur, Rupamoni; Kumar, Ashok; Bose, Biplab; Panda, Dulal; Saikia, Debashree; Chattopadhyay, Pronobesh; Mukherjee, Ashis K

    2014-10-01

    Compounds showing dual inhibition of thrombin and factor Xa (FXa) are the subject of great interest owing to their broader specificity for effective anticoagulation therapy against cardiovascular disorders. This is the first report on the functional characterization and assessment of therapeutic potential of a 4423.6 Da inhibitory peptide (Ruviprase) purified from Daboia russelii russelii venom. The secondary structure of Ruviprase is composed of α-helices (61.9%) and random coils (38.1%). The partial N-terminal sequence (E(1)-V(2)-X(3)-W(4)-W(5)-W(6)-A(7)-Q(8)-L(9)-S(10)) of Ruviprase demonstrated significant similarity (80.0%) with an internal sequence of apoptosis-stimulating protein reported from the venom of Ophiophagus hannah and Python bivittatus; albeit Ruviprase did not show sequence similarity with existing thrombin/FXa inhibitors, suggesting its uniqueness. Ruviprase demonstrated a potent in vitro anticoagulant property and inhibited both thrombin and FXa following slow binding kinetics. Ruviprase inhibited thrombin by binding to its active site via an uncompetitive mechanism with a Ki value and dissociation constant (KD) of 0.42 μM and 0.46 μM, respectively. Conversely, Ruviprase demonstrated mixed inhibition (Ki = 0.16 μM) of FXa towards its physiological substrate prothrombin. Furthermore, the biological properties of Ruviprase could not be neutralized by commercial polyvalent or monovalent antivenom. Ruviprase at a dose of 2.0 mg/kg was non-toxic and showed potent in vivo anticoagulant activity after 6 h of intraperitoneal treatment in mice. Because of the potent anticoagulant property as well as non-toxic nature of Ruviprase, the possible application of the peptide as an antithrombotic agent for combating thrombosis-associated ailments appears promising. Copyright © 2014 Elsevier Masson SAS. All rights reserved.

  1. CEPF Western Ghats Special Series: Frugivory and seed dispersal by the Asian Elephant Elephas maximus in the tropical forests of Nilgiri Biosphere Reserve, southern India

    Directory of Open Access Journals (Sweden)

    N. Baskaran

    2014-10-01

    Full Text Available Seed dispersal plays a potential role in plant species demographic processes. Elephants are important seed-dispersing agents. We studied frugivory and seed dispersal by Asian Elephants in the tropical deciduous and thorn forests of the Nilgiri Biosphere Reserve, southern India. We determined fruit consumption based on the presence of seeds and fruit remnants in elephant dung piles. In total, we identified seeds of eight plant species belonging to seven families in 16% out of 455 dung piles examined between 1991 and 2004. Coinciding with a peak fruiting season in the study area, seeds and other fruit parts appeared in the dung piles significantly more frequently during the dry season than in the wet seasons (southwest and northeast monsoons. Owing to differences in fruit species abundance in different habitats, there was more evidence of fruit consumption in the dry thorn than in the dry and moist deciduous forests. This corresponds with insufficient grass availability in thorn forests during the dry season and an increase in browse consumption as a supplementary diet. Seeds of Tamarindus indica and Acacia intsia were found in elephant dung more frequently than other species. Seed and fruit remnants were found in almost an equal number of dung piles of both bulls and herds.

  2. Coprophilous Mucorales (ex Zygomycota from three areas in the semi-arid of Pernambuco, Brazil

    Directory of Open Access Journals (Sweden)

    Carlos Alberto Fragoso de Souza

    Full Text Available Abstract Mucorales comprises fungi commonly isolated as saprobes from soil, dung, stored grains and plants. Although these fungi have been studied in several countries, there are relatively a few reports of them in semi-arid areas. Therefore, the aims of the present study were to assess and compare the Mucorales communities in dung from different species and breeds of herbivores in the semi-arid of Pernambuco, based on the frequency of occurrence and species richness of these fungi. Samples of dung collected in the cities of Arcoverde, Serra Talhada and Sertânia were incubated in moist chambers in triplicate. Altogether, 24 taxa of Mucorales distributed in the genera Absidia, Circinella, Cunninghamella, Lichtheimia, Mucor, Pilobolus, Rhizopus and Syncephalastrum were identified. The highest species richness was found in sheep excrement. Mucor circinelloides f. griseo-cyanus was the most common taxon, followed by M. ramosissimus. The similarity of the composition of Mucorales species was greatest between the excrements of Guzerá and Sindi breeds (bovine. All mucoralean species isolated are being cited for the first time from animal dung found in Caatinga and a new species of Mucor was recorded. An identification key for species of Mucorales from dung in the semi-arid region of Brazil is provided.

  3. Assessment of Heparin Anticoagulation Measured Using i-STAT and Hemochron Activated Clotting Time.

    Science.gov (United States)

    Maslow, Andrew; Chambers, Alison; Cheves, Tracey; Sweeney, Joseph

    2018-01-31

    Adequate anticoagulation, measured using activated clotting time (ACT), is important during vascular and cardiac surgeries. Unfractionated heparin is the most common anticoagulant used. The purpose of this analysis was to compare the i-STAT ACT (iACT) to the Hemochron ACT (hACT), both of which were then compared to anti-factor Xa (anti-Xa) assay, a representation of heparin level and activity. Prospective study. Tertiary care cardiovascular center. Eleven consecutive elective adult cardiac surgical patients. Prior to cardiopulmonary bypass, ACTs were measured using i-STAT and Hemochron technologies and compared to each other and to anti-Xa assay prior to and during a cumulative administration of heparin. Data were compared using bias analyses. Heparin (300 U/kg) was administered in quarterly doses. Coagulation labs were collected prior to and 3 minutes after each quarterly dose of heparin. The baseline ACTs for i-STAT and Hemochron were 147 and 142 seconds, respectively. A significant association was found between iACT and hACT (p = 0.002). The iACT measurements underestimated hACT at ACT levels >180 seconds or anti-Xa levels >0.75 U/mL. No significant difference was found between ACT data at anti-Xa levels 0.75 U/mL. Copyright © 2018 Elsevier Inc. All rights reserved.

  4. Neem ( Azadirachta indica a. juss) seedling growth as influenced by ...

    African Journals Online (AJOL)

    The effect of Arbuscular mycorrhizal fungus (AMF), specifically, Glomus moseae and cow dung on the growth of Neem (Azadiracchta indica, A. Juss) seedlings was investigated at the forestry quarters, Lagos Street, Maiduguri, Borno State, Nigeria. The study included three treatments: the cow dung, mycorrhizal treatments ...

  5. 8 *Henok Kassa , Hammed Suliman and Tenaw Workayew 8

    African Journals Online (AJOL)

    Dr Osondu

    2011-09-02

    Sep 2, 2011 ... + cow dung + Millettia ferruginea), (coffee husk + pulp + effective microorganism) were used to prepare compost. The experiment was ... compost amended with cow dung and effective microorganism alone. The level of N and Exch. K in ... Coffee farming systems in Ethiopia are conventionally divided into ...

  6. The impact of founder events on chromosomal variability in multiply mating species

    DEFF Research Database (Denmark)

    Pool, John E; Nielsen, Rasmus

    2008-01-01

    size reductions and recent bottlenecks leading to decreased X/A diversity ratios. Here we use theory and simulation to investigate a separate demographic effect-that of founder events involving multiply mated females-and find that it leads to much stronger reductions in X/A diversity ratios than...

  7. A farmer friendly and economic IPM strategy to combat root-knot nematodes infesting lentil

    Directory of Open Access Journals (Sweden)

    Rose Rizvi

    2015-12-01

    Full Text Available An experiment was conducted to assess the effect of Rhizobium sp., waste tea leaves, eggshell powder, and composted cow dung manure on the root-knot nematode, Meloidogyne incognita, on lentil in Botany department AMU, Aligarh, India. When used alone, composted cow dung was better in reducing galling and nematode multiplication and improving lentil growth followed by eggshell powder, Rhizobium sp., and waste tea leaves. Significant result in the integrated management of M. incognita was obtained when Rhizobium sp. was used in combination with cow dung and eggshell powder (with or without waste tea leaves. Combined application of root nodule bacterium and organic wastes like waste tea leaves, eggshell, and cow dung may be suggested to the farmers/growers or related persons who are having great enthusiasm to establish a lentil production business. Application of these organic materials along with the root nodule bacteria may be helpful to foster soil ecosystem which has been a hot topic in the present scenario.

  8. A novel protease activity assay using a protease-responsive chaperone protein

    International Nuclear Information System (INIS)

    Sao, Kentaro; Murata, Masaharu; Fujisaki, Yuri; Umezaki, Kaori; Mori, Takeshi; Niidome, Takuro; Katayama, Yoshiki; Hashizume, Makoto

    2009-01-01

    Protease activity assays are important for elucidating protease function and for developing new therapeutic agents. In this study, a novel turbidimetric method for determining the protease activity using a protease-responsive chaperone protein is described. For this purpose, a recombinant small heat-shock protein (sHSP) with an introduced Factor Xa protease recognition site was synthesized in bacteria. This recombinant mutant, FXa-HSP, exhibited chaperone-like activity at high temperatures in cell lysates. However, the chaperone-like activity of FXa-HSP decreased dramatically following treatment with Factor Xa. Protein precipitation was subsequently observed in the cell lysates. The reaction was Factor Xa concentration-dependent and was quantitatively suppressed by a specific inhibitor for Factor Xa. Protein aggregation was detected by a simple method based on turbidimetry. The results clearly demonstrate that this assay is an effective, easy-to-use method for determining protease activities without the requirement of labeling procedures and the use of radioisotopes.

  9. A novel protease activity assay using a protease-responsive chaperone protein

    Energy Technology Data Exchange (ETDEWEB)

    Sao, Kentaro [Graduate School of Systems Life Sciences, Kyushu University, 744 Motooka Nishi-ku, Fukuoka 819-0395 (Japan); Murata, Masaharu, E-mail: m-murata@dem.med.kyushu-u.ac.jp [Department of Advanced Medical Initiatives, Faculty of Medical Science, Kyushu University, 3-1-1 Maidashi, Higashi-ku Fukuoka 812-8582 (Japan); Fujisaki, Yuri; Umezaki, Kaori [Department of Advanced Medical Initiatives, Faculty of Medical Science, Kyushu University, 3-1-1 Maidashi, Higashi-ku Fukuoka 812-8582 (Japan); Mori, Takeshi; Niidome, Takuro; Katayama, Yoshiki [Graduate School of Systems Life Sciences, Kyushu University, 744 Motooka Nishi-ku, Fukuoka 819-0395 (Japan); Department of Applied Chemistry, Faculty of Engineering, Kyushu University, Nishi-ku Fukuoka 819-0395 (Japan); Center for Future Chemistry, Kyushu University, 744 Motooka, Nishi-ku, Fukuoka 819-0395 (Japan); Hashizume, Makoto [Department of Advanced Medical Initiatives, Faculty of Medical Science, Kyushu University, 3-1-1 Maidashi, Higashi-ku Fukuoka 812-8582 (Japan)

    2009-06-05

    Protease activity assays are important for elucidating protease function and for developing new therapeutic agents. In this study, a novel turbidimetric method for determining the protease activity using a protease-responsive chaperone protein is described. For this purpose, a recombinant small heat-shock protein (sHSP) with an introduced Factor Xa protease recognition site was synthesized in bacteria. This recombinant mutant, FXa-HSP, exhibited chaperone-like activity at high temperatures in cell lysates. However, the chaperone-like activity of FXa-HSP decreased dramatically following treatment with Factor Xa. Protein precipitation was subsequently observed in the cell lysates. The reaction was Factor Xa concentration-dependent and was quantitatively suppressed by a specific inhibitor for Factor Xa. Protein aggregation was detected by a simple method based on turbidimetry. The results clearly demonstrate that this assay is an effective, easy-to-use method for determining protease activities without the requirement of labeling procedures and the use of radioisotopes.

  10. Direct radiative effect due to brownness in organic carbon aerosols generated from biomass combustion

    International Nuclear Information System (INIS)

    Rathod, T.D.; Sahu, S.K.; Tiwari, M.; Pandit, G.G.

    2016-01-01

    We report the enhancement in the direct radiative effect due the presence of Brown carbon (BrC) as a part of organic carbon aerosols. The optical properties of organic carbon aerosols generated from pyrolytic combustion of mango tree wood (Magnifera Indica) and dung cake at different temperatures were considered. Mie codes were used to calculate absorption and scattering coefficients coupled with experimentally derived imaginary complex refractive index. The direct radiative effect (DRE) for sampled organic carbon aerosols was estimated using a wavelength dependent radiative transfer equation. The BrC DRE was estimated taking virtually non absorbing organic aerosols as reference. The BrC DRE from wood and dung cake was compared at different combustion temperatures and conditions. The BrC contributed positively to the direct top of the atmosphere radiative effect. Dung cake generated BrC aerosols were found to be strongly light absorbing as compared to BrC from wood combustion. It was noted that radiative effects of BrC from wood depended on its generation temperature and conditions. For BrC aerosols from dung cake such strong dependence was not observed. The average BrC aerosol DRE values were 1.53±0.76 W g"−"1 and 17.84±6.45 W g"−"1 for wood and dung cake respectively. The DRE contribution of BrC aerosols came mainly (67–90%) from visible light absorption though they exhibited strong absorption in shorter wavelengths of the UV–visible spectrum. - Highlights: • Biomass fuels (wood and dung cake) were studied for brown carbon direct radiative effects. • Model calculations predicted positive contribution of Brown carbon aerosols to organic carbon direct radiative effect. • Average direct radiative values for brown carbon from dung cake were higher compare to wood. • The visible light absorption played major role in brown carbon contribution (67–90 %) to total direct radiative effect.

  11. Sheep Excreta as Source of Nitrous Oxide in Ryegrass Pasture in Southern Brazil

    Directory of Open Access Journals (Sweden)

    Michely Tomazi

    2015-10-01

    Full Text Available ABSTRACT Livestock urine and dung are important components of the N cycle in pastures, but little information on its effect on soil nitrous oxide (N2O emissions is available. We conducted a short-term (39-day trial to quantify the direct N2O-N emissions from sheep excreta on an experimental area of ryegrass pasture growing on a Typic Paleudult in southern Brazil. Four rates of urine-N (161, 242, 323, and 403 kg ha-1 N and one of dung-N (13 kg ha-1 N were applied, as well as a control plot receiving no excreta. The N2O-N emission factor (EF = % of added N released as N2O-N for urine and dung was calculated, taking into account the N2O fluxes in the field, over a period of 39 days. The EF value of the urine and dung was used to estimate the emissions of N2O-N over a 90-day period of pasture in the winter under two grazing intensities (2.5 or 5.0 times the herbage intake potential of grazing lambs. The soil N2O-N fluxes ranged from 4 to 353 µg m-2h-1. The highest N2O-N fluxes occurred 16 days after application of urine and dung, when the highest soil nitrate content was also recorded and the water-filled pore space exceeded 60 %. The mean EF for urine was 0.25 % of applied N, much higher than that for dung (0.06 %. We found that N2O-N emissions for the 90-day winter pasture period were 0.54 kg ha-1 for low grazing intensity and 0.62 kg ha-1 for moderate grazing intensity. Comparison of the two forms of excreta show that urine was the main contributor to N2O-N emissions (mean of 36 %, whereas dung was responsible for less than 0.1 % of total soil N2O-N emissions.

  12. Conséquences de l'interaction entre préférences pour l'habitat et quantité de ressources trophiques sur les communautés d'insectes coprophages (Coleoptera: Scarabaeoidea)

    Science.gov (United States)

    Kadiri, Nassera; Lobo, Jorge M.; Lumaret, Jean-Pierre

    Between the years 1988 and 1995, five dung beetle communities were studied in combined conditions of habitat and trophic resources. Investigations were conducted on La Viale experimental farm, in the Causse Méjean, southern France. At each site, dung beetle traps of standard design were set up simultaneously. In most situations, the vegetation cover acted like a filter that allowed the penetration of several ubiquitous but fundamentally open-habitat dung beetle species into forest, at the same time drastically limiting their numbers. Open and close sites differed significantly, open and grazed sites showing the highest richness, abundance and biomass in beetles. Both in open and close sites, a significant increase in trophic resources led to an increase of the diversity and evenness. However in open-habitat, when resources were too abundant, few species were favoured and the diversity and evenness decreased. In forest-habitat, a continuous grazing during several years (increase in resources) modified the dung beetle community, with a high increase in the numbers and biomass of beetles but a smaller increase in richness. Numbers in forest habitat readjusted to the level observed in open habitat with equivalent trophic resources. Similarly to what was observed in open pastures, the forest communities were able to adjust their numbers to the level of available trophic resources. Resources were a more active variable than the structure of habitat on the dung beetle communities. Important resources go against the filter effect which allows the penetration under cover of open-habitat species. Changes were slow (several years), and forest communities remained weak. The poverty of forest habitats is discussed: This scarcity in species is probably due to long time human activities in Europe which drastically reduced forest habitats and developped grazing, favouring generalist and heliophilous open-habitat dung beetle species. Actual grassland communities in Europe are

  13. Biogas Production Potential of Calatropis Procera (Sodom Apple ...

    African Journals Online (AJOL)

    The leaves and stems of Calatropis procera was digested under anaerobic condition to generate biogas. Cow dung was used as reference sample. Three digesters Calatropis procera leaves (CPL), Calatropis procera stem (CPS) and Cow Dung (CWD) respectively were used. Each contained 40g sample and 800 ml of ...

  14. Laboratory and greenhouse assessment of plant availability of organic N in animal manure

    NARCIS (Netherlands)

    Antil, R.S.; Janssen, B.H.; Lantinga, E.A.

    2009-01-01

    Laboratory data (thermal fractionation, pepsin extraction, C:No ratio) of dung and manure were mutually compared and contrasted with plant-availability of organic N (No) as found in a greenhouse experiment according to the double-pot technique. Two types of fresh cow dung (one with a relatively wide

  15. The effect of some ecological factors on the intestinal parasite loads ...

    Indian Academy of Sciences (India)

    Some ecological factors that might potentially influence intestinal parasite loads in the Asian elephant (Elephas maximus Linn.) were investigated in the Nilgiris, southern India. Fresh dung samples from identified animals were analysed, and the number of eggs/g of dung used as an index of parasite load. Comparisons ...

  16. Simultaneous and Sequential Feature Negative Discriminations: Elemental Learning and Occasion Setting in Human Pavlovian Conditioning

    Science.gov (United States)

    Baeyens, Frank; Vervliet, Bram; Vansteenwegen, Debora; Beckers, Tom; Hermans, Dirk; Eelen, Paul

    2004-01-01

    Using a conditioned suppression task, we investigated simultaneous (XA-/A+) vs. sequential (X [right arrow] A-/A+) Feature Negative (FN) discrimination learning in humans. We expected the simultaneous discrimination to result in X (or alternatively the XA configuration) becoming an inhibitor acting directly on the US, and the sequential…

  17. African Journal of Biotechnology - Vol 11, No 33 (2012)

    African Journals Online (AJOL)

    Introgression of bacterial blight (BB) resistance genes Xa7 and Xa21 into popular restorer line and their hybrids by molecular marker-assisted backcross (MABC) selection scheme ... Concentration of selected heavy metals in water of the Juru River, Penang, Malaysia · EMAIL FREE FULL TEXT EMAIL FREE FULL TEXT

  18. Nepal Ambient Monitoring and Source Testing Experiment (NAMaSTE): emissions of trace gases and light-absorbing carbon from wood and dung cooking fires, garbage and crop residue burning, brick kilns, and other sources

    Science.gov (United States)

    Stockwell, Chelsea E.; Christian, Ted J.; Goetz, J. Douglas; Jayarathne, Thilina; Bhave, Prakash V.; Praveen, Puppala S.; Adhikari, Sagar; Maharjan, Rashmi; DeCarlo, Peter F.; Stone, Elizabeth A.; Saikawa, Eri; Blake, Donald R.; Simpson, Isobel J.; Yokelson, Robert J.; Panday, Arnico K.

    2016-09-01

    The Nepal Ambient Monitoring and Source Testing Experiment (NAMaSTE) campaign took place in and around the Kathmandu Valley and in the Indo-Gangetic Plain (IGP) of southern Nepal during April 2015. The source characterization phase targeted numerous important but undersampled (and often inefficient) combustion sources that are widespread in the developing world such as cooking with a variety of stoves and solid fuels, brick kilns, open burning of municipal solid waste (a.k.a. trash or garbage burning), crop residue burning, generators, irrigation pumps, and motorcycles. NAMaSTE produced the first, or rare, measurements of aerosol optical properties, aerosol mass, and detailed trace gas chemistry for the emissions from many of the sources. This paper reports the trace gas and aerosol measurements obtained by Fourier transform infrared (FTIR) spectroscopy, whole-air sampling (WAS), and photoacoustic extinctiometers (PAX; 405 and 870 nm) based on field work with a moveable lab sampling authentic sources. The primary aerosol optical properties reported include emission factors (EFs) for scattering and absorption coefficients (EF Bscat, EF Babs, in m2 kg-1 fuel burned), single scattering albedos (SSAs), and absorption Ångström exponents (AAEs). From these data we estimate black and brown carbon (BC, BrC) emission factors (g kg-1 fuel burned). The trace gas measurements provide EFs (g kg-1) for CO2, CO, CH4, selected non-methane hydrocarbons up to C10, a large suite of oxygenated organic compounds, NH3, HCN, NOx, SO2, HCl, HF, etc. (up to ˜ 80 gases in all). The emissions varied significantly by source, and light absorption by both BrC and BC was important for many sources. The AAE for dung-fuel cooking fires (4.63 ± 0.68) was significantly higher than for wood-fuel cooking fires (3.01 ± 0.10). Dung-fuel cooking fires also emitted high levels of NH3 (3.00 ± 1.33 g kg-1), organic acids (7.66 ± 6.90 g kg-1), and HCN (2.01 ± 1.25 g kg-1), where the latter could

  19. Cavalieri Integration - CSIR Technical report

    CSIR Research Space (South Africa)

    Grobler, TL

    2011-10-01

    Full Text Available ] is called a translational function. Two examples of trans- lational functions are shown in Figure 4.A and Figure 4.B, and Figure 4.C presents an example of a linear function a(y) which is not translational with respect to f(x). y f(x) xa b a(y) A. y... f(x) xa b a(y) B. y f(x) xa b a(y) C. Figure 4. Examples of translational, and non-translational functions. De nition 3.2 (Cavalieri region R). Let R be any region (in R2) bounded by a nonnegative function f(x) (which is continuous...

  20. Cavalieri integration

    CSIR Research Space (South Africa)

    Ackermann, ER

    2012-09-01

    Full Text Available ; b] is called a translational function. Two examples of translational functions are shown in Figure 4.A and Figure 4.B, and Figure 4.C presents an example of a linear function a(y) which is not translational with respect to f(x). y f(x) xa b a...(y) A. y f(x) xa b a(y) B. y f(x) xa b a(y) C. Figure 4: Examples of translational, and non-translational functions. De nition 3.2 (Cavalieri region R). Let R be any region (in R2) bounded by a nonnegative function f(x) (which is continuous...

  1. The Grass Snake and the Basilisk: From Pre-Christian Protective House God to the Antichrist

    NARCIS (Netherlands)

    Lenders, H.J.R.; Janssen, I.A.W.

    2014-01-01

    The grass snake owes its far northern distribution in Europe to the production and hoarding of dung from stock breeding. Dung heaps appear to be perfect breeding sites that surpass ‘natural’ reproduction sites in quality. Here we point out that the grass snake's dependency on manure goes back to

  2. Livestock manures and compost production and use in Uganda

    African Journals Online (AJOL)

    Therefore, for sustainable production and export of cotton, it was imperative to ... used to supplement the mulch from the banana trash and sometimes "tete" .... 17.7. Source. Stephens. 1937. Table 4 Effect of chemical preservatives on nitrogen content in cattle dung and urine. Treatment. Dung. Urine .%. %. Control. 0.59. 2.0.

  3. Journal of Genetics | Indian Academy of Sciences

    Indian Academy of Sciences (India)

    ... backcross derived line possessing Xa21 + Pi2 and another possessing Xa33 were intercrossed to stack the target resistance genes into the genetic background of RPHR-1005. At ICF4, 10 promising lines possessing three resistance genes in homozygous condition along with fine-grain type, complete fertility restoration, ...

  4. Domoic acid toxicokinetics in Dungeness crabs: New insights into mechanisms that regulate bioaccumulation

    Energy Technology Data Exchange (ETDEWEB)

    Schultz, Irvin R., E-mail: ir_schultz@pnl.gov; Skillman, Ann; Sloan-Evans, Siobhan; Woodruff, Dana

    2013-09-15

    Highlights: •Domoic acid is retained in the hepatopancreas after oral dosing but not after intravascular dosing. •Localization of domoic acid in the hepatopancreas is extracellular, likely in the lumen of tubules. •Isolated hepatopancreas cells do not absorb domoic acid from culture media. •Domoic acid is eliminated through urinary excretion. -- Abstract: Domoic acid (DA) is an excitatory neurotoxic amino acid produced by several marine algal species and is the causative agent of amnesic shellfish poisoning. Profound differences in the toxicokinetics of DA have been identified in a wide variety of shellfish. We characterized the toxicokinetics of DA in Dungeness crabs (Metacarcinus magister) after oral and intravascular dosing (IV) using a variety of doses ranging from 0.1 to 20 mg/kg. After a 1 mg/kg oral dose, DA disappeared from the foregut within 2 h and largely accumulated in the hepatopancreas, with hemolymph and other tissues having 100–1000 times lower concentrations. After IV dosing, hemolymph concentrations of DA were unexpectedly high and toxicokinetic analysis indicated the steady-state volume of distribution (V{sub ss}) was 123–197 ml/kg, which is well below the hemolymph volume of 350 ml/kg for crabs. This indicated only limited extravascular distribution of DA was occurring after IV injection, which is surprising considering the capacity of the hepatopancreas to sequester DA after oral dosing. Additional studies measured the partitioning of DA in hepatopancreas cellular and subcellular fractions. The subcellular distribution of DA was primarily associated with the S8 fraction and could be filtered through a 30,000 MW cut-off filter, indicating DA was not appreciably bound to macromolecules. Interestingly, very little (<0.4%) of the total hepatopancreas DA tissue content was associated with the cellular fraction isolated after dissociation and separation from tissue fragments. The in vivo and in vitro results led us to hypothesize that DA

  5. Coprophilous Mucorales (ex Zygomycota) from three areas in the semi-arid of Pernambuco, Brazil.

    Science.gov (United States)

    Souza, Carlos Alberto Fragoso de; Lima, Diogo Xavier; Gurgel, Luciana M S; Santiago, André Luiz Cabral Monteiro de Azevedo

    Mucorales comprises fungi commonly isolated as saprobes from soil, dung, stored grains and plants. Although these fungi have been studied in several countries, there are relatively a few reports of them in semi-arid areas. Therefore, the aims of the present study were to assess and compare the Mucorales communities in dung from different species and breeds of herbivores in the semi-arid of Pernambuco, based on the frequency of occurrence and species richness of these fungi. Samples of dung collected in the cities of Arcoverde, Serra Talhada and Sertânia were incubated in moist chambers in triplicate. Altogether, 24 taxa of Mucorales distributed in the genera Absidia, Circinella, Cunninghamella, Lichtheimia, Mucor, Pilobolus, Rhizopus and Syncephalastrum were identified. The highest species richness was found in sheep excrement. Mucor circinelloides f. griseo-cyanus was the most common taxon, followed by M. ramosissimus. The similarity of the composition of Mucorales species was greatest between the excrements of Guzerá and Sindi breeds (bovine). All mucoralean species isolated are being cited for the first time from animal dung found in Caatinga and a new species of Mucor was recorded. An identification key for species of Mucorales from dung in the semi-arid region of Brazil is provided. Copyright © 2016 Sociedade Brasileira de Microbiologia. Published by Elsevier Editora Ltda. All rights reserved.

  6. Paris saponin-induced autophagy promotes breast cancer cell apoptosis via the Akt/mTOR signaling pathway.

    Science.gov (United States)

    Xie, Zhan-Zhi; Li, Man-Mei; Deng, Peng-Fei; Wang, Sheng; Wang, Lei; Lu, Xue-Ping; Hu, Liu-Bing; Chen, Zui; Jie, Hui-Yang; Wang, Yi-Fei; Liu, Xiao-Xiao; Liu, Zhong

    2017-02-25

    Paris saponins possess anticancer, anti-inflammatory, and antiviral effects. However, the anticancer effect of Paris saponins has not been well elucidated and the mechanisms underlying the potential function of Paris saponins in cancer therapy are needed to be further identify. In this study, we report that saponin compounds isolated from Paris polyphylla exhibited antitumor activity against breast cancer cell lines, MCF-7 and MDA-MB-231. Paris saponin XA-2 induced apoptosis in both cell lines, as evidenced by the activation of caspases and cleavage of Poly (ADP-ribose) polymerase. The ability of XA-2 to induce autophagy was confirmed by acridine orange staining, accumulation of autophagosome-bound Long chain 3 (LC3)-II, and measurement of autophagic flux. XA-2-induced autophagy was observed to promote apoptosis by the combined treatment of breast cancer cell lines with XA-2 and autophagy inhibitors 3-methyladenine and bafilomycin A1, respectively. Moreover, we report a decrease in the levels of Akt/mTOR signaling pathway proteins, such as the phosphorylated forms of Akt, mTOR, P70S6K, and eukaryotic translation initiation factor 4E-binding protein 1 (4EBP1). Taken together, these results provide important insights explaining the anticancer activity of Paris saponins and the potential development of XA-2 as a new therapeutic agent. Copyright © 2017 Elsevier B.V. All rights reserved.

  7. Characterization of a disease susceptibility locus for exploring an efficient way to improve rice resistance against bacterial blight

    Institute of Scientific and Technical Information of China (English)

    Qi Cheng; Weihua Mao; Wenya Xie; Qinsong Liu; Jianbo Cao; Meng Yuan; Qinglu Zhang; Xianghua Li; Shiping Wang

    2017-01-01

    Bacterial blight caused by Xanthomonas oryzae pv.oryzae (Xoo) is the most harmful bacterial disease of rice worldwide.Previously,we characterized major disease resistance (MR) gene xa25,which confers race-specific resistance to Xoo strain PXO339.The xa25 is a recessive allele of the SWEET13 locus,but SWEET13's interaction with PXO339 and how efficiently using this locus for rice breeding still need to be defined.Here we show that the SWEET13 allele from rice Zhenshan 97 is a susceptibility gene to PXO339.Using this allele's promoter to regulate xa25 resulted in disease,suggesting that the promoter is a key determinant in SWEET13 caused disease in Zhanshan 97 after PXO339 infection.PXO339 transcriptionally induces SWEET13 to cause disease.Partial suppressing SWEET13 expression leads to a high level of resistance to PXO339.Thus,the transcriptionally suppressed SWEET13 functions as xa25 in resistance to PXO339.Hybrid rice is widely grown in many countries.However,recessive MR genes have not been efficiently used for disease resistance breeding in hybrid rice production for both parents of the hybrid have to carry the same recessive gene.However,the suppressed SWEET13 functions dominantly,which will have advantage to improve the resistance of hybrid rice to xa25-incomptible Xoo.

  8. Layout ppp

    African Journals Online (AJOL)

    Nubidga

    November) 2011 in plots established in 2010 using a factorial design with 4 cow dung application levels. (0, 7.5, 15 ... showed that cow dung application appeared to have an ameliorating effect on the growth and fresh yield .... Package for Social Sciences (SPSS) Standard ... to evaluate the effect of interaction and the effect.

  9. Physical impact of grazing by sheep in the Nama Karoo subshrub ...

    African Journals Online (AJOL)

    When litter and dung are expressed in terms of loss and excretion per animal, both decreased with increased stocking rate. On average 80% of the dung was excreted on only 10% of the camp area, which mostly took place at the watering and sleeping places. These findings demonstrate the complex interaction between ...

  10. Susceptibilidade do besouro rola-bosta africano a reguladores de crescimento de insetos Susceptibility of African dung beetle to insect growth regulators

    Directory of Open Access Journals (Sweden)

    L.N. Domingues

    2009-10-01

    Full Text Available Verificou-se a ação dos reguladores de crescimento de insetos (IGR, diflubenzuron e methoprene, sobre o besouro rola-bosta africano, Digitonthophagus gazella (Fabricius, um inimigo natural da mosca-dos-chifres, Haematobia irritans irritans (Linnaeus. Casais de besouros foram colocados em baldes contendo terra úmida e alimentados com fezes bovinas contendo 1, 0,5 ou 0,2ppm de diflubenzuron e 0,2ppm de methoprene. Os insetos e sua prole foram recuperados com o auxílio de armadilhas pitfall. Diflubenzuron e methoprene não afetaram a sobrevivência dos adultos inicialmente expostos, mas interferiram na produção de descendentes. Diflubenzuron, nas concentrações de 1 e 0,5ppm, também afetou a duração do ciclo de vida dos besouros. Nenhum dos IGRs alterou a razão sexual dos descendentes obtidos. As concentrações testadas de diflubenzuron mostraram-se moderadamente nocivas ao besouro enquanto methoprene a 0,2ppm mostrou ser pouco nocivo, segundo os critérios da International Organization for Biological Control.The effects of insect growth regulators (IGR, diflubenzuron and methoprene, on African dung beetle, Digitonthophagus gazella (Fabricius, a natural enemy of the horn fly, Haematobia irritans irritans (Linnaeus, was studied. Beetles were placed in buckets partially filled with humid soil and were fed bovine feces containing 1, 0.5, or 0.2ppm diflubenzuron and 0.2ppm methoprene. Insects and their progenies were recovered by pitfall traps. Diflubenzuron and methoprene did not affect the survival of the adults but reduced their progenies. Diflubenzuron 1 and 0.5ppm also affected the life cicle of the beetles. None of the IGR modified the gender ratio of the progenies. According to the IOBC criteria, diflubenzuron tested concentrations showed to be moderately harmful to the beetles, whereas methoprene 0.2ppm was slightly harmful.

  11. Cultivation and fruit body production of Lentinus squarrosulus Mont ...

    African Journals Online (AJOL)

    The mycelia growth of Lentinus squarrosulus culture on the leaves and bark of common fruit trees were investigated. The effect of supplementing these fruit trees with 25% each of rice bran, horse dung, poultry droppings, cow dung, fresh cassava flour and oil palm waste fiber on the mycelia growth of this fungus was also ...

  12. Effect of Waste Paper on Biogas Production from Co-digestion of ...

    African Journals Online (AJOL)

    The effect of waste paper on biogas production from the co-digestion of fixed amount of cow dung and water hyacinth was studied at room temperature in five batch reactor for over 60 days. Waste paper addition was varied for a fixed amount of cow dung and water hyacinth until maximum biogas production was achieved.

  13. An ultrasensitive electrochemical sensor for simultaneous determination of xanthine, hypoxanthine and uric acid based on Co doped CeO{sub 2} nanoparticles

    Energy Technology Data Exchange (ETDEWEB)

    Lavanya, N. [Department of Bioelectronics and Biosensors, Alagappa University, Karaikudi 630003, Tamilnadu (India); Sekar, C., E-mail: Sekar2025@gmail.com [Department of Bioelectronics and Biosensors, Alagappa University, Karaikudi 630003, Tamilnadu (India); Murugan, R.; Ravi, G. [Department of Physics, Alagappa University, Karaikudi 630003, Tamilnadu (India)

    2016-08-01

    A novel electrochemical sensor has been fabricated using Co doped CeO{sub 2} nanoparticles for selective and simultaneous determination of xanthine (XA), hypoxanthine (HXA) and uric acid (UA) in a phosphate buffer solution (PBS, pH 5.0) for the first time. The Co-CeO{sub 2} NPs have been prepared by microwave irradiation method and characterized by Powder XRD, Raman spectroscopy, HRTEM and VSM measurements. The electrochemical behaviours of XA, HXA and UA at the Co-CeO{sub 2} NPs modified glassy carbon electrode (GCE) were studied by cyclic voltammetry and square wave voltammetry methods. The modified electrode exhibited remarkably well-separated anodic peaks corresponding to the oxidation of XA, HXA and UA over the concentration range of 0.1–1000, 1–600 and 1–2200 μM with detection limits of 0.096, 0.36, and 0.12 μM (S/N = 3), respectively. For simultaneous detection by synchronous change of the concentrations of XA, HXA and UA, the linear responses were in the range of 1–400 μM each with the detection limits of 0.47, 0.26, and 0.43 μM (S/N = 3), respectively. The fabricated sensor was further applied to the detection of XA, HXA and UA in human urine samples with good selectivity and high reproducibility. - Highlights: • A novel electrochemical sensor has been fabricated for simultaneous determination of purine metabolites xanthine, hypoxanthine, and uric acid based on Co doped CeO{sub 2} nanoparticles. • The Co-CeO{sub 2} modified glassy carbon electrode exhibited wide linear range towards the detection of XA, HXA and UA than ever reported in the literature. • The fabricated sensor was successfully applied for the analysis of human urine samples with satisfactory results.

  14. Removal of hydrogen sulfide (H2S) from biogas for the community in the province of Maha Sarakham

    Science.gov (United States)

    Pinate, W.; Dangphonthong, D.; Sirirach, S.; Sukkhon, S.

    2017-09-01

    Biogas produced from the fermentation in the province of Maha Sarakham of excreta from cow dung, fattening pigs and buffalo dung in small scale farms contained hydrogen sulfide (H2S) at 764, 926 and 1,103 ppm, respectively. This gas has offensive smell and is corrosive to motor and metal stove of farmers, thus needs to be eliminated. The adsorbent granules soaking in FeCl3 and NaOH made from grey cement mixed with diatomaceous earth or fine sand. The experiment cow dung, fattening pigs and buffalo dung farms revealed that the adsorbent granules made from fine sand mixed with grey cement had better efficiency in reducing H2S than diatomaceous earth plus grey cement or scrap iron (97.1-91.4 vs. 86.0-64.3 and 77.9-89.4%, Pbiogas from 3,141 to 0 ppm in the first day and to 6 ppm on day 25 of using period, during which the colour of adsorbent granules changed from red brown to dark brown.

  15. Evaluation of Novel Inoculation Strategies for Solid State Anaerobic Digestion of Yam Peelings in Low-Tech Digesters

    DEFF Research Database (Denmark)

    Heiske, Stefan; Jurgutis, Linas; Kádár, Zsófia

    2015-01-01

    The operation of household scale anaerobic digesters is typically based on diluted animal dung, requiring stabled livestock and adequate water availability. This excludes many rural households in low-income countries from the benefits of a domestic biogas digester. Solid state anaerobic digestion...... inoculation strategies and evaluating the necessity of dung addition as a supportive biomass. In initial lab scale trials 143 +/- 4 mL CH4/g VS (volatile solids) were obtained from a mixture of yam peelings and dung digested in a multi-layer-inoculated batch reactor. In a consecutive incubation cycle in which...... dome digester indicated that SSAD can reduce process water demand and the digester volume necessary to supply a given biogas demand....

  16. Relationship between drug resistance and the clustered, regularly interspaced, short, palindromic repeat-associated protein genes cas1 and cas2 in Shigella from giant panda dung.

    Science.gov (United States)

    Ren, Lu; Deng, Lin-Hua; Zhang, Ri-Peng; Wang, Cheng-Dong; Li, De-Sheng; Xi, Li-Xin; Chen, Zhen-Rong; Yang, Rui; Huang, Jie; Zeng, Yang-Ru; Wu, Hong-Lin; Cao, San-Jie; Wu, Rui; Huang, Yong; Yan, Qi-Gui

    2017-02-01

    To detect drug resistance in Shigella obtained from the dung of the giant panda, explore the factors leading to drug resistance in Shigella, understand the characteristics of clustered, regularly interspaced, short, palindromic repeats (CRISPR), and assess the relationship between CRISPR and drug resistance. We collected fresh feces from 27 healthy giant pandas in the Giant Panda Conservation base (Wolong, China). We identified the strains of Shigella in the samples by using nucleotide sequence analysis. Further, the Kirby-Bauer paper method was used to determine drug sensitivity of the Shigella strains. CRISPR-associated protein genes cas1 and cas2 in Shigella were detected by polymerase chain reaction (PCR), and the PCR products were sequenced and compared. We isolated and identified 17 strains of Shigella from 27 samples, including 14 strains of Shigella flexneri, 2 strains of Shigella sonnei, and 1 strain of Shigella dysenteriae. Further, drug resistance to cefazolin, imipenem, and amoxicillin-clavulanic acid was identified as a serious problem, as multidrug-resistant strains were detected. Further, cas1 and cas2 showed different degrees of point mutations. The CRISPR system widely exists in Shigella and shares homology with that in Escherichia coli. The cas1 and cas 2 mutations contribute to the different levels of resistance. Point mutations at sites 3176455, 3176590, and 3176465 in cas1 (a); sites 3176989, 3176992, and 3176995 in cas1 (b); sites 3176156 and 3176236 in cas2 may affect the resistance of bacteria, cause emergence of multidrug resistance, and increase the types of drug resistance.

  17. Effects of nitrogen enrichment on heavy metals content of cattle ...

    African Journals Online (AJOL)

    The research was carried out at John Ker Nigeria Organo-Mineral Company site at Ikot Ekpene, Akwa Ibom State, Nigeria, to investigate the effect of nitrogen enrichment on contents of heavy metals in cattle dung/poultry manure compost and the growth of maize. Cattle dung was mixed with poultry manure in the ratio of 3:1 ...

  18. Strategy Of Attrition: Why General Westmoreland Failed In 1967

    Science.gov (United States)

    2016-05-26

    assault on South Vietnamese regulars at Xa Tan Hung resulted in...with forty-six wounded. To complicate the situation, civilian casualties continued to mass. During the attack at Xa Tan Hung, the Viet Cong wounded...Ronald H. Advice And Support: The Early. Years, 1941-1960. Washington, DC: Center of Military History,1985. Taleb, Nassim Nicholas . Antifragile: Things

  19. Nepal Ambient Monitoring and Source Testing Experiment (NAMaSTE): emissions of particulate matter from wood- and dung-fueled cooking fires, garbage and crop residue burning, brick kilns, and other sources

    Science.gov (United States)

    Jayarathne, Thilina; Stockwell, Chelsea E.; Bhave, Prakash V.; Praveen, Puppala S.; Rathnayake, Chathurika M.; Robiul Islam, Md.; Panday, Arnico K.; Adhikari, Sagar; Maharjan, Rashmi; Goetz, J. Douglas; DeCarlo, Peter F.; Saikawa, Eri; Yokelson, Robert J.; Stone, Elizabeth A.

    2018-02-01

    The Nepal Ambient Monitoring and Source Testing Experiment (NAMaSTE) characterized widespread and under-sampled combustion sources common to South Asia, including brick kilns, garbage burning, diesel and gasoline generators, diesel groundwater pumps, idling motorcycles, traditional and modern cooking stoves and fires, crop residue burning, and heating fire. Fuel-based emission factors (EFs; with units of pollutant mass emitted per kilogram of fuel combusted) were determined for fine particulate matter (PM2.5), organic carbon (OC), elemental carbon (EC), inorganic ions, trace metals, and organic species. For the forced-draft zigzag brick kiln, EFPM2.5 ranged from 12 to 19 g kg-1 with major contributions from OC (7 %), sulfate expected to be in the form of sulfuric acid (31.9 %), and other chemicals not measured (e.g., particle-bound water). For the clamp kiln, EFPM2.5 ranged from 8 to 13 g kg-1, with major contributions from OC (63.2 %), sulfate (23.4 %), and ammonium (16 %). Our brick kiln EFPM2.5 values may exceed those previously reported, partly because we sampled emissions at ambient temperature after emission from the stack or kiln allowing some particle-phase OC and sulfate to form from gaseous precursors. The combustion of mixed household garbage under dry conditions had an EFPM2.5 of 7.4 ± 1.2 g kg-1, whereas damp conditions generated the highest EFPM2.5 of all combustion sources in this study, reaching up to 125 ± 23 g kg-1. Garbage burning emissions contained triphenylbenzene and relatively high concentrations of heavy metals (Cu, Pb, Sb), making these useful markers of this source. A variety of cooking stoves and fires fueled with dung, hardwood, twigs, and/or other biofuels were studied. The use of dung for cooking and heating produced higher EFPM2.5 than other biofuel sources and consistently emitted more PM2.5 and OC than burning hardwood and/or twigs; this trend was consistent across traditional mud stoves, chimney stoves, and three-stone cooking

  20. Relationships between Prosopis flexuosa (Fabaceae and cattle in the Monte desert: Seeds, seedlings and saplings on cattle-use site classes Interacciones entre Prosopis flexuosa (Fabaceae y el ganado en el desierto de Monte: Semillas, plántulas y renovales en los sitios de uso del ganado

    Directory of Open Access Journals (Sweden)

    CLAUDIA M CAMPOS

    2011-06-01

    Full Text Available The fate of Prosopis flexuosa seeds dispersed by cattle is dependant on the spatial pattern of dung deposition and foraging movements. We hypothesised that cattle-use site classes explain the response variables related to seed input and fate of seeds, seedlings and saplings (small plants more than one year old. We defined sites with heavy cattle traffic ("trails" and "periphery of trails", sites used for resting and foraging ("under Prosopis", and sites where isolated individuals only walk ("under shrubs" and "bare soil". Considering the established cattle-use site classes, our specific goals were to quantify and compare: (1 seeds transported in cattle dung; (2 seedlings 10 months after dung deposition; (3 established saplings; and (4 germinated and remaining seeds, and seedling survival in dung immediately after dung deposition. In a grazed field at Ñacuñán (Mendoza, Argentina we worked in four similar areas, each consisting of 25-ha plots 2 km apart. Space use by cattle caused differential seed input: "under Prosopis" and in the "periphery of trails" animals deposited the largest amounts of dung and seeds. Ten months after dung deposition, the highest number of seedlings occurred on "trails", "under Prosopis" and in the "periphery of trails". In the long term, the highest number of established saplings occurred only in the "periphery of trails". The number of seeds germinated immediately after fruit production and dung deposition was very low. Survival of seedlings sprouting from dung-germinated seeds did not exceed one week. On "trails" and in the "periphery of trails" the persistence of seeds in dung was low because of dung disintegration by the action of cattle trampling. The seeds that did not remain in dung were probably the source of seeds that will germinate in the next wet season (i.e. 10 months after dung deposition. With different effects depending on cattle site activity and on the stage of the P. flexuosa plant (seed, seedling

  1. Comparative study of coal and biomass co-combustion with coal burning separately through emissions analysis

    International Nuclear Information System (INIS)

    Siddique, M.; Asadullah, A.; Khan, G.; Soomro, S.A.

    2016-01-01

    Appropriate eco-friendly methos to mitigate the problem of emissions from combustion of fossil fuel are highly demanded. The current study was focused on the effect of using coal and coal biomass co-combustion on the gaseous emissions. Different biomass were used along with coal. The coal used was lignite coal and the biomass' were tree waste, cow dung and banana tree leaves Various ratios of coal and biomass were used to investigate the combustion behavior of coal cow dung and 100% banana tree leaves emits less emission of CO, CO/sub 2/, NOx and SO/sub 2/ as compared to 100% coal, Maximum amount of CO emission were 1510.5 ppm for bannana tree waste and minimum amount obtained for lakhra coal and cow dung manure (70:30) of 684.667 leaves (90:10) and minimum amount of SO/sub 2/ present in samples is in lakhra coal-banana tree waste (80:20). The maximum amount of NO obtained for banana tree waste were 68 ppm whereas amount from cow dung manure (30.83 ppm). The study concludes that utilization of biomass with coal could make remedial action against environment pollution. (author)

  2. Pertumbuhan cacing tanah Eisenia fetida sp. Pada kompos limbah fleshing

    Directory of Open Access Journals (Sweden)

    Prayitno Prayitno

    2015-12-01

    Full Text Available The use of earthworm as a source of income and a means for managing organic solid waste such as fleshing waste has been widely applied. The aim of this research was to find the optimum ratio between fleshing waste and cow dung in the growing medium of Eisenia fetida sp. This research was conducted by growing the E. fetida sp. earthworm in the medium containing fleshing waste mixed with cow dung. The ratio of fleshing waste and cow dung was varied at 0:100; 10:90; 20:80; 30:70; 40:60; and 50:50. In addition, 2 parts of chopped stubbles per part of every sample was added as a carbon source. The prepared media were fermented for three weeks with EM4 as a starter, followed by incubation of the earthworm for six weeks. The weight and the number of earthworm were evaluated every two weeks. The optimum growth of earthworm was achieved at the 2nd week of incubation with 185.48% and 121.10% increase of weight and number of earthworm, respectively, at 40:60 ratio of fleshing waste and cow dung in the growing medium.

  3. Abscisic acid, xanthoxin and violaxanthin in the caps of gravistimulated maize roots

    Science.gov (United States)

    Feldman, L. J.; Arroyave, N. J.; Sun, P. S.

    1985-01-01

    The occurrence and distribution of abscisic acid (ABA), xanthoxin (Xa) and the carotenoid violaxanthin (Va) were investigated in root tips of maize (Zea mays L. cv. Merit). In roots grown in the dark, Va and ABA were present in relatively high amounts in the root cap and in low amounts in the adjacent terminal 1.5 mm of the root. Xanthoxin was present in equal concentrations in both regions. In roots exposed to light, the ABA distribution was reversed, with relatively low levels in the root cap and high levels in the adjacent 1.5-mm segment. Light also caused a decrease in Va in both regions of the root and an increase in Xa, especially in the cap. In the maize cultivar used for this work, light is necessary for gravitropic curving. This response occurs within the same time frame as the light-induced ABA redistribution as well as the changes in the levels of Va and Xa. These data are consistent with a role for ABA in root gravitropism and support the proposal that Xa may arise from the turnover of Va.

  4. Nepal Ambient Monitoring and Source Testing Experiment (NAMaSTE: emissions of trace gases and light-absorbing carbon from wood and dung cooking fires, garbage and crop residue burning, brick kilns, and other sources

    Directory of Open Access Journals (Sweden)

    C. E. Stockwell

    2016-09-01

    Full Text Available The Nepal Ambient Monitoring and Source Testing Experiment (NAMaSTE campaign took place in and around the Kathmandu Valley and in the Indo-Gangetic Plain (IGP of southern Nepal during April 2015. The source characterization phase targeted numerous important but undersampled (and often inefficient combustion sources that are widespread in the developing world such as cooking with a variety of stoves and solid fuels, brick kilns, open burning of municipal solid waste (a.k.a. trash or garbage burning, crop residue burning, generators, irrigation pumps, and motorcycles. NAMaSTE produced the first, or rare, measurements of aerosol optical properties, aerosol mass, and detailed trace gas chemistry for the emissions from many of the sources. This paper reports the trace gas and aerosol measurements obtained by Fourier transform infrared (FTIR spectroscopy, whole-air sampling (WAS, and photoacoustic extinctiometers (PAX; 405 and 870 nm based on field work with a moveable lab sampling authentic sources. The primary aerosol optical properties reported include emission factors (EFs for scattering and absorption coefficients (EF Bscat, EF Babs, in m2 kg−1 fuel burned, single scattering albedos (SSAs, and absorption Ångström exponents (AAEs. From these data we estimate black and brown carbon (BC, BrC emission factors (g kg−1 fuel burned. The trace gas measurements provide EFs (g kg−1 for CO2, CO, CH4, selected non-methane hydrocarbons up to C10, a large suite of oxygenated organic compounds, NH3, HCN, NOx, SO2, HCl, HF, etc. (up to ∼ 80 gases in all. The emissions varied significantly by source, and light absorption by both BrC and BC was important for many sources. The AAE for dung-fuel cooking fires (4.63 ± 0.68 was significantly higher than for wood-fuel cooking fires (3.01 ± 0.10. Dung-fuel cooking fires also emitted high levels of NH3 (3.00 ± 1.33 g kg−1, organic acids (7.66 ± 6.90 g kg−1, and HCN

  5. Scarab Beetle (Coleoptera: Scarabaeidae Fauna in Ardabil Province, North West Iran

    Directory of Open Access Journals (Sweden)

    G Mowlavi

    2008-12-01

    Full Text Available "nBackground: Dung beetles of Coleoptera associated to undisturbed cattle droppings in pastures present great diver¬sity and abundance. Dung beetles also play an important role for transmission of some helminthes to human and cat¬tle. This study was made to survey the biodiversity and abundance of these beetles in Ardebil Province, western Iran."nMethods: According to the field study all beetles attracted to fresh cow dung in five areas of Ardebil Province in¬cluding Namin, Ardabil, Meshkinshahr, Neer and Sarein were collected and identified. They were collected during summer 2007 from June to September, with general peaks appearing to be correlated with temperature mainly at 11 a.m to 15 p.m. The samples were identified using appropriate systematic key "nResults: A total of 231 specimens belonging to 9 beetle genera and at least 15 species were identified as Euoniticel¬lus fulvus, Sisyphus schaffaer, Euonthophagus taurus, Copris lunaris, Chironitis pamphilus, Gymnopleurus coriarus, Euonthophagus amyntas, Caccobius schreberi, Onthophagus speculifer, Onthophagus furcatus, Aphodius, lugens, Apho¬dius fimetarius, A. scrutator, Geotrupes spiniger and G. stercorarius"nThe most abundant and diverse subfamilies were Coprinae, Geotrupinae, and Aphodiinae. "nConclusion: We found 15 species of dung beetles occurred in the region. The prevalence of each species is varied depending on location. Some of them play an important role for helminths transmission of veterinary and public health importance. The finding will provide a clue for pasture management as well as public health monitoring and surveillance of the disease transmitted by dung beetles. 

  6. Interim Feasibility Report and Draft Environmental Impact Statement, Grays Harbor, Chehalis and Hoquiam Rivers, Washington, Channel Improvements for Navigation.

    Science.gov (United States)

    1982-06-01

    community depends on the continued descent of organic materials from the overlying waters for nourishment. The Dungeness crab ( Cancer magister) is an...immediately north and south of Grays Harbor. EIS-34 o Crabs. Dungeness crabs ( Cancer magister) are abundant in Grays Harbor, though most are smaller...Cooper Cultural Resources Mama Seattle District, Evaluation Corps of Engineers Endangered Species Brunner Seattle District, Evaluation Corps of Engineers

  7. On the regularity of mild solutions to complete higher order differential equations on Banach spaces

    Directory of Open Access Journals (Sweden)

    Nezam Iraniparast

    2015-09-01

    Full Text Available For the complete higher order differential equation u(n(t=Σk=0n-1Aku(k(t+f(t, t∈ R (* on a Banach space E, we give a new definition of mild solutions of (*. We then characterize the regular admissibility of a translation invariant subspace al M of BUC(R, E with respect to (* in terms of solvability of the operator equation Σj=0n-1AjXal Dj-Xal Dn = C. As application, almost periodicity of mild solutions of (* is proved.

  8. Tactical Radar Technology Study. Volume II.

    Science.gov (United States)

    1980-03-01

    0026 UNCLASSIFIED RADC-TR-D-4 8V OL-2 NL -AD A084885 -I " r N oS14t Rosen F Leo Canie OdK ArFm - Bucs Now@ Yo NUY344 80 5, 27 2 17 - --- ?TrM*A B. BRHLM... collectively meet the requirements for the dree separate functions. When one considers the ATR operational requirement for long-range surveillance in... collective network. The ability to alleviate the demands placed upon the resources of individual sensors, will be directly related to the efficiency with

  9. A cidade e as serras de Eça de Queiroz, o "esse adorável Virgílio": del bucolismo a la palingenesia = A cidade e as serras de Eça de Queiroz, ou "esse adorável Virgílio": do bucolismo à palingenesia = Eça de Queiroz’s A cidade e as serras , or "esse adorável Virgílio": between bucolism and palingenesy

    Directory of Open Access Journals (Sweden)

    Jurado, Francisco García

    2014-01-01

    Full Text Available A novela A cidade e as Serras de Eça de Queiroz, assim como seu texto anterior, o conto “Civilização” estão escritos a partir de varias características importantes da primeira Bucólica de Virgilio. Esta presença virgiliana se deve, em grande parte, à reação contraria ao decadentismo defendido por J. K. Huysmans e o desejo de regeneração, assim como a leitura sobre Virgilio que o pensador social P. J. Proudhon havía realizado

  10. Simulating Ru L 3 -Edge X-ray Absorption Spectroscopy with Time-Dependent Density Functional Theory: Model Complexes and Electron Localization in Mixed-Valence Metal Dimers

    Energy Technology Data Exchange (ETDEWEB)

    Van Kuiken, Benjamin E.; Valiev, Marat; Daifuku, Stephanie L.; Bannan, Caitlin; Strader, Matthew L.; Cho, Hana; Huse, Nils; Schoenlein, Robert W.; Govind, Niranjan; Khalil, Munira

    2013-05-30

    Ruthenium L3-edge X-ray absorption (XA) spectroscopy probes unoccupied 4d orbitals of the metal atom and is increasingly being used to investigate the local electronic structure in ground and excited electronic states of Ru complexes. The simultaneous development of computational tools for simulating Ru L3-edge spectra is crucial for interpreting the spectral features at a molecular level. This study demonstrates that time-dependent density functional theory (TDDFT) is a viable and predictive tool for simulating ruthenium L3-edge XA spectroscopy. We systematically investigate the effects of exchange correlation functional and implicit and explicit solvent interactions on a series of RuII and RuIII complexes in their ground and electronic excited states. The TDDFT simulations reproduce all of the experimentally observed features in Ru L3-edge XA spectra within the experimental resolution (0.4 eV). Our simulations identify ligand-specific charge transfer features in complicated Ru L3-edge spectra of [Ru(CN)6]4- and RuII polypyridyl complexes illustrating the advantage of using TDDFT in complex systems. We conclude that the B3LYP functional most accurately predicts the transition energies of charge transfer features in these systems. We use our TDDFT approach to simulate experimental Ru L3-edge XA spectra of transition metal mixed-valence dimers of the form [(NC)5MII-CN-RuIII(NH3)5] (where M = Fe or Ru) dissolved in water. Our study determines the spectral signatures of electron delocalization in Ru L3-edge XA spectra. We find that the inclusion of explicit solvent molecules is necessary for reproducing the spectral features and the experimentally determined valencies in these mixed-valence complexes. This study validates the use of TDDFT for simulating Ru 2p excitations using popular quantum chemistry codes and providing a powerful interpretive tool for equilibrium and ultrafast Ru L3-edge XA spectroscopy.

  11. Transcriptomic Analysis and the Expression of Disease-Resistant Genes in Oryza meyeriana under Native Condition.

    Directory of Open Access Journals (Sweden)

    Bin He

    Full Text Available Oryza meyeriana (O. meyeriana, with a GG genome type (2n = 24, accumulated plentiful excellent characteristics with respect to resistance to many diseases such as rice shade and blast, even immunity to bacterial blight. It is very important to know if the diseases-resistant genes exist and express in this wild rice under native conditions. However, limited genomic or transcriptomic data of O. meyeriana are currently available. In this study, we present the first comprehensive characterization of the O. meyeriana transcriptome using RNA-seq and obtained 185,323 contigs with an average length of 1,692 bp and an N50 of 2,391 bp. Through differential expression analysis, it was found that there were most tissue-specifically expressed genes in roots, and next to stems and leaves. By similarity search against protein databases, 146,450 had at least a significant alignment to existed gene models. Comparison with the Oryza sativa (japonica-type Nipponbare and indica-type 93-11 genomes revealed that 13% of the O. meyeriana contigs had not been detected in O. sativa. Many diseases-resistant genes, such as bacterial blight resistant, blast resistant, rust resistant, fusarium resistant, cyst nematode resistant and downy mildew gene, were mined from the transcriptomic database. There are two kinds of rice bacterial blight-resistant genes (Xa1 and Xa26 differentially or specifically expressed in O. meyeriana. The 4 Xa1 contigs were all only expressed in root, while three of Xa26 contigs have the highest expression level in leaves, two of Xa26 contigs have the highest expression profile in stems and one of Xa26 contigs was expressed dominantly in roots. The transcriptomic database of O. meyeriana has been constructed and many diseases-resistant genes were found to express under native condition, which provides a foundation for future discovery of a number of novel genes and provides a basis for studying the molecular mechanisms associated with disease

  12. Simulating Ru L3-edge X-ray absorption spectroscopy with time-dependent density functional theory: model complexes and electron localization in mixed-valence metal dimers.

    Science.gov (United States)

    Van Kuiken, Benjamin E; Valiev, Marat; Daifuku, Stephanie L; Bannan, Caitlin; Strader, Matthew L; Cho, Hana; Huse, Nils; Schoenlein, Robert W; Govind, Niranjan; Khalil, Munira

    2013-05-30

    Ruthenium L3-edge X-ray absorption (XA) spectroscopy probes unoccupied 4d orbitals of the metal atom and is increasingly being used to investigate the local electronic structure in ground and excited electronic states of Ru complexes. The simultaneous development of computational tools for simulating Ru L3-edge spectra is crucial for interpreting the spectral features at a molecular level. This study demonstrates that time-dependent density functional theory (TDDFT) is a viable and predictive tool for simulating ruthenium L3-edge XA spectroscopy. We systematically investigate the effects of exchange correlation functional and implicit and explicit solvent interactions on a series of Ru(II) and Ru(III) complexes in their ground and electronic excited states. The TDDFT simulations reproduce all of the experimentally observed features in Ru L3-edge XA spectra within the experimental resolution (0.4 eV). Our simulations identify ligand-specific charge transfer features in complicated Ru L3-edge spectra of [Ru(CN)6](4-) and Ru(II) polypyridyl complexes illustrating the advantage of using TDDFT in complex systems. We conclude that the B3LYP functional most accurately predicts the transition energies of charge transfer features in these systems. We use our TDDFT approach to simulate experimental Ru L3-edge XA spectra of transition metal mixed-valence dimers of the form [(NC)5M(II)-CN-Ru(III)(NH3)5](-) (where M = Fe or Ru) dissolved in water. Our study determines the spectral signatures of electron delocalization in Ru L3-edge XA spectra. We find that the inclusion of explicit solvent molecules is necessary for reproducing the spectral features and the experimentally determined valencies in these mixed-valence complexes. This study validates the use of TDDFT for simulating Ru 2p excitations using popular quantum chemistry codes and providing a powerful interpretive tool for equilibrium and ultrafast Ru L3-edge XA spectroscopy.

  13. SIRT1 genetic variants associate with the metabolic response of Caucasians to a controlled lifestyle intervention – the TULIP Study

    Directory of Open Access Journals (Sweden)

    Stefan Norbert

    2008-11-01

    Full Text Available Abstract Background Sirtuin1 (SIRT1 regulates gene expression in distinct metabolic pathways and mediates beneficial effects of caloric restriction in animal models. In humans, SIRT1 genetic variants associate with fasting energy expenditure. To investigate the relevance of SIRT1 for human metabolism and caloric restriction, we analyzed SIRT1 genetic variants in respect to the outcome of a controlled lifestyle intervention in Caucasians at risk for type 2 diabetes. Methods A total of 1013 non-diabetic Caucasians from the Tuebingen Family Study (TUEF were genotyped for four tagging SIRT1 SNPs (rs730821, rs12413112, rs7069102, rs2273773 for cross-sectional association analyses with prediabetic traits. SNPs that associated with basal energy expenditure in the TUEF cohort were additionally analyzed in 196 individuals who underwent a controlled lifestyle intervention (Tuebingen Lifestyle Intervention Program; TULIP. Multivariate regressions analyses with adjustment for relevant covariates were performed to detect associations of SIRT1 variants with the changes in anthropometrics, weight, body fat or metabolic characteristics (blood glucose, insulin sensitivity, insulin secretion and liver fat, measured by magnetic resonance techniques after the 9-month follow-up test in the TULIP study. Results Minor allele (X/A carriers of rs12413112 (G/A had a significantly lower basal energy expenditure (p = 0.04 and an increased respiratory quotient (p = 0.02. This group (rs12413112: X/A was resistant against lifestyle-induced improvement of fasting plasma glucose (GG: -2.01%, X/A: 0.53%; p = 0.04, had less increase in insulin sensitivity (GG: 17.3%, X/A: 9.6%; p = 0.05 and an attenuated decline in liver fat (GG: -38.4%, X/A: -7.5%; p = 0.01. Conclusion SIRT1 plays a role for the individual lifestyle intervention response, possibly owing to decreased basal energy expenditure and a lower lipid-oxidation rate in rs12413112 X/A allele carriers. SIRT1 genetic

  14. Computing Preferred Extensions for Argumentation Systems with Sets of Attacking

    DEFF Research Database (Denmark)

    Nielsen, Søren Holbech; Parsons, Simon

    2006-01-01

    The hitherto most abstract, and hence general, argumentation system, is the one described by Dung in a paper from 1995. This framework does not allow for joint attacks on arguments, but in a recent paper we adapted it to support such attacks, and proved that this adapted framework enjoyed the same...... formal properties as that of Dung. One problem posed by Dung's original framework, which was neglected for some time, is how to compute preferred extensions of the argumentation systems. However, in 2001, in a paper by Doutre and Mengin, a procedure was given for enumerating preferred extensions...... for these systems. In this paper we propose a method for enumerating preferred extensions of the potentially more complex systems, where joint attacks are allowed. The method is inspired by the one given by Doutre and Mengin....

  15. Enhancement of local species richness in tundra by seed dispersal through guts of muskox and barnacle goose

    DEFF Research Database (Denmark)

    Bruun, Hans Henrik; Lundgren, Rebekka; Philipp, Marianne

    2008-01-01

    The potential contribution of vertebrate-mediated seed rain to the maintenance of plant community richness in a High Arctic ecosystem was investigated. We analyzed viable seed content in dung of the four numerically most important terrestrial vertebrates in Northeast Greenland - muskox (Ovibos...... moschatus), barnacle goose (Branta leucopsis), Arctic fox (Alopex lagopus) and Arctic hare (Lepus arcticus). High numbers of plant propagules were found in the dung of muskox and barnacle goose. Seeds of many plant species were found in the faeces of one vertebrate species only. Propagule composition...... in barnacle goose droppings was relatively uniform over samples, with a high abundance of the nutritious bulbils of Polygonum viviparum (Bistorta vivipara), suggesting that geese have a narrow habitat preference and feed selectively. Propagule composition in muskox dung was diverse and heterogeneous among...

  16. Variations in dung beetles assemblages (Coleoptera: Scarabaeidae within two rain forest habitats in French Guiana Variaciones de las agregaciones de escarabajos coprófagos (Coleoptera: Scarabaeidae en dos hábitats del bosque tropical en la Guayana Francesa

    Directory of Open Access Journals (Sweden)

    François Feer

    2013-06-01

    Full Text Available The structure of dung beetle communities inhabiting tropical forests are known to be sensitive to many kinds of environmental changes such as microclimate related to vegetation structure. I examined Scarabaeinae assemblages in two sites of undisturbed high forest and two sites of low forest forming a transitional zone with the open habitat of an inselberg in French Guiana. Sampling was made with pitfall and flight interception traps during 2003 and 2004. The driest and warmest conditions characterized the low forest sites. Across two years we obtained 2 927 individuals from 61 species with pitfall traps and 1 431 individuals from 85 species with flight interception traps. Greater species richness and abundance characterized all sites sampled with pitfall traps during 2003 more than 2004. In 2003 no differences were detected among sites by rarefaction analyses. In 2004 the species richest high forest site was significantly different from one of the low forest sites. For both years Clench model asymptotes for species richness were greater in high forest than in low forest sites. For both years, mean per-trap species richness, abundance and biomass among high forest sites were similar and higher than in low forest sites, especially where the lowest humidity and the highest temperature were recorded. Within the two low forest sites, species richness and abundance recorded during the second year, decreased with distance to edge. Different dominant roller species characterized the pitfall samples in one site of low forest and in other sites. Small variations in microclimatic conditions correlated to canopy height and openness likely affected dung beetle assemblages but soil depth and the presence of large mammals providing dung resource may also play a significant role.Es conocido que la estructura de las comunidades de escarabajos coprófagos que habitan los bosques tropicales es sensible a diferentes tipos de cambios ambientales tales como el

  17. Monitoring low molecular weight heparins at therapeutic levels: dose-responses of, and correlations and differences between aPTT, anti-factor Xa and thrombin generation assays.

    Directory of Open Access Journals (Sweden)

    Owain Thomas

    Full Text Available Low molecular weight heparins (LMWH's are used to prevent and treat thrombosis. Tests for monitoring LMWH's include anti-factor Xa (anti-FXa, activated partial thromboplastin time (aPTT and thrombin generation. Anti-FXa is the current gold standard despite LMWH's varying affinities for FXa and thrombin.To examine the effects of two different LMWH's on the results of 4 different aPTT-tests, anti-FXa activity and thrombin generation and to assess the tests' concordance.Enoxaparin and tinzaparin were added ex-vivo in concentrations of 0.0, 0.5, 1.0 and 1.5 anti-FXa international units (IU/mL, to blood from 10 volunteers. aPTT was measured using two whole blood methods (Free oscillation rheometry (FOR and Hemochron Jr (HCJ and an optical plasma method using two different reagents (ActinFSL and PTT-Automat. Anti-FXa activity was quantified using a chromogenic assay. Thrombin generation (Endogenous Thrombin Potential, ETP was measured on a Ceveron Alpha instrument using the TGA RB and more tissue-factor rich TGA RC reagents.Methods' mean aPTT at 1.0 IU/mL LMWH varied between 54s (SD 11 and 69s (SD 14 for enoxaparin and between 101s (SD 21 and 140s (SD 28 for tinzaparin. ActinFSL gave significantly shorter aPTT results. aPTT and anti-FXa generally correlated well. ETP as measured with the TGA RC reagent but not the TGA RB reagent showed an inverse exponential relationship to the concentration of LMWH. The HCJ-aPTT results had the weakest correlation to anti-FXa and thrombin generation (Rs0.62-0.87, whereas the other aPTT methods had similar correlation coefficients (Rs0.80-0.92.aPTT displays a linear dose-response to LMWH. There is variation between aPTT assays. Tinzaparin increases aPTT and decreases thrombin generation more than enoxaparin at any given level of anti-FXa activity, casting doubt on anti-FXa's present gold standard status. Thrombin generation with tissue factor-rich activator is a promising method for monitoring LMWH's.

  18. Nepal Ambient Monitoring and Source Testing Experiment (NAMaSTE: emissions of particulate matter from wood- and dung-fueled cooking fires, garbage and crop residue burning, brick kilns, and other sources

    Directory of Open Access Journals (Sweden)

    T. Jayarathne

    2018-02-01

    Full Text Available The Nepal Ambient Monitoring and Source Testing Experiment (NAMaSTE characterized widespread and under-sampled combustion sources common to South Asia, including brick kilns, garbage burning, diesel and gasoline generators, diesel groundwater pumps, idling motorcycles, traditional and modern cooking stoves and fires, crop residue burning, and heating fire. Fuel-based emission factors (EFs; with units of pollutant mass emitted per kilogram of fuel combusted were determined for fine particulate matter (PM2.5, organic carbon (OC, elemental carbon (EC, inorganic ions, trace metals, and organic species. For the forced-draft zigzag brick kiln, EFPM2.5 ranged from 12 to 19 g kg−1 with major contributions from OC (7 %, sulfate expected to be in the form of sulfuric acid (31.9 %, and other chemicals not measured (e.g., particle-bound water. For the clamp kiln, EFPM2.5 ranged from 8 to 13 g kg−1, with major contributions from OC (63.2 %, sulfate (23.4 %, and ammonium (16 %. Our brick kiln EFPM2.5 values may exceed those previously reported, partly because we sampled emissions at ambient temperature after emission from the stack or kiln allowing some particle-phase OC and sulfate to form from gaseous precursors. The combustion of mixed household garbage under dry conditions had an EFPM2.5 of 7.4 ± 1.2 g kg−1, whereas damp conditions generated the highest EFPM2.5 of all combustion sources in this study, reaching up to 125 ± 23 g kg−1. Garbage burning emissions contained triphenylbenzene and relatively high concentrations of heavy metals (Cu, Pb, Sb, making these useful markers of this source. A variety of cooking stoves and fires fueled with dung, hardwood, twigs, and/or other biofuels were studied. The use of dung for cooking and heating produced higher EFPM2.5 than other biofuel sources and consistently emitted more PM2.5 and OC than burning hardwood and/or twigs; this trend was consistent across traditional mud

  19. Determination of enoxaparin with rotational thrombelastometry using the prothrombinase-induced clotting time reagent.

    Science.gov (United States)

    Schaden, Eva; Schober, Andreas; Hacker, Stefan; Spiss, Christian; Chiari, Astrid; Kozek-Langenecker, Sibylle

    2010-04-01

    Drug monitoring of low molecular weight heparin is generally not recommended, but could be reasonable in critically ill patients, whose risk for bleeding or thrombosis shows a high interpatient variability. Anti-Xa assays are not available around the clock even in central hospitals, whereas rotational thrombelastometry (ROTEM) becomes increasingly used at the bedside. Prothrombinase-induced clotting time (PiCT) reagent allows determination of factor Xa-inhibition in plasma. The aim of our study was to evaluate enoxaparin determination in whole blood with the ROTEM using specific test modifications, including PiCT. After ethics committee's approval, citrated whole blood obtained from overall 16 healthy volunteers was incubated with enoxaparin at 16 different anti-Xa concentrations. Main endpoint was the clotting time (CT) in ROTEM representing initial activation of clot formation. CT was determined in the new PiCT-ROTEM test, in a low-tissue factor-activated modification (LowTF-ROTEM) as well as in the commercially available heparin-sensitive ROTEM assays (HEPTEM and INTEM). In the absence of enoxaparin, CT values were 168.6 +/- 6.1 s (PiCT-ROTEM), 247.3 +/- 18.6 s (LowTF-ROTEM), and -6.2 +/- 7.9 s (INTEM-HEPTEM). A linear dependency (P anti-Xa concentration and CT was found for PiCT-ROTEM, LowTF-ROTEM, and for INTEM-HEPTEM with correlation coefficients of 0.93 for PiCT-ROTEM, 0.94 for LowTF-ROTEM, and 0.81 for INTEM-HEPTEM. This in-vitro experiment demonstrates a strong correlation between enoxaparin anti-Xa concentrations and specific ROTEM tests. These promising assays should be further evaluated for monitoring anticoagulation in high-risk patients in clinical studies.

  20. Cell growth and hydrogen production on the mixture of xylose and glucose using a novel strain of Clostridium sp. HR-1 isolated from cow dung compost

    Energy Technology Data Exchange (ETDEWEB)

    Xu, Ji-Fei; Ren, Nan-Qi; Wang, Ai-Jie; Qiu, Jie; Zhao, Qing-Liang; Feng, Yu-Jie; Liu, Bing-Feng [State Key Laboratory of Urban Water Resource and Environment (SKLUWRE), School of Municipal and Environmental Engineering, Harbin Institute of Technology, Harbin 150090 (China)

    2010-12-15

    A novel mesophilic hydrogen-producing bacterium was isolated from cow dung compost and designated as Clostridium sp. HR-1 by 16S rRNA gene sequence. The optimum condition for hydrogen production by strain HR-1 was pH of 6.5, temperature of 37 C and yeast extract as nitrogen sources. The strain HR-1 has the ability to utilize kinds of hexose and pentose as carbon sources for growth and H{sub 2} production. Cell growth and hydrogen productivity were investigated for batch fermentation on media containing different ratios of xylose and glucose. Glucose was the preferred substrate in the glucose and xylose mixtures. The high glucose fraction had higher cell biomass production rate. The rate of glucose consumption was higher than xylose consumption, and remained essentially constant independent of xylose content of the mixture. The rate of xylose utilization was decreased with increasing of the glucose fraction. The average H{sub 2} yield and specific H{sub 2} production rates with xylose and glucose are 1.63 mol-H{sub 2}/mol xylose and 11.14-H{sub 2} mmol/h g-cdw, and 2.02 mol-H{sub 2}/mol-glucose and 9.37 mmol-H{sub 2}/h g-cdw, respectively. Using the same initial substrate concentration, the maximum average H{sub 2} yield and specific H{sub 2} production rates with the mixtures of 9 g/l xylose and 3 g/l glucose was 2.01 mol-H{sub 2}/mol-mixed sugar and 12.56 mmol-H{sub 2}/h g-cdw, respectively. During the fermentation, the main soluble microbial products were ethanol and acetate which showed trends with the different ratios of xylose and glucose. (author)

  1. Oral heparin results in the appearance of heparin fragments in the plasma of rats

    International Nuclear Information System (INIS)

    Larsen, A.K.; Lund, D.P.; Langer, R.; Folkman, J.

    1986-01-01

    We have previously shown that angiogenesis inhibition and tumor regression can be accomplished by combinations of heparin or heparin fragments with cortisone. Oral heparin was also effective in combination with cortisone. We now show that a single oral dose of [ 35 S]heparin or [ 3 H]heparin (15,000 units/kg) results in continuous release of radioactive material into the bloodstream for at least 12 hr. This is associated with the presence of anti-factor Xa activity at a level of approximately equal to 0.1 unit/ml. The radioactive material is identified as oligo-, di-, and monosaccharides by its behavior in chromatographic systems, its possession of anti-factor Xa activity, and the effect of treatment with bacterial heparinase. The heparin fragments are extensively metabolized to fragments without anti-factor Xa activity that are readily subject to urinary excretion

  2. Searching Online Chemical Data Repositories via the ChemAgora Portal.

    Science.gov (United States)

    Zanzi, Antonella; Wittwehr, Clemens

    2017-12-26

    ChemAgora, a web application designed and developed in the context of the "Data Infrastructure for Chemical Safety Assessment" (diXa) project, provides search capabilities to chemical data from resources available online, enabling users to cross-reference their search results with both regulatory chemical information and public chemical databases. ChemAgora, through an on-the-fly search, informs whether a chemical is known or not in each of the external data sources and provides clikable links leading to the third-party web site pages containing the information. The original purpose of the ChemAgora application was to correlate studies stored in the diXa data warehouse with available chemical data. Since the end of the diXa project, ChemAgora has evolved into an independent portal, currently accessible directly through the ChemAgora home page, with improved search capabilities of online data sources.

  3. A farmer friendly and economic IPM strategy to combat root-knot nematodes infesting lentil

    OpenAIRE

    Rose Rizvi; Rizwan Ali Ansari; Gulshan Zehra; Irshad Mahmood

    2015-01-01

    An experiment was conducted to assess the effect of Rhizobium sp., waste tea leaves, eggshell powder, and composted cow dung manure on the root-knot nematode, Meloidogyne incognita, on lentil in Botany department AMU, Aligarh, India. When used alone, composted cow dung was better in reducing galling and nematode multiplication and improving lentil growth followed by eggshell powder, Rhizobium sp., and waste tea leaves. Significant result in the integrated management of M. incognita was obtain...

  4. バイオマス燃料ボイラーの高温排熱を利用した熱電発電システムの基礎特性

    OpenAIRE

    奥, 将俊; 松尾, 龍磨; 菅, 誠也; 姫野, 慎也; 田島, 大輔; 林, 則行; 杉本, 安寛

    2012-01-01

    Department of Agriculture in University of Miyazaki, developed the “cow-dung derived low moisture content biomass fuel" made from animal husbandry waste.###In this study, elucidated the basics characteristic of the fuel and developed the biomass direct combustion system which used of the “cow-dung derived low moisture content biomass fuel". In addition, installed the testing machine, and investigated basic characteristic of the machine. The basic characteristic was investigated about temperat...

  5. Waste recycling: utilization of coffee grounds and kitchen waste in vermicomposting.

    Science.gov (United States)

    Adi, A J; Noor, Z M

    2009-01-01

    Vermicomposting using Lumbricus rubellus for 49 days was conducted after 21 days of pre-composting. Three different combination of treatments were prepared with eight replicates for each treatment namely cow dung: kitchen waste in 30:70 ratio (T(1)), cow dung: coffee grounds in 30:70 ratio (T(2)), and cow dung: kitchen waste: coffee grounds in 30:35:35 ratio (T(3)). The multiplication of earthworms in terms of numbers and weight were measured at the end of vermicomposting. Consequently, only T(2) showed significant increase (from it initial stage) compared to other treatments. The presence of coffee grounds in T(2) and T(3) showed higher percentage of nutrient elements in vermicompost produced. The data reveal that coffee grounds can be decomposed through vermicomposting and help to enhance the quality of vermicompost produced rather than sole use of kitchen waste in vermicomposting.

  6. A narrativa comunicando espacialidades: mídias sociais e as mudanças no discurso sobre o território amazônico

    OpenAIRE

    Santos, Renata Nazaré Machado Tárrio dos

    2014-01-01

    Os discursos midiáticos sobre a Amazônia seguiram, na história brasileira, um mesmo padrão baseado no estereótipo primitivo e bucólico construído desde o descobrimento do país, alicerçado na literatura e mantido pelas mídias tradicionais. No entanto, o espaço amazônico sofreu transformações, recaindo numa Amazônia urbana e desenvolvida, embora ainda não reconhecida como tal. Isso ocorre justamente pela força que a narrativa estereotipada construiu durante a história. Sucede que...

  7. Tissue factor-dependent activation of tritium-labeled factor IX and factor X in human plasma

    International Nuclear Information System (INIS)

    Morrison, S.A.; Jesty, J.

    1984-01-01

    A comparism was made of the tissue factor-dependent activation of tritium-labeled factor IX and factor X in a human plasma system and a study was made of the role of proteases known to stimulate factor VII activity. Plasma was defibrinated by heating and depleted of its factors IX and X by passing it through antibody columns. Addition of human brain thromboplastin, Ca2+, and purified 3H-labeled factor X to the plasma resulted, after a short lag, in burst-like activation of the factor X, measured as the release of radiolabeled activation peptide. The progress of activation was slowed by both heparin and a specific inhibitor of factor Xa but factor X activation could not be completely abolished by such inhibitors. In the case of 3H-factor IX activation, the rate also increased for approximately 3 min after addition of thromboplastin, but was not subsequently curtailed. A survey of proteases implicated as activators of factor VII in other settings showed that both factor Xa and factor IXa could accelerate the activation of factor IX. However, factor Xa was unique in obliterating activation when present at concentrations greater than approximately 1 nM. Heparin inhibited the tissue factor-dependent activation of factor IX almost completely, apparently through the effect of antithrombin on the feedback reactions of factors Xa and IXa on factor VII. These results suggest that a very tight, biphasic control of factor VII activity exists in human plasma, which is modulated mainly by factor Xa. At saturation of factor VIIa/tissue factor, factor IX activation was significantly more rapid than was previously found in bovine plasma under similar conditions. The activation of factor X at saturation was slightly more rapid than in bovine plasma, despite the presence of heparin

  8. Use of Enoxaparin in Obese Adolescents During Bariatric Surgery--a Pilot Study.

    Science.gov (United States)

    Mushtaq, Alvina; Vaughns, Janelle D; Ziesenitz, Victoria C; Nadler, Evan P; van den Anker, John N

    2015-10-01

    Obese patients have a higher risk of venous thromboembolism when immobilized due to surgery. The objective of this study was to assess anti-factor Xa activity in adolescent bariatric surgical patients receiving prophylactic enoxaparin. Four morbidly obese adolescents undergoing laparoscopic sleeve gastrectomy were enrolled. Enoxaparin was administered (40 mg subcutaneous (SC) if BMI ≤50 kg/m(2) or 60 mg SC if BMI >50 kg/m(2)) for prevention of venous thromboembolism every 12 h starting after induction of anesthesia until discharge. Plasma anti-factor Xa activity was assessed over 12 h after the first dose and used as a surrogate marker for enoxaparin levels. Non-compartmental analysis of anti-factor Xa activity levels was performed and compared with previously published studies. Patients recruited were 16 to 18 years of age with a mean BMI of 52.6 ± 5.8 kg/m(2) (>99th BMI percentile). Peak anti-factor Xa activity ranged from 0.20 to 0.23 IU/mL in our study population, compared to 0.38 to 0.53 IU/mL in the cited lean comparator groups. Our current dosing practice of 40 mg SC for individuals with a BMI ≤50 kg/m(2) and 60 mg for individuals with a BMI ≥50 kg/m(2) resulted in anti-factor Xa activity that was sufficient for adequate thromboprophylaxis in adolescent bariatric surgical patients. Our data also demonstrates lower drug exposures in the obese when compared to lean patients. Therefore, randomized controlled efficacy and safety studies are urgently needed to guide the use of low-molecular-weight heparins in the pediatric and adolescent obese population.

  9. The flame characteristics of the biogas has produced through the digester method with various starters

    Science.gov (United States)

    Ketut, Caturwati Ni; Agung, Sudrajat; Mekro, Permana; Heri, Haryanto; Bachtiar

    2018-01-01

    Increasing the volume of waste, especially in urban areas is a source of problems in realizing the comfort and health of the environment. It needs to do a good handling of garbage so as to provide benefits for the whole community. Organic waste processing through bio-digester method to produce a biogas as an energy source is an effort. This research was conducted to test the characteristics of biogas flame generated from organic waste processing through digester with various of the starter such as: cow dung, goat manure, and leachate that obtained from the landfill at Bagendung-Cilegon. The flame height and maximum temperature of the flame are measured for the same pressure of biogas. The measurements showed the flame produced by bio-digester with leachate starter has the lowest flame height compared to the other types of biogas, and the highest flame height is given by biogas from digester with cow dung as a starter. The maximum flame temperature of biogas produced by leachate as a starter reaches 1027 °C. This value is 7% lower than the maximum flame temperature of biogas produced by cow dung as a starter. Cow dung was observed to be the best starter compared to goat manure and leachate, but the use of leachate as a starter in producing biogas with biodigester method is not the best but it worked.

  10. PEMBERIAN KOTORAN KAMBING TERHADAP PERTUMBUHAN DAN HASIL WORTEL (Daucus carota DAN BAWANG DAUN (Allium fistulosum L. DENGAN BUDIDAYA TUMPANGSARI

    Directory of Open Access Journals (Sweden)

    Trias Budi Rahayu

    2016-03-01

    Full Text Available Intercropping cultivation model is commonly used in organic farming system. The system is aimed to save land and fertilizer aside from creating biodiversity in a portion of a planting. The research was conducted in Permata Hati Farm, Ciburial Village, Cisarua Sub district, Bogor Regency, West Java from October 2012 to January 2013. The purposes of the research are: a to know the effect of goat dung application toward the growth and yield of organically managed carrot and scallion intercropping, and b to determine the best quantity of goat dung to promote growth and yield of carrot and scallion intercropping. Randomized Completely Block Design (RCBD with 6 treatments and 3 replications was used in this experiment. The treatments applied were 0 ton ha- 1, 5 ton ha-1, 10 ton ha-1, 15 ton ha-1, 20 ton ha-1, and 25 ton ha-1 of goat dung. Duncan’s Multiple Range Test (DMRT at the confidence level of 95% was used to analyze the result. The application of 15 ton ha-1 goat dung affected scallion’s height and number of seedlings as well as carrot’s biomass and height. This dosage resulted in the best yield of scallion and carrot intercropping.

  11. Incorporation of Bacterial Blight Resistance Genes Into Lowland Rice Cultivar Through Marker-Assisted Backcross Breeding.

    Science.gov (United States)

    Pradhan, Sharat Kumar; Nayak, Deepak Kumar; Pandit, Elssa; Behera, Lambodar; Anandan, Annamalai; Mukherjee, Arup Kumar; Lenka, Srikanta; Barik, Durga Prasad

    2016-07-01

    Bacterial blight (BB) of rice caused by Xanthomonas oryzae pv. oryzae is a major disease of rice in many rice growing countries. Pyramided lines carrying two BB resistance gene combinations (Xa21+xa13 and Xa21+xa5) were developed in a lowland cultivar Jalmagna background through backcross breeding by integrating molecular markers. In each backcross generation, markers closely linked to the disease resistance genes were used to select plants possessing the target genes. Background selection was continued in those plants carrying resistant genes until BC(3) generation. Plants having the maximum contribution from the recurrent parent genome were selected in each generation and hybridized with the recipient parent. The BB-pyramided line having the maximum recipient parent genome recovery of 95% was selected among BC3F1 plants and selfed to isolate homozygous BC(3)F(2) plants with different combinations of BB resistance genes. Twenty pyramided lines with two resistance gene combinations exhibited high levels of tolerance against the BB pathogen. In order to confirm the resistance, the pyramided lines were inoculated with different X. oryzae pv. oryzae strains of Odisha for bioassay. The genotypes with combination of two BB resistance genes conferred high levels of resistance to the predominant X. oryzae pv. oryzae isolates prevalent in the region. The pyramided lines showed similarity with the recipient parent with respect to major agro-morphologic traits.

  12. Disappearance of a low molecular weight heparin fraction (CY 216) differs from standard heparin in rabbits

    International Nuclear Information System (INIS)

    Boneu, B.; Buchanan, M.R.; Caranobe, C.; Gabaig, A.M.; Dupouy, D.; Sie, P.; Hirsh, J.

    1987-01-01

    In previous studies, we have reported that standard heparin (SH) was cleared by two mechanisms, a saturable mechanism which predominated at low doses (less than 100 anti-factor Xa U/kg) and a non-saturable mechanism which predominated at higher doses, when the first mechanism became saturated. In this study, we examined the importance of these two mechanisms in the disappearance of a low molecular weight heparin fraction (LMWH) (CY 216), by comparing the pharmacokinetics and the pharmacodynamics of a wide range of doses of SH and CY 216 (1.5 to 500 anti-factor Xa U/kg). Pharmacokinetics was measured as the disappearance of 125 I-radiolabelled SH or CY 216. Pharmacodynamics was measured as the disappearance of the anti-factor Xa activity of SH and CY 216. We found that the saturable mechanism contributed little to the disappearance of CY 216 and that it was cleared predominantly by the non-saturable mechanism at all doses tested. Thus, at low doses (less than 100 anti-factor Xa U/kg), SH was cleared more rapidly than CY 216, whereas at higher doses, CY 216 was cleared more rapidly than SH. We conclude that the mechanism of disappearance of LMWH's differ significantly from those of SH, and that this difference may explain the apparent prolonged anticoagulant activity of LMWH's within the therapeutic range doses

  13. Biogas Production and Engine Conversion From Diesel Engine to Biogas Engine for Lighting in Rural Area

    OpenAIRE

    Tun, Seint Thandar

    2012-01-01

    The research of alternative fuels implemented in internal combustion engines are becoming the subjects of interest nowadays. This paper describes a production of biogas from cow dung, diesel engine conversion process with piston modification of ZH1115 diesel engine. To produce biogas, the usual practice is to mix water with some organic material, such as cow dung (a free source of the appropriate micro-organisms). The slurry is placed in a leak-proof container (called a digester) and leaves i...

  14. Penerapan Iptek Biogas “Menuju Konsep Desa Mandiri Energy-dme” Di Desa Rarang Lombok Timur

    OpenAIRE

    Mara, I Made; Suartika, Made

    2015-01-01

    The implementation of science and communities service project is aimed to minimize destitution by implementing self feeding and energy generating village concept. The specific goal of this project is the utilization of cattle dung to produce a biogas. The method is being used for this project is by illuminating and educating the community to be able to build and operate the cattle dung biogas digester by their own. In addition, the community is completely involved to this project since the ea...

  15. Normal Female Germ Cell Differentiation Requires the Female X Chromosome to Autosome Ratio and Expression of Sex-Lethal in DROSOPHILA MELANOGASTER

    OpenAIRE

    Schüpbach, Trudi

    1985-01-01

    In somatic cells of Drosophila, the ratio of X chromosomes to autosomes (X:A ratio) determines sex and dosage compensation. The present paper addresses the question of whether germ cells also use the X:A ratio for sex determination and dosage compensation. Triploid female embryos were generated which, through the loss of an unstable ring-X chromosome, contained some germ cells of 2X;3A constitution in their ovaries. Such germ cells were shown to differentiate along one of two alternative pat...

  16. Survey of Forest Elephants Loxodonta cyclotis (Matschie, 1900 (Mammalia: Proboscidea: Elephantidae in the Bia Conservation Area, Ghana

    Directory of Open Access Journals (Sweden)

    Emmanuel Danquah

    2014-10-01

    Full Text Available Information on elephant ranges and numbers is vital for effective conservation and management, especially in western Africa where elephant populations are small and scattered.  The Bia Conservation Area (BCA in southwestern Ghana is a priority site for the conservation of Forest Elephants in western Africa.  A dung count was conducted using a systematic segmented track line design to determine the density and distribution of the BCA elephant population.  The mean density of dung-piles was 452.15 per sq.km. and mean dung survival time was estimated to be 54.64 days (SD 2 days, leading to an estimate of 146 elephants (95% confidence interval 98-172 with a density of 0.48/km2 for the BCA. This estimate probably makes the Bia forest elephant population the largest in Ghana.  Records of BCA elephant activities were also made.  This study augments the Regional African Elephant Database and should facilitate strategic planning and management programmes.

  17. UTILIZATION OF VERMIWASH POTENTIAL ON CERTAIN SUMMER VEGETABLE CROPS

    Directory of Open Access Journals (Sweden)

    GORAKH NATH

    2010-06-01

    Full Text Available The study was carried out to evaluate the impact of vermiwash on the growth, flowering and productivity of okra (Abelmoschus esculantus, lobia (Vigna unguiculata and radish (Raphnus sativus. Vermiwash was extracted from different vermicompost which was composted from different animal agro and kitchen wastes through earthworm Eisenia foetida. It was observed that treatment of vermiwash shows significantly increased in growth and productivity and decreased flowering period. The maximum significant growth was observed in 30 mg/m2 concentration of combination of buffalo dung with rice bran 38.0±1.3 cm. in case of okra, 30 mg/m2 concentration of combination of buffalo dung with gram bran (seed of Cicer arientinum 215.5±5.2 cm., in lobia crops and 30 mg/m2 concentration of buffalo dung with gram bran 20.4±1.4 cm. The significant early starting of flowering and increased in productivity was found in all treated groups with respect to control.

  18. The Xanthomonas Ax21 protein is processed by the general secretory system and is secreted in association with outer membrane vesicles

    Directory of Open Access Journals (Sweden)

    Ofir Bahar

    2014-01-01

    Full Text Available Pattern recognition receptors (PRRs play an important role in detecting invading pathogens and mounting a robust defense response to restrict infection. In rice, one of the best characterized PRRs is XA21, a leucine rich repeat receptor-like kinase that confers broad-spectrum resistance to multiple strains of the bacterial pathogen Xanthomonas oryzae pv. oryzae (Xoo. In 2009 we reported that an Xoo protein, called Ax21, is secreted by a type I-secretion system and that it serves to activate XA21-mediated immunity. This report has recently been retracted. Here we present data that corrects our previous model. We first show that Ax21 secretion does not depend on the predicted type I secretion system and that it is processed by the general secretion (Sec system. We further show that Ax21 is an outer membrane protein, secreted in association with outer membrane vesicles. Finally, we provide data showing that ax21 knockout strains do not overcome XA21-mediated immunity.

  19. Sensitivity of soil phosphorus tests in predicting the potential risk of phosphorus loss from pasture soil

    OpenAIRE

    H. SOINNE; K. SAARIJÄRVI; M. KARPPINEN

    2008-01-01

    The objective of this study was to examine the effects of urine and dung additions on the phosphorus (P) chemistry of pasture land and to compare the sensitivity of two soil extraction methods in assessing the P-loading risk. In a field experiment, urine and dung were added to soil in amounts corresponding to single excrement portions and the soil samples, taken at certain intervals, were analysed for pHH2O, acid ammonium acetate extractable P (PAc) and water extractable total P (TPw), and mo...

  20. Progress with the AGR system

    International Nuclear Information System (INIS)

    Merrett, D.J.

    1984-01-01

    The AGR programme was initiated in 1965 with the ordering of the Dungeness 'B' reactor, followed by Hinkley point 'B' (1965), Hunterston 'B' (1968), Hartlepool (1970), Heysham I (1970) and the two latest stations at Heysham II and Torness. The paper reviews the achievements and prospects for the AGR system under 6 topic headings. These include: operational experience at Hinkley Point 'B' and Hunterston'B', commissioning of Dungeness 'B', Hartlepool and Heysham I, Heysham II/Torness design, Heysham II/Torness programme and finally future prospects. (U.K.)