WorldWideScience

Sample records for dubnium 267

  1. Extraction systems for the study of dubnium

    International Nuclear Information System (INIS)

    Gates, J.M.; Sudowe, R.; Ali, M.N.; Calvert, M.G.; Dragojevic, I.; Ellison, P.A.; Garcia, M.A.; Gharibyan, N.; Gregorich, K.E.; Nelson, S.L.; Neumann, S.H.; Parsons-Moss, T.; Stavsetra, L.; Nitsche, H.

    2007-01-01

    The chemistry of transactinide elements (Z (ge) 104) is a topic of great interest in current nuclear chemistry research. The chemical systems that can be used in these studies are limited by the short half-lives of the isotopes and the small production rates of atoms per minute or even atoms per week. In the initial investigations, the chemistry used had to be very selective to the periodic group of interest to separate the transactinide atom from all the other unwanted nuclear reaction products, e.g., transfer products. By using the Berkeley Gas-filled Separator (BGS) as a physical pre-separator, we are able concentrate on systems that are selective between the members of the group of interest, because all other interfering products and the beam are being suppressed by the BGS [1]. We are developing suitable extraction systems for the study of element 105, dubnium. For this purpose we have studied the extraction of niobium and tantalum, the lighter homologs of dubnium, from mineral acids with different organophosphorus compounds. All studies were performed online, using short-lived niobium and tantalum produced in the 124 Sn( 51 V,5n) 170 Ta and 74 Se( 18 O,p3n) 88 Nb reactions. This allowed for the study of the lighter homologues at metal concentrations of 10 -16 M. At these low metal concentrations, the formation of polymeric species is largely prohibited. As seen in Fig. 1, by varying the extractant and the hydrochloric acid concentration from 1 to 11 M, we are able to see a difference in extraction behavior between niobium and tantalum. While the system is suitable for determining chemical differences between the lighter homologues, the extraction of tantalum from hydrochloric acid shows slow kinetics. Figure 2 shows that after 90 seconds of mixing, the system is not in equilibrium. However, experiments indicate that equilibrium is reached faster at higher acid concentrations. We have studied the influence of hydrogen ion concentration on the extraction

  2. 39 CFR 267.4 - Information security standards.

    Science.gov (United States)

    2010-07-01

    ... 39 Postal Service 1 2010-07-01 2010-07-01 false Information security standards. 267.4 Section 267... INFORMATION § 267.4 Information security standards. (a) The Postal Service will operate under a uniform set of information security standards which address the following functional aspects of information flow and...

  3. 39 CFR 267.5 - National Security Information.

    Science.gov (United States)

    2010-07-01

    ... 39 Postal Service 1 2010-07-01 2010-07-01 false National Security Information. 267.5 Section 267.5... § 267.5 National Security Information. (a) Purpose and scope. The purpose of this section is to provide regulations implementing Executive Order 12356 National Security Information (hereinafter referred to as the...

  4. 27 CFR 24.267 - Losses in transit.

    Science.gov (United States)

    2010-04-01

    ... 27 Alcohol, Tobacco Products and Firearms 1 2010-04-01 2010-04-01 false Losses in transit. 24.267 Section 24.267 Alcohol, Tobacco Products and Firearms ALCOHOL AND TOBACCO TAX AND TRADE BUREAU, DEPARTMENT OF THE TREASURY LIQUORS WINE Losses of Wine § 24.267 Losses in transit. Where the loss in transit of...

  5. 26 CFR 1.267(b)-1 - Relationships.

    Science.gov (United States)

    2010-04-01

    ... 26 Internal Revenue 3 2010-04-01 2010-04-01 false Relationships. 1.267(b)-1 Section 1.267(b)-1...) INCOME TAXES Items Not Deductible § 1.267(b)-1 Relationships. (a) In general. (1) The persons referred to... partnership separately. Therefore, if the other person and a partner are within any one of the relationships...

  6. 38 CFR 26.7 - VA environmental decision making and documents.

    Science.gov (United States)

    2010-07-01

    ... 38 Pensions, Bonuses, and Veterans' Relief 2 2010-07-01 2010-07-01 false VA environmental decision making and documents. 26.7 Section 26.7 Pensions, Bonuses, and Veterans' Relief DEPARTMENT OF VETERANS AFFAIRS (CONTINUED) ENVIRONMENTAL EFFECTS OF THE DEPARTMENT OF VETERANS AFFAIRS (VA) ACTIONS § 26.7 VA environmental decision making and document...

  7. 40 CFR 267.143 - Financial assurance for closure.

    Science.gov (United States)

    2010-07-01

    ...), utilizing the certificate of insurance for closure specified at 40 CFR 264.151(e). (f) Corporate financial... 40 Protection of Environment 26 2010-07-01 2010-07-01 false Financial assurance for closure. 267... PERMIT Financial Requirements § 267.143 Financial assurance for closure. The owner or operator must...

  8. 18 CFR 284.267 - Intrastate pipeline emergency transportation rates.

    Science.gov (United States)

    2010-04-01

    ... POLICY ACT OF 1978 AND RELATED AUTHORITIES Emergency Natural Gas Sale, Transportation, and Exchange... 18 Conservation of Power and Water Resources 1 2010-04-01 2010-04-01 false Intrastate pipeline emergency transportation rates. 284.267 Section 284.267 Conservation of Power and Water Resources FEDERAL...

  9. 40 CFR 267.53 - Who must have copies of the contingency plan?

    Science.gov (United States)

    2010-07-01

    ... contingency plan? 267.53 Section 267.53 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED... UNDER A STANDARDIZED PERMIT Contingency Plan and Emergency Procedures § 267.53 Who must have copies of the contingency plan? (a) You must maintain a copy of the plan with all revisions at the facility; and...

  10. 26 CFR 1.401(a)(26)-7 - Testing methods.

    Science.gov (United States)

    2010-04-01

    ... 26 Internal Revenue 5 2010-04-01 2010-04-01 false Testing methods. 1.401(a)(26)-7 Section 1.401(a... (CONTINUED) INCOME TAXES Pension, Profit-Sharing, Stock Bonus Plans, Etc. § 1.401(a)(26)-7 Testing methods... the rules in § 1.401(a)(26)-5. (b) Simplified testing method. A plan is treated as satisfying the...

  11. 40 CFR 267.148 - Incapacity of owners or operators, guarantors, or financial institutions.

    Science.gov (United States)

    2010-07-01

    ..., guarantors, or financial institutions. 267.148 Section 267.148 Protection of Environment ENVIRONMENTAL... FACILITIES OPERATING UNDER A STANDARDIZED PERMIT Financial Requirements § 267.148 Incapacity of owners or operators, guarantors, or financial institutions. (a) An owner or operator must notify the Regional...

  12. 40 CFR 267.147 - Liability requirements.

    Science.gov (United States)

    2010-07-01

    ... consideration of the guarantee. If the guarantor is a firm with a “substantial business relationship” with the... PERMIT Financial Requirements § 267.147 Liability requirements. (a) Coverage for sudden accidental... facilities, must demonstrate financial responsibility for bodily injury and property damage to third parties...

  13. 40 CFR 267.198 - What are the general operating requirements for my tank systems?

    Science.gov (United States)

    2010-07-01

    ... FACILITIES OPERATING UNDER A STANDARDIZED PERMIT Tank Systems § 267.198 What are the general operating... 40 Protection of Environment 26 2010-07-01 2010-07-01 false What are the general operating requirements for my tank systems? 267.198 Section 267.198 Protection of Environment ENVIRONMENTAL PROTECTION...

  14. Functional, genetic and chemical characterization of biosurfactants produced by plant growth-promoting Pseudomonas putida 267.

    Science.gov (United States)

    Kruijt, Marco; Tran, Ha; Raaijmakers, Jos M

    2009-08-01

    Plant growth-promoting Pseudomonas putida strain 267, originally isolated from the rhizosphere of black pepper, produces biosurfactants that cause lysis of zoospores of the oomycete pathogen Phytophthora capsici. The biosurfactants were characterized, the biosynthesis gene(s) partially identified, and their role in control of Phytophthora damping-off of cucumber evaluated. The biosurfactants were shown to lyse zoospores of Phy. capsici and inhibit growth of the fungal pathogens Botrytis cinerea and Rhizoctonia solani. In vitro assays further showed that the biosurfactants of strain 267 are essential in swarming motility and biofilm formation. In spite of the zoosporicidal activity, the biosurfactants did not play a significant role in control of Phytophthora damping-off of cucumber, since both wild type strain 267 and its biosurfactant-deficient mutant were equally effective, and addition of the biosurfactants did not provide control. Genetic characterization revealed that surfactant biosynthesis in strain 267 is governed by homologues of PsoA and PsoB, two nonribosomal peptide synthetases involved in production of the cyclic lipopeptides (CLPs) putisolvin I and II. The structural relatedness of the biosurfactants of strain 267 to putisolvins I and II was supported by LC-MS and MS-MS analyses. The biosurfactants produced by Ps. putida 267 were identified as putisolvin-like CLPs; they are essential in swarming motility and biofilm formation, and have zoosporicidal and antifungal activities. Strain 267 provides excellent biocontrol activity against Phytophthora damping-off of cucumber, but the lipopeptide surfactants are not involved in disease suppression. Pseudomonas putida 267 suppresses Phy. capsici damping-off of cucumber and provides a potential supplementary strategy to control this economically important oomycete pathogen. The putisolvin-like biosurfactants exhibit zoosporicidal and antifungal activities, yet they do not contribute to biocontrol of Phy

  15. 40 CFR 267.201 - What must I do when I stop operating the tank system?

    Science.gov (United States)

    2010-07-01

    ... OPERATING UNDER A STANDARDIZED PERMIT Tank Systems § 267.201 What must I do when I stop operating the tank... 40 Protection of Environment 26 2010-07-01 2010-07-01 false What must I do when I stop operating the tank system? 267.201 Section 267.201 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY...

  16. 40 CFR 267.175 - What special requirements must I meet for incompatible wastes?

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 26 2010-07-01 2010-07-01 false What special requirements must I meet for incompatible wastes? 267.175 Section 267.175 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) SOLID WASTES (CONTINUED) STANDARDS FOR OWNERS AND OPERATORS OF HAZARDOUS WASTE...

  17. 40 CFR 267.203 - What special requirements must I meet for incompatible wastes?

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 26 2010-07-01 2010-07-01 false What special requirements must I meet for incompatible wastes? 267.203 Section 267.203 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) SOLID WASTES (CONTINUED) STANDARDS FOR OWNERS AND OPERATORS OF HAZARDOUS WASTE...

  18. 43 CFR 30.267 - What if I disagree with the probate decision regarding tribal purchase option?

    Science.gov (United States)

    2010-10-01

    ... decision regarding tribal purchase option? 30.267 Section 30.267 Public Lands: Interior Office of the Secretary of the Interior INDIAN PROBATE HEARINGS PROCEDURES Tribal Purchase of Interests Under Special Statutes § 30.267 What if I disagree with the probate decision regarding tribal purchase option? If you are...

  19. 40 CFR 267.116 - What must I do with contaminated equipment, structure, and soils?

    Science.gov (United States)

    2010-07-01

    ... equipment, structure, and soils? 267.116 Section 267.116 Protection of Environment ENVIRONMENTAL PROTECTION..., structure, and soils? You must properly dispose of or decontaminate all contaminated equipment, structures, and soils during the partial and final closure periods. By removing any hazardous wastes or hazardous...

  20. 40 CFR 267.150 - State assumption of responsibility.

    Science.gov (United States)

    2010-07-01

    ... STANDARDIZED PERMIT Financial Requirements § 267.150 State assumption of responsibility. (a) If a State either assumes legal responsibility for an owner's or operator's compliance with the closure care or liability... 40 Protection of Environment 26 2010-07-01 2010-07-01 false State assumption of responsibility...

  1. Cold Fusion Production and Decay of Neutron-Deficient Isotopes of Dubnium and Development of Extraction Systems for Group V Elements

    Energy Technology Data Exchange (ETDEWEB)

    Gates, Jacklyn M. [Univ. of California, Berkeley, CA (United States)

    2008-07-31

    Excitation functions for the 1n and 2n exit channels of the 208Pb(51V,xn)259-xDb reaction were measured. A maximum cross section of the 1n exit channel of 2070$+1100\\atop{-760}$ pb was measured at an excitation energy of 16.0 ± 1.8 MeV. For the 2n exit channel, a maximum cross section of 1660$+450\\atop{-370}$ pb was measured at 22.0 ± 1.8 MeV excitation energy. The 1n excitation function for the 209Bi(50Ti,n)258Db reaction was remeasured, resulting in a cross section of 5480$+1730\\atop{-1370}$ pb at an excitation energy of 16.0 ± 1.6 MeV. Differences in cross section maxima are discussed in terms of the fusion probability below the barrier. The extraction of niobium (Nb) and tantalum (Ta) from hydrochloric acid and mixed hydrochloric acid/lithium chloride media by bis(2-ethylhexyl) hydrogen phosphate (HDEHP) and bis(2-ethylhexyl) hydrogen phosphite (BEHP) was studied. The goal of the experiments was to find a system that demonstrates selectivity among the members of group five of the Periodic Table and is also suitable for the study of dubnium (Db, Z = 105). Experiments with niobium and tantalum were performed with carrier (10-6 M), carrier free (10-10 M) and trace (10-16 M) concentrations of metal using hydrochloric acid solution with concentrations ranging from 1 - 11 M. The extraction of niobium and tantalum from mixed hydrochloric acid/lithium chloride media by HDEHP and BEHP as a function of hydrogen ion (H+) concentration was also investigated. The data obtained are used as the basis to discuss the speciation of niobium and tantalum under the conditions studied and to evaluate possible extraction mechanisms. The 74Se(18O,p3n)88gNb excitation function was measured to determine the best energy for producing the 88Nb used in chemistry experiments. A maximum cross section of 495 +- 5 mb was observed at an 18O energy of 74.0 Me

  2. 49 CFR 40.267 - What problems always cause an alcohol test to be cancelled?

    Science.gov (United States)

    2010-10-01

    ... cancelled? 40.267 Section 40.267 Transportation Office of the Secretary of Transportation PROCEDURES FOR... always cause an alcohol test to be cancelled? As an employer, a BAT, or an STT, you must cancel an... the test was cancelled and must be treated as if the test never occurred. These problems are: (a) In...

  3. 40 CFR 267.174 - What special requirements must I meet for ignitable or reactive waste?

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 26 2010-07-01 2010-07-01 false What special requirements must I meet for ignitable or reactive waste? 267.174 Section 267.174 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) SOLID WASTES (CONTINUED) STANDARDS FOR OWNERS AND OPERATORS OF HAZARDOUS WASTE...

  4. Functional characterization of the protein C A267T mutation: evidence for impaired secretion due to defective intracellular transport

    Directory of Open Access Journals (Sweden)

    Tjeldhorn Lena

    2010-09-01

    Full Text Available Abstract Background Activated protein C (PC is a serine protease that regulates blood coagulation by inactivating coagulation factors Va and VIIIa. PC deficiency is an autosomally inherited disorder associated with a high risk of recurrent venous thrombosis. The aim of the study was to explore the mechanisms responsible for severe PC deficiency in a patient with the protein C A267T mutation by in-vitro expression studies. Results Huh7 and CHO-K1 cells were transiently transfected with expression vectors containing wild-type (WT PC and mutated PC (A267T PC cDNAs. PC mRNA levels were assessed by qRT-PCR and the PC protein levels were measured by ELISA. The mRNA levels of WT PC and A267T PC were similar, while the intracellular protein level of A267T PC was moderately decreased compared to WT PC. The secretion of A267T PC into the medium was severely impaired. No differences in molecular weights were observed between WT and A267T PC before and after treatment with endo-β-N-acetylglucosaminidase. Proteasomal and lysosomal degradations were examined using lactacystin and bafilomycin, respectively, and revealed that A267T PC was slightly more susceptible for proteasomal degradation than WT PC. Intracellular co-localization analysis indicated that A267T PC was mainly located in the endoplasmic reticulum (ER, whereas WT PC was observed in both ER and Golgi. Conclusions In contrast to what has been reported for other PC mutants, intracellular degradation of A267T PC was not the main/dominant mechanism underlying the reduced intracellular and secretion levels of PC. Our results indicate that the A267T mutation most likely caused misfolding of PC, which might lead to increased retention of the mutated PC in ER.

  5. 40 CFR 267.202 - What special requirements must I meet for ignitable or reactive wastes?

    Science.gov (United States)

    2010-07-01

    ... material no longer meets the definition of ignitable or reactive waste under § 261.21 or § 261.23 of this... requirements for the maintenance of protective distances between the waste management area and any public ways... for ignitable or reactive wastes? 267.202 Section 267.202 Protection of Environment ENVIRONMENTAL...

  6. 5 CFR 532.267 - Special wage schedules for aircraft, electronic, and optical instrument overhaul and repair...

    Science.gov (United States)

    2010-01-01

    ... manufacturing. 334418 Printed circuit assembly (electronic assembly) manufacturing. 334419 Other electronic..., electronic, and optical instrument overhaul and repair positions in Puerto Rico. 532.267 Section 532.267 Administrative Personnel OFFICE OF PERSONNEL MANAGEMENT CIVIL SERVICE REGULATIONS PREVAILING RATE SYSTEMS...

  7. 47 CFR 90.267 - Assignment and use of frequencies in the 450-470 MHz band for low power use.

    Science.gov (United States)

    2010-10-01

    ...-470 MHz band for low power use. 90.267 Section 90.267 Telecommunication FEDERAL COMMUNICATIONS... Special Frequencies or Frequency Bands § 90.267 Assignment and use of frequencies in the 450-470 MHz band... medical radio telemetry device with an output power not to exceed 20 milliwatts without specific...

  8. 40 CFR 267.90 - Who must comply with this section?

    Science.gov (United States)

    2010-07-01

    ... PERMIT Releases from Solid Waste Management Units § 267.90 Who must comply with this section? This subpart applies to you if you own or operate a facility that treats or stores hazardous waste under a 40...

  9. 40 CFR 267.170 - Does this subpart apply to me?

    Science.gov (United States)

    2010-07-01

    ... PERMIT Use and Management of Containers § 267.170 Does this subpart apply to me? This subpart applies to you if you own or operate a facility that treats or stores hazardous waste in containers under a 40...

  10. 40 CFR 267.34 - When must personnel have access to communication equipment or an alarm system?

    Science.gov (United States)

    2010-07-01

    ... to an internal alarm or emergency communication device, either directly or through visual or voice... communication equipment or an alarm system? 267.34 Section 267.34 Protection of Environment ENVIRONMENTAL... have access to communication equipment or an alarm system? (a) Whenever hazardous waste is being poured...

  11. Protein kinase A phosphorylates serine 267 in the homeodomain of engrailed-2 leading to decreased DNA binding

    DEFF Research Database (Denmark)

    Hjerrild, Majbrit; Stensballe, Allan; Jensen, Ole N

    2004-01-01

    Engrailed-2 (En-2) belongs to an evolutionarily conserved family of DNA binding homeodomain-containing proteins that are expressed in mammalian brain during development. Here, we demonstrate that serine 267 in the homeodomain of En-2 is phosphorylated by protein kinase A (PKA) in forskolin......-treated COS-7 cells. Furthermore, we analyze the physiological function of En-2 phosphorylation by PKA. The nuclear localization of En-2 is not influenced by the phosphorylation of serine 267. However, substitution of serine 267 with alanine resulted in increased binding of En-2 to DNA, while replacing serine...

  12. 40 CFR 267.171 - What standards apply to the containers?

    Science.gov (United States)

    2010-07-01

    ... STANDARDIZED PERMIT Use and Management of Containers § 267.171 What standards apply to the containers... to the management of the containers. (a) Condition of containers. If a container holding hazardous... that are compatible and will not react with the hazardous waste to be stored. (c) Management of...

  13. 40 CFR 267.101 - What must I do to address corrective action for solid waste management units?

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 26 2010-07-01 2010-07-01 false What must I do to address corrective action for solid waste management units? 267.101 Section 267.101 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) SOLID WASTES (CONTINUED) STANDARDS FOR OWNERS AND OPERATORS OF HAZARDOUS WASTE FACILITIES OPERATING UNDER A...

  14. Mutation of androgen receptor N-terminal phosphorylation site Tyr-267 leads to inhibition of nuclear translocation and DNA binding.

    Directory of Open Access Journals (Sweden)

    Mehmet Karaca

    Full Text Available Reactivation of androgen receptor (AR may drive recurrent prostate cancer in castrate patients. Ack1 tyrosine kinase is overexpressed in prostate cancer and promotes castrate resistant xenograft tumor growth and enhances androgen target gene expression and AR recruitment to enhancers. Ack1 phosphorylates AR at Tyr-267 and possibly Tyr-363, both in the N-terminal transactivation domain. In this study, the role of these phosphorylation sites was investigated by characterizing the phosphorylation site mutants in the context of full length and truncated AR lacking the ligand-binding domain. Y267F and Y363F mutants showed decreased transactivation of reporters. Expression of wild type full length and truncated AR in LNCaP cells increased cell proliferation in androgen-depleted conditions and increased colony formation. However, the Y267F mutant of full length and truncated AR was defective in stimulating cell proliferation. The Y363F mutant was less severely affected than the Y267F mutant. The full length AR Y267F mutant was defective in nuclear translocation induced by androgen or Ack1 kinase. The truncated AR was constitutively localized to the nucleus. Chromatin immunoprecipitation analysis showed that it was recruited to the target enhancers without androgen. The truncated Y267F AR mutant did not exhibit constitutive nuclear localization and androgen enhancer binding activity. These results support the concept that phosphorylation of Tyr-267, and to a lesser extent Tyr-363, is required for AR nuclear translocation and recruitment and DNA binding and provide a rationale for development of novel approaches to inhibit AR activity.

  15. 40 CFR 267.54 - When must I amend the contingency plan?

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 26 2010-07-01 2010-07-01 false When must I amend the contingency plan... STANDARDIZED PERMIT Contingency Plan and Emergency Procedures § 267.54 When must I amend the contingency plan? You must review, and immediately amend the contingency plan, if necessary, whenever: (a) The facility...

  16. 20 CFR 1002.267 - How is compensation during the period of service calculated in order to determine the employee's...

    Science.gov (United States)

    2010-04-01

    ... 20 Employees' Benefits 3 2010-04-01 2010-04-01 false How is compensation during the period of service calculated in order to determine the employee's pension benefits, if benefits are based on compensation? 1002.267 Section 1002.267 Employees' Benefits OFFICE OF THE ASSISTANT SECRETARY FOR VETERANS' EMPLOYMENT AND TRAINING SERVICE, DEPARTMENT OF...

  17. 40 CFR 267.55 - What is the role of the emergency coordinator?

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 26 2010-07-01 2010-07-01 false What is the role of the emergency... STANDARDIZED PERMIT Contingency Plan and Emergency Procedures § 267.55 What is the role of the emergency... familiar with all aspects of the facility's contingency plan, all operations and activities at the facility...

  18. WAY 267,464, a non-peptide oxytocin receptor agonist, impairs social recognition memory in rats through a vasopressin 1A receptor antagonist action.

    Science.gov (United States)

    Hicks, Callum; Ramos, Linnet; Reekie, Tristan A; Narlawar, Rajeshwar; Kassiou, Michael; McGregor, Iain S

    2015-08-01

    Recent in vitro studies suggest that the oxytocin receptor (OTR) agonist WAY 267,464 has vasopressin 1A receptor (V1AR) antagonist effects. This might limit its therapeutic potential due to the positive involvement of the V1AR in social behavior. The objective of this study was to assess functional V1AR antagonist-like effects of WAY 267,464 in vivo using a test of social recognition memory. Adult experimental rats were tested for their recognition of a juvenile conspecific rat that they had briefly met 30 or 120 min previously. The modulatory effects of vasopressin (AVP), the selective V1AR antagonist SR49059, and WAY 267,464 were examined together with those of the selective OTR antagonist Compound 25 (C25). Drugs were administered immediately after the first meeting. Control rats showed recognition of juveniles at a 30 min, but not a 120 min retention interval. AVP (0.005, but not 0.001 mg/kg intraperitoneal (i.p.)) improved memory such that recognition was evident after 120 min. This was prevented by pretreatment with SR49059 (1 mg/kg) and WAY 267,464 (10, 30, and 100 mg/kg). Given alone, SR49059 (1 mg/kg) and WAY 267,464 (30 and 100 mg/kg) impaired memory at a 30 min retention interval. The impairment with WAY 267,464 was not prevented by C25 (5 mg/kg), suggesting V1AR rather than OTR mediation of the effect. Given alone, C25 also impaired memory. These results highlight a tonic role for endogenous AVP (and oxytocin) in social recognition memory and indicate that WAY 267,464 functions in vivo as a V1AR antagonist to prevent the memory-enhancing effects of AVP.

  19. Functional, genetic and chemical characterization of biosurfactants produced by plant growth-promoting Pseudomonas putida 267

    NARCIS (Netherlands)

    Kruijt, M.; Tran, H.; Raaijmakers, J.M.

    2009-01-01

    Aims: Plant growth-promoting Pseudomonas putida strain 267, originally isolated from the rhizosphere of black pepper, produces biosurfactants that cause lysis of zoospores of the oomycete pathogen Phytophthora capsici. The biosurfactants were characterized, the biosynthesis gene(s) partially

  20. 78 FR 56859 - Foreign-Trade Zone 267-Fargo, North Dakota; Authorization of Production Activity; CNH America...

    Science.gov (United States)

    2013-09-16

    ... DEPARTMENT OF COMMERCE Foreign-Trade Zones Board [B-51-2013] Foreign-Trade Zone 267--Fargo, North Dakota; Authorization of Production Activity; CNH America, LLC, (Construction and Agricultural Equipment..., submitted a notification of proposed production activity to the Foreign-Trade Zones (FTZ) Board on behalf of...

  1. 40 CFR 267.176 - What must I do when I want to stop using the containers?

    Science.gov (United States)

    2010-07-01

    ... (CONTINUED) SOLID WASTES (CONTINUED) STANDARDS FOR OWNERS AND OPERATORS OF HAZARDOUS WASTE FACILITIES OPERATING UNDER A STANDARDIZED PERMIT Use and Management of Containers § 267.176 What must I do when I want to stop using the containers? You must remove all hazardous waste and hazardous waste residues from...

  2. 78 FR 33052 - Foreign-Trade Zone (FTZ) 267-Fargo, North Dakota; Notification of Proposed Production Activity...

    Science.gov (United States)

    2013-06-03

    ...%) for the foreign status inputs noted below and in the existing scope of authority. Customs duties also... Agricultural Equipment Production); Fargo, North Dakota The Fargo Municipal Airport Authority, grantee of FTZ... within Site 2 of FTZ 267. The facilities currently have FTZ authority to produce tractors, wheel loaders...

  3. Body temperature and cardiac changes induced by peripherally administered oxytocin, vasopressin and the non-peptide oxytocin receptor agonist WAY 267,464: a biotelemetry study in rats

    Science.gov (United States)

    Hicks, C; Ramos, L; Reekie, T; Misagh, G H; Narlawar, R; Kassiou, M; McGregor, I S

    2014-01-01

    Background and Purpose There is current interest in oxytocin (OT) as a possible therapeutic in psychiatric disorders. However, the usefulness of OT may be constrained by peripheral autonomic effects, which may involve an action at both OT and vasopressin V1A receptors. Here, we characterized the cardiovascular and thermoregulatory effects of OT, vasopressin (AVP) and the non-peptide OT receptor agonist WAY 267,464 in rats, and assessed the relative involvement of the OT and V1A receptors in these effects. Experimental Approach Biotelemetry in freely moving male Wistar rats was used to examine body temperature and heart rate after OT (0.01 – 1 mg kg−1; i.p.), AVP (0.001 – 0.1 mg kg−1; i.p.) or WAY 267,464 (10 and 100 mg kg−1; i.p.). The actions of the OT receptor antagonist Compound 25 (C25, 5 and 10 mg kg−1) and V1A receptor antagonist SR49059 (1 and 10 mg kg−1) were studied, as well as possible V1A receptor antagonist effects of WAY 267,464. Key Results OT and AVP dose-dependently reduced body temperature and heart rate. WAY 267,464 had similar, but more modest, effects. SR49059, but not C25, prevented the hypothermia and bradycardia induced by OT and AVP. WAY 267,464 (100 mg·kg−1) prevented the effects of OT, and to some extent AVP. Conclusions and Implications Peripherally administered OT and AVP have profound cardiovascular and thermoregulatory effects that appear to principally involve the V1A receptor rather than the OT receptor. Additionally, WAY 267,464 is not a simple OT receptor agonist, as it has functionally relevant V1A antagonist actions. PMID:24641248

  4. Body temperature and cardiac changes induced by peripherally administered oxytocin, vasopressin and the non-peptide oxytocin receptor agonist WAY 267,464: a biotelemetry study in rats.

    Science.gov (United States)

    Hicks, C; Ramos, L; Reekie, T; Misagh, G H; Narlawar, R; Kassiou, M; McGregor, I S

    2014-06-01

    There is current interest in oxytocin (OT) as a possible therapeutic in psychiatric disorders. However, the usefulness of OT may be constrained by peripheral autonomic effects, which may involve an action at both OT and vasopressin V1A receptors. Here, we characterized the cardiovascular and thermoregulatory effects of OT, vasopressin (AVP) and the non-peptide OT receptor agonist WAY 267,464 in rats, and assessed the relative involvement of the OT and V1A receptors in these effects. Biotelemetry in freely moving male Wistar rats was used to examine body temperature and heart rate after OT (0.01 - 1 mg kg(-1); i.p.), AVP (0.001 - 0.1 mg kg(-1); i.p.) or WAY 267,464 (10 and 100 mg kg(-1); i.p.). The actions of the OT receptor antagonist Compound 25 (C25, 5 and 10 mg kg(-1)) and V1A receptor antagonist SR49059 (1 and 10 mg kg(-1)) were studied, as well as possible V1A receptor antagonist effects of WAY 267,464. OT and AVP dose-dependently reduced body temperature and heart rate. WAY 267,464 had similar, but more modest, effects. SR49059, but not C25, prevented the hypothermia and bradycardia induced by OT and AVP. WAY 267,464 (100 mg·kg(-1)) prevented the effects of OT, and to some extent AVP. Peripherally administered OT and AVP have profound cardiovascular and thermoregulatory effects that appear to principally involve the V1A receptor rather than the OT receptor. Additionally, WAY 267,464 is not a simple OT receptor agonist, as it has functionally relevant V1A antagonist actions. © 2014 The British Pharmacological Society.

  5. Characterization of Group V Dubnium Homologs on DGA Extraction Chromatography Resin from Nitric and Hydrofluoric Acid Matrices

    Energy Technology Data Exchange (ETDEWEB)

    Despotopulos, J D; Sudowe, R

    2012-02-21

    Studies of the chemical properties of superheavy elements (SHE) pose interesting challenges due to their short half-lives and low production rates. Chemical systems must have extremely fast kinetics, fast enough kinetics to be able to examine the chemical properties of interest before the SHE decays to another nuclide. To achieve chemistry on such time scales, the chemical system must also be easily automated. Most importantly however, a chemical system must be developed which provides suitable separation and kinetics before an on-line study of a SHE can be performed. Relativistic effects make studying the chemical properties of SHEs interesting due to the impact these effects could have on the SHEs chemical properties. Relativistic effects arise when the velocity of the s orbital electrons approach the speed of light. As this velocity increases, the Bohr radius of the inner electron orbitals decreases and there is an increase in the particles mass. This contraction results in a destabilization of the energy of the outer d and f electron orbitals (5f and 6d in the case of SHE), which can cause these to expand due to their increased shielding from the nuclear charge. Another relativistic effect is the spin-orbit splitting for p, d, and f orbitals into j = 1 {+-} 1/2 states. This can lead most interestingly to a possible increased stability of element 114, which due to large spin-orbit splitting of the 7p orbital and the relativistically stabilized 7p{sub 1/2} and 7s orbital gives rise to a closed shell ground state of 7s{sup 2}7p{sub 1/2}{sup 2}. The homologs of element 105, dubnium (Db), Ta and Nb and the pseudo-homolog Pa, are well known to hydrolyze and form both neutral and non-neutral monoatomic and polyatomic species that may cause issues with extraction from a given chemical system. Early ion-exchange and solvent-extraction studies show mixed results for the behavior of Db. Some studies show Db behaving most similar to Ta, while others show it behaving

  6. Determination of Pesticides by Gas Chromatography Combined with Mass Spectrometry Using Femtosecond Lasers Emitting at 267, 400, and 800 nm as the Ionization Source.

    Science.gov (United States)

    Yang, Xixiang; Imasaka, Tomoko; Imasaka, Totaro

    2018-04-03

    A standard sample mixture containing 51 pesticides was separated by gas chromatography (GC), and the constituents were identified by mass spectrometry (MS) using femtosecond lasers emitting at 267, 400, and 800 nm as the ionization source. A two-dimensional display of the GC/MS was successfully used for the determination of these compounds. A molecular ion was observed for 38 of the compounds at 267 nm and for 30 of the compounds at 800 nm, in contrast to 27 among 50 compounds when electron ionization was used. These results suggest that the ultraviolet laser is superior to the near-infrared laser for molecular weight determinations and for a more reliable analysis of these compounds. In order to study the conditions for optimal ionization, the experimental data were examined using the spectral properties (i.e., the excitation and ionization energies and absorption spectra for the neutral and ionized species) obtained by quantum chemical calculations. A few molecules remained unexplained by the currently reported rules, requiring additional rules for developing a full understanding of the femtosecond ionization process. The pesticides in the homogenized matrix obtained from kabosu ( citrus sphaerocarpa) were measured using lasers emitting at 267 and 800 nm. The pesticides were clearly separated and measured on the two-dimensional display, especially for the data measured at 267 nm, suggesting that this technique would have potential for use in the practical trace analysis of the pesticides in the environment.

  7. 40 CFR 267.200 - What must I do in case of a leak or a spill?

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 26 2010-07-01 2010-07-01 false What must I do in case of a leak or a... UNDER A STANDARDIZED PERMIT Tank Systems § 267.200 What must I do in case of a leak or a spill? If there has been a leak or a spill from a tank system or secondary containment system, or if either system is...

  8. NuSTAR reveals the extreme properties of the super-Eddington accreting supermassive black hole in PG 1247+267

    DEFF Research Database (Denmark)

    Lanzuisi, G.; Perna, M.; Comastri, A.

    2016-01-01

    PG1247+267 is one of the most luminous known quasars at z similar to 2 and is a strongly super-Eddington accreting supermassive black hole (SMBH) candidate. We obtained NuSTAR data of this intriguing source in December 2014 with the aim of studying its high-energy emission, leveraging the broad...

  9. Novel selective catalytic reduction with tritium: synthesis of the GABAA receptor radioligand 1-(4-ethynylphenyl)-4-[2,3-3H2]propyl-2,6,7-trioxabicyclo[2.2.2 ]octane

    International Nuclear Information System (INIS)

    Palmer, C.J.; Casida, J.E.

    1991-01-01

    Protection of the terminal alkyne function in 1-(4-ethynylphenyl)-4-(prop-2-enyl)-2,6,7-trioxabicyclo[2.2.2] octane with a trimethylsilyl group permits the selective catalytic reduction of the olefin moiety with tritium gas to give after deprotection 1-(4-ethynylphenyl)-4-[2,3- 3 H 2 ] propyl-2,6,7-trioxabicyclo-[2.2.2] octane. The labeled product at high specific activity is an improved radioligand for the GABA-gated chloride channel of insects and mammals and the intermediate 4-[2,3- 3 H 2 ]propyl-1-[4-[(trimethylsilyl)ethynyl]phenyl]-2,6,7-trioxabicyclo[2.2.2]octane is useful for studies on the metabolic activation of this selective proinsecticide. (author)

  10. Nisin Z Production by Lactococcus lactis subsp. cremoris WA2-67 of Aquatic Origin as a Defense Mechanism to Protect Rainbow Trout (Oncorhynchus mykiss, Walbaum) Against Lactococcus garvieae.

    Science.gov (United States)

    Araújo, Carlos; Muñoz-Atienza, Estefanía; Pérez-Sánchez, Tania; Poeta, Patrícia; Igrejas, Gilberto; Hernández, Pablo E; Herranz, Carmen; Ruiz-Zarzuela, Imanol; Cintas, Luis M

    2015-12-01

    Probiotics represent an alternative to chemotherapy and vaccination to control fish diseases, including lactococcosis caused by Lactococcus garvieae. The aims of this study were (i) to determine the in vitro probiotic properties of three bacteriocinogenic Lactococcus lactis subsp. cremoris of aquatic origin, (ii) to evaluate in vivo the ability of L. cremoris WA2-67 to protect rainbow trout (Oncorhynchus mykiss, Walbaum) against infection by L. garvieae, and (iii) to demonstrate the role of nisin Z (NisZ) production as an anti-infective mechanism. The three L. cremoris strains survived in freshwater at 18 °C for 7 days, withstood exposure to pH 3.0 and 10 % (v/v) rainbow trout bile, and showed different cell surface hydrophobicity (37.93-58.52 %). The wild-type NisZ-producer L. cremoris WA2-67 and its non-bacteriocinogenic mutant L. cremoris WA2-67 ∆nisZ were administered orally (10(6) CFU/g) to rainbow trout for 21 days and, subsequently, fish were challenged with L. garvieae CLG4 by the cohabitation method. The fish fed with the bacteriocinogenic strain L. cremoris WA2-67 reduced significantly (p trout against infection with the invasive pathogen L. garvieae and the relevance of NisZ production as an anti-infective mechanism. This is the first report demonstrating the effective in vivo role of LAB bacteriocin (NisZ) production as a mechanism to protect fish against bacterial infection. Our results suggest that the wild-type NisZ-producer strain L. cremoris WA2-67 could be used in fish farming to prevent lactococcosis in rainbow trout.

  11. Discovery of a young, 267 millisecond pulsar in the supernova remnant W44

    Science.gov (United States)

    Wolszczan, A.; Cordes, J. M.; Dewey, R. J.

    1991-01-01

    This paper reports the discovery of a 267 msec pulsar, PSR 1853 + 01, in the SNR W44 (G34.7 - 0.4), located south of the W44, well within its radio shell and at the outher edge of the X-ray emission region which fills the SNR interior. The PSR 1853 + 01 is separated only 20 arcmin from the PSR 1854 + 00 pulsar discovered by Mohanty (1983). Results of timing observatons of PSR 1853 + 01 are presented, and a possible relationship between the two objects is examined. It is suggested that the two pulsars may have a common origin in a binary system disrupted by the explosion that produced W44.

  12. Novel selective catalytic reduction with tritium: synthesis of the GABA sub A receptor radioligand 1-(4-ethynylphenyl)-4-(2,3- sup 3 H sub 2 )propyl-2,6,7-trioxabicyclo(2. 2. 2 )octane

    Energy Technology Data Exchange (ETDEWEB)

    Palmer, C J; Casida, J E [California Univ., Berkeley, CA (United States). Pesticide Chemistry and Toxicology Lab.

    1991-07-01

    Protection of the terminal alkyne function in 1-(4-ethynylphenyl)-4-(prop-2-enyl)-2,6,7-trioxabicyclo(2.2.2) octane with a trimethylsilyl group permits the selective catalytic reduction of the olefin moiety with tritium gas to give after deprotection 1-(4-ethynylphenyl)-4-(2,3-{sup 3}H{sub 2}) propyl-2,6,7-trioxabicyclo-(2.2.2) octane. The labeled product at high specific activity is an improved radioligand for the GABA-gated chloride channel of insects and mammals and the intermediate 4-(2,3-{sup 3}H{sub 2})propyl-1-(4-((trimethylsilyl)ethynyl)phenyl)-2,6,7-trioxabicyclo(2.2.2)octane is useful for studies on the metabolic activation of this selective proinsecticide. (author).

  13. CT-guided biopsy with cutting-edge needle for the diagnosis of malignant lymphoma: Experience of 267 biopsies

    International Nuclear Information System (INIS)

    Agid, R.; Sklair-Levy, M.; Bloom, A.I.; Lieberman, S.; Polliack, A.; Ben-Yehuda, D.; Sherman, Y.; Libson, E.

    2003-01-01

    AIM: We performed a retrospective study of 267 core needle aspiration biopsies in order to estimate the accuracy of CT-guided aspiration core needle biopsies for the diagnosis and subsequent treatment of malignant lymphoma. MATERIALS AND METHODS: Between 1989 and 1999, 267 CT-guided core needle biopsies were performed in 241 patients with either primary or recurrent malignant lymphoma. Patients age ranged from 4--88 years. One hundred and sixty-six (62.2%) nodal and 101 (37.8%) extranodal aspiration biopsies were performed using either 18 G or 20 G Turner needles. Statistical method used was Chi-square analysis. RESULTS: An accurate histological diagnosis was made in 199 (82.5%) patients, the remaining 42 (17.4%) patients had non-diagnostic CT biopsies. Thirty-seven of them were diagnosed by a surgical biopsy, four by bone marrow biopsy and in one patient by paracentesis. One hundred and seventy-nine patients had non-Hodgkin's lymphoma (NHL) and 62 had Hodgkin's disease (HD); 23 (9.54%) patients underwent repeated CT biopsy which was diagnostic in 17 (73.9%) and non-diagnostic in six (26%). CONCLUSION: CT-guided aspiration core biopsies were sufficient to establish a diagnosis in lymphoproliferative disorders in 82.5% of cases. In the light of this experience we suggest that imaging-guided core needle biopsy be used as the first step in the work up of many patients with lymphoma Agid,R. et al. (2003). Clinical Radiology58, 143-147

  14. A Question of Jurisdiction: Art. 267 TFEU Preliminary References of a CFSP Nature

    DEFF Research Database (Denmark)

    Butler, Graham

    2017-01-01

    Can the Court of Justice of the European Union assert jurisdiction and provide a national court with an interpretation of Union law in a case referred to it from a national court under an Art. 267 TFEU preliminary reference, when the subject matter is in regard to the Common Foreign and Security...... Policy (CFSP)? This was one of a number of questions referred to the Court of Justice from the High Court of England and Wales in Rosneft (judgment of 28 March 2017, case C-72/15). In March 2017, the Court of Justice meeting in a Grand Chamber formation, answered this jurisdictional question...... in the affirmative. Given the significance of this judgment for the law of CFSP, and the Opinion of the Advocate General in 2016, this judgment was hotly anticipated given its implications for the “specific rules and procedures” that are applicable to the law of CFSP. As the Court of Justice continues in a line...

  15. Nustar Reveals the Extreme Properties of the Super-Eddington Accreting Supermassive Black Hole in PG 1247+267

    Science.gov (United States)

    Lanzuisi, G.; Perna, M.; Comastri, A.; Cappi, M.; Dadina, M.; Marinucci, A.; Masini, A.; Matt, G.; Vagnetti, F.; Vignali, C.; hide

    2016-01-01

    PG1247+267 is one of the most luminous known quasars at z approximately 2 and is a strongly super-Eddington accreting supermassive black hole (SMBH) candidate. We obtained NuSTAR data of this intriguing source in December 2014 with the aim of studying its high-energy emission, leveraging the broad band covered by the new NuSTAR and the archival XMM-Newton data. Several measurements are in agreement with the super-Eddington scenario for PG1247+267: the soft power law (gamma = 2.3 +/- 0.1); the weak ionized Fe emission line; and a hint of the presence of outflowing ionized gas surrounding the SMBH. The presence of an extreme reflection component is instead at odds with the high accretion rate proposed for this quasar. This can be explained with three different scenarios; all of them are in good agreement with the existing data, but imply very different conclusions: i) a variable primary power law observed in a low state, superimposed on a reflection component echoing a past, higher flux state; ii) a power law continuum obscured by an ionized, Compton thick, partial covering absorber; and iii) a relativistic disk reflector in a lamp-post geometry, with low coronal height and high BH spin. The first model is able to explain the high reflection component in terms of variability. The second does not require any reflection to reproduce the hard emission, while a rather low high-energy cutoff of approximately 100 keV is detected for the first time in such a high redshift source. The third model require a face-on geometry, which may affect the SMBH mass and Eddington ratio measurements. Deeper X-ray broad-band data are required in order to distinguish between these possibilities.

  16. Bentonite buffer pre-test. Core drilling of drillholes ONK-PP264...267 in ONKALO at Olkiluoto 2010

    International Nuclear Information System (INIS)

    Toropainen, V.

    2010-12-01

    Suomen Malmi Oy (Smoy) core drilled four drillholes for bentonite buffer pre-test in ONKALO at Eurajoki, Olkiluoto in July 2010. The identification numbers of the holes are ONK-PP264..267, and the lengths of the drillholes are approximately 4.30 metres each. The drillholes are 75.7 mm by diameter. The drillholes were drilled in a niche at access tunnel chainage 1475. The hydraulic DE 130 drilling rig was used for the work. The drilling water was taken from the ONKALO drilling water pipeline and premixed sodium fluorescein was used as a label agent in the drilling water. In addition to drilling, the drillcores were logged and reported by geologist. Geological logging included the following parameters: lithology, foliation, fracture parameters, fractured zones, core loss, weathering, fracture frequency, RQD and rock quality. The main rock type in the drillholes is pegmatitic granite. The average fracture frequency in the drill cores is 4.0 pcs / m and the average RQD value 94.2 %. (orig.)

  17. A high-quality factor of 267 000 micromechanical silicon resonator utilizing TED-free torsional vibration mode

    Science.gov (United States)

    Nakamura, K.; Naito, Y.; Onishi, K.; Kawakatsu, H.

    2012-12-01

    In industrial applications of a micromechanical silicon resonator as a physical sensor, a high-quality factor Q and a low-temperature coefficient of Q (TCQ) are required for high sensitivity in a wide temperature range. Although the newly developed thin film encapsulation technique enables a beam to operate with low viscous damping in a vacuum cavity, the Q of a flexural vibration mode is limited by thermo-elastic damping (TED). We proposed a torsional beam resonator which features both a high Q and a low TCQ because theoretically the torsional vibration mode does not suffer from TED. From experiments, Q of 267 000 and TCQ of 1.4 for the 20 MHz torsional vibration mode were observed which were superior to those of the flexural mode. The pressure of the residual gas in the cavity of only 20 pl volume, which is one of the energy loss factors limiting the Q, was successfully estimated to be 1-14 Pa. Finally, the possibilities of improving the Q and the difference of the measured TCQ from a theoretical value were discussed.

  18. Solvothermal synthesis of a new 3-D mixed-metal sulfide framework, (H{sub 1.33}tren)[In{sub 2.67}Sb{sub 1.33}S{sub 8}]·tren

    Energy Technology Data Exchange (ETDEWEB)

    Lampkin, John D., E-mail: j.lampkin@pgr.rdg.ac.uk; Powell, Anthony V., E-mail: a.v.powell@rdg.ac.uk; Chippindale, Ann M., E-mail: a.m.chippindale@rdg.ac.uk

    2016-11-15

    A new indium(III) antimony(V) sulfide, (H{sub 1.33}tren)[In{sub 2.67}Sb{sub 1.33}S{sub 8}]·tren, has been prepared solvothermally at 433 K. The compound crystallises in the tetragonal space group I-42d (lattice parameters, a=12.6248(5) and c=19.4387(18) Å at 150 K) and contains adamantane-like T2 supertetrahedral units comprised of corner-sharing InS{sub 4}{sup 5−} and SbS{sub 4}{sup 3−} tetrahedra. The adamantane-like units are then linked through sulfur vertices to generate an open, 3-D framework structure containing large pores in which neutral, protonated tren (tris(2-aminoethylene)amine) molecules reside. The presence of the organic components was confirmed by solid-state {sup 13}C NMR (10 kHz), combustion and thermogravimetric analysis. The band gap, obtained from UV–vis diffuse reflectance measurements, is 2.7(2) eV. Stirring with either water or alkali-metal salt solution leads to removal of the neutral tren molecules and an ~9% reduction in unit-cell volume on formation of (H{sub 1.33}tren)[In{sub 2.67}Sb{sub 1.33}S{sub 8}]·(H{sub 2}O){sub 4}. - Graphical abstract: Linking of In(III)-Sb(V)-S adamantane units to form a 3-D open framework. - Highlights: • Preparation and structural characterisation of a new mixed-metal thiometallate. • The first mixed In(III)/Sb(V) supertetrahedron. • Optical band gap of 2.7(2) eV. • Soaking in aqueous alkali-metal solutions leads to removal of ca. 50% of the organic content.

  19. Positional effect of phosphorylation sites 266 and 267 in the cytoplasmic domain of the E2 protein of hepatitis C virus 3a genotype: Interferon Resistance analysis via Sequence Alignment

    Directory of Open Access Journals (Sweden)

    Ur Rehman Irshad

    2011-05-01

    Full Text Available Abstract Background Interferon is well thought-out as the key defence against all infections including HCV. The only treatment for HCV infection is pegylated interferon alpha (IFN-α but unluckily more than half of the infected individuals do not act in response to the cure and become chronic HCV carriers. The mechanism how HCV induce interferon resistance is still elusive. It is recently reported that HCV envelope protein 2 interacts with PKR which is the interferon-inducible protein kinase and which in turn blocks the activity of its target molecule called eukaryotic initiation factor elF2. Sequence analysis of Envelope protein reveals it contains a domain homologous to phosphorylation sites of PKR andthe translation initiation factor eIF2alpha. Envelope protein competes for phosphorylation with PKR. Inhibition of kinase activity of PKR is postulated as a mechanism of to interferon (IFN resistance. Results Present study involves the insilico investigation of possible role of potential phosphorylation in envelope 2 protein of 3a genotype in interferon resistance. Envelope protein coding genes were isolated from local HCV isolates, cloned and sequenced. Phylogenetic analysis was done and tertiary structure of envelope gene was predicted. Visualization of phosphorylation in tertiary structure reveals that residue 266 and 267 of envelope gene 2 are surface exposed and their phosphorylation may compete with the phosphorylation of PKR protein and possibly involved in mediating Interferon Resistance. Conclusion A hybrid in-silico and wet laboratory approach of motif prediction, evolutionary and structural analysis has pointed out serine 266 and 267 of the HCV E2 gene as a hopeful claimant for the serine phosphorylation. Recognition of these nucleotide variations may assist to propose genotype precise therapy to avoid and resolve HCV infections.

  20. Electrochemical hydrogen-storage properties of La{sub 0.78}Mg{sub 0.22}Ni{sub 2.67}Mn{sub 0.11}Al{sub 0.11}Co{sub 0.52}-M1Ni{sub 3.5}Co{sub 0.6}Mn{sub 0.4}Al{sub 0.}-5 composites

    Energy Technology Data Exchange (ETDEWEB)

    Huang, Hongxia, E-mail: hhxhunan@126.com [Key Lab of New Processing Technology for Nonferrous Metals and Materials Ministry of Education, Guilin University of Technology, Guilin (China); Li, Guohui [Guangxi Scientific Experiment Center of Mining, Metallurgy and Environment, College of Chemistry and Bioengineering, Guilin University of Technology, Guilin (China); Zhuang, Shuxin [School of Material Science and engineering, Xiamen University of Technology, Xiamen (China)

    2013-07-15

    For improving the electrochemical properties of nonstoichiometric AB{sub 3} -type La{sub 0.7}8Mg{sub 0.22}Ni{sub 2.67}Mn{sub 0.11}Al{sub 0.11}Co{sub 0.52} alloy as negative electrode of Ni-MH battery, its related composites La{sub 0.78}Mg{sub 0.22}Ni{sub 2.67}Mn{sub 0.11}Al{sub 0.11}Co{sub 0.52}-x wt.% M1Ni{sub 3.5}Co{sub 0.6}Mn{sub 0.4}Al{sub 0.5} (x = 0, 10, 20, 30) were prepared. Analysis by X-ray diffractometry (XRD) revealed that the composites consist mainly of LaNi{sub 5} and La{sub 2}Ni{sub 7} phases. Despite the small decrease in the maximum discharge capacity, the cycle performance was significantly enhanced. Linear polarization (LP), anodic polarization (AP) and potential step discharge experiments revealed that the electrochemical kinetics increases first and then decreases with increasing x. (author)

  1. 267 ORIGINAL ARTICLE

    African Journals Online (AJOL)

    boaz

    Lasting ... resulted in 360 (90%) of the students being absent from school from less than 10 days ... In areas of high and stable transmission, people tend ... number: 0823521). Semi-structured questionnaire was administered to the students.

  2. Extraction of niobium and tantalum isotopes using organophosphorus compounds. Pt. 1. Extraction of 'carrier-free' metal concentrations from HCl solutions

    International Nuclear Information System (INIS)

    Gates, J.M.; California Univ., Berkeley, CA; Sudowe, R.; Stavsetra, L.

    2009-01-01

    The extraction of niobium (Nb) and tantalum (Ta) from hydrochloric acid media by bis(2-ethylhexyl) hydrogen phosphate (HDEHP) and bis(2-ethylhexyl) hydrogen phosphite (BEHP) was studied. The goal of the experiments is to find a system that demonstrates selectivity between the members of group five of the Periodic Table and is also suitable for the study of dubnium (Db, Z=105). Experiments were performed at the trace level (10 -16 M Nb or Ta) using hydrochloric acid with concentrations ranging from 1-11 M and short-lived isotopes of Nb and Ta produced in nuclear reactions. When HDEHP was used as the extractant, the Nb extraction yield decreased with increasing acid concentrations above 6 M, while the amount of Ta extracted remained over 75% for all acid concentrations studied. Tantalum was found to be extracted by BEHP at acid concentrations above 6 M, while niobium was not significantly extracted. The data obtained are used as the basis to discuss the speciation of Nb and Ta under the conditions studied and to evaluate possible extraction mechanisms. (orig.)

  3. Chemistry of superheavy elements

    International Nuclear Information System (INIS)

    Schaedel, M.

    2012-01-01

    The chemistry of superheavy elements - or transactinides from their position in the Periodic Table - is summarized. After giving an overview over historical developments, nuclear aspects about synthesis of neutron-rich isotopes of these elements, produced in hot-fusion reactions, and their nuclear decay properties are briefly mentioned. Specific requirements to cope with the one-atom-at-a-time situation in automated chemical separations and recent developments in aqueous-phase and gas-phase chemistry are presented. Exciting, current developments, first applications, and future prospects of chemical separations behind physical recoil separators ('pre-separator') are discussed in detail. The status of our current knowledge about the chemistry of rutherfordium (Rf, element 104), dubnium (Db, element 105), seaborgium (Sg, element 106), bohrium (Bh, element 107), hassium (Hs, element 108), copernicium (Cn, element 112), and element 114 is discussed from an experimental point of view. Recent results are emphasized and compared with empirical extrapolations and with fully-relativistic theoretical calculations, especially also under the aspect of the architecture of the Periodic Table. (orig.)

  4. Construction of a time-of-flight neutron spectrometer for reaction angles 000 and study of the reaction 65Cu(p,xn) 65Zn for Esub(p)=26.7 MeV

    International Nuclear Information System (INIS)

    Holler, Y.

    1984-01-01

    At the Hamburg Isochronous Cyclotron a novel time-of-flight neutron spectrometer was designed, constructed, and tested by means of a for the planned application typical nuclear reaction. The apparature was optimized for the measurement of continuous, structure-deficient neutron spectra in a wide angular range at a reproducible, as low as possible scattering neutron background. Such a facility is fitted to the strengths of the Hamburg cyclotron and allows to study questions on the precompound emission and on the inelastic projectile ( 3 He) breakup. The final test was performed with the reaction 65 Cu(p,xn) 65 Zn at Esub(p)=26.7 MeV for which already comparable data over a smaller angular range were present. In the analysis of the measurement results performed regarding the precompound effects the hybrid-exciton model calculations let recognize essential deviations at high neutron energies in the range of the extreme reaction angles. (orig./HSI) [de

  5. Pages 259 - 267.pmd

    African Journals Online (AJOL)

    Administrator

    Peltier CA, Omes C, Ndimubanzi PC et al. Validation of 2006 WHO Prediction Scores for. True HIV Infection in Children less than 18 months with a positive serological HIV test. PLoS ONE I www.plosone.org April 2009; 4. (4): I e5312. 28. Mayaux MJ, Burgard M, Teglas JP,et al. Neonatal characteristics in rapidly progressive ...

  6. Metabolism of the insecticidally active GABAA receptor antagonist 4-sec-[3,4-3H2]butyl-1-(4-cyanophenyl)-2,6,7-trioxabicyclo[2.2.2]octane

    International Nuclear Information System (INIS)

    Deng, Yanli; Palmer, C.J.; Toia, R.F.; Casida, J.E.

    1990-01-01

    4-sec-[3,4- 3 H 2 ]Butyl-1-(4-cyanophenyl)-2,6,7-trioxabicyclo[2.2.2]octane (referred to as [ 3 H]COB) was examined as an example of a new class of insecticidally active compounds that block the γ-aminobutyric acid gated chloride channel. Metabolites were identified by thin-layer cochromatography with standards from synthesis and by consideration of their hydrolytic and oxidative degradation products formed in situ on two-dimensional silica gel chromatoplates. Metabolism of [ 3 H]COB by mouse liver and housefly abdomen microsomes is dependent on fortification with NADPH. The O-methylene and sec-butyl sites are sensitive to oxidation. Each carbon of the sec-butyl group is individually functionalized with strong preference for the methylene site in the mouse but not the housefly microsomal system. O-Methylene hydroxylation initiates spontaneous cage opening to form an aldehyde that undergoes metabolic reduction, ultimately yielding the same cyanobenzoate ester of 2,2-bis-(hydroxymethyl)-3-methylpentan-1-ol formed by direct hydrolysis. Houseflies injected with [ 3 H]COB form many if not all of the same metabolites, with major products being the aforementioned cyanobenzoate, the orthoester oxidized at the sec-butyl methylene site, and polar conjugates

  7. Aqueous chemistry of transactinides

    International Nuclear Information System (INIS)

    Schaedel, M.

    2001-01-01

    The aqueous chemistry of the first three transactinide elements is briefly reviewed with special emphasis given to recent experimental results. Short introductory remarks are discussing the atom-at-a-time situation of transactinide chemistry as a result of low production cross-sections and short half-lives. In general, on-line experimental techniques and, more specifically, the automated rapid chemistry apparatus, ARCA, are presented. Present and future developments of experimental techniques and resulting perspectives are outlined at the end. The central part is mainly focussing on hydrolysis and complex formation aspects of the superheavy group 4, 5, and 6 transition metals with F - and Cl - anions. Experimental results are compared with the behaviour of lighter homologous elements and with relativistic calculations. It will be shown that the chemical behaviour of the first superheavy elements is already strongly influenced by relativistic effects. While it is justified to place rutherfordium, dubnium and seaborgium in the Periodic Table of the Elements into group 4, 5 and 6, respectively, it is no more possible to deduce from this position in detail the chemical properties of these transactinide or superheavy elements. (orig.)

  8. Multifarious beneficial traits and plant growth promoting potential of Serratia marcescens KiSII and Enterobacter sp. RNF 267 isolated from the rhizosphere of coconut palms (Cocos nucifera L.).

    Science.gov (United States)

    George, Priya; Gupta, Alka; Gopal, Murali; Thomas, Litty; Thomas, George V

    2013-01-01

    Two plant growth promoting bacteria designated as KiSII and RNF 267 isolated from the rhizosphere of coconut palms were identified as Serratia marcescens and Enterobacter sp. based on their phenotypic features, BIOLOG studies and 16S rRNA gene sequence analysis. Both bacteria exhibited phosphate solubilization, ammonification, and production of indole acetic acid, β-1, 3 glucanase activities and 1-aminocyclopropane-1-carboxylate-deaminase activity. They could also tolerate a range of pH conditions, low temperature and salinity (NaCl). In addition, S. marcescens KiSII exhibited N- fixation potential, chitinase activity, siderophore production and antibiotics production. Seed bacterization with these bacteria increased the growth parameters of test plants such as paddy and cowpea over uninoculated control in green house assay. In coconut seedlings, significant increase in growth and nutrient uptake accompanied with higher populations of plant beneficial microorganisms in their rhizospheres were recorded on inoculation with both the PGPRs. The present study clearly revealed that PGPRs can aid in production of healthy and vigorous seedlings of coconut palm which are hardy perennial crops. They offer a scope to be developed into novel PGPR based bioinoculants for production of elite seedlings that can benefit the coconut farming community and the coconut based ecology.

  9. 46_ _267 - 278__Aminu- Biosynthesis

    African Journals Online (AJOL)

    User

    ISSN 2006 – 6996. BIOSYNTHESIS, CHARACTERIZATION AND ANTIMICROBIAL STUDY OF .... the excitation of surface Plasmon vibration with. AgNPs. ... Thin films of the sample were prepared on a carbon ... The resulting film on the SEM.

  10. Site characterization and validation - Tracer migration experiment in the validation drift, report 2, Part 2: breakthrough curves in the validation drift appendices 5-9

    International Nuclear Information System (INIS)

    Birgersson, L.; Widen, H.; Aagren, T.; Neretnieks, I.; Moreno, L.

    1992-01-01

    Flowrate curves for the 53 sampling areas in the validation drift with measureable flowrates are given. The sampling area 267 is treated as three separate sampling areas; 267:1, 267:2 and 267:3. The total flowrate for these three sampling areas is given in a separate plot. The flowrates are given in ml/h. The time is given in hours since April 27 00:00, 1990. Disturbances in flowrates are observed after 8500 hours due to opening of boreholes C1 and W1. Results from flowrate measurements after 8500 hours are therefore excluded. The tracer breakthrough curves for 38 sampling areas in the validation drift are given as concentration values versus time. The sampling area 267 is treated as three separate sampling areas; 267:1, 267:2 and 267:3. This gives a total of 40 breakthrough curves for each tracer. (au)

  11. Metabolism of the insecticidally active GABA sub A receptor antagonist 4-sec-(3,4- sup 3 H sub 2 )butyl-1-(4-cyanophenyl)-2,6,7-trioxabicyclo(2. 2. 2)octane

    Energy Technology Data Exchange (ETDEWEB)

    Deng, Yanli; Palmer, C.J.; Toia, R.F.; Casida, J.E. (Univ. of California, Berkeley (USA))

    1990-03-01

    4-sec-(3,4-{sup 3}H{sub 2})Butyl-1-(4-cyanophenyl)-2,6,7-trioxabicyclo(2.2.2)octane (referred to as ({sup 3}H)COB) was examined as an example of a new class of insecticidally active compounds that block the {gamma}-aminobutyric acid gated chloride channel. Metabolites were identified by thin-layer cochromatography with standards from synthesis and by consideration of their hydrolytic and oxidative degradation products formed in situ on two-dimensional silica gel chromatoplates. Metabolism of ({sup 3}H)COB by mouse liver and housefly abdomen microsomes is dependent on fortification with NADPH. The O-methylene and sec-butyl sites are sensitive to oxidation. Each carbon of the sec-butyl group is individually functionalized with strong preference for the methylene site in the mouse but not the housefly microsomal system. O-Methylene hydroxylation initiates spontaneous cage opening to form an aldehyde that undergoes metabolic reduction, ultimately yielding the same cyanobenzoate ester of 2,2-bis-(hydroxymethyl)-3-methylpentan-1-ol formed by direct hydrolysis. Houseflies injected with ({sup 3}H)COB form many if not all of the same metabolites, with major products being the aforementioned cyanobenzoate, the orthoester oxidized at the sec-butyl methylene site, and polar conjugates.

  12. Costing of a State-Wide Population Based Cancer Awareness and Early Detection Campaign in a 2.67 Million Population of Punjab State in Northern India.

    Science.gov (United States)

    Thakur, Js; Prinja, Shankar; Jeet, Gursimer; Bhatnagar, Nidhi

    2016-01-01

    Punjab state is particularly reporting a rising burden of cancer. A 'door to door cancer awareness and early detection campaign' was therefore launched in the Punjab covering about 2.67 million population, wherein after initial training accredited social health activists (ASHAs) and other health staff conducted a survey for early detection of cancer cases based on a twelve point clinical algorithm. To ascertain unit cost for undertaking a population-based cancer awareness and early detection campaign. Data were collected using bottom-up costing methods. Full economic costs of implementing the campaign from the health system perspective were calculated. Options to meet the likely demand for project activities were further evaluated to examine their worth from the point of view of long-term sustainability. The campaign covered 97% of the state population. A total of 24,659 cases were suspected to have cancer and were referred to health facilities. At the state level, incidence and prevalence of cancer were found to be 90 and 216 per 100,000, respectively. Full economic cost of implementing the campaign in pilot district was USD 117,524. However, the financial cost was approximately USD 6,301. Start-up phase of campaign was more resource intensive (63% of total) than the implementation phase. The economic cost per person contacted and suspected by clinical algorithm was found to be USD 0.20 and USD 40 respectively. Cost per confirmed case under the campaign was 7,043 USD. The campaign was able to screen a reasonably large population. High to high economic cost points towards the fact that the opportunity cost of campaign put a significant burden on health system and other programs. However, generating awareness and early detection strategy adopted in this campaign seems promising in light of fact that organized screening is not in place in India and in many developing countries.

  13. Publications | Page 267 | IDRC - International Development ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Through books, articles, research publications, and studies, we aim to widen the ... procedures for export of vegetables, as well as import of tires from Sri Lanka. ... the Las Bambas copper deposit in Peru (slated to be chosen on 23 July) had ...

  14. Influence of relativistic effects on hydration and hydrolysis of rutherfordium, dubnium and some 6-th row element cations

    International Nuclear Information System (INIS)

    Bilewicz, A.; Siekierski, S.

    1999-01-01

    New evidence for the influence of relativistic effect on coordination number, (CN), and hydrolysis of Rf 4+ and Db 5+ aqua ions has been presented. It has been argued that very strong hydrolysis of the heaviest members of Groups 12, 13 is caused by the low CN of Hg 2+ and Tl 3+ in their aqua ions. Low CN is the result of relativistic effects which stabilize the 6s orbital, increasing thereby the respective promotion energy. That supports our previous view that strong hydrolysis of Rf aq 4+ much greater than that of Hf aq 4+ and Zr aq 4+ , is also a result of lower CN. Since the promotion energy for sp 3 d 4 hybridization (CN 8) seems to be close to that od sp 3 d 2 hybridization (CN 6), and since hybridization energies of Zr 4+ , Hf 4+ and Rf 4+ do not differ very much for hexa- and octahydrates the two aqua ions i.e., M(H 2 O) 6 4+ and M(H 2 O) 8 4+ may coexist in aqueous acid solutions. However, due to relativistic stabilization of 7s and destabilization of 6s orbitals, which increases promotion energy, the Rf 4+ aqua cation should show coordination number 6 rather than 8. A shift of equilibrium toward a lower hydrate increases the tendency to hydrolyse. (author)

  15. Journal of Earth System Science | Indian Academy of Sciences

    Indian Academy of Sciences (India)

    Home; Journals; Journal of Earth System Science; Volume 110; Issue 4. Volume 110, Issue 4. December 2001, pages 267-463. Recent Researchers in Petrology and Geochemistry. pp 267-267. Preface · S Bhattacharya J Ganguly · More Details Fulltext PDF. pp 269-285. Earth support systems: Threatened? Why? What can ...

  16. Chemistry of the superheavy elements.

    Science.gov (United States)

    Schädel, Matthias

    2015-03-13

    The quest for superheavy elements (SHEs) is driven by the desire to find and explore one of the extreme limits of existence of matter. These elements exist solely due to their nuclear shell stabilization. All 15 presently 'known' SHEs (11 are officially 'discovered' and named) up to element 118 are short-lived and are man-made atom-at-a-time in heavy ion induced nuclear reactions. They are identical to the transactinide elements located in the seventh period of the periodic table beginning with rutherfordium (element 104), dubnium (element 105) and seaborgium (element 106) in groups 4, 5 and 6, respectively. Their chemical properties are often surprising and unexpected from simple extrapolations. After hassium (element 108), chemistry has now reached copernicium (element 112) and flerovium (element 114). For the later ones, the focus is on questions of their metallic or possibly noble gas-like character originating from interplay of most pronounced relativistic effects and electron-shell effects. SHEs provide unique opportunities to get insights into the influence of strong relativistic effects on the atomic electrons and to probe 'relativistically' influenced chemical properties and the architecture of the periodic table at its farthest reach. In addition, they establish a test bench to challenge the validity and predictive power of modern fully relativistic quantum chemical models. © 2015 The Author(s) Published by the Royal Society. All rights reserved.

  17. A Technical History of the SEI

    Science.gov (United States)

    2017-01-01

    more effec- tively use scarce assurance resources. The theory is borrowing and extending concepts from law, philosophy, artificial intelligence , and...Consequence: Enterprise Risk Management and Security Improvement 189 The SEI Contribution 190 References 190 Cybersecurity Engineering 192 The...Provides Benefits 267 The SEI Contribution 267 References 267 8 Forensics 269 Introduction to Computer Forensics: Digital Intelligence and

  18. 12 CFR 26.7 - Change in circumstances.

    Science.gov (United States)

    2010-01-01

    ... the depository organization, or an acquisition, merger, consolidation, or any reorganization of the ownership structure of a depository organization that causes a previously permissible interlock to become... change in circumstances may include an increase in asset size of an organization, a change in the...

  19. 47 CFR 73.267 - Determining operating power.

    Science.gov (United States)

    2010-10-01

    ... may be checked by measuring the power at the transmitter terminals while either: (1) Operating the... the final amplifier stages have been modified pursuant to FCC approval, the licensee must furnish the FCC and also retain with the station records the measurement data used as a basis for determining the...

  20. 25 CFR 700.267 - Disclosure of records.

    Science.gov (United States)

    2010-04-01

    ... form that is not individually identifiable; (4) To the National Archives of the United States as a... the record has such value; (5) To another agency or to an instrumentality of any governmental... if the activity is authorized by law, and if the head of the agency or instrumentality has made a...

  1. Chemical behaviour of a few atoms of rutherfordium (Rf, Z= 104) and of dubnium (Db, Z= 105) produced at Orsay

    International Nuclear Information System (INIS)

    Trubert, D.; Hussonnois, M.; Le Naour, C.; Brillard, L.; Monroy Guzman, F.; Le Du, J.F.; Servajean, V.

    1998-01-01

    The isotopes 261 Rf and 262 Db were produced by irradiation of a 248 Cm target with respectively 18 O and 19 F ions, at the MP Tandem accelerator of Orsay (France). These isotopes were isolated in HF medium, using he RACHEL setup. Moreover, the radioisotope 262 DB was produced by a nuclear reaction. (authors)

  2. Chemical Identification of Dubnium as a Decay Product of Element 115 Produced in the Reaction $\\rm {^{48}Ca}+{^{243}Am}$

    CERN Document Server

    Dmitriev, S N; Utyonkov, V K; Shishkin, S V; Eremin, A V; Lobanov, Yu V; Chepigin, V I; Sokol, E A; Tsyganov, Yu S; Vostokin, G K; Aksenov, N V; Hussonnois, M; Itkis, M G; Aggeler, H W; Schumann, D; Bruchertseifer, H; Eichler, R; Shaughnessy, D A; Wilk, P A; Kenneally, J M; Stoyer, M A; Wild, J F

    2004-01-01

    The results of an experiment designed to identify $^{268}$Db as the terminal isotope in the $\\alpha $-decay chain of element 115 produced via the ${\\rm {^{243}Am}}({\\rm {^{48}Ca}},3n){\\rm {^{288}115}}$ reaction are presented. The $^{243}$Am target was bombarded with a beam dose of $3.4\\cdot 10^{18}$ $^{48}$Ca projectiles at an energy of 247 MeV at the center of the target. The reaction products were collected in the surface layer of a copper catcher block, which was removed with a lathe and then dissolved in concentrated HNO$_{3}$. The group-5 elements were separated by sorption onto Dowex $50{\\times} 8$ cation-exchange resin with subsequent desorption using 1 M HF, which forms anionic fluoride complexes of group-5 elements. The eluent was evaporated onto a 0.4 $\\mu$m thick polyethylene foil that was placed between a pair of semiconductor detectors surrounded by $^{3}$He neutron counters for measurement of $\\alpha$ particles, fission fragments, and neutrons. In the course of the experiment, we observed 15 spo...

  3. Identification of a Novel EF-Loop in the N-terminus of TRPM2 Channel Involved in Calcium Sensitivity

    Directory of Open Access Journals (Sweden)

    Yuhuan Luo

    2018-06-01

    Full Text Available As an oxidative stress sensor, transient receptor potential melastatin 2 (TRPM2 channel is involved in many physiological and pathological processes including warmth sensing, ischemia injury, inflammatory diseases and diabetes. Intracellular calcium is critical for TRPM2 channel activation and the IQ-like motif in the N-terminus has been shown to be important by mediating calmodulin binding. Sequence analysis predicted two potential EF-loops in the N-terminus of TRPM2. Site-directed mutagenesis combining with functional assay showed that substitution with alanine of several residues, most of which are conserved in the typical EF-loop, including D267, D278, D288, and E298 dramatically reduced TRPM2 channel currents. By further changing the charges or side chain length of these conserved residues, our results indicate that the negative charge of D267 and the side chain length of D278 are critical for calcium-induced TRPM2 channel activation. G272I mutation also dramatically reduced the channel currents, suggesting that this site is critical for calcium-induced TRPM2 channel activation. Furthermore, D267A mutant dramatically reduced the currents induced by calcium alone compared with that by ADPR, indicating that D267 residue in D267–D278 motif is the most important site for calcium sensitivity of TRPM2. In addition, inside-out recordings showed that mutations at D267, G272, D278, and E298 had no effect on single-channel conductance. Taken together, our data indicate that D267–D278 motif in the N-terminus as a novel EF-loop is critical for calcium-induced TRPM2 channel activation.

  4. Chemical and physical composition of grain-type and food-type soybean for food processing Composição química e física de soja tipo grão e tipo alimento para o processamento de alimentos

    Directory of Open Access Journals (Sweden)

    Josemeyre Bonifácio da Silva

    2009-07-01

    Full Text Available The objective of this work was to evaluate the chemical and physical characteristics of grains of soybean (Glycine max cultivars for food processing. The soybean cultivars evaluated were: grain-type - BRS 133 and BRS 258; food-type - BRS 213 (null lipoxygenases, BRS 267 (vegetable-type and BRS 216 (small grain size. BRS 267 and BRS 216 cultivars showed higher protein content, indicating that they could promote superior nutritional value. BRS 213 cultivar showed the lowest lipoxygenase activity, and BRS 267, the lowest hexanal content. These characteristics can improve soyfood flavor. After cooking, BRS 267 cultivar grains presented a higher content of aglycones (more biologically active form of isoflavones and oleic acid, which makes it proper for functional foods and with better stability for processing, and also showed high content of fructose, glutamic acid and alanine, compounds related to the soybean mild flavor. Because of its large grain size, BRS 267 is suitable for tofu and edamame, while small-grain-sized BRS 216 is good for natto and for soybean sprouts production. BRS 216 and BRS 213 cultivars presented shorter cooking time, which may be effective for reducing processing costs.O objetivo deste trabalho foi avaliar as características químicas e físicas de grãos de cultivares de soja (Glycine max para o processamento de alimentos. As cultivares avaliadas foram: tipo grão - BRS 133 e BRS 258; tipo alimento - BRS 213 (desprovida de lipoxigenases, BRS 267 (tipo hortaliça e BRS 216 (tamanho de grão pequeno. As cultivares BRS 216 e BRS 267 apresentaram maior teor de proteínas e poderiam promover valor nutricional superior. A cultivar BRS 213 apresentou a menor atividade de lipoxigenases e a BRS 267, o menor teor de hexanal. Essas características podem melhorar o sabor dos alimentos. Com o cozimento, os grãos da cultivar BRS 267 apresentaram maior teor de agliconas (forma biologicamente mais ativa das isoflavonas e de ácido oleico

  5. Effect of cooling rate on the phase structure and magnetic properties of Fe{sub 26.7}Co{sub 28.5}Ni{sub 28.5}Si{sub 4.6}B{sub 8.7}P{sub 3} high entropy alloy

    Energy Technology Data Exchange (ETDEWEB)

    Wei, Ran; Sun, Huan; Chen, Chen [School of Materials Science and Engineering, Zhengzhou University, Zhengzhou 450001 (China); Han, Zhenhua [School of Materials Science and Engineering, Xi’an University of Technology, Xi’an 710068 (China); Li, Fushan, E-mail: fsli@zzu.edu.cn [School of Materials Science and Engineering, Zhengzhou University, Zhengzhou 450001 (China)

    2017-08-01

    Highlights: • High entropy alloy with amorphous phase and FCC solid solution phase are successfully developed respectively. • The amorphous phase exhibits better soft magnetic properties than that of the solid solution phase. • The BCC phase transformed into FCC phase, and then into BCC phase was found in this HEA. - Abstract: The effect of cooling rate on phase structure and magnetic properties of the Fe{sub 26.7}Co{sub 28.5}Ni{sub 28.5}Si{sub 4.6}B{sub 8.7}P{sub 3} high entropy alloy (HEA) was investigated. The HEA forms into amorphous phase by melt spinning method at high cooling rate and FCC solid solution phase at low cooling rate. The soft magnetic properties of the amorphous phase (saturation magnetization B{sub s} of 1.07T and coercivity H{sub c} of 4 A/m) are better than that of the solid solution phase (B{sub s} of 1.0 T and H{sub c} of 168 A/m). In order to study the phase evolution of the present HEA, anneal experiments were conducted. It is found that crystallization products of amorphous phase are solid solution phase which constitute much of FCC and a small amount of BCC. BCC phase transforms into FCC phase, and then into BCC phase with the increase of annealing temperature.

  6. 76 FR 14115 - Aviation Rulemaking Advisory Committee Meeting on Transport Airplane and Engine Issues

    Science.gov (United States)

    2011-03-15

    ..., Telephone (202) 267-3168, Fax (202) 267-5075, or e-mail at [email protected] . SUPPLEMENTARY INFORMATION... Committee Meeting on Transport Airplane and Engine Issues AGENCY: Federal Aviation Administration (FAA), DOT... Rulemaking Advisory Committee [[Page 14116

  7. Seroprevalence of hepatitis B e antigen (HBe antigen and B core antibodies (IgG anti-HBcore and IgM anti-HBcore among hepatitis B surface antigen positive blood donors at a Tertiary Centre in Nigeria

    Directory of Open Access Journals (Sweden)

    Akinbami Akinsegun A

    2012-03-01

    Full Text Available Abstract Background Hepatitis B virus (HBV is a common cause of liver disease throughout the world. HBV is transmitted through blood and other body fluids, including semen and saliva. Chronic replication of HBV virons is characterized by persistence circulation of HBsAg, HBeAg and HBV DNA; usually with anti-HBc and occasionally with anti-HBs. Aim: To determine the prevalence of HBeAg, IgG anti-HBcore and IgM anti-HBcore amongst HBsAg positive blood donors. These parameters are reflective of transmissibility and active hepatitis B infection. A cross sectional study was carried out at the blood donor clinics of Lagos State University Teaching Hospital Ikeja and Lagos University Teaching Hospital Idiaraba. A total of 267 donors were recruited to determine HBe antigen, IgG and IgM anti-HBcore antibodies amongst hepatitis BsAg positive donors. Five milliliters of blood was collected from those who tested positive to HBsAg screen during donation. The sera were subjected to enzyme linked immunosorbent assay (ELISA. Pearson chi-squared test was used for the analytical assessment. Findings A total number of 267 HBsAg positive blood donors were studied. A seroprevalence of 8.2% (22 of 267 HBeAg was obtained, 4 of 267 (1.5% were indeterminate while 241 (90.3% tested negative. Only 27 out of 267 donors (10.1% tested positive to IgM anti-HBcore, 234(87.6% tested negative, while 6(2.2% were indeterminate. A higher percentage of 60.7% (162 of 267 tested positive to IgG anti-HBcore, while 39.3% (105 of 267 tested negative. Conclusion There is a low seroprevalence rate of HBeAg-positive chronic hepatitis and relatively high IgG anti-HBcore and IgM anti-HBcore rates in South West Nigeria.

  8. Causes and Risk Factors for Maternal Mortality in Rural Tanzania ...

    African Journals Online (AJOL)

    AJRH Managing Editor

    , School of Public Health ... Keywords: Maternal death, maternal mortality, risk factors and developing country .... technique which encompasses use of educational ..... Farm. Workers. 0.70. 0.547. (0.213-2.267). Cannot work 2.67. 0.396. (0.277-.

  9. African Journal of Drug & Alcohol Studies, 15(2), 2016 Copyright ...

    African Journals Online (AJOL)

    Tel: (+267) 355-4783, Mobile (+267) 71710420, Email address: Gobopamang. .... tried a range of different types of drugs ... Sex- tasy is a term used to refer to taking vi- agra and ecstasy together with ..... on Drug Abuse technical review meet-.

  10. 7 CFR 2.67 - Administrator, Economic Research Service.

    Science.gov (United States)

    2010-01-01

    ... agriculture system, including general economic analyses of the international financial and monetary aspects of... problems; and (v) Rural people and communities, as authorized by title II of the Agricultural Marketing Act... countries; or (v) Entering into agreements with land-grant colleges and universities, other organizations...

  11. 26 CFR 1.267(a)-1 - Deductions disallowed.

    Science.gov (United States)

    2010-04-01

    ... accrual method of accounting. For example, if the accrued expenses or interest are paid after the... an accrual method of accounting. A uses a combination of accounting methods permitted under section... disbursements method of accounting with respect to such items of gross income for his taxable year in which or...

  12. 40 CFR 267.151 - Wording of the instruments.

    Science.gov (United States)

    2010-07-01

    ... Obligations Covered by a Financial Test or Corporate Guarantee.] [If this firm qualifies for the financial... Financial Test or Corporate Guarantee [On the following lines list all obligations that are covered by a financial test or a corporate guarantee extended by your firm. You may add additional lines and leave blank...

  13. 43 CFR 26.7 - Application format and instructions.

    Science.gov (United States)

    2010-10-01

    ... projects): (1) Project number. (2) Project name and address. (3) Project location (nearest city or town and... to be taken. (d) Part IV—(Assurances) is preprinted within Attachment M, Exhibit M-5, OMB Circular A...

  14. 1935 15' Quad #267 Aerial Photo Mosaic Index

    Data.gov (United States)

    Earth Data Analysis Center, University of New Mexico — Aerial Photo Reference Mosaics contain aerial photographs that are retrievable on a frame by frame basis. The inventory contains imagery from various sources that...

  15. Dicty_cDB: VSJ267 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available nsadnsgaknlyviavkgikgrlnrlpsagv gdmvmatvkkgkpelrkkvctglvvrqrkhwkrkdgvyiyfednagvmcnpkgevkgnil gpvakecsdlwpkva...kvctglvvrqrkhwkrkdgvyiyfednagvmcnpkgevkgnil gpvakecsdlwpkvatnagtiv*INTHKVX--- ---

  16. Dicty_cDB: SSJ267 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available AM049129 |pid:none) Timarcha balearica mRNA for riboso... 114 1e-24 EF639014_1( ...g-e... 116 3e-25 CR954207_405( CR954207 |pid:none) Ostreococcus tauri strain OTTH05... 114 1e-24 AM049129_1(

  17. 26 CFR 1.267(f)-1 - Controlled groups.

    Science.gov (United States)

    2010-04-01

    ... significant purpose the avoidance of Federal income tax. (f) Receivables. If S acquires a receivable from the... determined on a separate entity basis. Thus, S's $30 loss is long-term capital loss and B's $10 gain is... Internal Revenue INTERNAL REVENUE SERVICE, DEPARTMENT OF THE TREASURY (CONTINUED) INCOME TAX (CONTINUED...

  18. 77 FR 267 - Marine Mammals; File No. 16621

    Science.gov (United States)

    2012-01-04

    ... Alejandro Acevedo- Guti[eacute]rrez, Ph.D., Biology Department, Western Washington University, Bellingham... Conservation Division, Office of Protected Resources, NMFS, 1315 East-West Highway, Room 13705, Silver Spring... permit to address the interactions between humans and harbor seals in the Salish Sea, USA. They propose...

  19. 24 CFR 203.267 - Duration of periodic MIP.

    Science.gov (United States)

    2010-04-01

    ... URBAN DEVELOPMENT MORTGAGE AND LOAN INSURANCE PROGRAMS UNDER NATIONAL HOUSING ACT AND OTHER AUTHORITIES SINGLE FAMILY MORTGAGE INSURANCE Contract Rights and Obligations Mortgage Insurance Premiums-Periodic... deed to the Commissioner is filed for record or the contract of insurance is terminated. [48 FR 28805...

  20. Methods in half-linear asymptotic theory

    Czech Academy of Sciences Publication Activity Database

    Řehák, Pavel

    2016-01-01

    Roč. 2016, Č. 267 (2016), s. 1-27 ISSN 1072-6691 Institutional support: RVO:67985840 Keywords : half-linear differential equation * nonoscillatory solution * regular variation Subject RIV: BA - General Mathematics Impact factor: 0.954, year: 2016 http://ejde.math.txstate.edu/Volumes/2016/267/abstr.html

  1. Correlation Investigation as to the Mental Health of the Prison Guard in Xi'an Police Station

    Institute of Scientific and Technical Information of China (English)

    Feng Xue

    2005-01-01

    Based on the symptom check list 90,EPQ scale and the simplified coping style questionaire,the author made a relative study on psychological health,personality character and coping style of 267 prison guard of police bureau in Xi'an city .The study shows this:   ①The mental health,personality character and coping style could be effected by many factors,such as gender,age,educational background,income,origin,satisfactory degree of working enviroment and some others.The mental health,personality character and coping style could effect each other.②The psychological health state of 267 prison guard is much worse than that of domestic common people.③The personality character of 267 prison guard shows much higher hostility and lower nervous than that of domestic common people.④The coping style of 267 prison guard often take positive coping styles.⑤Psychological health,personality character and coping style of prison guard are closely related.

  2. 75 FR 10551 - Aviation Rulemaking Advisory Committee Meeting on Transport Airplane and Engine Issues

    Science.gov (United States)

    2010-03-08

    ..., Telephone (202) 267-3168, Fax (202) 267-5075, or e-mail at [email protected] . SUPPLEMENTARY INFORMATION... participating by telephone, PLEASE CONTACT Ralen Gao by e-mail or phone for the teleconference call-in number... Committee Meeting on Transport Airplane and Engine Issues AGENCY: Federal Aviation Administration (FAA), DOT...

  3. Binary asteroid population. 3. Secondary rotations and elongations

    Czech Academy of Sciences Publication Activity Database

    Pravec, Petr; Scheirich, Peter; Kušnirák, Peter; Hornoch, Kamil; Galád, Adrián; Naidu, S.P.; Pray, D. P.; Világi, J.; Gajdoš, Š.; Kornoš, L.

    2016-01-01

    Roč. 267, March (2016), s. 267-295 ISSN 0019-1035 R&D Projects: GA ČR GAP209/12/0229; GA ČR GA15-07193S Institutional support: RVO:67985815 Keywords : asteroids * rotation * dynamics Subject RIV: BN - Astronomy, Celestial Mechanics, Astrophysics Impact factor: 3.131, year: 2016

  4. Untitled

    Indian Academy of Sciences (India)

    Seo-glasses are shown in figure 5. As the average coordination number (r) is increased, T, also increases gradually and shows a saturation behaviour beyond (r) = 267. Another important feature observed is that the T, values for both glasses follow the same variation up to around (r) = 267 and then deviate showing.

  5. Proceedings – Mathematical Sciences | Indian Academy of Sciences

    Indian Academy of Sciences (India)

    Home; Journals; Proceedings – Mathematical Sciences; Volume 119; Issue 3. Issue front cover thumbnail. Volume 119, Issue 3. June 2009, pages 267-410. pp 267-274. A Finer Classification of the Unit Sum Number of the Ring of Integers of Quadratic Fields and Complex Cubic Fields · Nahid Ashrafi · More Details Abstract ...

  6. Isolation of live Borrelia burgdorferi sensu lato spirochaetes from patients with undefined disorders and symptoms not typical for Lyme borreliosis

    Czech Academy of Sciences Publication Activity Database

    Rudenko, Natalia; Golovchenko, Maryna; Vancová, Marie; Clark, K.; Grubhoffer, Libor; Oliver, J. H., Jr.

    2016-01-01

    Roč. 22, č. 3 (2016), 267.e9-267.e15 ISSN 1198-743X EU Projects: European Commission(XE) 278976 - ANTIGONE Institutional support: RVO:60077344 Keywords : antibiotic treatment * live Borrelia burgdorferi * live Borrelia bissettii * Lyme borreliosis * recovery of live spirochaetes Subject RIV: FN - Epidemiology, Contagious Diseases ; Clinical Immunology Impact factor: 5.292, year: 2016

  7. Intergenerational Transmission of Internalizing Problems: Effects of Parental and Grandparental Major Depressive Disorder on Child Behavior

    Science.gov (United States)

    Pettit, Jeremy W.; Olino, Thomas M.; Roberts, Robert E.; Seeley, John R.; Lewinsohn, Peter M.

    2008-01-01

    Effects of lifetime histories of grandparental (G1) and parental (G2) major depressive disorder (MDD) on children's (G3) internalizing problems were investigated among 267 G3 children (ages 2-18 years) who received Child Behavior Checklist (CBCL) ratings and had diagnostic data available on 267 biological G2 parents and 527 biological G1…

  8. A Strategy for Dealing with Cuba in the 1980s.

    Science.gov (United States)

    1982-09-01

    many ideas as well as a supportive colleague in the writing of earlier drafts. Paul Davis and Harry Gelman were intellectually demanding but constructive...Raul Castro (2nd Sec.) M-26-7:Rg 1st V. Pres., Councils of Min.b & State; Minister, MINFAR (c) Juan Almeida (Hem.) M-26-7:Fg. V. Pros., Councils of Min.b

  9. Resonance – Journal of Science Education | News

    Indian Academy of Sciences (India)

    More Details Fulltext PDF. pp 257-258. Author Index · More Details Fulltext PDF. pp 259-264. Subject Index · More Details Fulltext PDF. pp 265-266. Index · More Details Fulltext PDF. pp 267-267 Flowering Trees. Prima Vera · More Details Fulltext PDF. pp 268-268 Featured Scientist. C. V. Raman · More Details Fulltext PDF ...

  10. 40 CFR 267.112 - What procedures must I follow?

    Science.gov (United States)

    2010-07-01

    ... hazardous waste residues and contaminated containment system components, equipment, structures, and soils... contaminated soils, methods for sampling and testing surrounding soils, and criteria for determining the extent of decontamination required to satisfy the closure performance standard; (5) A detailed description...

  11. All projects related to | Page 267 | IDRC - International Development ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    2011-10-31

    Despite the widespread nature of abuse facing women in contexts of armed conflict and transition, there is little documentation on how such women experience injustice and how they exercise their agency to demand justice. Start Date: October 31, 2011. End Date: April 30, 2014. Topic: WAR CRIMES, VIOLENCE AGAINST ...

  12. Waterborne Commerce of the United States, Calendar Year 1980. Part 1. Waterways and Harbors, Atlantic Coast.

    Science.gov (United States)

    1982-09-01

    3.9 2,68 .007 Sol 22 ----------- ----- 3322 COPPER ALLOTS. UNHORMED -------------------.--------- 3.19’ 0.901 267 6...PRODUCTS-------------- 1~91 11::j; 01.131 Sol 22,641----------- --------- ---------- 3241 BUILDING CEMEN----------------- ------3. 2,2 i74 3.400 1 41t...11,047 ----- TON-MILES, OCEANOING . 6111,267,297, __________ _____ ___________ INSTERN AL (SMORT TONSI COMMODITY TOA Nj’l U#UIUV U OUD ] H TOTAL

  13. Casein haplotypes and their association with milk production traits in Norwegian Red cattle

    Directory of Open Access Journals (Sweden)

    Nome Torfinn

    2009-02-01

    Full Text Available Abstract A high resolution SNP map was constructed for the bovine casein region to identify haplotype structures and study associations with milk traits in Norwegian Red cattle. Our analyses suggest separation of the casein cluster into two haplotype blocks, one consisting of the CSN1S1, CSN2 and CSN1S2 genes and another one consisting of the CSN3 gene. Highly significant associations with both protein and milk yield were found for both single SNPs and haplotypes within the CSN1S1-CSN2-CSN1S2 haplotype block. In contrast, no significant association was found for single SNPs or haplotypes within the CSN3 block. Our results point towards CSN2 and CSN1S2 as the most likely loci harbouring the underlying causative DNA variation. In our study, the most significant results were found for the SNP CSN2_67 with the C allele consistently associated with both higher protein and milk yields. CSN2_67 calls a C to an A substitution at codon 67 in β-casein gene resulting in histidine replacing proline in the amino acid sequence. This polymorphism determines the protein variants A1/B (CSN2_67 A allele versus A2/A3 (CSN2_67 C allele. Other studies have suggested that a high consumption of A1/B milk may affect human health by increasing the risk of diabetes and heart diseases. Altogether these results argue for an increase in the frequency of the CSN2_67 C allele or haplotypes containing this allele in the Norwegian Red cattle population by selective breeding.

  14. People and things. CERN Courier, Sep 1986, v. 26(7)

    Energy Technology Data Exchange (ETDEWEB)

    Anon.

    1986-09-15

    The article reports on achievements of various people, staff changes and position opportunities within the CERN organization and contains news updates on upcoming or past events. The next regular meeting of the Division of Particles and Fields of the American Physical Society will take place from 14-17 January 1987 in Salt Lake City, Utah, hosted by the Department of Physics of the University of Utah.; A meeting on Computing in High Energy Physics will be held from 2-6 February 1987 at Asilomar State Beach, Monterey, California, arranged by the Stanford Linear Accelerator Center (SLAC) and the Santa Cruz Institute for Particle Physics.

  15. Anabolic-Androgenic Steroids - doi:10.5020/18061230.2007.p267

    Directory of Open Access Journals (Sweden)

    Urival Magno Gomes Ferreira

    2012-01-01

    Full Text Available There are evidences of the increase in the consumption of anabolic steroids and the damages to health caused by their indiscriminate use, mainly among children and youngsters. The anabolic-androgenic steroids (AAS consist in testosterone and its derivatives. They are produced endogenously in the testicles and adrenal cortex and are responsible for the secondary sexual characteristics associated to masculinity. Although the results of the exogenous use of AAS are still controversial, they have been used for the increase of physical strength and muscle mass. These substances are directly related to different clinical conditions such as: bladder cancer, coronary disease, gynecomastia, hepatic disorders and cancer, and sterility. This study aimed at approaching relevant topics related to the drugs action mechanisms, ways of use and metabolism, and side effects, besides the importance of the prevention in the use of those drugs in most diverse age groups. The abusive use of anabolic-androgenic steroids consists in a problem that has gradually occurred, which has given rise to laws, rules and support groups turned to the prevention, education and restriction of their use.

  16. 26 CFR 1.267(c)-1 - Constructive ownership of stock.

    Science.gov (United States)

    2010-04-01

    ... owned by A. In addition, the family ownership rule may be applied to make AWF, AW's father, the... members of his family it is not necessary that he own stock in the corporation either directly or... stock owned directly or indirectly by or for a member of his family, or by or for his partner, is not to...

  17. People and things. CERN Courier, Sep 1986, v. 26(7)

    International Nuclear Information System (INIS)

    Anon.

    1986-01-01

    The article reports on achievements of various people, staff changes and position opportunities within the CERN organization and contains news updates on upcoming or past events. The next regular meeting of the Division of Particles and Fields of the American Physical Society will take place from 14-17 January 1987 in Salt Lake City, Utah, hosted by the Department of Physics of the University of Utah.; A meeting on Computing in High Energy Physics will be held from 2-6 February 1987 at Asilomar State Beach, Monterey, California, arranged by the Stanford Linear Accelerator Center (SLAC) and the Santa Cruz Institute for Particle Physics

  18. 40 CFR 267.195 - What are the secondary containment requirements?

    Science.gov (United States)

    2010-07-01

    ... wastes or accumulated liquid out of the system to the soil, groundwater, or surface water at any time... the failure of either the primary or secondary containment structure or the presence of any release of... 40 Protection of Environment 26 2010-07-01 2010-07-01 false What are the secondary containment...

  19. Synthesis and Antitumor Activities of Phenanthrene-Based Alkaloids

    Directory of Open Access Journals (Sweden)

    Zhanyou Wang

    2009-12-01

    Full Text Available A series of phenanthrene-based tylophorine derivatives (PBTs were synthesized and their cytotoxic activities against the H460 human large-cell lung carcinoma cell line were evaluated. Among these compounds, N-(3-hydroxy-2,6,7-tri-methoxyphenanthr-9-ylmethyl-L-prolinol (5a, and N-(3-hydroxy-2,6,7-trimethoxy-phenanthr-9-ylmethyl-L-valinol (9 exhibited good activities, with IC50 values of 11.6 and 6.1 mM, respectively.

  20. Thermal expansion anomaly and thermal conductivity of U3O8

    International Nuclear Information System (INIS)

    Schulz, B.

    1975-01-01

    The anomaly in the thermal expansion of U 3 O 8 and results of the thermal conductivity of this compound are described. U 3 O 8 powder heat treated at 1,223 K was consolidated by pressing and sintering in air at 1,223 and 1,373 K to a density of 66% and 80.8% TD. The O/U ratio was 2.67 and 2.63 respectively, the crystal structure being orthorhombic in both cases. For UOsub(2.63) the thermal linear expansion was measured in the temperature range 293 K-1,063 K in pressing direction and normal to it, while for UOsub(2.67) measurements were done parallel to the pressing direction. The curves of the linear thermal expansion from 373 K up to 623 K show negative values and above positive for the three curves. The results are related to known data of phase-transition-temperatures of the orthorhombic U 3 O 8 . Measurements of the thermal conductivity were done on UOsub(2.67). Because of the high porosity of the samples, known relationships for the porosity correction of the thermal conductivity were proved on alumina with 34 % porosity. The values of the thermal conductivity of UOsub(2.67) (corrected to zero porosity) show a very slight temperature dependence, they are about three times lower than those of the stoichiometric uranium dioxide in the same temperature range

  1. Lymphoscintigraphic diagnosis of the lymph node metastasis of esophageal cancer

    International Nuclear Information System (INIS)

    Terui, Shoji; Kawai, Hideo; Hirashima, Toshio; Yamaguchi, Hajime; Kato, Hoichi; Iizuka, Norifumi

    1985-01-01

    Lymphoscintigraphy with 99m Tc-labeled rhenium sulfur colloid was performed preoperatively in 30 patients with esopohageal cancer. It showed hot nodes in a total of 267 lymph nodes, 176 mediastinal nodes and 91 celiac artery nodes. Of these 267 nodes, 47 (18 %) were found to have metastasis, including 34 (19 %) mediastinal nodes and 13 (14 %) celiac artery nodes. On the other hand, the number of non-visualized lymph nodes (cold nodes) was 542. Of them, 78 (14 %) had metastasis; 46 (15 %) were mediastinal nodes and 32 (14 %) were celiac artery nodes. (Namekawa, K.)

  2. Influence of the substituents on the electronic and electrochemical properties of a new square-planar nickel-bis(quinoxaline-6,7-dithiolate) system: synthesis, spectroscopy, electrochemistry, crystallography, and theoretical investigation.

    Science.gov (United States)

    Bolligarla, Ramababu; Reddy, Samala Nagaprasad; Durgaprasad, Gummadi; Sreenivasulu, Vudagandla; Das, Samar K

    2013-01-07

    We describe the synthesis, crystal structures, electronic absorption spectra, and electrochemistry of a series of square-planar nickel-bis(quinoxaline-6,7-dithiolate) complexes with the general formula [Bu(4)N](2)[Ni(X(2)6,7-qdt)(2)], where X = H (1a), Ph (2a), Cl (3), and Me (4). The solution and solid-state electronic absorption spectral behavior and electrochemical properties of these compounds are strongly dependent on the electron donating/accepting nature of the substituent X, attached to the quinoxaline-6,7-dithiolate ring in the system [Bu(4)N](2)[Ni(X(2)6,7-qdt)(2)]. Particularly, the charge transfer (CT) transition bands observed in the visible region are greatly affected by the electronic nature of the substituent. A possible explanation for this influence of the substituents on electronic absorption and electrochemistry is described based on highest occupied molecular orbital (HOMO) to lowest unoccupied molecular orbital (LUMO) gaps, which is further supported by ground-state electronic structure calculations. In addition to this, the observed CT bands in all the complexes are sensitive to the solvent polarity. Interestingly, compounds 1a, 2a, 3, and 4 undergo reversible oxidation at very low oxidation potentials appearing at E(1/2) = +0.12 V, 0.033 V, 0.18 V, and 0.044 V vs Ag/AgCl, respectively, in MeOH solutions, corresponding to the respective couples [Ni(X(2)6,7-qdt)(2)](-)/[Ni(X(2)6,7-qdt)(2)](2-). Compounds 1a, 3, and 4 have been characterized unambiguously by single crystal X-ray structural analysis; compound 2a could not be characterized by single crystal X-ray structure determination because of the poor quality of the concerned crystals. Thus, we have synthesized the tetraphenyl phosphonium salt of the complex anion of 2a, [PPh(4)](2)[Ni(Ph(2)6,7-qdt)(2)]·3DMF (2b) for its structural characterization.

  3. NhaA Na+/H+ antiporter mutants that hardly react to the membrane potential.

    Directory of Open Access Journals (Sweden)

    Dudu Alkoby

    Full Text Available pH and Na+ homeostasis in all cells requires Na+/H+ antiporters. The crystal structure, obtained at pH 4, of NhaA, the main antiporter of Escherichia coli, has provided general insights into an antiporter mechanism and its unique pH regulation. Here, we describe a general method to select various NhaA mutants from a library of randomly mutagenized NhaA. The selected mutants, A167P and F267C are described in detail. Both mutants are expressed in Escherichia coli EP432 cells at 70-95% of the wild type but grow on selective medium only at neutral pH, A167P on Li+ (0.1 M and F267C on Na+ (0.6 M. Surprising for an electrogenic secondary transporter, and opposed to wild type NhaA, the rates of A167P and F267C are almost indifferent to membrane potential. Detailed kinetic analysis reveals that in both mutants the rate limiting step of the cation exchange cycle is changed from an electrogenic to an electroneutral reaction.

  4. Determination of Nerve Agent Metabolites by Ultraviolet Femtosecond Laser Ionization Mass Spectrometry.

    Science.gov (United States)

    Hamachi, Akifumi; Imasaka, Tomoko; Nakamura, Hiroshi; Li, Adan; Imasaka, Totaro

    2017-05-02

    Nerve agent metabolites, i.e., isopropyl methylphosphonic acid (IMPA) and pinacolyl methylphosphonic acid (PMPA), were derivatized by reacting them with 2,3,4,5,6-pentafluorobenzyl bromide (PFBBr) and were determined by mass spectrometry using an ultraviolet femtosecond laser emitting at 267 and 200 nm as the ionization source. The analytes of the derivatized compounds, i.e., IMPA-PFB and PMPA-PFB, contain a large side-chain, and molecular ions are very weak or absent in electron ionization mass spectrometry. The use of ultraviolet femtosecond laser ionization mass spectrometry, however, resulted in the formation of a molecular ion, even for compounds such as these that contain a highly bulky functional group. The signal intensity was larger at 200 nm due to resonance-enhanced two-photon ionization. In contrast, fragmentation was suppressed at 267 nm (nonresonant two-photon ionization) especially for PMPA-PFB, thus resulting in a lower background signal. This favorable result can be explained by the small excess energy in ionization at 267 nm and by the low-frequency vibrational mode of a bulky trimethylpropyl group in PMPA.

  5. 40 CFR 267.52 - What must be in the contingency plan?

    Science.gov (United States)

    2010-07-01

    ... hazardous waste or hazardous waste constituents to air, soil, or surface water at the facility. (2) Describe... decontamination equipment), where this equipment is required. In addition, you must include the location and a...

  6. Far-infrared spectrophotometry of SN 1987A - Days 265 and 267

    Science.gov (United States)

    Moseley, S. H.; Dwek, E.; Silverberg, R. F.; Glaccum, W.; Graham, J. R.; Loewenstein, R. F.

    1989-01-01

    The paper presents 16-66-micron spectra of SN 1987A taken on days 266 and 268 after core collapse. The spectrum consists of a nearly flat continuum, strong emission lines of hydrogen, and fine-structure lines of Fe II, Fe III, Co II, S I, and possibly Fe I, Ni II, and S III. From the relative strength of three lines which arise from transitions within the ground and excited states of Fe II, the temperature and a lower limit on the density of the line-emitting region are derived. From the line strengths, the abundances of Fe and S I, the end products of explosive nucleosynthesis in the supernova are estimated. An upper limit is also set to the amount of Co II remaining in the mantle. The low measured mass of Fe suggests that the ejecta are clumpy. The flat continuum is most likely free-free emission from the expanding supernova ejecta. About 35 percent of this emission arises from the ionized metals in the mantle; the rest arises from ionized hydrogen. At the time of these observations, there is no evidence for any emission from dust that may have formed in the supernova ejecta or from preexisting dust in the surrounding medium.

  7. : tous les projets | Page 267 | CRDI - Centre de recherches pour le ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    ... accru pour le travail d'évaluation que les capacités d'évaluation ne peuvent toutefois soutenir. Date de début : 1 octobre 2011. End Date: 24 novembre 2015. Sujet: RESEARCH CAPACITY, RESEARCH METHODS, EVALUATION TECHNIQUES, GENDER ANALYSIS. Région: India, South Asia, Central Asia, Far East Asia.

  8. 27 CFR 26.267 - Payment of tax by electronic fund transfer.

    Science.gov (United States)

    2010-04-01

    ... of this chapter, a gross amount equal to or exceeding five million dollars in wine taxes combining... summarized separately for distilled spirits taxes, wine taxes, or beer taxes, and is defined as the gross tax... procedures established by the U.S. Customs Service. (d) Each person who is required by this section to make...

  9. ORF Alignment: NC_004463 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available y protein ... [Bradyrhizobium japonicum USDA 110] ... Length = 108 ... Query: 208 DIAILHRASRFIDQN...LGRNDLSVATICREIGVSRSVLYRVFAPLAGVADYIRGRRLEAIH 267 ... DIAILHRASRFIDQNLGRND...LSVATICREIGVSRSVLYRVFAPLAGVADYIRGRRLEAIH Sbjct: 1 ... DIAILHRASRFIDQNLGRNDLSVATICREIGVSRSVLYRVFAPLAGVADYIRGRRLEAIH 60 ...

  10. Preparations and crystal structures of 8 coordinate uranyl(VI) complexes having macrocyclic ligands derived from pyrroledicarboxialdehydes and diamines

    International Nuclear Information System (INIS)

    Komagine, J.; Takeda, M.; Takahashi, M.

    2006-01-01

    Six 8-coordinate uranyl(VI) complexes with macrocyclic Schiff base ligands derived from 2,6-pyrroledicarboxialdehyde and diamines are prepared and the crystal structures for two of them are determined focusing on the relation between the size of the ligands and U-N bond distances. No difference in average uranyl bond distances and bond angles are observed between [UO 2 (bipytn)](a) and [UO 2 (bipydmtn)](b). U-N bonds of these complexes are, however, not equal; the U-N(pyrrole) bonds [2.45(a), 2.44(b) A] are much shorter than the U-N(imine) bonds [2.67(a), 2.67(b) A]. (author)

  11. DNA cytosine methylation in the bovine leukemia virus promoter is associated with latency in a lymphoma-derived B-cell line: potential involvement of direct inhibition of cAMP-responsive element (CRE)-binding protein/CRE modulator/activation transcription factor binding.

    Science.gov (United States)

    Pierard, Valérie; Guiguen, Allan; Colin, Laurence; Wijmeersch, Gaëlle; Vanhulle, Caroline; Van Driessche, Benoît; Dekoninck, Ann; Blazkova, Jana; Cardona, Christelle; Merimi, Makram; Vierendeel, Valérie; Calomme, Claire; Nguyên, Thi Liên-Anh; Nuttinck, Michèle; Twizere, Jean-Claude; Kettmann, Richard; Portetelle, Daniel; Burny, Arsène; Hirsch, Ivan; Rohr, Olivier; Van Lint, Carine

    2010-06-18

    Bovine leukemia virus (BLV) proviral latency represents a viral strategy to escape the host immune system and allow tumor development. Besides the previously demonstrated role of histone deacetylation in the epigenetic repression of BLV expression, we showed here that BLV promoter activity was induced by several DNA methylation inhibitors (such as 5-aza-2'-deoxycytidine) and that overexpressed DNMT1 and DNMT3A, but not DNMT3B, down-regulated BLV promoter activity. Importantly, cytosine hypermethylation in the 5'-long terminal repeat (LTR) U3 and R regions was associated with true latency in the lymphoma-derived B-cell line L267 but not with defective latency in YR2 cells. Moreover, the virus-encoded transactivator Tax(BLV) decreased DNA methyltransferase expression levels, which could explain the lower level of cytosine methylation observed in the L267(LTaxSN) 5'-LTR compared with the L267 5'-LTR. Interestingly, DNA methylation inhibitors and Tax(BLV) synergistically activated BLV promoter transcriptional activity in a cAMP-responsive element (CRE)-dependent manner. Mechanistically, methylation at the -154 or -129 CpG position (relative to the transcription start site) impaired in vitro binding of CRE-binding protein (CREB) transcription factors to their respective CRE sites. Methylation at -129 CpG alone was sufficient to decrease BLV promoter-driven reporter gene expression by 2-fold. We demonstrated in vivo the recruitment of CREB/CRE modulator (CREM) and to a lesser extent activating transcription factor-1 (ATF-1) to the hypomethylated CRE region of the YR2 5'-LTR, whereas we detected no CREB/CREM/ATF recruitment to the hypermethylated corresponding region in the L267 cells. Altogether, these findings suggest that site-specific DNA methylation of the BLV promoter represses viral transcription by directly inhibiting transcription factor binding, thereby contributing to true proviral latency.

  12. 267 Isolement des bactéries lactiques à partir des produits laitiers ...

    African Journals Online (AJOL)

    sanae

    L'objectif de cette étude est donc l'isolement des bactéries lactiques à partir de lben et ... la souche Lb4 du genre Lactobacillus possède une forte propriété acidifiante. ..... En plus de l'agroalimentaire, Cette boisson pourra jouer un rôle très ...

  13. 40 CFR 267.141 - Definitions of terms as used in this subpart.

    Science.gov (United States)

    2010-07-01

    ... to limit the meanings of terms in a way that conflicts with generally accepted accounting practices... regulations and are not intended to limit their meanings in a way that conflicts with general insurance... relationship means the extent of a business relationship necessary under applicable State law to make a...

  14. Erythrocyte Sedimentation Rate (ESR): MedlinePlus Lab Test Information

    Science.gov (United States)

    ... K. Brunner & Suddarth's Handbook of Laboratory and Diagnostic Tests. 2 nd Ed, Kindle. Philadelphia: Wolters Kluwer Health, Lippincott Williams & Wilkins; c2014. Erythrocyte Sedimentation Rate (ESR); p. 267– ...

  15. Co víme o historii vápnitých slatinišť v Západních Karpatech

    Czech Academy of Sciences Publication Activity Database

    Hájková, Petra; Hájek, M.; Horsák, M.; Jamrichová, Eva

    2015-01-01

    Roč. 50, č. 2 (2015), s. 267-282 ISSN 1211-5258 Institutional support: RVO:67985939 Keywords : bryophytes * Caricion davallianae * macrofossils * palaeoecology * relicts * succession Subject RIV: EH - Ecology, Behaviour

  16. Factors mediating the depression in the adult obese outpatients

    Directory of Open Access Journals (Sweden)

    Gudelj-Rakić Jelena

    2007-01-01

    Full Text Available Introduction: The prevalence of obesity is rising to epidemic proportions at the alarming rate in both developed and underdeveloped countries around the world. Current prevalence data from individual national studies suggest that the obesity prevalence in the European countries ranges from 10% to 20% for men, and 10% to 25% for women. Health consequences of obesity imply both a number of fatal and non-fatal health problems (out of which the most common are cardiovascular problems, non-insulin dependent diabetes mellitus, cancers, and also a wide spectrum of psychological consequences from diminished self-esteem to clinical depression. Causal relationship between obesity and many chronic diseases is evidence- based. At the same time, there are marked differences in research data regarding causal obesity-depression relationship. Several studies have found no direct association between obesity and depression, while in others the prevalence of depression in obese patients was up to 50%. Gender, obesity grade, socioeconomic status and asking for professional help are named as moderators and mediators of this relationship. Among recommended screening methods, BDI-II is the most frequently used in the adult outpatient departments. Objective The aim of the study was to determine possible risk factors of depression in adult obese patients treated for obesity. Gender, obesity and education level as well as marital status were analyzed as possible moderators of depression-obesity relationship. Method The research included 267 patients, 38.0±14.6 years of age, who referred to the Outpatient Nutrition Department for dietetic consultation or nutritional medical therapy. Nutritional status was assessed by BMI (kg/mІ, calculated from measured values of body weight and height according to WHO recommendations. An estimate of the existence and/or depression level was investigated by Beck Depression Inventory - self administered questionnaire recommended for use

  17. Compositional Differences between Felsic Volcanic Rocks from the ...

    African Journals Online (AJOL)

    Bheema

    characteristics of the volcanic units, we describe the compositional differences ...... Geology and mineral resources of Somalia and surrounding regions. ... zone (Ethiopia) Journal of Volcanological and Geothermal Research, 80: 267-280.

  18. 75 FR 12121 - Extended Operations (ETOPS) of Multi-Engine Airplanes; Technical Amendment

    Science.gov (United States)

    2010-03-15

    ... CONTACT: Zara Willis, Office of Rulemaking, Federal Aviation Administration, 800 Independence Ave., SW., Washington, DC 20591; telephone (202) 493-4405 facsimile (202) 267- 5075; e-mail Zara[email protected

  19. β-ray irradiation effects in RbBr: Eu crystals

    International Nuclear Information System (INIS)

    Pacheco B, J.M.; Rodriguez M, R.; Perez S, R.

    2006-01-01

    Defects induced by β-ray irradiation in RbBr: Eu 2+ crystals doped with a high concentration of Eu 2+ ions are studied by means of optical absorption (OA), thermoluminescence (TL), and optically stimulated TL (OSTL). The fading, dose, and optical bleaching effects on the TL glow curves of room temperature irradiated samples has been analyzed. OA indicates that irradiation of samples at room temperature induce the formation of F but not F z centers. The TL glow curves show peaks at 267, 303, and 403 K. The 267 K glow peak disappear in less than 1 s under blue light or infrared radiation photo bleaching. A high sensitivity to the ionizing radiation has been observed. These results confirm that this material is an efficient phosphor. (Author)

  20. Štípaná industrie z mladoneolitického sídelního areálu s rondelem ve Vchynicích, okr. Litoměřice

    Czech Academy of Sciences Publication Activity Database

    Stolz, D.; Řídký, J.; Půlpán, M.; Burgert, Pavel

    2015-01-01

    Roč. 67, č. 2 (2015), s. 267-286 ISSN 0323-1267 Institutional support: RVO:67985912 Keywords : Late Neolithic * Stroke Pottery culture * chipped stone industry Subject RIV: AC - Archeology, Anthropology, Ethnology

  1. Final Rule for Control of Air Pollution From Aircraft and Aircraft Engines; Emission Standards and Test Procedures

    Science.gov (United States)

    EPA adopted emission standards and related provisions for aircraft gas turbine engines with rated thrusts greater than 26.7 kilonewtons. These engines are used primarily on commercial passenger and freight aircraft.

  2. 40 CFR 270.305 - What tank information must I keep at my facility?

    Science.gov (United States)

    2010-07-01

    ... (CONTINUED) SOLID WASTES (CONTINUED) EPA ADMINISTERED PERMIT PROGRAMS: THE HAZARDOUS WASTE PERMIT PROGRAM... 267.198. (j) For tank systems in which ignitable, reactive, or incompatible wastes are to be stored or...

  3. Topos

    Czech Academy of Sciences Publication Activity Database

    Kopecký, Jakub

    2011-01-01

    Roč. 94, č. 5 (2011), s. 264-267 ISSN 0027-8203 Institutional research plan: CEZ:AV0Z90610518 Keywords : meaning * grammatical gender * inflection * Czech National Corpus Subject RIV: AI - Linguistics

  4. Doubling over ten years of central obesity in Hong Kong Chinese working men.

    Science.gov (United States)

    Ko, Tin-choi Gary; Chan, Juliana; Chan, Amy; Wong, Patrick; Hui, Stanley; Chow, Ferrie; Tong, Spencer; Chan, Cecilia

    2007-07-05

    Obesity is now an epidemic in most parts of the world. In this cross sectional study, we report the most recent data on obesity in Hong Kong Chinese working population and compare the changes over 10 years. Between July 2000 and March 2002, 5882 adult subjects from the working class in Hong Kong were recruited (2716 men (46.2%) and 3166 women (53.8%)). They were randomly selected using computer generated codes according to the distribution of occupational groups. Results of this study were compared with the data collected from a prevalence survey for cardiovascular risk factors in a Hong Kong Chinese working population conducted in 1990 (1513 subjects, 910 men (60.1%) and 603 women (39.9%)). Standardized percentages of overweight, obesity, and central obesity, in Hong Kong Chinese working population were 59.7%, 35.0%, 26.7% in men and 32.0%, 21.7%, 26.7% in women. Compared to the data collected in 1990, the percentage of obesity increased by 5% in men and reduced by 6% in women. The percentage of central obesity doubled in men (from 12.2% to 26.7%) but remained stable in women. There is a doubling of the percentage of central obesity in Hong Kong Chinese working men over previous decade. Education and proper lifestyle modification program to tackle this social health issue are urgently indicated.

  5. Cheyne-stokes respiration during wakefulness in patients with chronic heart failure.

    Science.gov (United States)

    Grimm, Wolfram; Kesper, Karl; Cassel, Werner; Timmesfeld, Nina; Hildebrandt, Olaf; Koehler, Ulrich

    2017-05-01

    Cheyne-Stokes respiration (CSR) during sleep has been studied extensively in patients with chronic heart failure (CHF). Prevalence and prognostic significance of CSR during wakefulness in CHF, however, are largely unknown. CSR during wakefulness with an apnea-hypopnea cut-off ≥5/h and moderate to severe CSR with an apnea-hypopnea cutoff ≥15/h were analyzed using polysomnographic recordings in 267 patients with stable CHF with reduced left ventricular (LV) ejection fraction at our institution. Primary endpoint during follow-up was heart transplant-free survival. Fifty of 267 patients (19%) had CSR during wakefulness and 73 of 267 patients (27%) had CSR during sleep. CSR during wakefulness was associated with advanced age, atrial fibrillation, decreased LV ejection fraction, increased LV end-diastolic diameter, brain natriuretic peptide, New York Heart Failure class, and CSR during sleep. During 43 months mean follow-up, 67 patients (25%) died and 4 patients (1%) underwent heart transplantation. Multivariate Cox analysis identified age, male gender, chronic kidney disease, and LV ejection fraction as predictors of reduced transplant-free survival. CSR during wakefulness with an apnea-hypopnea cutoff ≥5/h as well as moderate to severe CSR while awake using an apnea-hypopnea cutoff ≥15/h did not predict reduced transplant-free survival independently from confounding factors. CSR during wakefulness appears to be a marker of heart failure severity.

  6. to view fulltext PDF

    Indian Academy of Sciences (India)

    of phthalic acid and terephthalic acid. 267. Basu K ... Bhusare S R. Phenylboronic acid catalysed synthesis of 1,5-benzodia- .... dipicolinatochromium(III) complex involving oxalate as ..... Computational and experimental studies on oxalic acid.

  7. Occurrence and Species Distribution of Strictly Anaerobic Bacterium Pectinatus in Brewery Bottling Halls

    Czech Academy of Sciences Publication Activity Database

    Matoulková, D.; Kosař, K.; Slabý, M.; Sigler, Karel

    2012-01-01

    Roč. 70, č. 4 (2012), s. 262-267 ISSN 0361-0470 Institutional support: RVO:61388971 Keywords : Beer spoilage * Biofilm * Conveyor belt Subject RIV: EE - Microbiology, Virology Impact factor: 1.000, year: 2012

  8. The language and style of Latin rubrics in medieval liturgical Easter drama

    Czech Academy of Sciences Publication Activity Database

    Vršecká-Kvízová, Kateřina

    -, č. 71 (2013), s. 267-280 ISSN 1376-7453 R&D Projects: GA MŠk(CZ) LD13043 Institutional support: RVO:67985955 Keywords : Easter drama * Medieval Latin * Latin rubrics Subject RIV: AI - Linguistics

  9. 77 FR 44309 - Petition for Exemption; Summary of Petition Received

    Science.gov (United States)

    2012-07-27

    ... INFORMATION CONTACT: Frances Shaver, ARM-207, (202) 267- 4059, FAA, Office of Rulemaking, 800 Independence Ave... No.: FAA-2012-0081. Petitioner: Blue Ridge Community College. Section of 14 CFR Affected: Sec. 147.21...

  10. Retenção do fungicida triadimenol em latossolos em razão da calagem e da fosfatagem Retention of the fungicide triadimenol in Latosol due to lime and phosphate applications

    Directory of Open Access Journals (Sweden)

    Júlio César Azevedo Nóbrega

    2005-05-01

    Full Text Available O objetivo deste trabalho foi avaliar o efeito da calagem e da fosfatagem na retenção do triadimenol em um Latossolo Vermelho-Amarelo distrófico (LVAd e em um Latossolo Vermelho distrófico (LVd em microcolunas de solo. Calagem e fosfatagem, realizadas em conjunto, reduziram a retenção do produto nas amostras do LVAd (7,7% e 8,6%, respectivamente, para a dose de 2,67 e 10,68 kg ha-1 do princípio ativo. No LVd, a calagem e fosfatagem, quando realizadas isoladamente, causaram menor retenção do produto (calagem 7,2% e 3,9%, fosfatagem 10,1% e 6,8%, respectivamente, para as doses de 2,67 e 10,68 kg ha-1 em relação às amostras controle. Apesar da quantidade do produto na solução do solo ser inferior a 1% da dose aplicada, valores mais elevados do produto foram encontrados nas amostras de solo tratadas com calcário e fosfato, isoladamente ou não, no LVAd e, isoladamente, no LVd.The objective of this work was to evaluate the effect of liming and phosphate applications on the retention of triadimenol in microcolumns of soil material of a distrophic Red-Yellow Latosol (Typic Hapludox and a distrophic Red Latosol (Typic Hapludox. Lime and phosphate applications decreased retention of triadimenol on LVAd samples (7.7% and 8.6%, respectively, for 2.67 and 10.68 kg ha-1 of the active principle. Lower retention of triadimenol was observed on LVd samples when lime and phosphate were applied separately (liming 7.2% and 3.9%, phosphate fertilization 10.1% and 6.8%, respectively, for 2.67 and 10.68 kg ha-1 of the compound. In spite of the amount of the chemical in soil solution being inferior to 1% of the dose applied, higher values of the chemical were found in the samples with lime and phosphate, singly or not in the LVAd and singly in the LVd.

  11. The importance of being subtle: small changes in calcium homeostasis control cognitive decline in normal aging

    Czech Academy of Sciences Publication Activity Database

    Toescu, E.C.; Verkhratsky, Alexei

    2007-01-01

    Roč. 6, - (2007), s. 267-273 ISSN 1474-9718 Institutional research plan: CEZ:AV0Z50390512 Keywords : Aging * Ca homeostasis * Cognitive decline Subject RIV: FH - Neurology Impact factor: 5.854, year: 2007

  12. Caloplaca allochroa (lichenized Ascomycetes), a new saxicolous lichen species from South Korea

    Czech Academy of Sciences Publication Activity Database

    Joshi, Y.; Vondrák, Jan; Vondráková, O.; Nguyen, T.T.; Hur, J.-S.

    2011-01-01

    Roč. 2011, č. 117 (2011), s. 261-267 ISSN 0093-4666 Institutional research plan: CEZ:AV0Z60050516 Keywords : anthraquinones * taxonomy * Teloschistaceae Subject RIV: EF - Botanics Impact factor: 0.709, year: 2011

  13. The Effect of Transient Operations on the Levels and Congener Profiles of PCBz, PCPh and PCDD/F in Raw Flue Gases of MSWI Plant

    Czech Academy of Sciences Publication Activity Database

    Šyc, Michal; Fišerová, Eva; Karban, Jindřich; Punčochář, Miroslav; Pekárek, Vladimír

    2015-01-01

    Roč. 118, JAN 2015 (2015), s. 261-267 ISSN 0045-6535 Institutional support: RVO:67985858 Keywords : benzenes * phenols * waste incineration Subject RIV: CI - Industrial Chemistry, Chemical Engineering Impact factor: 3.698, year: 2015

  14. Proposed Rule and Related Materials for Control of Emissions of Air Pollution From Nonroad Diesel Engines Control of Air Pollution From Aircraft and Aircraft Engines; Proposed Emission Standards and Test Procedures

    Science.gov (United States)

    EPA is proposing to adopt emission standards and related provisions for aircraft gas turbine engines with rated thrusts greater than 26.7 kilonewtons. These engines are used primarily on commercial passenger and freight aircraft.

  15. Lidová hudba a zvukový záznam

    Czech Academy of Sciences Publication Activity Database

    Kratochvíl, Matěj

    2006-01-01

    Roč. 93, č. 3 (2006), s. 259-267 ISSN 0009-0794 Institutional research plan: CEZ:AV0Z90580513 Keywords : folk music * sound recording * phonograph * technology * media Subject RIV: AC - Archeology, Anthropology, Ethnology

  16. Intercalation of tartrazine into ZnAl and MgAl layered double hydroxides

    Czech Academy of Sciences Publication Activity Database

    Beneš, L.; Melánová, Klára; Zima, Vítězslav; Svoboda, Jan

    2005-01-01

    Roč. 70, č. 2 (2005), s. 259-267 ISSN 0010-0765 Institutional research plan: CEZ:AV0Z40500505 Keywords : intercalation * hydrotalcite Subject RIV: CA - Inorganic Chemistry Impact factor: 0.949, year: 2005

  17. Dvě konference o Němcích ze středovýchodní Evropy ve Freiburku

    Czech Academy of Sciences Publication Activity Database

    Nosková, Jana

    2017-01-01

    Roč. 104, č. 2 (2017), s. 264-267 ISSN 0009-0794 Institutional support: RVO:68378076 Keywords : Germans * Central Eastern Europe * Freiburg * Ethnology * Anthropology Subject RIV: AC - Archeology, Anthropology , Ethnology OBOR OECD: Antropology, ethnology

  18. Optimization of the transverse electron polarization of HERA at 26.7 GeV

    International Nuclear Information System (INIS)

    Grosshauser, C.

    1994-08-01

    The methods applied for the optimization of the transverse electron polarization were presented in the following and the measurements performed by this extensively described. By these measurements could be shown that in pure electron-beam operation a degree of polarization of P similar 67% can be reached. A adjustment of the electron storage ring determined by this allows also under luminosity conditions without further optimization an only fewly deminuished transverse electron polarization. The measured polarization values where thereby over several hours stable and could also after months be reproduced. An interference of the polarization by electron-proton collisions could not be stated in the framework of the measurements. In an optimization of the electron polarization performed during the luminosity operation polarization values of P similar 67% could be reached. Thereby could be stated that an optimization of the electron polarization can be perforemd parallel to the data taking of the experiments H1 and ZEUS without fearing of extensive interferences for the measurement conditions of the experiments. By means of the resonance depolarization, which was at HERA for the first time successfully applied, the electron energy was determined with a maximal error of similar 3 MeV and an energy calibration of the HERA electron storage ring performed. At this energy calibration a mean deviation of the nominal energy from the energy values, which were determined by means of the depolarization measurements, of similar 35 MeV resulted. By the different studies on the transverse electron polarization and by the production of the worldwide first longitudinally polarized electron beam in a storage ring, in which a degree of polarization of P long ≥55% was observed, could be shown that a data taking of the experiment HERMES can be pursued parallel to the experiments H1 and ZEUS in the electron storage ring HERA

  19. Detection of polychlorinated biphenyls in transformer oils in Vietnam by multiphoton ionization mass spectrometry using a far-ultraviolet femtosecond laser as an ionization source.

    Science.gov (United States)

    Duong, Vu Thi Thuy; Duong, Vu; Lien, Nghiem Thi Ha; Imasaka, Tomoko; Tang, Yuanyuan; Shibuta, Shinpei; Hamachi, Akifumi; Hoa, Do Quang; Imasaka, Totaro

    2016-03-01

    Polychlorinated biphenyls (PCBs) in transformer and food oils were measured using gas chromatography combined with multiphoton ionization mass spectroscopy. An ultrashort laser pulse emitting in the far-ultraviolet region was utilized for efficient ionization of the analytes. Numerous signal peaks were clearly observed for a standard sample mixture of PCBs when the third and fourth harmonic emissions (267 and 200nm) of a femtosecond Ti:sapphire laser (800nm) were employed. The signal intensities were found to be greater when measured at 200nm compared with those measured at 267nm, providing lower detection limits especially for highly chlorinated PCBs at shorter wavelengths. After simple pretreatment using disposable columns, PCB congeners were measured and found to be present in the transformer oils used in Vietnam. Copyright © 2015 Elsevier B.V. All rights reserved.

  20. Utilization of gene mapping and candidate gene mutation screening for diagnosing clinically equivocal conditions: a Norrie disease case study.

    Science.gov (United States)

    Chini, Vasiliki; Stambouli, Danai; Nedelea, Florina Mihaela; Filipescu, George Alexandru; Mina, Diana; Kambouris, Marios; El-Shantil, Hatem

    2014-06-01

    Prenatal diagnosis was requested for an undiagnosed eye disease showing X-linked inheritance in a family. No medical records existed for the affected family members. Mapping of the X chromosome and candidate gene mutation screening identified a c.C267A[p.F89L] mutation in NPD previously described as possibly causing Norrie disease. The detection of the c.C267A[p.F89L] variant in another unrelated family confirms the pathogenic nature of the mutation for the Norrie disease phenotype. Gene mapping, haplotype analysis, and candidate gene screening have been previously utilized in research applications but were applied here in a diagnostic setting due to the scarcity of available clinical information. The clinical diagnosis and mutation identification were critical for providing proper genetic counseling and prenatal diagnosis for this family.

  1. Kodiak, Alaska 3 arc-second DEM

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — The 3-second Kodiak Alaska Elevation Grid provides bathymetric data in ASCII raster format of 2.67-second resolution in geographic coordinates. This grid is strictly...

  2. Seward, Alaska 3 arc-second DEM

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — The 3 arc-second Seward Alaska Elevation Grid provides bathymetric data in ASCII raster format of 2.67-second resolution in geographic coordinates. This grid is...

  3. About Eosinophilic Disorders

    Science.gov (United States)

    ... Matthew J. Ryan, MD Edisio J. Semeao, MD Raman Sreedharan, MBBS, DCH, MRCPCH Ritu Verma, MBChB Jessica ... 879-2467 Foundation 267-426-6500 Research 215-590-3800 Referring Physicians 1-800-879-2467 Explore ...

  4. Butenolides from Plant-Derived Smoke: Natural Plant-Growth Regulators with Antagonistic Actions on Seed Germination

    Czech Academy of Sciences Publication Activity Database

    Light, M. E.; Burger, B. V.; Staerk, D.; Kohout, Ladislav; van Staden, J.

    2010-01-01

    Roč. 73, č. 2 (2010), s. 267-269 ISSN 0163-3864 Institutional research plan: CEZ:AV0Z40550506 Keywords : butenolides * karrikins * brassinosteroids Subject RIV: CC - Organic Chemistry Impact factor: 2.872, year: 2010

  5. The Ultrafast Wolff Rearrangement in the Gas Phase

    Science.gov (United States)

    Steinbacher, Andreas; Roeding, Sebastian; Brixner, Tobias; Nuernberger, Patrick

    The Wolff rearrangement of gas-phase 5-diazo Meldrum's acid is disclosed with femtosecond ion spectroscopy. Distinct differences are found for 267 nm and 200 nm excitation, the latter leading to even two ultrafast rearrangement reactions.

  6. The Experience of Strategic Thinking in a Volatile, Complex, Uncertain & Ambiguous (VUCA) Environment

    Science.gov (United States)

    2014-08-01

    p. 267). • Corporate strategy. “The pattern of decisions in a company that determines and reveals its objectives, purposes, or goals, produces the...341 Starbuck & Milliken, 1988, p.349 Meindl, Stubbart, & Porac, 1996, p.286

  7. Download this PDF file

    African Journals Online (AJOL)

    ONIKOYI

    transforming water resources available for agricultural activities in Benue State,. Nigeria. ... Most often, the responsibility of provision of water supply infrastructure are left within the domain of the .... Leak detection and repairs on taps. 26.7.

  8. Komentované fytocenologické snímky z České republiky. 1.

    Czech Academy of Sciences Publication Activity Database

    Dřevojan, P.; Novák, P.; Sádlo, Jiří

    2016-01-01

    Roč. 52, č. 2 (2016), s. 257-267 ISSN 1211-5258 R&D Projects: GA ČR GB14-36079G Institutional support: RVO:67985939 Keywords : plant communities * plant ecology * syntaxonomy Subject RIV: EF - Botanics

  9. Magnetic susceptibility measurement of single iron/cobalt carbonyl microcrystal by atmospheric magnetophoresis

    Czech Academy of Sciences Publication Activity Database

    Suwa, M.; Oshino, Y.; Watarai, H.; Kasai, A.; Šubrt, Jan

    2008-01-01

    Roč. 9, č. 2 (2008), , 024215-1-024215-6 ISSN 1468-6996 Institutional research plan: CEZ:AV0Z40320502 Keywords : magnetophoresis under atmosphere Subject RIV: CA - Inorganic Chemistry Impact factor: 1.267, year: 2008

  10. Refined Orbital Performance Measurements of the Air Force Electric Propulsion Space Experiment (ESEX) Ammonia Arcjet

    National Research Council Canada - National Science Library

    Fife, J

    2001-01-01

    .... The on-board Servo Accelerometer Assembly (SAA) measured spacecraft acceleration. The mean values of thrust, specific impulse and thrust efficiency are 1.93 +/- 0.06 Newtons, 786.2 +/- 43.0 seconds and 0.267 +/- 0.021, respectively...

  11. Crystal structure of the 14-3-3zeta:serotonin N-acetyltransferase complex. A role for scaffolding in enzyme regulation

    Czech Academy of Sciences Publication Activity Database

    Obšil, Tomáš; Ghirlando, R.; Klein, D. C.; Ganguly, S.; Dyda, F.

    2001-01-01

    Roč. 105, č. 2 (2001), s. 257-267 ISSN 0092-8674 Institutional research plan: CEZ:AV0Z5011922 Keywords : 14-3-3 * AANAT * crystal structure Subject RIV: BO - Biophysics Impact factor: 29.210, year: 2001

  12. nociceptive activities of Elephantorrhiza elephantina

    African Journals Online (AJOL)

    PRECIOUS

    2009-06-15

    Jun 15, 2009 ... The acute toxicity test showed that the plant is relatively safe to use. Key words: Inflammation ... MATERIALS AND METHODS. Plant material ..... plants: An inventory, Natal, South Africa: University of Natal Press. pp. 266-267.

  13. Cinema and the Great War - Andrew Kelly, 1997. History by Hollywood. The use and abuse of the American past - Robert Brant Toplin, 1996

    NARCIS (Netherlands)

    Kester, Bernadette

    1998-01-01

    textabstractReview of: Cinema and the Great War. Andrew Kelly, Londen, New York (Routledge), 1997, 219 p.History by Hollywood. The use and abuse of the American past. Robert Brant Toplin, Chicago (Urbana), 1996, 267 p.

  14. Environmental distribution of coral-associated relatives of apicomplexan parasites

    Czech Academy of Sciences Publication Activity Database

    Janouškovec, J.; Horák, Aleš; Barott, K. L.; Rohwer, F. L.; Keeling, P. J.

    2013-01-01

    Roč. 7, č. 2 (2013), s. 444-447 ISSN 1751-7362 Institutional support: RVO:60077344 Keywords : apicomplexan-related lineages * Chromera * coral symbionts * coral reef ecosystem Subject RIV: EH - Ecology, Behaviour Impact factor: 9.267, year: 2013

  15. Interventions to promote psychiatric patients' compliance to mental ...

    African Journals Online (AJOL)

    2014-11-21

    Nov 21, 2014 ... Such a synthesis may be considered by mental health .... Cochrane: n = 104. Manual. Reference list: n = 13. Total: n = 1365. FIGURE 1: ..... antidepressant treatment', Nordic Journal of Psychiatry 64(4), 265−267. http://.

  16. Infundibular dilatation of the posterior communicating artery in a defined population.

    Science.gov (United States)

    Vlajković, Slobodan; Vasović, Ljiljana; Trandafilović, Milena; Jovanović, Ivan; Ugrenović, Slađana; Dorđević, Gordana

    2015-01-01

    Unusual widening of the posterior communicating artery (PCoA) at its beginning from the cerebral portion of the internal carotid artery (ICA) was described as its infundibular dilatation (ID). A possibility of ID rupture or progression to aneurysm was the reason for an investigation of its frequency and morphologic features in specimens of the Serbian population. Cerebral arteries on the brain base of 267 adult cadavers of both genders and varying age and causes of death were dissected. The images of the PCoA in 190 fetuses were also reviewed. ID of the PCoA was defined as a funnel shaped beginning of different width from ICA, wherein PCoA continues from ID apex to the posterior cerebral artery. There were no cases of ID in fetuses. ID and aneurysms of the PCoA were found in 6/267 or 2.2% and 3/267 or 1.12% of adults, respectively. Unilaterally, they existed on the left side and, frequently, in male cases aging 70 years and older, that had died without cerebral cause. Bilaterally, ID was found in 2/6 cases. There was only one case of ID and aneurysm of the PCoA, but from the ID. We are of the opinion that ID of the PCoA only develops postnatally and probably is due to the influence of hemodynamic factors or hypertension. Copyright © 2014 Elsevier GmbH. All rights reserved.

  17. Dynamics of Db isotopes formed in reactions induced by 238U, 248Cm, and 249Bk across the Coulomb barrier

    Science.gov (United States)

    Kaur, Gurjit; Sandhu, Kirandeep; Kaur, Amandeep; Sharma, Manoj K.

    2018-05-01

    The dynamical cluster decay model is employed to investigate the decay of *265Db and *267Db nuclei, formed in the 27Al+238U , 18O+249Bk , and 19F+248Cm hot fusion reactions at energies around the Coulomb barrier. First, the fission dynamics of the 27Al+238U reaction is explored by investigating the fragmentation and preformation yield of the reaction. The symmetric mass distribution of the fission fragments is observed for *265Db nucleus, when static β2 i deformations are used within hot optimum orientation approach. However, the mass split gets broaden for the use of β2 i-dynamical hot configuration of the fragments and becomes clearly asymmetric for the cold-static-deformed approach. Within the application of cold orientations of fragments, a new fission channel is observed at mass asymmetry η =0.29 . In addition to 238U-induced reaction, the work is carried out to address the fission and neutron evaporation cross sections of *267Db nucleus formed via 19F+248Cm and 18O+249Bk reactions, besides a comprehensive analysis of fusion and capture processes. Higher fusion cross sections and compound nucleus formation probabilities (PCN) are obtained for the 18O+249Bk reaction, as larger mass asymmetry in the entrance channel leads to reduced Coulomb factor. Finally, the role of sticking (IS) and nonsticking (INS) moments of inertia is analyzed for the 4 n and 5 n channels of *267Db nuclear system.

  18. Spinal motor neuron neuroaxonal spheroids in chronic aluminum neurotoxicity contain phosphatase-resistant high molecular weight neurofilament (NFH).

    Science.gov (United States)

    Gaytan-Garcia, S; Kim, H; Strong, M J

    1996-04-15

    It has previously been shown that a single intracisternal inoculum of AlCl3 in young adult New Zealand white rabbits will induce a dose-dependent phosphatase resistance of high molecular weight neurofilament protein (NFH) that is proportionate to the extent of neurofilamentous inclusion formation (Strong and Jakowec, 1994). To determine if the potential for dissolution of aluminum-induced neurofilamentous inclusions was dependent on the degree of NFH phosphatase resistance, we have examined NFH phosphatase sensitivity in a reversible chronic model of aluminum neurotoxicity. Rabbits receiving repeated intracisternal inoculums of 100 microgram AlCl3 at 28 day intervals until day 267 develop spinal motor neuron perikaryal and neuroaxonal neurofilamentous aggregates in a stereotypic, dose-dependent fashion. In the rabbits receiving inoculums until day 156 with survival until day 267 without further aluminum exposure, neuroaxonal spheroids remained prominent while perikaryal inclusions largely resolved. Immunoreactivity to a monoclonal antibody recognizing phosphorylated NFH (SMI 31) was abolished in perikaryal aggregates at each time interval by dephosphorylation with bovine alkaline phosphatase. However, neuroaxonal spheroids maintained their immunoreactivity. Using time-course dephosphorylation studies of spinal cord homogenates, we observed a significant reduction in the rate of dephosphorylation of NFH following 267 days of AlCl3 exposure (P < 0.05). These observations suggest that neuroaxonal spheroids contain phosphatase-resistant NFH isoforms and that the potential for resolution of intraneuronal neurofilamentous inclusions correlates with the susceptibility of NF within these inclusions to enzymatic dephosphorylation.

  19. Strong broad green UV-excited photoluminescence in rare earth (RE = Ce, Eu, Dy, Er, Yb) doped barium zirconate

    Energy Technology Data Exchange (ETDEWEB)

    Borja-Urby, R. [Grupo de Espectroscopia de Materiales Avanzados y Nanoestructurados (EMANA), Centro de Investigaciones en Optica A. C., Leon, Gto. 37150 (Mexico); Diaz-Torres, L.A., E-mail: ditlacio@cio.mx [Grupo de Espectroscopia de Materiales Avanzados y Nanoestructurados (EMANA), Centro de Investigaciones en Optica A. C., Leon, Gto. 37150 (Mexico); Salas, P. [Centro de Fisica Aplicada y Tecnologia Avanzada, Universidad Nacional Autonoma de Mexico, A.P. 1-1010, Queretaro, Qro. 76000 (Mexico); Angeles-Chavez, C. [Instituto Mexicano del Petroleo, Ciudad de Mexico, D. F. 07730 (Mexico); Meza, O. [Grupo de Espectroscopia de Materiales Avanzados y Nanoestructurados (EMANA), Centro de Investigaciones en Optica A. C., Leon, Gto. 37150 (Mexico)

    2011-10-25

    Highlights: > Trivalent rare earth (RE) substitution on Zr{sup 4+} sites in BaZrO{sub 3} lead to band gap narrowing. > RE substitution lead to enhanced blue-green intrinsic emission of nanocrystalline BaZrO{sub 3} > Blue-green hue of BaZrO3:RE depends on RE dopant and excitation UV wavelength > BaZrO3: Dy{sup 3+} PL chromatic coordinates correspond to pure white color coordinates of CIE 1931 model - Abstract: The wet synthesis hydrothermal method at 100 deg. C was used to elaborate barium zirconate (BaZrO{sub 3}) unpurified with 0.5 mol% of different rare earth ions (RE = Yb, Er, Dy, Eu, Ce). Morphological, structural and UV-photoluminescence properties depend on the substituted rare earth ionic radii. While the crystalline structure of RE doped BaZrO{sub 3} remains as a cubic perovskite for all substituted RE ions, its band gap changes between 4.65 and 4.93 eV. Under 267 nm excitation the intrinsic green photoluminescence of the as synthesized BaZrO{sub 3}: RE samples is considerably improved by the substitution on RE ions. For 1000 deg. C annealed samples, under 267 nm, the photoluminescence is dominated by the intrinsic BZO emission. It is interesting to notice that Dy{sup 3+}, Er{sup 3+} and Yb{sup 3+} doped samples present whitish emissions that might be useful for white light generation under 267 nm excitation. CIE color coordinates are reported for all samples.

  20. Complete moment convergence of weighted sums for processes ...

    Indian Academy of Sciences (India)

    Proc. Indian Acad. Sci. (Math. Sci.) Vol. 124, No. 2, May 2014, pp. 267–279. c Indian Academy of ... College of Mathematics and Statistics, Chongqing Technology and Business. University ...... (1995) (Oxford: Clarendon Press). [14] Wang X J ...

  1. Anionic catalyst binders based on trimethylamine-quaternized poly(2,6-dimethyl-1,4-phenylene oxide) for alkaline electrolyzers

    Czech Academy of Sciences Publication Activity Database

    Schauer, Jan; Hnát, J.; Brožová, Libuše; Žitka, Jan; Bouzek, K.

    2015-01-01

    Roč. 473, 1 January (2015), s. 267-273 ISSN 0376-7388 Institutional support: RVO:61389013 Keywords : poly(2,6-dimethyl-1,4-phenylene oxide) * bromination * trimethylamine Subject RIV: CD - Macromolecular Chemistry Impact factor: 5.557, year: 2015

  2. Geochemistry and distribution of sediments in the East Indian shelf ...

    Indian Academy of Sciences (India)

    29

    trace element geochemistry yielded interesting results about the sediment .... sediments and the core samples are as given in Table 1. ..... radioactive lead, thorium and uranium showed higher concentration in C3 than in C1 ...... Plant Soil, 267,.

  3. Browse Title Index

    African Journals Online (AJOL)

    Items 51 - 100 of 267 ... ... 1822) juveniles reared in cages suspended in concrete tank and earthen ... Dietary intervention with garlic/onion in the treatment and management of ... Effects of consuming fish caught from the crude oil-contaminated ...

  4. Assessment of the physical activity, body mass index and energy ...

    African Journals Online (AJOL)

    Z. Hattingh

    2014-08-20

    Aug 20, 2014 ... revealed that 32% of black women were obese and 26.7% were overweight .... Fasting blood samples were collected as part of the larger study to establish ... Continuous variables were described by medians and percentiles ...

  5. A cross-sectional survey of dental caries, oral hygiene, and Helicobacter pylori infection in adults.

    Science.gov (United States)

    Liu, Peng; Yue, Ji; Han, Shufang; Deng, Tianzheng; Fu, Chongjian; Zhu, Guoxiong; Chen, Dong

    2013-07-01

    We explored the epidemiological risk factors for dental caries to help explain differences in the prevalence of adult dental caries. We examined 841 people for the presence of Helicobacter pylori in their dental plaque and for dental caries. Of the 841 subjects, 574 (68.25%) were infected with H pylori, and 516 (61.36%) were diagnosed with dental caries. Among the 574 subjects with H pylori, the prevalence of dental caries was 73.52% (422/574), while the prevalence among the 267 cases without H pylori was 35.21% (94/267). A correlation existed between the presence of H pylori and the occurrence of dental caries (χ(2) = 112.8, P pylori had a higher mean dental plaque index than those without. In conclusion, H pylori infection in the oral cavity is associated with dental caries and poor dental hygiene.

  6. High strain rate tensile properties of annealed 2 1/4 Cr--1 Mo steel

    International Nuclear Information System (INIS)

    Klueh, R.L.; Oakes, R.E. Jr.

    1975-01-01

    The high strain rate tensile properties of annealed 2 1 / 4 Cr-1 Mo steel were determined and the tensile behavior from 25 to 566 0 C and strain rates of 2.67 x 10 -6 to 144/s were described. Above 0.1/s at 25 0 C, both the yield stress and the ultimate tensile strength increased rapidly with increasing strain rate. As the temperature was increased, a dynamic strain aging peak appeared in the ultimate tensile strength-temperature curves. The peak height was a maximum at about 350 0 C and 2.67 x 10 -6 /s. With increasing strain rate, a peak of decreased height occurred at progressively higher temperatures. The major effect of strain rate on ductility occurred at elevated temperatures, where a decrease in strain rate caused an increase in total elongation and reduction in area

  7. Effect of in-situ TiC particulate on the wear resistance of spray-deposited 7075 Al matrix composite

    International Nuclear Information System (INIS)

    Wang Feng; Liu Huimin; Yang Bin

    2005-01-01

    TiC reinforced 7075 Al matrix composites have been fabricated by a melt in-situ reaction spray deposition. The microstructures of spray-deposited alloys were studied using scanning electron microscopy (SEM) and X-ray diffraction (XRD). The dry sliding wear behavior of the alloys was investigated using a pin-on-disc machine under four loads, namely 8.9, 17.8, 26.7 and 35.6 N. It has been found that the wear behavior of the alloys was dependent on the TiC content in the microstructure and the applied load. At a lower load (8.9 N), with increasing TiC content, the wear rate of the alloy was decreased. At a higher loads (26.7, 35.6 N), a spray-deposited 7075 Al alloy exhibited superior wear resistance to the 7075/TiC composites

  8. New lichen records from Bukovské vrchy Mts (NE Slovakia)

    Czech Academy of Sciences Publication Activity Database

    Pišút, I.; Lackovičová, A.; Guttová, A.; Palice, Zdeněk

    2007-01-01

    Roč. 42, č. 2 (2007), s. 267-280 ISSN 0001-625X R&D Projects: GA ČR GA206/03/1214 Institutional research plan: CEZ:AV0Z60050516 Keywords : lichen * Carpathians * lichenofloristics Subject RIV: EF - Botanics

  9. Sociolinguistic Bibliography of European Countries for 2008: CZ

    Czech Academy of Sciences Publication Activity Database

    Kaderka, Petr

    2010-01-01

    Roč. 24, č. 1 (2010), s. 267-272 ISSN 0933-1883 R&D Projects: GA ČR GA405/09/2028 Institutional research plan: CEZ:AV0Z90610518 Keywords : sociolinguistics * bibliography * Czech Republic Subject RIV: AI - Linguistics

  10. Evaluation of Genotoxicity of CSE1034 by Ames and In vitro ...

    African Journals Online (AJOL)

    NADPH) was obtained from Himedia (Mumbai, India). Ames test. The test was ..... W, Passarge E. Toxicity of antibiotics cultured human skin fibroblast. Humangenetik 1975; 28: 273-267. 15. McCann J, Choi E, Yamasaki E, Ames BN. Detection of.

  11. Electrical and optical properties of ZnO–WO3 nanocomposite and its ...

    Indian Academy of Sciences (India)

    2, April 2017, pp. ... Materials Research Laboratory, Department of Physics, University of Lucknow, Lucknow 226007, India .... ing pressure of 267 MPa in a hydraulic press machine (M.B. ... posed by Friot et al [38] and Anderson and Parks [39]:.

  12. Jaderná energetika v roce 2014

    Czech Academy of Sciences Publication Activity Database

    Wagner, Vladimír

    2014-01-01

    Roč. 65, č. 5 (2014), s. 261-267 ISSN 0375-8842 Institutional support: RVO:61389005 Keywords : nuclear energy * fast breeder reactors * reactor of III+ generation * Fukushima I * Germany Energiewende Subject RIV: BG - Nuclear, Atomic and Molecular Physics, Colliders

  13. Introduction to special issue on the ecology of clonal plants

    Czech Academy of Sciences Publication Activity Database

    Gross, K. L.; Herben, T.; Klimešová, Jitka

    2017-01-01

    Roč. 52, 3-4 (2017), s. 265-267 ISSN 1211-9520 Institutional support: RVO:67985939 Keywords : Introduction to special issue * clonal plants * clonal meeting Subject RIV: EH - Ecology, Behaviour OBOR OECD: Ecology Impact factor: 1.017, year: 2016

  14. Effect of JUNCAO-cultivated Ganoderma lucidum spent mushroom ...

    African Journals Online (AJOL)

    Tropical Journal of Pharmaceutical Research February 2018; 17 (2): 261-267 ... This is an Open Access article that uses a funding model which does not charge readers or their institutions ..... Holstein steers [20]) because it is easy to digest.

  15. Apoptosis induced by (di-isopropyloxyphoryl-Trp) -Lys-OCH in K562 ...

    Indian Academy of Sciences (India)

    PRAKASH KUMAR G

    Kornblau S M 1998 The role of apoptosis in the pathogenesis, prognosis, and therapy of ... Reeves J P 1979 Accumulation of amino acids by lysosomes incubated with amino acid ... of disease; Science 267 1456–1462. Van Engeland M ...

  16. Physiological response, molecular analysis and water use efficiency ...

    African Journals Online (AJOL)

    SAM

    2014-07-16

    Jul 16, 2014 ... sensor over the leaf lamina. In each plant ... The samples containing tubes were incubated at ... supernatant was decanted and transferred to a fresh tube. ..... Drain. Eng. 128: 267-277. Farshad G, Mohsen S, Peyman J (2008).

  17. Effects of an inorganic insecticide (boric acid) against Blattella ...

    African Journals Online (AJOL)

    ufuoma

    2013-05-01

    May 1, 2013 ... Data on ovarian .... The overall data suggested an interference of boric acid with the ... solutions as baits for management of German cockroaches .... Comp. Biochem. Physiol. 135C:257-267. Tine S, Aribi N, Soltani N (2011).

  18. Rare germline alterations in cancer-related genes associated with the risk of multiple primary tumor development

    DEFF Research Database (Denmark)

    Villacis, Rolando A. R.; Basso, Tatiane R; Canto, Luisa M

    2017-01-01

    Multiple primary tumors (MPT) have been described in carriers of inherited cancer predisposition genes. However, the genetic etiology of a large proportion of MPT cases remains unclear. We reviewed 267 patients with hereditary cancer predisposition syndromes (HCPS) that underwent genetic counseli...

  19. Effect of force and location of bottleneck for particle moving through ...

    Indian Academy of Sciences (India)

    Anirban Sharma

    Department of Chemical Sciences, Indian Institute of Science Education and Research Kolkata,. Mohanpur ... σgg = 2.67 Е is much higher than σgg = 6.8 Е.18 Though both Ea and force ... barrier at the window plane during intercage migration.

  20. Optimisation of Lab-Scale Continuous Alcohol-Free Beer Production

    Czech Academy of Sciences Publication Activity Database

    Lehnert, R.; Novák, Pavel; Macieira, F.; Kuřec, M.; Teixeira, J.A.; Brányik, T.

    2009-01-01

    Roč. 27, č. 4 (2009), s. 267-275 ISSN 1212-1800 Institutional research plan: CEZ:AV0Z40720504 Keywords : alcohol-free beer * continuous reactor * immobilised yeast Subject RIV: CI - Industrial Chemistry, Chemical Engineering Impact factor: 0.602, year: 2009

  1. Volné radikály v lidských vlasech

    Czech Academy of Sciences Publication Activity Database

    Stopka, Pavel; Křížová, Jana; Navrátilová, E.

    2002-01-01

    Roč. 10, č. 4 (2002), s. 262-267 ISSN 1210-7921 R&D Projects: GA ČR GA203/01/0944 Institutional research plan: CEZ:AV0Z4032918 Keywords : human hair * melanin * EPR spectroscopy Subject RIV: CA - Inorganic Chemistry

  2. USE OF SOCIAL MEDIA TOOLS AMONG NIGERIAN ...

    African Journals Online (AJOL)

    Facebook, twitter and other digital media, according to Levine (2012), has opened up a whole new world of social .... Marketing of personal goods and services 13. 40. 11. 64 (26.7%) .... trends and future challenges, USA: Prentice Hall. 51 ...

  3. Soil development on loess overlying Cretaceous sediments and Devonian limestones

    Czech Academy of Sciences Publication Activity Database

    Žigová, Anna; Šťastný, Martin

    2015-01-01

    Roč. 12, č. 3 (2015), s. 267-278 ISSN 1214-9705 Institutional support: RVO:67985831 Keywords : loess * Cretaceous and Devonian rocks * mineral composition * soil development * Luvic Chernozem * Albic Luvisol Subject RIV: DF - Soil Science Impact factor: 0.561, year: 2015

  4. Reproductive performance of dairy cows affected by endometritis ...

    African Journals Online (AJOL)

    Moraima

    2015-07-15

    Jul 15, 2015 ... Author(s) agree that this article remains permanently open access under the terms of ... production of 26.7± 3.6 kg milk/day, and primiparous cows, with an ..... vaginal mucus reflects uterine bacterial infection and the immune.

  5. System of Antioxidant Protection of Corn Roots in Case of Adaptation to Combined Action of Herbicides and Soil Drought

    Directory of Open Access Journals (Sweden)

    G. S. Rossihina

    2005-09-01

    Full Text Available Reaction of antioxidant enzymes in the maize root (Kadr 267 MVhybrid to the combined action of herbicides and soil drought was studied. These conditions activated superoxide dismutase (SOD and peroxidase and coused oscillation in the catalase enzymatic activity.

  6. Structural study of Pr.sub.0.8./sub.Na.sub.0.2./sub.MnO.sub.3./sub. at high pressure

    Czech Academy of Sciences Publication Activity Database

    Kozlenko, D. P.; Glazkov, V. P.; Jirák, Zdeněk; Savenko, B. N.

    2003-01-01

    Roč. 267, - (2003), s. 120-126 ISSN 0304-8853 Institutional research plan: CEZ:AV0Z1010914 Keywords : manganites * high pressures * crystal and magnetic structure * neutron diffraction Subject RIV: BM - Solid Matter Physics ; Magnetism Impact factor: 0.910, year: 2003

  7. Comparative effectiveness of nafcillin or cefazolin versus vancomycin in methicillin-susceptible Staphylococcus aureus bacteremia

    Directory of Open Access Journals (Sweden)

    McGregor Jessina C

    2011-10-01

    Full Text Available Abstract Background The high prevalence of methicillin-resistant S. aureus (MRSA has led clinicians to select antibiotics that have coverage against MRSA, usually vancomycin, for empiric therapy for suspected staphylococcal infections. Clinicians often continue vancomycin started empirically even when methicillin-susceptible S. aureus (MSSA strains are identified by culture. However, vancomycin has been associated with poor outcomes such as nephrotoxicity, persistent bacteremia and treatment failure. The objective of this study was to compare the effectiveness of vancomycin versus the beta-lactam antibiotics nafcillin and cefazolin among patients with MSSA bacteremia. The outcome of interest for this study was 30-day in-hospital mortality. Methods This retrospective cohort study included all adult in-patients admitted to a tertiary-care facility between January 1, 2003 and June 30, 2007 who had a positive blood culture for MSSA and received nafcillin, cefazolin or vancomycin. Cox proportional hazard models were used to assess independent mortality hazards comparing nafcillin or cefazolin versus vancomycin. Similar methods were used to estimate the survival benefits of switching from vancomycin to nafcillin or cefazolin versus leaving patients on vancomycin. Each model included statistical adjustment using propensity scores which contained variables associated with an increased propensity to receive vancomycin. Results 267 patients were included; 14% (38/267 received nafcillin or cefazolin, 51% (135/267 received both vancomycin and either nafcillin or cefazolin, and 35% (94/267 received vancomycin. Thirty (11% died within 30 days. Those receiving nafcillin or cefazolin had 79% lower mortality hazards compared with those who received vancomycin alone (adjusted hazard ratio (HR: 0.21; 95% confidence interval (CI: 0.09, 0.47. Among the 122 patients who initially received vancomycin empirically, those who were switched to nafcillin or cefazolin (66

  8. v Micro vegetab obiolog bles so gical q old in J uality Jimma and sa ...

    African Journals Online (AJOL)

    sunny

    cci and aero ..... These were carried out by Gram staining techniques and observing .... horse cart (26.7%), car (23.3%) and humans back ...... Microbiology. The Benjamin puplishing co. Ic., New. York, USA. pp. 274-278. Trias R, Bañeras L, ...

  9. New α-Glucosidase inhibitors from Croton bonplandianum Croton ...

    African Journals Online (AJOL)

    26.7 μg/mL, relative to that of the positive control, acarbose (IC50, 38.2 µg/mL). Conclusion: The ... Chemicals, reagents and instrumentation α-Glucosidase ... measurements performed on the MAT 312 mass ... the extraction process, 20.2 g of.

  10. Hydrodesulfurization Activities of NiMo Catalysts Supported on Mechanochemically Prepared Al‐Ce Mixed Oxides.

    Czech Academy of Sciences Publication Activity Database

    Jirátová, Květa; Spojakina, A.; Kaluža, Luděk; Palcheva, R.; Balabánová, Jana; Tyuliev, G.

    2016-01-01

    Roč. 37, č. 2 (2016), s. 258-267 ISSN 0253-9837 R&D Projects: GA ČR GAP106/11/0902 Institutional support: RVO:67985858 Keywords : nickel * molybdenum * alumina Subject RIV: CI - Industrial Chemistry, Chemical Engineering Impact factor: 2.813, year: 2016

  11. Sensitivity and specificity of the bioassay of estrogenicity in mammary gland and seminal vesicles of male mice

    Czech Academy of Sciences Publication Activity Database

    Škarda, Josef

    2002-01-01

    Roč. 51, č. 3 (2002), s. 267-276 ISSN 0862-8408 R&D Projects: GA ČR GA523/99/0843; GA AV ČR KSK5020115 Keywords : bioassay * estrogenicity * mammary gland Subject RIV: ED - Physiology Impact factor: 0.984, year: 2002

  12. A Gateway((R)) -compatible bacterial adenylate cyclase-based two-hybrid system

    Czech Academy of Sciences Publication Activity Database

    Ouellette, S. P.; Gauliard, E.; Antošová, Zuzana; Ladant, D.

    2014-01-01

    Roč. 6, č. 3 (2014), s. 259-267 ISSN 1758-2229 Institutional support: RVO:67985823 Keywords : bacterial two-hybrid system * protein–protein interactions * cell division * Gateway((R))(GW) cloning system Subject RIV: EE - Microbiology, Virology Impact factor: 3.293, year: 2014

  13. Respiratory metabolism of salivary glands during the late larval and prepupal development of Drosophila melanogaster

    Czech Academy of Sciences Publication Activity Database

    Farkaš, R.; Sláma, Karel

    2015-01-01

    Roč. 81, October 01 (2015), s. 109-117 ISSN 0022-1910 Institutional support: RVO:60077344 Keywords : salivary glands * in vitro culture * metamorphosis Subject RIV: ED - Physiology Impact factor: 2.267, year: 2015 http://www.sciencedirect.com/science/article/pii/S0022191015001328

  14. Job Satisfaction in Health Education and the Value of Added Credentialing.

    Science.gov (United States)

    Prelip, Michael L.

    2001-01-01

    Surveyed 267 health educators to measure job satisfaction in the profession and investigate whether individual credentialing affected overall job satisfaction and satisfaction with work, pay, opportunity for promotion, coworkers, and supervision. Results indicated satisfaction with coworkers, work, supervision, and pay, but dissatisfaction with…

  15. ORF Alignment: NC_006513 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_006513 gi|56476897 >1r0wC 2 267 324 600 2e-59 ... ref|YP_158486.1| putative composite... ATP-binding transmembrane ABC transporter ... protein [Azoarcus sp. EbN1] emb|CAI07585.1| putative ... composite

  16. Effect of UV-B radiation on the fatty acid composition of the marine phytoplankter Tetraselmis sp.: Relationahip to cellular pigments

    Digital Repository Service at National Institute of Oceanography (India)

    Goes, J.I.; Handa, N.; Taguchi, S.; Hama, T.

    values or the values of fatty ac~ds recorded when the treated samples were returned to control conditions. Variance ratios (F) presented in Table 4 Goes et a1 Effect of UV-B radiation on Tetraselmis fatty acid compos~tion 267 -- Table 3...

  17. Sadhana | Indian Academy of Sciences

    Indian Academy of Sciences (India)

    Home; Journals; Sadhana. Zeynab Khosravinia. Articles written in Sadhana. Volume 39 Issue 2 April 2014 pp 267-281. A new colour constancy algorithm based on automatic determination of gray framework parameters using neural network · Mohammad Mehdi Faghih Zeynab Khosravinia Mohsen Ebrahimi Moghaddam.

  18. Methylated trivalent arsenicals are potent inhibitors of glucose stimulated insulin secretion by murine pancreatic islets

    Czech Academy of Sciences Publication Activity Database

    Doulliet, Ch.; Currier, J. M.; Saunders, J.; Bodnar, W. M.; Matoušek, Tomáš; Stýblo, M.

    2013-01-01

    Roč. 267, č. 1 (2013), s. 11-15 ISSN 0041-008X R&D Projects: GA MŠk LH12040 Institutional support: RVO:68081715 Keywords : arsenic speciation * tissue * hydride generation Subject RIV: CB - Analytical Chemistry, Separation Impact factor: 3.630, year: 2013

  19. Browse Title Index

    African Journals Online (AJOL)

    Items 201 - 250 of 267 ... Vol 6, No 2 (2008), Stability of Serum/Plasma Glucose for the Diagnosis of Diabetes ... Application as Single Cell Protein for Growth of the Juvenile Fish, ... Given to the Nursing Mothers and Their Degree of Acceptance of ...

  20. Innovation, improvement and operations: an exploration of the management of alignment

    NARCIS (Netherlands)

    de Leede, Jan; Looise, Jan C.; Alders, B.C.M.; Alders, Ben C.M.

    2002-01-01

    Based on the assumption that the three functions of operations, improvement and innovation within companies need to be aligned to improve company performance, this article addresses two internal alignment mechanisms structural and social-dynamic alignment. A survey of 267 companies confirms that

  1. Nanostructured hydroxyapatite/TiO2 composite coating applied to commercially pure titanium by a co-sputtering technique

    International Nuclear Information System (INIS)

    Lee, Baek-Hee; Koshizaki, Naoto

    2008-01-01

    We demonstrate an approach for the coating of nanostructured hydroxyapatite(HAP)/TiO 2 composite on commercially pure Ti (CP-Ti) by a co-sputtering process. HAP/TiO 2 composite film was obtained by controlling the processing pressure. It was observed that decomposition of HAP into CaO was easily induced during sputtering at 0.53 Pa, a typical sputtering condition for film deposition. However, HAP/TiO 2 composite film was obtained with the sputtering pressure of 2.67 Pa. The Ca/P ratio was nearly maintained at 1.66 by sputter deposition at 2.67 Pa. We further confirmed by analysis of plasma spectral emission that the variation of the hydroxyl (OH) radical present was due to the Ar pressure during sputtering. It has been shown that HAP coatings are dependent on the processing pressure, which the hydroxyl radical requires in order to create HAP

  2. Effects of Training on Accuracy of Decoding Complex Nonverbal Behavior. Working Paper No. 267.

    Science.gov (United States)

    Atkinson, Michael L.; And Others

    Two studies investigated the effects of training on how accurately observers (college students) decoded a complex nonverbal stimulus. In the first experiment, observers viewed silent videotapes of 16 third and fourth-grade school children who were listening to an easy or a difficult lesson. Half of the children were responding spontaneously, while…

  3. Enniatin B-induced cell death and inflammatory responses in RAW 267.4 murine macrophages

    Energy Technology Data Exchange (ETDEWEB)

    Gammelsrud, A. [Norwegian Veterinary Institute, P.O. Box 750, Centrum, N-0106 Oslo (Norway); Department of Air Pollution and Noise, Division of Environmental Medicine, Norwegian Institute of Public Health, N-0403 Oslo (Norway); Solhaug, A. [Norwegian Veterinary Institute, P.O. Box 750, Centrum, N-0106 Oslo (Norway); Dendelé, B. [EA 4427 SeRAIC, IRSET, Université de Rennes 1, IFR 140, Rennes (France); Sandberg, W.J. [Department of Air Pollution and Noise, Division of Environmental Medicine, Norwegian Institute of Public Health, N-0403 Oslo (Norway); Ivanova, L. [Norwegian Veterinary Institute, P.O. Box 750, Centrum, N-0106 Oslo (Norway); Kocbach Bølling, A. [Department of Air Pollution and Noise, Division of Environmental Medicine, Norwegian Institute of Public Health, N-0403 Oslo (Norway); Lagadic-Gossmann, D. [EA 4427 SeRAIC, IRSET, Université de Rennes 1, IFR 140, Rennes (France); Refsnes, M.; Becher, R. [Department of Air Pollution and Noise, Division of Environmental Medicine, Norwegian Institute of Public Health, N-0403 Oslo (Norway); Eriksen, G. [Norwegian Veterinary Institute, P.O. Box 750, Centrum, N-0106 Oslo (Norway); Holme, J.A., E-mail: jorn.holme@fhi.no [Department of Air Pollution and Noise, Division of Environmental Medicine, Norwegian Institute of Public Health, N-0403 Oslo (Norway)

    2012-05-15

    The mycotoxin enniatin B (EnnB) is predominantly produced by species of the Fusarium genera, and often found in grain. The cytotoxic effect of EnnB has been suggested to be related to its ability to form ionophores in cell membranes. The present study examines the effects of EnnB on cell death, differentiation, proliferation and pro-inflammatory responses in the murine monocyte–macrophage cell line RAW 264.7. Exposure to EnnB for 24 h caused an accumulation of cells in the G0/G1-phase with a corresponding decrease in cyclin D1. This cell cycle-arrest was possibly also linked to the reduced cellular ability to capture and internalize receptors as illustrated by the lipid marker ganglioside GM1. EnnB also increased the number of apoptotic, early apoptotic and necrotic cells, as well as cells with elongated spindle-like morphology. The Neutral Red assay indicated that EnnB induced lysosomal damage; supported by transmission electron microscopy (TEM) showing accumulation of lipids inside the lysosomes forming lamellar structures/myelin bodies. Enhanced levels of activated caspase-1 were observed after EnnB exposure and the caspase-1 specific inhibitor ZYVAD-FMK reduced EnnB-induced apoptosis. Moreover, EnnB increased the release of interleukin-1beta (IL-1β) in cells primed with lipopolysaccharide (LPS), and this response was reduced by both ZYVAD-FMK and the cathepsin B inhibitor CA-074Me. In conclusion, EnnB was found to induce cell cycle arrest, cell death and inflammation. Caspase-1 appeared to be involved in the apoptosis and release of IL-1β and possibly activation of the inflammasome through lysosomal damage and leakage of cathepsin B. -- Highlights: ► The mycotoxin EnnB induced cell cycle arrest, cell death and inflammation. ► The G0/G1-arrest was linked to a reduced ability to internalize receptors. ► EnnB caused lysosomal damage, leakage of cathepsin B and caspase-1 cleavage. ► Caspase-1 was partly involved in both apoptosis and release of IL-1β. ► There was a synergistic action between EnnB and bacterial LPS.

  4. Enniatin B-induced cell death and inflammatory responses in RAW 267.4 murine macrophages

    International Nuclear Information System (INIS)

    Gammelsrud, A.; Solhaug, A.; Dendelé, B.; Sandberg, W.J.; Ivanova, L.; Kocbach Bølling, A.; Lagadic-Gossmann, D.; Refsnes, M.; Becher, R.; Eriksen, G.; Holme, J.A.

    2012-01-01

    The mycotoxin enniatin B (EnnB) is predominantly produced by species of the Fusarium genera, and often found in grain. The cytotoxic effect of EnnB has been suggested to be related to its ability to form ionophores in cell membranes. The present study examines the effects of EnnB on cell death, differentiation, proliferation and pro-inflammatory responses in the murine monocyte–macrophage cell line RAW 264.7. Exposure to EnnB for 24 h caused an accumulation of cells in the G0/G1-phase with a corresponding decrease in cyclin D1. This cell cycle-arrest was possibly also linked to the reduced cellular ability to capture and internalize receptors as illustrated by the lipid marker ganglioside GM1. EnnB also increased the number of apoptotic, early apoptotic and necrotic cells, as well as cells with elongated spindle-like morphology. The Neutral Red assay indicated that EnnB induced lysosomal damage; supported by transmission electron microscopy (TEM) showing accumulation of lipids inside the lysosomes forming lamellar structures/myelin bodies. Enhanced levels of activated caspase-1 were observed after EnnB exposure and the caspase-1 specific inhibitor ZYVAD-FMK reduced EnnB-induced apoptosis. Moreover, EnnB increased the release of interleukin-1beta (IL-1β) in cells primed with lipopolysaccharide (LPS), and this response was reduced by both ZYVAD-FMK and the cathepsin B inhibitor CA-074Me. In conclusion, EnnB was found to induce cell cycle arrest, cell death and inflammation. Caspase-1 appeared to be involved in the apoptosis and release of IL-1β and possibly activation of the inflammasome through lysosomal damage and leakage of cathepsin B. -- Highlights: ► The mycotoxin EnnB induced cell cycle arrest, cell death and inflammation. ► The G0/G1-arrest was linked to a reduced ability to internalize receptors. ► EnnB caused lysosomal damage, leakage of cathepsin B and caspase-1 cleavage. ► Caspase-1 was partly involved in both apoptosis and release of IL-1β. ► There was a synergistic action between EnnB and bacterial LPS.

  5. 40 CFR 267.1101 - What design and operating standards must my containment building meet?

    Science.gov (United States)

    2010-07-01

    ... generally recognized by the industry such as the American Concrete Institute (ACI) and the American Society...) Stresses of daily operation, including the movement of heavy equipment within the unit and contact of such...

  6. 40 CFR 267.56 - What are the required emergency procedures for the emergency coordinator?

    Science.gov (United States)

    2010-07-01

    ... hazardous surface water run-off from water or chemical agents used to control fire and heat-induced...) The extent of injuries, if any. (vi) The possible hazards to human health or the environment outside...

  7. SU-F-T-267: A Clarkson-Based Independent Dose Verification for the Helical Tomotherapy

    Energy Technology Data Exchange (ETDEWEB)

    Nagata, H [Shonan Kamakura General Hospital, Kamakura, Kanagawa, (Japan); Juntendo University, Hongo, Tokyo (Japan); Hongo, H [Shonan Kamakura General Hospital, Kamakura, Kanagawa, (Japan); Tsukuba University, Tsukuba, Ibaraki (Japan); Kawai, D [Kanagawa Cancer Center, Yokohama, Kanagawa (Japan); Takahashi, R [Cancer Institute Hospital of Japanese Foundation for Cancer Research, Koto, Tokyo (Japan); Hashimoto, H [Shonan Fujisawa Tokushukai Hospital, Fujisawa, Kanagawa (Japan); Tachibana, H [National Cancer Center, Kashiwa, Chiba (Japan)

    2016-06-15

    Purpose: There have been few reports for independent dose verification for Tomotherapy. We evaluated the accuracy and the effectiveness of an independent dose verification system for the Tomotherapy. Methods: Simple MU Analysis (SMU, Triangle Product, Ishikawa, Japan) was used as the independent verification system and the system implemented a Clarkson-based dose calculation algorithm using CT image dataset. For dose calculation in the SMU, the Tomotherapy machine-specific dosimetric parameters (TMR, Scp, OAR and MLC transmission factor) were registered as the machine beam data. Dose calculation was performed after Tomotherapy sinogram from DICOM-RT plan information was converted to the information for MU and MLC location at more segmented control points. The performance of the SMU was assessed by a point dose measurement in non-IMRT and IMRT plans (simple target and mock prostate plans). Subsequently, 30 patients’ treatment plans for prostate were compared. Results: From the comparison, dose differences between the SMU and the measurement were within 3% for all cases in non-IMRT plans. In the IMRT plan for the simple target, the differences (Average±1SD) were −0.70±1.10% (SMU vs. TPS), −0.40±0.10% (measurement vs. TPS) and −1.20±1.00% (measurement vs. SMU), respectively. For the mock prostate, the differences were −0.40±0.60% (SMU vs. TPS), −0.50±0.90% (measurement vs. TPS) and −0.90±0.60% (measurement vs. SMU), respectively. For patients’ plans, the difference was −0.50±2.10% (SMU vs. TPS). Conclusion: A Clarkson-based independent dose verification for the Tomotherapy can be clinically available as a secondary check with the similar tolerance level of AAPM Task group 114. This research is partially supported by Japan Agency for Medical Research and Development (AMED)

  8. Incidence of seed migration to the chest, abdomen, and pelvis after transperineal interstitial prostate brachytherapy with loose 125I seeds

    International Nuclear Information System (INIS)

    Sugawara, Akitomo; Shigematsu, Naoyuki; Nakashima, Jun; Kunieda, Etsuo; Nagata, Hirohiko; Mizuno, Ryuichi; Seki, Satoshi; Shiraishi, Yutaka; Kouta, Ryuichi; Oya, Mototsugu

    2011-01-01

    The aim was to determine the incidence of seed migration not only to the chest, but also to the abdomen and pelvis after transperineal interstitial prostate brachytherapy with loose 125 I seeds. We reviewed the records of 267 patients who underwent prostate brachytherapy with loose 125 I seeds. After seed implantation, orthogonal chest radiographs, an abdominal radiograph, and a pelvic radiograph were undertaken routinely to document the occurrence and sites of seed migration. The incidence of seed migration to the chest, abdomen, and pelvis was calculated. All patients who had seed migration to the abdomen and pelvis subsequently underwent a computed tomography scan to identify the exact location of the migrated seeds. Postimplant dosimetric analysis was undertaken, and dosimetric results were compared between patients with and without seed migration. A total of 19,236 seeds were implanted in 267 patients. Overall, 91 of 19,236 (0.47%) seeds migrated in 66 of 267 (24.7%) patients. Sixty-nine (0.36%) seeds migrated to the chest in 54 (20.2%) patients. Seven (0.036%) seeds migrated to the abdomen in six (2.2%) patients. Fifteen (0.078%) seeds migrated to the pelvis in 15 (5.6%) patients. Seed migration occurred predominantly within two weeks after seed implantation. None of the 66 patients had symptoms related to the migrated seeds. Postimplant prostate D90 was not significantly different between patients with and without seed migration. We showed the incidence of seed migration to the chest, abdomen and pelvis. Seed migration did not have a significant effect on postimplant prostate D90

  9. Two-phase southward subduction of the Mongol-Okhotsk oceanic plate constrained by Permian-Jurassic granitoids in the Erguna and Xing'an massifs (NE China)

    Science.gov (United States)

    Liu, Huichuan; Li, Yinglei; He, Hongyun; Huangfu, Pengpeng; Liu, Yongzheng

    2018-04-01

    Geodynamics of the Mongol-Okhotsk oceanic plate southward subduction are still pending problems. This paper presents new zircon LA-ICP-MS U-Pb age and whole-rock geochemical data for the middle Permian to Middle Jurassic granitoids in the western Erguna and central Xing'an massifs. 267-264 Ma, 241 Ma and 173 Ma I-type granites, and 216 Ma A-type granites were identified in the Erguna and Xing'an massifs (NE China). The I-type granites were produced by partial melting of the lower mafic crust. The 216 Ma A-type granites were derived from partial melting of crustal materials with tonalitic to granodioritic compositions. The 267-264 Ma and 241 Ma I-type granites were generated in an Andean-type arc setting, wheras the 216 Ma A-type and 173 Ma granites were formed in supra subduction extensional setting. We summarized previous age data of the middle Permian to Middle Jurassic magmtaic rocks in the Erguna and Xing'an Massifs and identified two isolated phases of magmatic activity including the ca. 267-225 Ma and ca. 215-165 Ma periods, with a significant magmatic gap at ca. 225-215 Ma. These middle Permian to Middle Jurassic magmatic rocks are closely related to the southward subduction of the Mongol-Okhotsk ocean. A two-stage tectonic evolutionary model was proposed to account for these geological observations in the Erguna and Xing'an massifs, involving Permian to Middle Triassic continuous southward subduction of the Mongol-Okhotsk oceanic plate and Late Triassic to Jurassic slab-rollback and supra subduction extension.

  10. Preliminary estimation of bryophyte biomass and carbon pool from three contrasting different vegetation types

    Czech Academy of Sciences Publication Activity Database

    Singh, M.K.; Juhász, A.; Csintalan, Z.; Kaligaric, M.; Marek, Michal V.; Urban, Otmar; Tuba, Z.

    2005-01-01

    Roč. 33, č. 1 (2005), s. 267-270 ISSN 0133-3720 Grant - others:EU(CZ) HPRI-CT-2002-00197 Institutional research plan: CEZ:AV0Z60870520 Keywords : bryophyte * carbon pool * rain forest Subject RIV: EH - Ecology, Behaviour Impact factor: 0.320, year: 2005

  11. Influence of UV and Ozonised Water Treatment on Trans-resveratrol Content in Berry Skins and Juices of Franc and Green Veltliner Grapes

    Czech Academy of Sciences Publication Activity Database

    Landfeld, A.; Tříska, Jan; Balík, J.; Strohalm, J.; Novotná, P.; Vrchotová, Naděžda; Totušek, J.; Lefnerová, D.; Híc, P.; Tománková, E.; Halama, R.; Houška, M.

    2015-01-01

    Roč. 33, č. 3 (2015), s. 267-276 ISSN 1212-1800 R&D Projects: GA MZe QI91B094 Institutional support: RVO:67179843 Keywords : grape juices * stilbens content * UV irradiation * ozonisation Subject RIV: GM - Food Processing Impact factor: 0.728, year: 2015

  12. 77 FR 1629 - Authorization To Use Lower Than Standard Takeoff, Approach and Landing Minimums at Military and...

    Science.gov (United States)

    2012-01-11

    ... the search function of the docket Web site, anyone can find and read the electronic form of all...: For technical questions concerning this action, contact Gregory French, Air Transportation Division... SW., Washington, DC 20591; telephone (202) 267-4112; email gregory.french@faa.gov . For legal...

  13. The effects of strength-based versus deficit-based self-regulated learning strategies on students' effort intentions

    NARCIS (Netherlands)

    Hiemstra, Djoerd; Van Yperen, Nico W.

    In two randomized experiments, one conducted online (n = 174) and one in the classroom (n = 267), we tested the effects of two types of self-regulated learning (SRL) strategies on students’ intentions to put effort into professional development activities: strength-based SRL strategies (i.e.,

  14. In Vitro Digestibility of Aluminum from Hibiscus sabdariffa Hot Watery Infusion and Its Concentration in Urine of Healthy Individuals

    Czech Academy of Sciences Publication Activity Database

    Frankova, A.; Malik, J.; Drabek, O.; Szakova, J.; Sperlingova, I.; Kloucek, P.; Novy, P.; Tejnecky, V.; Landa, Přemysl; Leuner, O.; Kokoska, L.

    2016-01-01

    Roč. 174, č. 2 (2016), s. 267-273 ISSN 0163-4984 Institutional support: RVO:61389030 Keywords : dialysis dementia * tea * bioavailability * speciation * toxicity * Aluminum * In vitro digestion * Hot watery infusion * Urine * Hibiscus sabdariffa L Subject RIV: EF - Botanics Impact factor: 2.399, year: 2016

  15. Recommendations of the International Medical Informatics Association (IMIA) on Education in Health and Medical Informatics

    Czech Academy of Sciences Publication Activity Database

    Arokiasamy, J.; Ball, M.; Barnett, D.; Bearman, M.; Bemmel van, J.; Douglas, J.; Fisher, P.; Garrie, R.; Gatewood, L.; Goossen, W.; Grant, A.; Hales, J.; Hasman, A.; Haux, R.; Hovenga, E.; Johns, M.; Knaup, P.; Leven, F. J.; Lorenzi, N.; Murray, P.; Neame, R.; Protti, D.; Power, M.; Richard, J.; Schuster, E.; Swinkels, W.; Yang, J.; Zelmer, L.; Zvárová, Jana

    2001-01-01

    Roč. 40, č. 5 (2001), s. 267-277 ISSN 0026-1270 Institutional research plan: AV0Z1030915 Keywords : health informatics * medical informatics * education * recommendations * International Medical Informatics Association * IMIA Subject RIV: BB - Applied Statistics, Operational Research Impact factor: 1.254, year: 2001

  16. On p dependent boundedness of singular integral operators

    Czech Academy of Sciences Publication Activity Database

    Honzík, Petr

    2011-01-01

    Roč. 267, 3-4 (2011), s. 931-937 ISSN 0025-5874 Institutional research plan: CEZ:AV0Z10190503 Keywords : singular integral operators Subject RIV: BA - General Mathematics Impact factor: 0.749, year: 2011 http://www.springerlink.com/content/k507g30163351250/

  17. Research

    African Journals Online (AJOL)

    abp

    2016-01-27

    Jan 27, 2016 ... obesity, hypertension and diabetes in urban and rural. Cameroon. International Journal Of Obesity. 2002; 26(7):. 1009-116. PubMed | Google Scholar. 13. Akintunde AA, Ayodele OE, Akinwusi PO, Opadijo GO. Metabolic syndrome: comparison of occurrence using three definitions in hypertensive patients.

  18. Effects of Cooperative Education on Student Adaptation to University.

    Science.gov (United States)

    Carrell, Suzanne E.; Rowe, Patricia M.

    1993-01-01

    In a comparison of cooperative education and regular students in arts, math, and science (n=267), co-op students reported better social adjustment and attachment to the university and greater commitment to educational goals. Arts students were better adapted to university than others. (SK)

  19. Effect of tandospirone, a serotonin-1A receptor partial agonist, on information processing and locomotion in dizocilpine-treated rats

    Czech Academy of Sciences Publication Activity Database

    Bubeníková-Valešová, V.; Svoboda, Jan; Horáček, J.; Sumiyoshi, T.

    2010-01-01

    Roč. 212, č. 2 (2010), s. 267-276 ISSN 0033-3158 R&D Projects: GA MŠk(CZ) 1M0517 Institutional research plan: CEZ:AV0Z50110509 Keywords : Tandospirone * Schizophrenia * NMDA receptor Subject RIV: FH - Neurology Impact factor: 3.817, year: 2010

  20. Magnonic charge pumping via spin-orbit coupling

    Czech Academy of Sciences Publication Activity Database

    Ciccarelli, C.; Hals, K.M.D.; Irvine, A.; Novák, Vít; Tserkovnyak, Y.; Kurebayashi, H.; Brataas, A.; Ferguson, A.

    2015-01-01

    Roč. 10, č. 1 (2015), 50-54 ISSN 1748-3387 R&D Projects: GA MŠk(CZ) LM2011026 Institutional support: RVO:68378271 Keywords : spintronics * spin-orbit torque * GaMnAs Subject RIV: BM - Solid Matter Physics ; Magnetism Impact factor: 35.267, year: 2015

  1. 77 FR 4219 - FAA-Approved Portable Oxygen Concentrators; Technical Amendment

    Science.gov (United States)

    2012-01-27

    ... CONTACT: For technical questions concerning this action, contact DK Deaderick, Air Transportation Division...; telephone: (202) 267-7480; email: DK[email protected] . For legal questions concerning this action, contact....gov . SUPPLEMENTARY INFORMATION: Background On July 12, 2005, the FAA published SFAR 106, ``Use of...

  2. The prevalence of HIV among patients admitted with stroke at the ...

    African Journals Online (AJOL)

    lmboera

    The respective proportions were 44% vs 24.7%; 26.7% vs 7.6%; 20.0% vs 2.9%; 13.3% vs 1.2%; ... Key words: HIV, stroke, prevalence, hospital, Tanzania ..... The clinical picture of patients with stroke and HIV infection is of importance. As.

  3. Evaluation of commercial marine fish feeds for production of juvenile cobia in recirculating aquaculture systems

    Science.gov (United States)

    The effect of feeding three commercially available diets manufactured by three U.S. feed companies on production characteristics and body composition of juvenile cobia Rachycentron canadum reared in recirculating aquaculture systems (RAS) was evaluated in a 57 d growth trial. Juvenile cobia (26.7 +...

  4. 29 CFR Appendix A to Part 510 - Manufacturing Industries Eligible for Minimum Wage Phase-In

    Science.gov (United States)

    2010-07-01

    ... boxes, including sanitary. 267 1 Converted paper and paperboard products, except containers and boxes.... 2676 1 Sanitary paper products. 2677 1 Envelopes. 2678 3 Stationery, tablets, and related products.... 3172 1 Personal leather goods, except women's handbags and purses. 32 1 Stone, clay, glass, and...

  5. 76 FR 59306 - Proposed Establishment of Class D and E Airspace and Amendment of Class E Airspace; Punta Gorda, FL

    Science.gov (United States)

    2011-09-26

    ... Aviation Administration, Room 350, 1701 Columbia Avenue, College Park, Georgia 30337. FOR FURTHER... Independence Avenue, SW., Washington, DC 20591, or by calling (202) 267-8783. Communications must identify both.... Issued in College Park, Georgia, on September 16, 2011. Mark D. Ward, Manager, Operations Support Group...

  6. Factoring polynomials over arbitrary finite fields

    NARCIS (Netherlands)

    Lange, T.; Winterhof, A.

    2000-01-01

    We analyse an extension of Shoup's (Inform. Process. Lett. 33 (1990) 261–267) deterministic algorithm for factoring polynomials over finite prime fields to arbitrary finite fields. In particular, we prove the existence of a deterministic algorithm which completely factors all monic polynomials of

  7. Das Luthertum in Böhmen und seine (Nicht)Reflexion bei den Nuntien am Kaiserhof

    Czech Academy of Sciences Publication Activity Database

    Černušák, Tomáš

    2018-01-01

    Roč. 18, č. 2 (2018), s. 257-267 ISSN 1805-790X Keywords : Nuncius * Papacy * Bohemian lands * Lutheranism Subject RIV: AB - History OBOR OECD: History (history of science and technology to be 6.3, history of specific sciences to be under the respective headings)

  8. Electrolyte penetration into high energy ion irradiated polymers

    Czech Academy of Sciences Publication Activity Database

    Fink, D.; Petrov, A.; Müller, M.; Asmus, T.; Hnatowicz, Vladimír; Vacík, Jiří; Červená, Jarmila

    158/159 (2002), s. 228-233 ISSN 0257-8972 R&D Projects: GA AV ČR KSK1010104; GA ČR GA102/01/1324 Keywords : polymers * ion bombardment * defects * diffusion * nanostructrure Subject RIV: BG - Nuclear, Atomic and Molecular Physics, Colliders Impact factor: 1.267, year: 2002

  9. CONCLUSION It is obvious that a diagnosis of breast cancer causes ...

    African Journals Online (AJOL)

    Sitwala

    Psychology.1989; 56 (2) 267-183. 5. Kearney, N. and Richardson, A. (2006). Nursing. Patients with Cancer: Principles and Practice. Elsevier, London. 6. .... These patients may have normal vision, a normal neurological examination and normal plain radiographs, despite trauma that may. 2 lead to significant Complications.

  10. Possible Suppression of Magnetorotational Instability by Rapid Radial Flow

    Czech Academy of Sciences Publication Activity Database

    Abramowicz, M. A.; Horák, Jiří; Kluzniak, W.

    2013-01-01

    Roč. 63, č. 2 (2013), s. 267-273 ISSN 0001-5237 R&D Projects: GA ČR(CZ) GAP209/11/2004 Institutional support: RVO:67985815 Keywords : accretion disks * magnetohydrodynamics * black hole physics Subject RIV: BN - Astronomy, Celestial Mechanics, Astrophysics Impact factor: 1.955, year: 2013

  11. Creep in ODS copper reinforced with alumina short fibres - DRS copper

    Czech Academy of Sciences Publication Activity Database

    Kuchařová, Květa; Zhu, S. J.; Čadek, Josef

    2003-01-01

    Roč. 355, 1-2 (2003), s. 267-276 ISSN 0921-5093 R&D Projects: GA AV ČR IBS2041001 Institutional research plan: CEZ:AV0Z2041904 Keywords : Creep * ODS copper * Load transfer Subject RIV: JI - Composite Materials Impact factor: 1.365, year: 2003

  12. Neurological outcome in school-age children after in utero exposure to coumarins

    NARCIS (Netherlands)

    Wesseling, J; Van Driel, D; Smrkovsky, M; Van der Veer, E; Geven-Boere, LM; Sauer, PJJ; Touwen, BCL

    The effect of prenatal exposure to coumarins (acenocoumarol, phenprocoumon) on neurological outcome was assessed in a cohort of 306 children aged 7-15 years. Findings were compared with those in a non-exposed cohort of 267 children, matched for sex, age, and demographic region. We used a

  13. 77 FR 11738 - Authorization To Use Lower Than Standard Takeoff, Approach and Landing Minimums at Military and...

    Science.gov (United States)

    2012-02-28

    ... concerning this action, contact Gregory French, Air Transportation Division, 135 Air Carrier Operations...; telephone (202) 267-4112; email gregory.french@faa.gov . For legal questions concerning this action, contact... Documents An electronic copy of a rulemaking document my be obtained by using the Internet-- 1. Search the...

  14. N-glycosylated catalytic unit meets O-glycosylated propeptide: complex protein architecture in a fungal hexosaminidase

    Czech Academy of Sciences Publication Activity Database

    Plíhal, Ondřej; Sklenář, Jan; Kmoníčková, J.; Man, Petr; Pompach, Petr; Havlíček, Vladimír; Křen, Vladimír; Bezouška, Karel

    2004-01-01

    Roč. 32, č. 5 (2004), s. 764-765 ISSN 0300-5127 R&D Projects: GA ČR GA203/04/1045 Institutional research plan: CEZ:AV0Z5020903 Keywords : asperillus oryzoe * glycosyl hydrolase * preproprotein Subject RIV: EE - Microbiology, Virology Impact factor: 2.267, year: 2004

  15. 77 FR 13385 - Petition for Exemption; Summary of Petition Received

    Science.gov (United States)

    2012-03-06

    ...: Fax comments to the Docket Management Facility at 202-493-2251. Hand Delivery: Bring comments to the... INFORMATION CONTACT: Frances Shaver, ARM-207, (202) 267- 4059, FAA, Office of Rulemaking, 800 Independence Ave...--Aviation Safety. PETITION FOR EXEMPTION Docket No.: FAA-2012-0123 Petitioner: Bell Helicopter Textron...

  16. Reasoning about Independence in Probabilistic Models of Relational Data (Author’s Manuscript)

    Science.gov (United States)

    2014-01-06

    computer vision and information retrieval. Näıvely specifying a joint distribution by hand requires an exponential number of states; however, Bayesian...Journal of the Royal Statistical Society. Series B (Methodological), pages 267–288, 1996. Ioannis Tsamardinos, Laura E. Brown, and Constantin F. Aliferis

  17. 76 FR 17181 - Agency Information Collection Activities: Requests for Comments; Clearance of Renewed Approval of...

    Science.gov (United States)

    2011-03-28

    ... May 27, 2011. FOR FURTHER INFORMATION CONTACT: Carla Scott on (202) 267-9895, or by e-mail at: Carla... Tank Flammability on Transport Category Airplanes AGENCY: Federal Aviation Administration (FAA), DOT... Flammability on Transport Category Airplanes. Form Numbers: There are no FAA forms associated with this...

  18. Fixation of CO2 in air: Synthesis and crystal structure of a µ3-CO3 ...

    Indian Academy of Sciences (India)

    Unknown

    Fixation of CO2 in air: Synthesis and crystal structure of a ... from the reaction between copper(I) complexes and dioxygen.2,6,7 ... and co-workers from the reaction of [(L2) ..... followed by water dissociation.13h,24 While fixation of CO2 by ...

  19. Raphidascaris (Ichthyascaris) arii sp n. (Nematoda: Anisakidae), a new ascaridoid nematode from marine catfishes in the Gulf of Thailand

    Czech Academy of Sciences Publication Activity Database

    Yooyen, T.; Moravec, František; Wongsawad, C.

    2011-01-01

    Roč. 48, č. 4 (2011), 262-267 ISSN 0440-6605 R&D Projects: GA MŠk LC522 Institutional research plan: CEZ:AV0Z60220518 Keywords : parasitic nematode * Raphidascaris * Ichthyascaris * Thailand Subject RIV: GJ - Animal Vermins ; Diseases, Veterinary Medicine Impact factor: 0.773, year: 2011

  20. Multilocus phylogeny of arvicoline voles (Arvicolini, Rodentia) shows small tree terrace size

    Czech Academy of Sciences Publication Activity Database

    Martínková, Natália; Moravec, J.

    2012-01-01

    Roč. 61, 3-4 (2012), s. 254-267 ISSN 0139-7893 R&D Projects: GA AV ČR IAA600930609 Institutional support: RVO:68081766 Keywords : divergence * evolutionary history * supertree * supermatrix * phylogenetic tree terrace * Microtus * Arvicolinae Subject RIV: EG - Zoology Impact factor: 0.494, year: 2012

  1. 76 FR 37706 - Endangered and Threatened Wildlife and Plants; 12-Month Finding on a Petition To List Castanea...

    Science.gov (United States)

    2011-06-28

    ... release (Paillet, 1993, p. 267). This indicates there is some level of reproduction (cross pollination and... in shaping landscape and regional vegetation patterns in the Interior Highlands (Batek et al. 1999... scales, but at the landscape scale, vegetation patterns also may be controlled by disturbance histories...

  2. Exploring the Link between Corporal Punishment and Children's Cruelty to Animals.

    Science.gov (United States)

    Flynn, Clifton P.

    1999-01-01

    Study of college undergraduates (N=267) examined the relationship between corporal punishment inflicted by parents and perpetration of animal abuse. Analyses showed that the association between fathers' corporal punishment and sons' childhood animal cruelty persisted after controlling for child abuse, father-to-mother violence, and father's…

  3. Clonal diversity of Staphylococcus aureus originating from the small ruminants goats and sheep

    DEFF Research Database (Denmark)

    Concepción Porrero, M.; Hasman, Henrik; Vela, Ana I.

    2012-01-01

    Staphylococcus aureus is an important pathogen in humans and many animal species. The prevalence of different clonal types in animal species remains largely unknown. We analyzed 267 S. aureus from intramammary infections in goats (47) and sheep (220) by spa typing, multi-locus sequence typing (ML...

  4. Oxidative stress elicited by insecticides: A role for the adipokinetic hormnone

    Czech Academy of Sciences Publication Activity Database

    Velki, M.; Kodrík, Dalibor; Večeřa, Josef; Hackenberger, B. K.; Socha, Radomír

    2011-01-01

    Roč. 172, č. 1 (2011), s. 77-84 ISSN 0016-6480 R&D Projects: GA ČR GAP501/10/1215 Institutional research plan: CEZ:AV0Z50070508 Keywords : Insect * adipokinetic hormone * oxidative stress Subject RIV: ED - Physiology Impact factor: 3.267, year: 2011

  5. Ion-beam induced chemical and structural modification in polymers

    Czech Academy of Sciences Publication Activity Database

    Guenther, M.; Gerlach, G.; Suchaneck, G.; Sahre, K.; Eichorn, K. J.; Wolf, B.; Deineka, Alexander; Jastrabík, Lubomír

    158-159, - (2002), s. 108-113 ISSN 0257-8972 Grant - others:Ge(DE) 779/6-1 Institutional research plan: CEZ:AV0Z1010914 Keywords : polyimide * polyethersulfone- hardness * conductivity * polymer structure * ion implantation Subject RIV: BM - Solid Matter Physics ; Magnetism Impact factor: 1.267, year: 2002

  6. Exploring the Influence of Nature Relatedness and Perceived Science Knowledge on Proenvironmental Behavior

    Science.gov (United States)

    Obery, Amanda; Bangert, Arthur

    2017-01-01

    This study was undertaken to investigate the factors influencing proenvironmental behavior of individuals residing in the Northern Rocky Mountains (N = 267). Measures of relatedness to nature and perceived science knowledge were collected through a convenience sample approach using multiple avenues such as city email lists, organizational…

  7. Accumulation of free amino acids during exposure to drought in three springtail species

    Czech Academy of Sciences Publication Activity Database

    Holmstrup, M.; Slotsbo, S.; Rozsypal, Jan; Henriksen, P. G.; Bayley, M.

    2015-01-01

    Roč. 82, NOV 01 (2015), s. 114-121 ISSN 0022-1910 EU Projects: European Commission(XE) 316304 - MODBIOLIN Institutional support: RVO:60077344 Keywords : collembola * desiccation * osmoregulation Subject RIV: ED - Physiology Impact factor: 2.267, year: 2015 http://www.sciencedirect.com/science/article/pii/S0022191015001912

  8. Data of evolutionary structure change: 1AIGN-1AIJS [Confc[Archive

    Lifescience Database Archive (English)

    Full Text Available ignment> 0 n> 1AIG n>N 1AI...RO CA 208 LEU CA 267 ALA CA 286 LYS CA 269 ...n> 1AIJ n>S 1AIJS...1AIGN-1AIJS 1AIG 1AIJ N S ------------ALLSFERKYRVPGGTL-------VGGN...LFDFWVGPFYVGFFGVATFFFAALGIILIAWSAVLQGTWNPQ-------LISVYPPALEYGLGG-APLAKGGLWQIITICATGAFVSWALREVEICRKLGIGYHIPFAFAFAI

  9. Communication Factors as Predictors of Relationship Quality: A National Study of Principals and School Counselors

    Science.gov (United States)

    Duslak, Mark; Geier, Brett

    2017-01-01

    This study examined the effects of meeting frequency, structured meeting times, annual agreements, and demographic variables on school counselor perceptions of their relationship with their building principal. Results of a regression analysis indicated that meeting frequency accounted for 26.7% of the variance in school counselor-reported…

  10. Synthetic Porphyrins and Metalloporphyrins

    Science.gov (United States)

    1976-12-10

    disease syndromes , drug metabolism and cancer. Porphyrins and metalloporphyrins such as tetraphenylporphine sulfonate and hema- toporphyrin have been found...267(1941). 34. A. D. Adler, F. R. Longo, J. D. Finarelli, J. Goldmacher, J. Assour and L. Korsakoff , J. Org. Chem., 32, 476(1967). 35. H. W

  11. Provenance of Neoproterozoic to upper Cretaceous sedimentary rocks, eastern Greenland: Implications for recognizing the sources of sediments in the Norwegian Sea

    Czech Academy of Sciences Publication Activity Database

    Sláma, Jiří; Walderhaug, O.; Fonneland, H.; Kosler, J.; Pederson, R. B.

    2011-01-01

    Roč. 238, 3/4 (2011), s. 254-267 ISSN 0037-0738 Institutional research plan: CEZ:AV0Z30130516 Keywords : sedimentary * Eastern Greenland * provenance * U-Pb and Lu-Hf * zircon * Jan Mayen Island * North Atlantic Subject RIV: DB - Geology ; Mineralogy Impact factor: 1.537, year: 2011

  12. 75 FR 52801 - Agency Information Collection Activities: Requests for Comments; Clearance of Renewed Approval of...

    Science.gov (United States)

    2010-08-27

    ... Airmen for the Operation of Light-Sport Aircraft AGENCY: Federal Aviation Administration (FAA), DOT... INFORMATION CONTACT: Carla Scott on (202) 267-9895, or by e-mail at: [email protected] . SUPPLEMENTARY INFORMATION: OMB Control Number: 2120-0690. Title: Certification of Airmen for the Operation of Light-Sport...

  13. Fulltext PDF

    Indian Academy of Sciences (India)

    user1

    methods for elliptic quasi-variational inequalities related to impulse control problem with mixed boundary conditions. 481. Hazarika G C. Analysis of a malaria model with mosquito-dependent transmission coefficient for humans. 93. Heinzer William J. seeAbhyankar Shreeram S. 267. Hosseinipoor M K. seeAlaeiyan Mehdi.

  14. Search Results | Page 24 | IDRC - International Development ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Results 231 - 240 of 1804 ... Gender 422 Apply Gender filter · POLICY MAKING 267 Apply .... Tanzania, along with most African countries, has been ... governments believe to be the root causes of urban violence. ... soaring urbanization, increasing inequality, and a chronic lack of basic public service including employmen.

  15. K B Shaik

    Indian Academy of Sciences (India)

    Home; Journals; Resonance – Journal of Science Education. K B Shaik. Articles written in Resonance – Journal of Science Education. Volume 15 Issue 3 March 2010 pp 257-267 Classroom. Chaos from Jerk Circuit · K B Shaik M K Mandal · More Details Fulltext PDF ...

  16. Prevalence of methicillin-resistant Staphylococcus aureus based on culture and PCR in inpatients at a tertiary care center in Tokyo, Japan.

    Science.gov (United States)

    Taguchi, Hirokazu; Matsumoto, Tetsuya; Ishikawa, Hiroki; Ohta, Shoichi; Yukioka, Tetsuo

    2012-10-01

    We investigated active screening for colonization with methicillin-resistant Staphylococcus aureus (MRSA) on admission and weekly follow-up surveillance after admission to a tertiary care center (TCC) between June 2007 and 31 December 2007. Eleven percent (30/267) of patients were found to be positive for MRSA by polymerase chain reaction (PCR) and/or culture on admission; 5% (12/267) became positive during the TCC stay. The major primary diagnoses in MRSA-positive patients were pneumonia and cerebrovascular diseases. Twenty-two (52%) of 42 patients were found to be MRSA positive by both PCR and culture, compared with 19 (45%) of 42 who were PCR positive and culture negative. These findings suggest that active surveillance with PCR is highly sensitive and useful for the detection of MRSA colonization. To our knowledge, this is the first report of active surveillance of MRSA by PCR and bacterial culture in critically ill inpatients in Japan.

  17. Water Absorption Properties of Heat-Treated Bamboo Fiber and High Density Polyethylene Composites

    Directory of Open Access Journals (Sweden)

    Lanxing Du

    2014-01-01

    Full Text Available To modify water absorption properties of bamboo fiber (BF and high density polyethylene (HDPE composites, heat treatment of BFs was performed prior to compounding them with HDPE to form the composites. The moisture sorption property of the composites was measured and their diffusion coefficients (Dm were evaluated using a one-dimensional diffusion model. Moisture diffusion coefficient values of all composites were in the range of 0.115x10-8 to 1.267x10-8 cm2/s. The values of Dm decreased with increasing BF heat-treatment temperature, and increased with increasing BF loading level. The Dm value of 40 wt% bamboo fiber/HDPE composites with BFs treated with 100 oC was the greatest (i.e., 1.267x10-8cm2/s. Morphology analysis showed increased fiber-matrix interfacial bonding damage due to fiber swelling and shrinking from water uptaking and drying. The mechanism of water absorption of the composite, indicated a general Fickian diffusion process.

  18. The effect of grinding at various vacuum levels on the color, phenolics, and antioxidant properties of apple.

    Science.gov (United States)

    Kim, Ah-Na; Kim, Hyun-Jin; Kerr, William L; Choi, Sung-Gil

    2017-02-01

    The purpose of this study was to evaluate the effect of grinding at different vacuum levels (2.67, 6.67, 13.33, 19.99, and 101.33kPa) on key quality factors of apple. In the control apple, ground at atmospheric pressure of 101.33kPa, the antioxidant activities rapidly decreased within the first 30min, then plateaued thereafter, while enzymatic browning increased. When apples were ground and held under vacuum, changes in color and antioxidant activity were much less, and the least change was measured in samples prepared at the lowest pressure. Model fitting of the data showed that antioxidant activity decreased as a function of the logarithm of the absolute pressure. The results from analysis for key phenolic compounds including chlorogenic acid, procyanidin B2, and epicatechin indicated that these compounds were least changed at vacuum grinding at 2.67kPa, compared to atmospheric grinding. Copyright © 2016 Elsevier Ltd. All rights reserved.

  19. Pusan East AFS K-9, Pusan, Korea. Revised Uniform Summary of Surface Weather Observations (RUSSWO)

    Science.gov (United States)

    1968-02-26

    ww.5 .5 - . . - --- "_ __ WNW * f_ 1*W 6.0 1W*__ NNIW .4 o f I 2_ es ofŕ’ fog__ __ v__. -’ ._ .I-_- __ - _ _ 11 -"- -- CALM 2.9. I Iso $ 127.0 2.3 01...27.2 48.3 48.9 49.6 49.6 9.6 49.7 49. 9.7 7T.7 4 ;9.7 49-/ 149. .7 ? iso 130.5 56.8 59.4 60.5 60.5 60.5 60.6 60.6 60.6 60.6 6C.6 6C.6 6C.6 6C.6 6C.6 cC...72.5 72. 72 . 72.5 72: I r Boo 26.7 68.3 70.3 71.6 73.0 73.1 73.6 73.7 73.7 74.C0 74.0 74. ,C 407. 27000 26.7 68.6 710.6 71.8 73.3 73.4 73.9 14.0

  20. A novel mutation in HSD11B2 causes apparent mineralocorticoid excess in an Omani kindred.

    Science.gov (United States)

    Yau, Mabel; Azkawi, Hanan Said Al; Haider, Shozeb; Khattab, Ahmed; Badi, Maryam Al; Abdullah, Wafa; Senani, Aisha Al; Wilson, Robert C; Yuen, Tony; Zaidi, Mone; New, Maria I

    2016-07-01

    Apparent mineralocorticoid excess (AME) is a rare autosomal recessive genetic disorder causing severe hypertension in childhood due to a deficiency of 11β-hydroxysteroid dehydrogenase type 2 (11βHSD2), which is encoded by HSD11B2. Without treatment, chronic hypertension leads to early development of end-organ damage. Approximately 40 causative mutations in HSD11B2 have been identified in ∼100 AME patients worldwide. We have studied the clinical presentation, biochemical parameters, and molecular genetics in six patients from a consanguineous Omani family with AME. DNA sequence analysis of affected members of this family revealed homozygous c.799A>G mutations within exon 4 of HSD11B2, corresponding to a p.T267A mutation of 11βHSD2. The structural change and predicted consequences owing to the p.T267A mutation have been modeled in silico. We conclude that this novel mutation is responsible for AME in this family. © 2016 New York Academy of Sciences.

  1. Serological survey of domestic animals for tick-borne encephalitis and Bhanja viruses in northeastern Hungary

    Czech Academy of Sciences Publication Activity Database

    Šikutová, Silvie; Hornok, S.; Hubálek, Zdeněk; Doležálková, I.; Juřicová, Zina; Rudolf, Ivo

    2009-01-01

    Roč. 135, 3-4 (2009), s. 267-271 ISSN 0378-1135 EU Projects: European Commission(XE) 10284 - EDEN Institutional research plan: CEZ:AV0Z60930519 Keywords : Tick-borne encephalitis * Bhanja virus * Cattle * Horse * Sheep * Hungary Subject RIV: EE - Microbiology, Virology Impact factor: 2.874, year: 2009

  2. Toward a Theory of Hybrid Warfare: The Russian Conduct of War During Peace

    Science.gov (United States)

    2015-12-01

    sporting contest outside of all political context, by a national tendency to seek a political cure-all, and by a reluctance to recognize the realities of...economically vital railway bridge at Kaspi and firebombed the Borjomi National Park, an important destination for tourism .267 In addition to the

  3. Transient expression of fusion gene coding for the HPV-16 epitopes fused to the sequence of potyvirus coat protein using different means of inoculation of Nicotiana benthamiana and Brassica rapa, cv. Rapa plants

    Czech Academy of Sciences Publication Activity Database

    Hoffmeisterová, Hana; Čeřovská, Noemi; Moravec, Tomáš; Plchová, Helena; Kmoníčková, Jitka; Velemínský, Jiří

    2008-01-01

    Roč. 94, č. 3 (2008), s. 261-267 ISSN 0167-6857 R&D Projects: GA ČR GA521/06/0973 Institutional research plan: CEZ:AV0Z50380511 Keywords : Edible vaccine * epitope expression * E7 oncogen Subject RIV: EE - Microbiology, Virology Impact factor: 1.017, year: 2008

  4. Kalivodův zápas o marxismus bez pověr a iluzí

    Czech Academy of Sciences Publication Activity Database

    Zumr, Josef

    2012-01-01

    Roč. 60, mimořádné číslo 2 (2012), s. 259-267 ISSN 0015-1831 Institutional support: RVO:67985955 Keywords : Robert Kalivoda * Marx ism * Hussite movement * Karl Marx * Sigmund Freud Subject RIV: AA - Philosophy ; Religion OBOR OECD: Philosophy, History and Philosophy of science and technology

  5. Interaction of extrinsic chemical factors affecting photodegradation of dissolved organic matter in aquatic ecosystems

    Czech Academy of Sciences Publication Activity Database

    Porcal, Petr; Dillon, P. J.; Molot, L. A.

    2014-01-01

    Roč. 13, č. 5 (2014), s. 799-812 ISSN 1474-905X R&D Projects: GA ČR(CZ) GAP503/12/0781 Institutional support: RVO:60077344 Keywords : photodegradation * dissolved organic matter * calcium * nitrate * iron * pH Subject RIV: DA - Hydrology ; Limnology Impact factor: 2.267, year: 2014

  6. Identifying sources and estimating glandular output of salivary TIMP-1

    DEFF Research Database (Denmark)

    Holten-Andersen, Lars; Jensen, Siri Beier; Jensen, Allan Bardow

    2008-01-01

    saliva (267.01 ng/min). Conclusion. This study shows that saliva contains authentic TIMP-1, the concentration of which was found to depend on gland type and salivary flow. Stimulated whole saliva is suggested as a reliable and easily accessible source for TIMP-1 determinations in bodily fluids....

  7. U.S. Army Nurse Membership, Accession and Loss Profiles (1987). Volume 1, Reserves

    Science.gov (United States)

    1988-12-01

    34male" dominated professions. Studies by Astin et al. (1987) and Green (1987) reveal that the national economy influences student career choices. That...Nursin Ecs, 5(6), 1987, 267-279. Bureau of Labor Statistics. Industry Wace survey: Nursing and Personal Care Facilities. Ss-t~d= 1985. (Bull. 2275

  8. 77 FR 54805 - Revocation of Jet Route J-528; WA

    Science.gov (United States)

    2012-09-06

    ...-0749; Airspace Docket No. 11-ANM-29] RIN 2120-AA66 Revocation of Jet Route J-528; WA AGENCY: Federal Aviation Administration (FAA), DOT. ACTION: Final rule. SUMMARY: This action removes Jet Route J-528... 20591; telephone: (202) 267-8783. SUPPLEMENTARY INFORMATION: Background Jet Route J-528 is currently...

  9. 76 FR 2708 - Porcelain-on-Steel Cooking Ware From Taiwan; Top-of-the-Stove Stainless Steel Cooking Ware From...

    Science.gov (United States)

    2011-01-14

    .... 701- TA-267 and 731-TA-304 (Third Review)] Porcelain-on-Steel Cooking Ware From Taiwan; Top-of-the-Stove Stainless Steel Cooking Ware From Korea AGENCY: United States International Trade Commission...-steel cooking ware from Taiwan and the antidumping and countervailing duty orders on imports of top-of...

  10. Ježekite, Na.sub.8./sub.[(UO.sub.2./sub.)(CO.sub.3./sub.).sub.3./sub.](SO.sub.4./sub.).sub.2./sub..3H.sub.2./sub.O, a new uranyl mineral from Jáchymov, Czech Republic

    Czech Academy of Sciences Publication Activity Database

    Plášil, Jakub; Hloušek, J.; Kasatkin, A.V.; Belakovskiy, D. I.; Čejka, J.; Chernyshov, D.

    2015-01-01

    Roč. 60, č. 4 (2015), 259-267 ISSN 1802-6222 R&D Projects: GA ČR GP13-31276P Institutional support: RVO:68378271 Keywords : ježekite * new mineral * uranyl carbonate-sulfate * crystal structure * Jáchymov Subject RIV: DB - Geology ; Mineralogy Impact factor: 1.326, year: 2015

  11. 78 FR 21702 - Petition for Exemption; Summary of Petition Received

    Science.gov (United States)

    2013-04-11

    ...: Fax comments to the Docket Management Facility at 202-493-2251. Hand Delivery: Bring comments to the... INFORMATION CONTACT: Tyneka Thomas ARM-105, (202) 267-7626, FAA, Office of Rulemaking, 800 Independence Ave... Exemption Docket No.: FAA-2012-1348. Petitioner: Flight Safety International, Inc. Section of 14 CFR...

  12. Pesticide exposures in a malarious and predominantly farming area ...

    African Journals Online (AJOL)

    Frequent symptoms that were reported after spraying, included cough (32.3%; 336/1040), difficulty in breathing (26.7%; 278/1040) and skin irritation (39.0%; 406/1040). Pesticide use among community members in the Kintampo area of Ghana is common and its potential health impacts warrant further investigation.

  13. 76 FR 60115 - Aviation Rulemaking Advisory Committee Meeting on Transport Airplane and Engine Issues

    Science.gov (United States)

    2011-09-28

    ... (202) 267-5075, or e-mail at [email protected] . SUPPLEMENTARY INFORMATION: Pursuant to Section 10(a)(2... by October 12, 2011. For persons participating by telephone, please contact Ralen Gao by e-mail or... Committee Meeting on Transport Airplane and Engine Issues AGENCY: Federal Aviation Administration (FAA), DOT...

  14. Biomarkers of Exposure to Toxic Substances. Volume 2: Genomics: Unique Patterns of Differential Gene Expression and Pathway Perturbation Resulting from Exposure to Nephrotoxins with Regional Specific Toxicity

    Science.gov (United States)

    2009-05-01

    producing cells in TGF-beta 1-induced renal interstitial fibrosis,” Histochemistry and Cell Biology., 119, 4, Apr 2003 pp. 267-80. Chen X, Abair TD ...protein l53 (predicted) 1367559_at ferritin light chain 1 1367589_at aconitase 2, mitochondrial 1367591_at peroxiredoxin 3 1367609_at macrophage

  15. Quantitative Determination of Telomerase Activity in Breast Cancer and Benign Breast Diseases

    Czech Academy of Sciences Publication Activity Database

    Šimíčková, M.; Nekulová, M.; Pecen, Ladislav; Černoch, M.; Vagundová, M.; Pačovský, Z.

    2001-01-01

    Roč. 48, č. 4 (2001), s. 267-273 ISSN 0028-2685 R&D Projects: GA MZd NM17 Institutional research plan: AV0Z1030915 Keywords : telomerase activity * quantitative analysis * breast cancer * benign breast diseases * prognisis Subject RIV: BA - General Mathematics Impact factor: 0.637, year: 2001

  16. Abdim\\'s Stork Ciconia abdimii in Niger: population size, breeding ...

    African Journals Online (AJOL)

    –4, n = 36), suggesting a total post-fledging population of c. 83 500 birds (95% CL ± 51 267), excluding any non-breeding (sub)adults. The home range of six satellite-tagged breeders in 2003 was 10–120 km2 (median 36 km2); birds adjacent ...

  17. Search Results | Page 99 | IDRC - International Development ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Results 981 - 990 of 1804 ... Gender 422 Apply Gender filter · POLICY MAKING 267 Apply POLICY MAKING filter ... This collaborative project will examine the role the Integrated ... under Climate Change in Small Island States of the Caribbean ... Philanthropy in Singapore has traditionally had a charitable and local orientation.

  18. Large Deviations for Stochastic Tamed 3D Navier-Stokes Equations

    International Nuclear Information System (INIS)

    Roeckner, Michael; Zhang, Tusheng; Zhang Xicheng

    2010-01-01

    In this paper, using weak convergence method, we prove a large deviation principle of Freidlin-Wentzell type for the stochastic tamed 3D Navier-Stokes equations driven by multiplicative noise, which was investigated in (Roeckner and Zhang in Probab. Theory Relat. Fields 145(1-2), 211-267, 2009).

  19. Journal of Earth System Science | Indian Academy of Sciences

    Indian Academy of Sciences (India)

    Home; Journals; Journal of Earth System Science; Volume 113; Issue 3. Volume 113, Issue 3. September 2004, pages 259-515. pp 259-267. Delineation of structures favourable to groundwater occurrence employing seismic refraction method — A case study from Tiruvuru, Krishna district, Andhra Pradesh · N Sundararajan ...

  20. Enhancing Public Resilience to Mass-Casualty WMD Terrorism in the United States: Definitions, Challenges, and Recommendations

    Science.gov (United States)

    2010-06-01

    Psychological Bulletin (2001), 127(2):267-86. 53 Albert Bandura , “Exercise of Human Agency Through Collective Efficacy,” Current Directions in Psychological...either personal (“I can do something about this”) or vicarious (“Events are under control”) in nature, in keeping with Albert Bandura’s distinction

  1. 76 FR 24089 - Credit Risk Retention

    Science.gov (United States)

    2011-04-29

    ... 17 CFR Part 246 Department of Housing and Urban Development 24 CFR Part 267 Credit Risk Retention... 2501-AD53 Credit Risk Retention AGENCIES: Office of the Comptroller of the Currency, Treasury (OCC..., Commission, FHFA, and HUD (the Agencies) are proposing rules to implement the credit risk retention...

  2. Observation of a population of Egyptian Vultures Neophron ...

    African Journals Online (AJOL)

    Campbell Murn

    Observational study of behavior: sampling methods. Behaviour 49:227- 267. Baral, N., R. Gautam & B. Tamang .2005. Population status and breeding ecology of White-rumped Vulture Gyps bengalensis in Rampur Valley,. Nepal. Forktail 21: 87-91. Brandl, R., Utschick, H & Schmidtke, K. 1985. Raptors and land-use systems.

  3. influence of molding water content on shear strength characteristic

    African Journals Online (AJOL)

    eobe

    INFLUENCE OF MOLDING WATER CONTENT ON SHEAR STRENGTH OF COMPACTED CEMENT KILN DUST, K. J. Osinub. K. J. Osinub. K. J. Osinubi, et al. Nigerian Journal of Technology,. Vol. 34, No. 2, April 2015 267 pavements or as waste containment materials. Therefore, recent studies have been geared towards.

  4. Journal of Earth System Science | Indian Academy of Sciences

    Indian Academy of Sciences (India)

    Home; Journals; Journal of Earth System Science. Pravin K Gupta. Articles written in Journal of Earth System Science. Volume 115 Issue 3 June 2006 pp 267-276. Fast computation of Hankel Transform using orthonormal exponential approximation of complex kernel function · Pravin K Gupta Sri Niwas Neeta Chaudhary.

  5. Injury-related South African mortality children, 1981 -1985

    African Journals Online (AJOL)

    1474. 6880. 427. % due to injury. 8,1. 49,5. 14,4. 26,7. Rank order of injury as cause of death. 5. 1. 3 .... Eleven per cent were 'accidental' and 9% were uicide. Discussion. Deaths are known to ..... SAS Institute Inc., 1985. 18. Waller AE, Baker ...

  6. Two new species of Philometra (Nematoda: Philometridae) from needlefishes (Belonidae) in Iraq, with a key to Philometra spp. parasitic in the host’s subcutaneous tissue, fins and musculature

    Czech Academy of Sciences Publication Activity Database

    Moravec, František; Ali, A. H.

    2005-01-01

    Roč. 52, č. 3 (2005), s. 267-273 ISSN 0015-5683 R&D Projects: GA ČR GA524/03/0061 Institutional research plan: CEZ:AV0Z60220518 Keywords : Philometra * marine fishes * Iraq Subject RIV: GJ - Animal Vermins ; Diseases, Veterinary Medicine Impact factor: 1.138, year: 2005

  7. The Impact of Collegiality amongst Australian Accounting Academics on Work-Related Attitudes and Academic Performance

    Science.gov (United States)

    Su, Sophia; Baird, Kevin

    2017-01-01

    This study provides an insight into the collegiality of Australian accounting academics and the association of collegiality with their work-related attitudes and academic performance. Data were collected by a survey questionnaire from a random sample of 267 accounting academics within Australian universities. The results suggest a moderate level…

  8. Search Results | Page 150 | IDRC - International Development ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Gender 422 Apply Gender filter · POLICY MAKING 267 Apply POLICY MAKING ... Employment and Income in Bolivia, Paraguay and Peru : Analysis of the Links ... In West Africa, private sector information and communication technology (ICT) ... in the fields of security reform and governance in different regions of the South.

  9. 75 FR 32982 - Notice of Intent To Request Extension From the Office of Management and Budget of a Currently...

    Science.gov (United States)

    2010-06-10

    ..., Request for Comments; Certification of Airmen for the Operation of Light-Sport Aircraft AGENCY: Federal... FURTHER INFORMATION CONTACT: Carla Scott on (202) 267-9895, or by e-mail at: [email protected] Operation of Light-Sport Aircraft. Type of Request: Extension without change of an approved collection. OMB...

  10. All projects related to | Page 56 | IDRC - International Development ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Program: Agriculture and Food Security. Total Funding: CA$ 1,071,267.00. Building Tools to Measure the Use of Information and Communication Technologies in Education. Project. In recent years, several Latin American countries have provided computers and connectivity to schools in the hopes of improving the quality ...

  11. 75 FR 70965 - Petition for Exemption; Summary of Petition Received

    Science.gov (United States)

    2010-11-19

    ... Federal holidays. Privacy: We will post all comments we receive, without change, to http:[sol][sol]www...., Monday through Friday, except Federal holidays. FOR FURTHER INFORMATION CONTACT: Keira Jones, 202-267... Exemption Docket No.: FAA-2010-0947 and FAA-2010-0970. Petitioner: Seaborne Virgin Islands, Inc. d.b.a...

  12. High-fluence implantation of iron into polyimide

    Czech Academy of Sciences Publication Activity Database

    Macková, Anna; Hnatowicz, Vladimír; Peřina, Vratislav; Popok, V. N.; Khaibullin, R. I.; Bazarov, V. V.; Odzhaev, V. B.

    158/159, - (2002), s. 395-398 ISSN 0257-8972 R&D Projects: GA ČR GA203/99/1626; GA ČR GA102/01/1324 Keywords : polyimide * ion implantation * iron * Rutherford backscattering spectroscopy Subject RIV: BG - Nuclear, Atomic and Molecular Physics, Colliders Impact factor: 1.267, year: 2002

  13. Doubly-doped BaY.sub.2./sub.F.sub.8./sub.:Er,Nd VUV scintillator

    Czech Academy of Sciences Publication Activity Database

    Pejchal, Jan; Nikl, Martin; Fukuda, K.; Kawaguchi, N.; Yanagida, T.; Yokota, Y.; Yoshikawa, A.; Babin, V.

    2010-01-01

    Roč. 45, 3-6 (2010), s. 265-267 ISSN 1350-4487 Grant - others:AVČR(CZ) M100100910 Institutional research plan: CEZ:AV0Z10100521 Keywords : energy transfer * luminescence * rare-earth fluorides * scintillators Subject RIV: BM - Solid Matter Physics ; Magnetism Impact factor: 1.019, year: 2010

  14. Vzájemný vztah maximálního uzávěrového tlaku uretry a Valsalva Leak-Point Pressure u žen se stresovým typem inkontince moči

    Czech Academy of Sciences Publication Activity Database

    Martan, A.; Mašata, J.; Švabík, K.; Drahorádová, P.; Halaška, M.; Voigt, R.; Pavlíková, Markéta

    2004-01-01

    Roč. 69, č. 4 (2004), s. 267-272 ISSN 1210-7832 R&D Projects: GA MZd NH7378 Keywords : inkontinence moči u žen * maximální uzávěrový tlak uretry * Valsalva leak -point pressure Subject RIV: FK - Gynaecology, Childbirth

  15. Der spätgotische Turmwächter des Altstädter Turms der Karlsbrücke. Neue Fragen einer einzigartigen Statue

    Czech Academy of Sciences Publication Activity Database

    Hlobil, Ivo

    2013-01-01

    Roč. 61, č. 3 (2013), s. 257-267 ISSN 0049-5123 R&D Projects: GA ČR GA13-39192S Institutional support: RVO:68378033 Keywords : Watchman * Late Gothic sculpture * Charles Bridge * Prague Subject RIV: AL - Art, Architecture, Cultural Heritage http://www.umeni-art.cz/cz/default.aspx

  16. Journal of Earth System Science | Indian Academy of Sciences

    Indian Academy of Sciences (India)

    Home; Journals; Journal of Earth System Science. Charuta V Prabhu. Articles written in Journal of Earth System Science. Volume 109 Issue 2 June 2000 pp 267-277. Diurnal variability of upper ocean temperature and heat budget in the southern Bay of Bengal during October — November, 1998 (BOBMEX-Pilot).

  17. Towards the proof of the cosmic censorship hypothesis in cosmological space-times

    International Nuclear Information System (INIS)

    Krolak, A.

    1987-01-01

    A theorem supporting the view that the cosmic censorship hypothesis proved recently by Krolak [A. Krolak, Gen. Relativ. Gravit. 15, 99 (1983); J. Class. Quantum Grav. 3, 267 (1986)] for asymptotically flat space-times, is true in general, is generalized so that it is applicable to cosmological situations

  18. Characterization of the interaction between glazes and ceramic bodies

    Czech Academy of Sciences Publication Activity Database

    Kavanová, M.; Kloužková, A.; Kloužek, Jaroslav

    2017-01-01

    Roč. 61, č. 3 (2017), s. 267-275 ISSN 0862-5468 Institutional support: RVO:67985891 Keywords : glazes * ceramic s * thermal analysis * coefficients of the thermal expansion * dilatometry Subject RIV: JH - Ceramic s, Fire-Resistant Materials and Glass OBOR OECD: Ceramic s Impact factor: 0.439, year: 2016

  19. 76 FR 65945 - Modification of Class B Airspace; Seattle, WA

    Science.gov (United States)

    2011-10-25

    ... Independence Avenue, SW., Washington, DC 20591; telephone: (202) 267-8783. SUPPLEMENTARY INFORMATION: History..., ``thence east to * * *'') where an arc is not referenced. These corrections are to standardize the format only. Also, in the NPRM description of Area E, a typographical error that listed the ``40-mile'' arc of...

  20. 76 FR 35363 - Proposed Amendment to Class B Airspace; Seattle, WA

    Science.gov (United States)

    2011-06-17

    ..., 1200 New Jersey Avenue, SE., West Building Ground Floor, Room W12-140, Washington, DC 20590-0001..., DC 20591; telephone: (202) 267-8783. SUPPLEMENTARY INFORMATION: Comments Invited Interested parties... area of the SEA Class B airspace: Area A. 2 NM arc northeast of SEA would be straightened and realigned...

  1. Potential airborne microbial hazards for workers on dairy and beef cattle farms in Egypt

    Directory of Open Access Journals (Sweden)

    Amr M.M. Abd-Elall

    2009-06-01

    Full Text Available This study was conducted to determine the concentration and frequency distribution of certain airborne micro-organisms on cattle farms and their potential health hazards to farm workers. The samples (60 air samples and 240 hand and nasal swabs from cattle farm workers were collected from ten cattle farms (five dairy barns and five beef sheds located in the Sharkia Governorate of Egypt. Air samples were collected for microbiological examination in liquid media using an all-glass impinger whereas those for fungal examination were placed on agar plates using slit air samplers (aeroscopes. The results showed that the overall means of total culturable bacterial and fungal counts were lower in the air of dairy cattle barns than in beef cattle sheds. Identification of the isolated bacteria revealed the recovery of the following species (from dairy cattle barns versus beef cattle sheds: Staphylococcus epidermidis (26.7% vs 36.7%, S. saprophyticus (20% vs 33.3%, S. aureus (10% vs 16.7%, Enterococcus faecalis (23.3% vs 26.7%, Enterobacter agglomerans (23.3 vs 13.3%, Escherichia coli, (16.7% vs 26.7%, Klebsiella oxytoca, (10% vs 16.7%, K. pneumoniae (3.3% vs 0%, Proteus rettegri (6.7% vs 13.3%, P. mirabilis (10% vs 10%, P. vulgaris (3.3% vs 6.7%, Pseudomonas species (6.7% vs 16.7%, respectively. Mycological examination of air samples revealed the presence of Aspergillus fumigatus (46.7% vs 63.3%, A. niger (20% vs 36.7%, A. flavus (13.3% vs 26.7%, Penicillium citrinum (16.7% vs 23.3%, P. viridicatum (13.3% vs 6.7%, P. capsulatum (3.3% vs 0%, Cladosporium spp. (30% vs 56.7%, Alternaria spp. (13.3 vs 23.3%, Mucor spp. (6.7% vs 16.7%, Fusarium spp. (3.3% vs 10%, Absidia spp. (6.7% vs 10%, Curvilaria spp. (10% vs 3.3%, Rhizopus spp. (6.7% vs 13.3%, Scopulariopsis (3.3% vs 6.7%, Epicoccum spp. (0% vs 3.4% and yeast (13.3% vs 20%, respectively. In addition, microbiological examinations of farm workers revealed heavy contamination of their hands and noses with

  2. L. Munro 2011-2012 Travel & Hospitality English.xlsx

    International Development Research Centre (IDRC) Digital Library (Canada)

    acray

    Quarter 3. October 19. Manchester, UK. Meetings and Lectures. 10,062.48. 2,960.98. 267.50. 13,290.96. November 17 to December 12 New Delhi, India and Harare, Zimbabwe Conference and Regional Office Visit. Quarter 4. February 10. Washington DC, USA. Memorial Service. March 2. Ottawa, Canada. Meeting.

  3. Shedding consistency of strongyle-type eggs in dutch boarding horses

    NARCIS (Netherlands)

    Dopfer, D.D.V.; Kerssens, C.M.; Meijer, Y.G.M.; Boersema, J.H.; Eysker, M.

    2004-01-01

    Faeces of 484 horses were sampled twice with an interval of 6 weeks while anthelmintic therapy was halted. Faecal eggs counts revealed that 267 (55.2%) horses had consistently low numbers of eggs per gram faeces (EPG) (EPG <100 or = 100), 155 (32.0%) horses had consistently high EPGs (EPG >

  4. A Community-based Survey of the Awareness and Acceptability of Oral Rehydration Therapy (ORT) as a Treatment for Acute Diarrhoea in Children.

    Science.gov (United States)

    Ekanem, E. E.; Benebo, N. S.

    1988-01-01

    A total of 267 Nigerian mothers with children under the age of five years were investigated regarding the degree of their awareness and acceptance of oral rehydration therapy in the treatment of childhood diarrhea. Results indicate that only 39 percent of the mothers had heard of ORT in treating diarrhea. (RJC)

  5. Occurrence of Philometra lateolabracis (Nematoda: Philometridae) in the gonads of marine perciform fishes in the Mediterranean region

    Czech Academy of Sciences Publication Activity Database

    Moravec, František; Glamuzina, B.; Marino, G.; Merella, P.; Di Cave, D.

    2003-01-01

    Roč. 53, č. 3 (2003), s. 267-269 ISSN 0177-5103 R&D Projects: GA ČR GA524/03/0061 Institutional research plan: CEZ:AV0Z6022909 Keywords : parasitic nematode * Philometra lateolabracis * marine fish Subject RIV: GJ - Animal Vermins ; Diseases, Veterinary Medicine Impact factor: 1.263, year: 2003

  6. Fulltext PDF

    Indian Academy of Sciences (India)

    distribution networks. 843. Akintoye ... Vortices in dam reservoir: A case study of. Karun III dam ... parameters using neural network. 267. Elyasi A ... Optimal way of selecting cities and con- veyances for ... Krishna V. Design and development of a web-enabled data ... Multi region based image retrieval system 333. Mazinan ...

  7. Why is the number of days required for induction of adult diapause in the linden bug Pyrrhocoris apterus fewer in the larval than in the adult stage?

    Czech Academy of Sciences Publication Activity Database

    Hodková, Magdalena

    2015-01-01

    Roč. 77, JUN 01 (2015), s. 39-44 ISSN 0022-1910 R&D Projects: GA ČR GAP502/10/1612 Institutional support: RVO:60077344 Keywords : diapause * reproduction * diapuase information Subject RIV: ED - Physiology Impact factor: 2.267, year: 2015 http://www.sciencedirect.com/science/article/pii/S0022191015000797

  8. Interpersonal Trust Consistency and the Quality of Peer Relationships during Childhood

    Science.gov (United States)

    Rotenberg, Ken J.; Boulton, Michael

    2013-01-01

    Five hundred five children (267 female) enrolled in school years 5 and 6 in the UK (M = 9 years and 9 months) completed measures of trust beliefs in peers, best friendships, ascriptions of trustworthiness, and trustworthiness toward peers. Children's social disengagement, peer preference, and peer victimization were assessed by sociometric…

  9. THE RELATIONSHIP BETWEEN TEMPOROMANDIBULAR-JOINT MOBILITY AND PERIPHERAL JOINT MOBILITY RECONSIDERED

    NARCIS (Netherlands)

    Dijkstra, P.U.; DEBONT, L.G.M.; VANDERWEELE, L.T.; Boering, G.

    The purpose of this paper was to study the relationship between temporomandibular joint (TMJ) mobility and mobility of joints and to study the general character of joint mobility in 83 subjects, 55 females and 28 males (mean age 26.7, range 13-46 years). The subjects were recruited from the

  10. Selenium protects the immature rat heart against ischemia/reperfusion injury

    Czech Academy of Sciences Publication Activity Database

    Ošťádalová, Ivana; Vobecký, Miloslav; Chvojková, Zuzana; Miková, D.; Hampl, V.; Wilhelm, J.; Ošťádal, Bohuslav

    2007-01-01

    Roč. 300, 1-2 (2007), s. 259-267 ISSN 0300-8177 R&D Projects: GA MŠk(CZ) 1M0510 Institutional research plan: CEZ:AV0Z50110509; CEZ:AV0Z40310501 Keywords : selenium * immature heart * ischemia Subject RIV: ED - Physiology Impact factor: 1.707, year: 2007

  11. Correct Interpretation of Creep Rates: A Case Study of Cu

    Czech Academy of Sciences Publication Activity Database

    Blum, W.; Dvořák, Jiří; Král, Petr; Eisenlohr, P.; Sklenička, V.

    2015-01-01

    Roč. 31, č. 11 (2015), s. 1065-1068 ISSN 1005-0302 R&D Projects: GA MŠk(CZ) ED1.1.00/02.0068 Institutional support: RVO:68081723 Keywords : Cu * Creep * Minimum creep rate * Activation energy * Stress exponent Subject RIV: JJ - Other Materials Impact factor: 2.267, year: 2015

  12. 75 FR 62144 - Porcelain-on-Steel Cooking Ware From China and Taiwan; Top-of-the-Stove Stainless Steel Cooking...

    Science.gov (United States)

    2010-10-07

    ...); (Investigation Nos. 701-TA-267 and 731-TA-304 (Third Review))] Porcelain-on-Steel Cooking Ware From China and Taiwan; Top-of- the-Stove Stainless Steel Cooking Ware From Korea AGENCY: United States International... porcelain-on-steel cooking ware from China and Taiwan and the antidumping and countervailing duty orders on...

  13. Journal of Genetics | Indian Academy of Sciences

    Indian Academy of Sciences (India)

    Home; Journals; Journal of Genetics. P. V. Ramchander. Articles written in Journal of Genetics. Volume 88 Issue 3 December 2009 pp 267-272 Research Article. GJB2 and GJB6 gene mutations found in Indian probands with congenital hearing impairment · G. Padma P. V. Ramchander U. V. Nandur T. Padma.

  14. 77 FR 37952 - Petition for Exemption; Summary of Petition Received

    Science.gov (United States)

    2012-06-25

    ...: Fax comments to the Docket Management Facility at 202-493-2251. Hand Delivery: Bring comments to the... INFORMATION CONTACT: Tyneka Thomas ARM-105, (202) 267-7626, FAA, Office of Rulemaking, 800 Independence Ave..., the safety of these children is greatly enhanced by the extra support and security that the FAA...

  15. 76 FR 410 - Petition for Exemption; Summary of Petition Received

    Science.gov (United States)

    2011-01-04

    ...: Fax comments to the Docket Management Facility at 202-493-2251. Hand Delivery: Bring comments to the... Federal holidays. FOR FURTHER INFORMATION CONTACT: Frances Shaver, ARM-207, (202) 267- 4059, FAA, Office... operational TCAS software and therefore has no impact on the safety performance of the system. [FR Doc. 2010...

  16. Mismatch between ectotherm thermal preferenda and optima for swimming: a test of the evolutionary pace hypothesis

    Czech Academy of Sciences Publication Activity Database

    Gvoždík, Lumír

    2015-01-01

    Roč. 42, č. 2 (2015), s. 137-145 ISSN 0071-3260 R&D Projects: GA ČR GAP506/10/2170 Institutional support: RVO:68081766 Keywords : Amphibia * Coadaptation * Evolutionary rates * Newts * Preferred body temperatures * Thermal performance curves * Thermal sensitivity Subject RIV: EG - Zoology Impact factor: 2.267, year: 2015

  17. Tectonic phase separation applied to the Sudetic Marginal Fault Zone (NE part of the Czech Republic)

    Czech Academy of Sciences Publication Activity Database

    Nováková, Lucie

    2015-01-01

    Roč. 12, č. 2 (2015), s. 251-267 ISSN 1672-6316 R&D Projects: GA ČR GA205/09/1244 Institutional support: RVO:67985891 Keywords : Sudetic Marginal Fault Zone * paleostress reconstruction * active tectonics * frequency analysis Subject RIV: DC - Siesmology, Volcanology, Earth Structure Impact factor: 1.017, year: 2015

  18. A highly diverse spectrum of naphthoquinone derivatives produced by the endophytic fungus Biatriospora sp CCF 4378

    Czech Academy of Sciences Publication Activity Database

    Stodůlková, Eva; Man, Petr; Kuzma, Marek; Černý, J.; Císařová, I.; Kubátová, A.; Chudíčková, Milada; Kolařík, Miroslav; Flieger, Miroslav

    2015-01-01

    Roč. 60, č. 3 (2015), s. 259-267 ISSN 0015-5632 R&D Projects: GA MŠk(CZ) LD13039; GA ČR GA13-16565S Institutional support: RVO:61388971 Keywords : NECTRIA-HAEMATOCOCCA * ASCOMYCETOUS FUNGUS * BIOLOGICAL-ACTIVITY Subject RIV: EE - Microbiology, Virology Impact factor: 1.335, year: 2015

  19. Synthesis and gas permeability of block copolymers composed of poly(styrene-co-acrylonitrile) and polystyrene blocks

    Czech Academy of Sciences Publication Activity Database

    Lokaj, Jan; Brožová, Libuše; Holler, Petr; Pientka, Zbyněk

    2002-01-01

    Roč. 67, č. 2 (2002), s. 267-278 ISSN 0010-0765 R&D Projects: GA ČR GA203/99/0572 Institutional research plan: CEZ:AV0Z4050913 Keywords : azeotropic styrene-acrylonitrile copolymers * block copolymers * nitroxide-mediated copolymerization Subject RIV: CD - Macromolecular Chemistry Impact factor: 0.848, year: 2002

  20. Emotional Intelligence as a Predictor of Student Success in First-Year Master of Social Work Students

    Science.gov (United States)

    Horne, Dana Meredith

    2017-01-01

    Emotional intelligence has been defined as "the ability to recognize the meanings of emotions and their relationships, and to reason and problem-solve on the basis of them" (Mayer, Caruso, & Salovey, 1999, p. 267). Despite the relevance of emotional intelligence to social work education, limited research has focused on the assessment…

  1. Knowledge and Beliefs about Developmental Dyslexia in Pre-Service and In-Service Spanish-Speaking Teachers

    Science.gov (United States)

    Soriano-Ferrer, Manuel; Echegaray-Bengoa, Joyce; Joshi, R. Malathesa

    2016-01-01

    The present study investigated knowledge, misconceptions, and lack of information about dyslexia among pre-service (PST) and in-service (IST) Spanish-speaking teachers in Spain and Peru. Two hundred and forty-six pre-service teachers and 267 in-service teachers completed the Knowledge and Beliefs about Developmental Dyslexia Scale (KBDDS).…

  2. Journal of Chemical Sciences | Indian Academy of Sciences

    Indian Academy of Sciences (India)

    pp 257-266 Full Papers ... complexes of rhodium - Synthesis, structure and, spectral and electrochemical properties ... pp 267-273 Full Papers ... pp 275-281 Full Papers ... Yuliang Che Hua Yang Hongxiao Jin Chunxin Lu Ziyang Liu ... Excited state dynamics of 9,9'-bianthryl in room temperature ionic liquids as revealed by ...

  3. A review of typhoid perforation in a rural African hospital ...

    African Journals Online (AJOL)

    Apart from the patients who had resection and primary anastomosis, 95(90.5%) had 2 layered closure of the perforation. The most common complications were wound infections (26.7%). Intra-abdominal abscesses (9.5%) and would dehiscence (7.6%). The mortality rate was 16.2% showing a remarkable improvement in ...

  4. Body Image, Self-Esteem, and Health-Related Behaviors among Male and Female First Year College Students

    Science.gov (United States)

    Lowery, Sarah E.; Kurpius, Sharon E. Robinson; Befort, Christie; Blanks, Elva Hull; Sollenberger, Sonja; Nicpon, Megan Foley; Huser, Laura

    2005-01-01

    This study examined the relationships among self-esteem, body image, and health-related behaviors of 267 female and 156 male first-year college students. Data were collected in 23 classrooms. Instruments included a demographic sheet, the Objectified Body Consciousness Scale, the Weight and Appearance Visual Analogue Scales, the Contour Drawing…

  5. Search Results | Page 100 | IDRC - International Development ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Results 991 - 1000 of 1804 ... Gender 422 Apply Gender filter · POLICY MAKING 267 Apply POLICY MAKING ... New research will identify opportunities to improve health care for the urban ... in January 2010, Haiti's children suffered some of the worst rates of ... This project seeks to understand the brain mechanisms necessary ...

  6. Interactive effects of ambient temperature and light sources at high relative humidity on growth performance and blood physiological variables in broilers grown to 42 day of age

    Science.gov (United States)

    The interactive effects of ambient temperature and light sources at high relative humidity on growth performance and blood physiological reactions in broilers grown to 42 day of age were investigated. The experiment consisted of 2 levels (Moderate=21.1, High=26.7 °C) of temperatures and 2 light sour...

  7. Evaluation of an Adaptive Automation Trigger Based on Task Performance, Priority, and Frequency

    Science.gov (United States)

    2013-06-01

    with dual Intel ® Xeon ® CPU x5550 processors @ 2.67 GHz each, 12.0 GB RAM, and a 1.5 GB PCIe nVidia Quadro FX 4800 graphics card (Microsoft...Cole Publishing Company . Miller, C. A., & Parasuraman, R. (2007). Designing for flexible interaction between humans and automation: Delegation

  8. CASE REPORT Hyperparathyroidism with presumed sellar ...

    African Journals Online (AJOL)

    Goswami P, Sarma PK, Sethi S, Hazarika S. Skeletal manifestations in a case of primary hyperparathyroid. -ism caused by parathyroid adenoma. Ind J Radiol Imag 2002; 12: 267-270. 2. Bone Tumours: Clinical, Radiologic and Pathologic Correlations. Philadelphia: Lea and Febiger, 2006. 3. Magu S, Mathur SK, Gulati SP, ...

  9. Voltammetry on Mercury and Carbon Electrodes as a Tool for Studies of Metallothionein Interactions with Metal Ions

    Czech Academy of Sciences Publication Activity Database

    Šestáková, Ivana; Mader, P.

    2000-01-01

    Roč. 46, č. 2 (2000), s. 257-267 ISSN 0145-5680 R&D Projects: GA ČR GV204/97/K084 Institutional research plan: CEZ:AV0Z4040901; CEZ:A54/98:Z4-040-9-ii Subject RIV: CG - Electrochemistry Impact factor: 1.449, year: 2000

  10. Experiment list: SRX524974 [Chip-atlas[Archive

    Lifescience Database Archive (English)

    Full Text Available SRX524974 hg19 Histone H3K27me3 Uterus Endometrial stromal cells NA 42283456,99.2,4...9.5,267 GSM1372866: H3K27me3 case2 w/ EP; Homo sapiens; ChIP-Seq source_name=Human endometrial stromal cells || tissue=Endometr

  11. analysis of factors affecting agribusiness cooperators' access to ...

    African Journals Online (AJOL)

    TO CREDIT FROM FORMAL SOURCES IN ABIA STATE, NIGERIA ... High interest rate, delay in loan disbursement and reluctance in repaying loans were .... to the amount obtained, X1 is sex (male = 1; female = ... only 2.67% have been in the production business for .... (2009) recorded 73.6% among married cooperators.

  12. Syntactic Atlas of the Dutch Dialects

    NARCIS (Netherlands)

    Barbiers, Sjef; Bennis, Hans; Vogelaer, De Gunther; Devos, Magda; Ham, van der Margreet

    2005-01-01

    Available in a Dutch and English Edition, the Syntactic Atlas of the Dutch Dialects (SAND) provides a detailed overview of the surprisingly rich syntactic variation found in 267 dialects of Dutch at the beginning of the 21th century. 200 full color maps show the geographic distribution of more than

  13. Syntactische atlas van de Nederlandse dialecten : Deel 1: Pronomina, Congruentie en Vooropplaatsing

    NARCIS (Netherlands)

    Barbiers, Sjef; Bennis, Hans; Vogelaer, De Gunther; Devos, Magda; Ham, van der Margreet

    2005-01-01

    Available in a Dutch and English Edition, the Syntactic Atlas of the Dutch Dialects provides a detailed overview of the surprisingly rich syntactic variation found in 267 dialects of Dutch at the beginning of the 21th century. 200 full color maps show the geographic distribution of more than 100

  14. Studies in Coprinus V — Coprinus section Coprinus. Revision of subsection Lanatuli Sing

    NARCIS (Netherlands)

    Uljé, C.B.; Noordeloos, M.E.

    1999-01-01

    A key is given to the species of subsection Lanatuli known from the Netherlands or to be expected in the Netherlands on account of records from neighbouring countries. For a key to the subsections in Coprinus section Coprinus see Uljé & Noordel., Persoonia 16 (1997) 267. Coprinus bicornis and C.

  15. different meanings a text may acquire: the case of malachi 1:11 1 ...

    African Journals Online (AJOL)

    interpreted from various perspectives. Historical interpretation attempts to locate the meaning of the .... in the argument. Verse 11 provides a new perspective to the argu- ment thus far. It answers the question of ... prophet a general shift towards a universal monotheistic worship, in particular the Persian era (Horst 1964:267).

  16. The Interagency: Evolving a Hamstrung and Broken System?

    Science.gov (United States)

    2013-05-23

    foreign to the Somali culture.85 Somalis’ oral traditions extend back to prehistory , tying them to the rules of antiquity and the family of Muhammad...Center, 2007), 30. 86 Ibid, 29.; Prehistory is a common term that refers to the time before written history. 87Bolger, Savage Peace, 267. 26

  17. Tuning emergent magnetism in a Hund's impurity

    Czech Academy of Sciences Publication Activity Database

    Khajetoorians, A.A.; Valentyuk, M.; Steinbrecher, M.; Schlenk, T.; Shick, Alexander; Kolorenč, Jindřich; Lichtenstein, A.I.; Wehling, T.O.; Wiesendanger, R.; Wiebe, J.

    2015-01-01

    Roč. 10, č. 11 (2015), s. 958-U195 ISSN 1748-3387 R&D Projects: GA ČR GC15-05872J Institutional support: RVO:68378271 Keywords : magnetic anisotropy * Kondo effect * strong electron correlations * scanning tunnelling microscopy Subject RIV: BM - Solid Matter Physics ; Magnetism Impact factor: 35.267, year: 2015

  18. Factors influencing alcohol and illicit drug use amongst first year medical students

    NARCIS (Netherlands)

    Popescu, Codruta Alina; Bob, Mihai Horatiu; Junjan, Veronica; Armean, Sebastian Mihai; Buzoianu, Anca Dana

    2014-01-01

    The aims of this study were a) to investigate patterns of alcohol, smoking and illicit drug use and b) evaluate the relationship between substance abuse and personality factors in a cohort of 267 first year medical students. 12.3 % (men) and 11.8% (female) medical students reported to be drinking

  19. 2,3-Dehydrosilybin A/B as a pro-longevity and anti-aggregation compound

    Czech Academy of Sciences Publication Activity Database

    Filippopoulou, K.; Papaevgeniou, N.; Lefakia, M.; Paraskevopoulou, A.; Biedermann, David; Křen, Vladimír; Chondrogianni, N.

    2017-01-01

    Roč. 103, FEB 2017 (2017), s. 256-267 ISSN 0891-5849 R&D Projects: GA MŠk(CZ) LD15081 Institutional support: RVO:61388971 Keywords : 2,3-dehydrosilybin A/B * Anti-aging * Anti-aggregation Subject RIV: CE - Biochemistry OBOR OECD: Biochemistry and molecular biology Impact factor: 5.606, year: 2016

  20. 76 FR 52905 - Proposed Amendment to Class B Airspace; Salt Lake City, UT

    Science.gov (United States)

    2011-08-24

    ... Floor, Room W12-140, Washington, DC 20590-0001; telephone: (202) 366-9826. You must identify FAA Docket... Aviation Administration, 800 Independence Avenue, SW., Washington, DC 20591; telephone: (202) 267-8783... no good ground references in this area. The FAA used the Wasatch VOR (TCH) 12-mile DME arc to define...

  1. 75 FR 27229 - Proposed Modification of Class B Airspace; Chicago, IL

    Science.gov (United States)

    2010-05-14

    ... Operations, M-30, 1200 New Jersey Avenue, SE., West Building Ground Floor, Room W12-140, Washington, DC 20590...., Washington, DC 20591; telephone: (202) 267-8783. SUPPLEMENTARY INFORMATION: Comments Invited Interested... MSL to 10,000 feet MSL, with the western boundary extended to a uniform 25 nautical mile arc of the...

  2. 77 FR 48476 - Proposed Amendment to Class B Airspace; Detroit, MI

    Science.gov (United States)

    2012-08-14

    ..., Room W12-140, Washington, DC 20590-0001; telephone: (202) 366-9826. You must identify FAA Docket No... Independence Avenue SW., Washington, DC 20591; telephone: (202) 267-8783. SUPPLEMENTARY INFORMATION: Comments... NM arc of I-DTW, keeping the southern boundary of the proposed 2,500-foot MSL Class B airspace shelf...

  3. 75 FR 9538 - Proposed Modification of Class B Airspace; Charlotte, NC

    Science.gov (United States)

    2010-03-03

    ... Operations, M-30, 1200 New Jersey Avenue, SE., West Building Ground Floor, RoomW12-140, Washington, DC 20590..., SW., Washington, DC 20591; telephone: (202) 267-8783. SUPPLEMENTARY INFORMATION: Comments Invited... area north of CLT from a point where the 14 NM arc intersects Highway 321 then clockwise to intersect...

  4. A survey of the use of arterial catheters in anesthetized dogs and cats: 267 cases.

    Science.gov (United States)

    Trim, Cynthia M; Hofmeister, Erik H; Quandt, Jane E; Shepard, Molly K

    2017-01-01

    To describe the clinical practice of insertion of arterial catheters in anesthetized dogs and cats, to document complications of arterial catheterization, and to determine risk factors associated with the complications. Prospective clinical study and retrospective evaluation of medical records. University teaching hospital. Dogs (n = 251) and 13 cats anesthetized for clinical procedures with arterial catheters inserted for blood pressure monitoring. None. Details of the animal and catheter were collected at the time of anesthesia. On the following day, the catheter site was palpated and observed for abnormalities and the medical records of all animals were reviewed retrospectively for complications. Details of catheter placement were available for 216 catheters: 158 catheters in a dorsal pedal artery, 50 catheters in the median caudal (coccygeal) artery, 6 in the median artery, and 1 each in a cranial tibial and lingual artery. Blood pressure was obtained from 200 catheters, and 12 catheters failed before the end of anesthesia. Postoperative observational data obtained from 112 catheters described a palpable arterial pulse at 73 sites and no pulse at 21 sites. No risk factor for arterial occlusion was identified. No complications resulting from arterial catheterization were noted in the medical records. Arterial catheterization resulted in loss of a peripheral pulse postoperatively in 21/94 (22.3%) of animals examined, although no evidence of tissue ischemia was noted in the medical records of any of the patients in this study. These results suggest that insertion of a catheter in the dorsal pedal or coccygeal arteries was not associated with a high risk for complications. However, the course of arterial occlusion postoperatively warrants further investigation. © Veterinary Emergency and Critical Care Society 2016.

  5. Comparative Study of the Spherical Downward Continuation

    Czech Academy of Sciences Publication Activity Database

    Sebera, Josef; Pitoňák, M.; Hamáčková, E.; Novák, P.

    2015-01-01

    Roč. 36, č. 2 (2015), s. 253-267 ISSN 0169-3298 Grant - others:GA MŠk(CZ) CZ.1.05/1.1.00/02.0090 Institutional support: RVO:67985815 Keywords : limited airborne gravity * potential-field data * horizontal plane Subject RIV: DE - Earth Magnetism, Geodesy, Geography Impact factor: 3.622, year: 2015

  6. Analysis of a Mycoplasma hominis membrane protein, P120

    DEFF Research Database (Denmark)

    Christiansen, Gunna; Mathiesen, SL; Nyvold, Charlotte Guldborg

    1994-01-01

    The monoclonal antibody mAb 26.7D generated against a clinical isolate of Mycoplasma hominis 7488 was shown to react with a surface-exposed epitope on a 120-kDa protein (P120). The gene encoding the protein was cloned and sequenced, and the transcriptional start point was determined by primer...

  7. The Effects of Social Capital Levels in Elementary Schools on Organizational Information Sharing

    Science.gov (United States)

    Ekinci, Abdurrahman

    2012-01-01

    This study aims to assess the effects of social capital levels at elementary schools on organizational information sharing as reported by teachers. Participants were 267 teachers selected randomly from 16 elementary schools; schools also selected randomly among 42 elementary schools located in the city center of Batman. The data were analyzed by…

  8. Inhibition of E2-induced expression of BRCA1 by persistent organochlorines

    DEFF Research Database (Denmark)

    Rattenborg, Thomas; Gjermandsen, Irene; Bonefeld-Jørgensen, Eva Cecilie

    2002-01-01

    and PCB#180]) was measured by a reporter gene construct carrying 267 bp of the BRCA1 promoter. A twofold concentration range was analyzed in MCF-7, and the results were supported by northern blot analysis of BRCA1 mRNA using the highest concentrations of the chemicals. RESULTS: All three polychlorinated...

  9. Nuclear Criticism after the Cold War: A Rhetorical Analysis of Two Contemporary Atomic Campaigns

    Science.gov (United States)

    1997-08-01

    commission’s elitist identity. It also overtly claimed a need to balance its "instincts for 136 idealism with realism " (Downer, 1996a). The products of...organization. Quarterly Journal of Speech, 79, 267-285. Taylor, B. C. (1993b). Fat Man and Little Boy: The cinematic representation of interests in

  10. 77 FR 64581 - Petition for Exemption; Summary of Petition Received

    Science.gov (United States)

    2012-10-22

    ...: Fax comments to the Docket Management Facility at 202-493-2251. Hand Delivery: Bring comments to the... holidays. FOR FURTHER INFORMATION CONTACT: Tyneka Thomas ARM-105, (202) 267-7626, FAA, Office of Rulemaking... Sec. 103.1(e)(1) to allow for an increased weight for the installation of proven safety devices like...

  11. Au implantation into various types of silicate glasses

    Czech Academy of Sciences Publication Activity Database

    Malinský, Petr; Macková, Anna; Bočan, Jiří; Švecová, B.; Nekvindová, P.

    2009-01-01

    Roč. 267, - (2009), s. 1575-1578 ISSN 0168-583X R&D Projects: GA MŠk(CZ) LC06041 Institutional research plan: CEZ:AV0Z10480505 Keywords : Au+ ion implantation * Glass es * RBS Depth profiling Subject RIV: BG - Nuclear, Atomic and Molecular Physics, Colliders Impact factor: 1.156, year: 2009

  12. Traditional processing, microbial and physicochemical changes ...

    African Journals Online (AJOL)

    A survey was conducted to characterise production methods of malwa; a Ugandan ... Changes in chemical parameters were determined using standard methods. ... Moistened millet flour was subjected to solid state pit fermentation for one week to ... spp increased from 2.67 to 6.22 log cfu mL–1 during 72 h of fermentation.

  13. Investigating Unique Environmental Influences of Parenting Practices on Youth Anxiety: A Monozygotic Twin Differences Study

    Science.gov (United States)

    Chen, Jie; Yu, Jing; Zhang, Jianxin

    2016-01-01

    The associations between parenting practices and adolescent anxiety symptoms were examined in both individual and monozygotic (MZ) twin differences levels. Participants were 804 pairs of Chinese MZ adolescent twins aged 10-18 years (M = 13.57, SD = 2.67, 52% females). Twins' anxiety symptoms were assessed by self- and parent-reports. Twins also…

  14. Wet effluent diffusion denuder: The tool for determination of monoterpenes in forest

    Czech Academy of Sciences Publication Activity Database

    Křůmal, Kamil; Mikuška, Pavel; Večeřová, Kristýna; Urban, Otmar; Pallozzi, E.; Večeřa, Zbyněk

    2016-01-01

    Roč. 153, JUN (2016), s. 260-267 ISSN 0039-9140 R&D Projects: GA MŠk(CZ) LO1415 Institutional support: RVO:68081715 ; RVO:67179843 Keywords : diffusion denuder * monoterpene * biogenic volatile organic compounds * tenax tubes Subject RIV: CB - Analytical Chemistry , Separation; EH - Ecology, Behaviour (UEK-B) Impact factor: 4.162, year: 2016

  15. Comparative analysis of thermal stability of two different nc-TiC/a-C:H coatings

    Czech Academy of Sciences Publication Activity Database

    Zábranský, L.; Buršíková, V.; Daniel, L.; Souček, P.; Vašina, P.; Dugáček, J.; Sťahel, P.; Caha, O.; Buršík, Jiří; Peřina, Vratislav

    2015-01-01

    Roč. 267, APR (2015), s. 32-39 ISSN 0257-8972 R&D Projects: GA MŠk(CZ) LM2011019 Institutional support: RVO:68081723 ; RVO:61389005 Keywords : nanocomposite * thermal annealing * hardness Subject RIV: BM - Solid Matter Physics ; Magnetism; BG - Nuclear, Atomic and Molecular Physics, Colliders (UJF-V) Impact factor: 2.139, year: 2015

  16. Differences in Pre-Service Teachers' Knowledge and Readiness to Use ICT in Education

    Science.gov (United States)

    Valtonen, Teemu; Kukkonen, Jari; Kontkanen, Sini; Mäkitalo-Siegl, Kati; Sointu, Erkko

    2018-01-01

    The aim of this paper is to provide insights into differences between pre-service teachers based on the areas of technological pedagogical content knowledge (TPACK) and the areas of theory of planned behaviour (TPB) in the context of using information and communication technology in education. The target group consisted of 267 first-year…

  17. Numerical modelling of the reinforcing effect of geosynthetic material used in a ballasted railway tracks

    Czech Academy of Sciences Publication Activity Database

    Jiroušek, Ondřej; Jíra, J.; Hrdlička, Ondřej; Kunecký, Jiří; Kytýř, Daniel; Vyčichl, J.; Doktor, Tomáš

    2010-01-01

    Roč. 224, č. 4 (2010), s. 259-267 ISSN 0954-4097 Institutional research plan: CEZ:AV0Z20710524 Keywords : railway track bed * reinforcing geogrid * finite-element modelling * settlement reduction * contact analysis * ballast material Subject RIV: JN - Civil Engineering Impact factor: 0.389, year: 2010 http://journals.pepublishing.com/content/k561040632411117/

  18. 75 FR 43147 - Fisheries of the Exclusive Economic Zone Off Alaska; Bering Sea and Aleutian Islands Crab...

    Science.gov (United States)

    2010-07-23

    ... of a 2.67-percent fee for cost recovery under the Bering Sea and Aleutian Islands Crab... for the 2010/2011 crab fishing year so they can calculate the required payment for cost recovery fees...-Stevens Act). The Program includes a cost recovery provision to collect fees to recover the actual costs...

  19. Next-Generation Molecular Histology Using Highly Multiplexed Ion Beam Imaging (MIBI) of Breast Cancer Tissue Specimens for Enhanced Clinical Guidance

    Science.gov (United States)

    2015-07-01

    in soft tissue sarcoma . J Surg Oncol 2005;92:267–271. 3. Stack EC, Wang C, Roman KA, et al. Multiplexed immuno- histochemistry, imaging, and...Contributions: M.A., S.B., and R.F. conducted experiments and wrote the manuscript. M.H. designed and fabricated reagents. C.H. assisted in data acquisition and

  20. 26 CFR 1.108-3 - Intercompany losses and deductions.

    Science.gov (United States)

    2010-04-01

    ... 26 Internal Revenue 2 2010-04-01 2010-04-01 false Intercompany losses and deductions. 1.108-3... Intercompany losses and deductions. (a) General rule. This section applies to certain losses and deductions... attributes to which section 108(b) applies, a loss or deduction not yet taken into account under section 267...

  1. TIPS Evaluation Project Retrospective Study: Wave 1 and 2.

    Science.gov (United States)

    Hubbard, Susan M.; Mulvey, Kevin P.

    2003-01-01

    Measured substance abuse treatment professionals' knowledge, attitudes, and practices regarding the Treatment Improvement Protocol (TIP) series and the 28 TIPs. Results for 3,267 respondents in wave 1 and 1,028 in wave 2 indicate that almost half of all professionals were aware of the TIPs. Attitudes toward TIPs were positive, but professionals…

  2. Magnetic phase transitions in ferrimagnetic DyFe.sub.5./sub.Al.sub.7./sub. near the compensation point

    Czech Academy of Sciences Publication Activity Database

    Mushnikov, N. V.; Rozenfeld, E.V.; Gorbunov, Denis; Andreev, Alexander V.

    2014-01-01

    Roč. 115, č. 3 (2014), s. 257-267 ISSN 0031-918X R&D Projects: GA ČR GAP204/12/0150 Institutional support: RVO:68378271 Keywords : rare- earth intermetallic compounds * ferrimagnetism * compensation temperature * magnetic anisotropy * magnetic phase transition Subject RIV: BM - Solid Matter Physics ; Magnetism Impact factor: 0.761, year: 2014

  3. Measurements of fast-neutron-induced signals in silicon pad detectors

    Czech Academy of Sciences Publication Activity Database

    Linhart, V.; Bedajanek, I.; Bém, Pavel; Götz, Miloslav; Honusek, Milan; Pospíšil, S.; Šimečková, Eva

    2006-01-01

    Roč. 563, č. 1 (2006), s. 263-267 ISSN 0168-9002 R&D Projects: GA MPO(CZ) 1H-PK/07 Institutional research plan: CEZ:AV0Z10480505 Keywords : background signals * neutron reactions * solid-state detectors Subject RIV: BG - Nuclear, Atomic and Molecular Physics, Colliders Impact factor: 1.185, year: 2006

  4. Regulation of Isoprenoid Pheromone Biosynthesis in Bumblebee Males

    Czech Academy of Sciences Publication Activity Database

    Prchalová, Darina; Buček, Aleš; Brabcová, Jana; Žáček, Petr; Kindl, Jiří; Valterová, Irena; Pichová, Iva

    2016-01-01

    Roč. 17, č. 3 (2016), s. 260-267 ISSN 1439-4227 R&D Projects: GA MŠk LO1302; GA ČR GA15-06569S Institutional support: RVO:61388963 Keywords : biosynthesis * Bombus spp. * gene expression * isoprenoid s * pheromones * transcriptional regulation Subject RIV: CE - Biochemistry Impact factor: 2.847, year: 2016

  5. Silicon nanocrystals in silica – Novel active waveguides for nanophotonics

    Czech Academy of Sciences Publication Activity Database

    Janda, P.; Valenta, J.; Ostatnický, T.; Skopalová, Eva; Pelant, Ivan; Elliman, R. G.; Tomasiunas, R.

    2006-01-01

    Roč. 121, - (2006), s. 267-273 ISSN 0022-2313 R&D Projects: GA AV ČR IAA1010316; GA ČR GP202/01/D030 Institutional research plan: CEZ:AV0Z10100521 Keywords : nanocrystal * waveguide * silicon * photonics Subject RIV: BM - Solid Matter Physics ; Magnetism Impact factor: 1.441, year: 2006

  6. Fission product interactions with nitrogen donor ligands used for spent nuclear fuel treatment

    Czech Academy of Sciences Publication Activity Database

    Aneheim, E.; Grüner, Bohumír; Ekberg, C.; Foreman, M.R.S.J.; Hájková, Zuzana; Löfström-Engdahl, E.; Drew, M. G. B.; Hudson, M.J.

    2013-01-01

    Roč. 50, č. 1 (2013), s. 154-163 ISSN 0277-5387 R&D Projects: GA MŠk(CZ) 7G08073 Grant - others:ACSEPT(XE) FP7-CP-2007-211 267 Institutional support: RVO:61388980 Keywords : BTBP * palladium * complexation * water solubility Subject RIV: CA - Inorganic Chemistry Impact factor: 2.047, year: 2013

  7. Intrapartální fetální monitoring, senzitivita a specificita metod

    Czech Academy of Sciences Publication Activity Database

    Hájek, Z.; Srp, B.; Pavlíková, Markéta; Zvárová, Jana; Liška, K.; Haddad El, R.; Pašková, A.; Pařízek, A.

    2006-01-01

    Roč. 71, č. 4 (2006), s. 263-267 ISSN 1210-7832 Grant - others:GA MZd(CZ) NH7664 Institutional research plan: CEZ:AV0Z10300504 Keywords : senzitivita * specificita * diagnostika hypoxie * kardiotokografie * fetální pulzní oxymetrie * ST analýza EKG plodu Subject RIV: BB - Applied Statistics, Operational Research

  8. Gender, Language, and Social Influence: A Test of Expectation States, Role Congruity, and Self-Categorization Theories

    Science.gov (United States)

    Reid, Scott A.; Palomares, Nicholas A.; Anderson, Grace L.; Bondad-Brown, Beverly

    2009-01-01

    This study compares self-categorization, expectation states, and role congruity theories' explanations for female influence. Male and female participants (N = 267) listened to a recording of a female speaker who used either tentative or assertive language under conditions that led participants to categorize her as a woman or as college-educated.…

  9. Fungal community on decomposing leaf litter undergoes rapid successional changes

    Czech Academy of Sciences Publication Activity Database

    Voříšková, Jana; Baldrian, Petr

    2013-01-01

    Roč. 7, č. 3 (2013), s. 477-486 ISSN 1751-7362 R&D Projects: GA MŠk(CZ) ME10152; GA MŠk LD12050; GA ČR GAP504/12/0709 Institutional support: RVO:61388971 Keywords : fungi * litter decomposition * cellulose Subject RIV: EE - Microbiology , Virology Impact factor: 9.267, year: 2013

  10. Wet effluent diffusion denuder: The tool for determination of monoterpenes in forest

    Czech Academy of Sciences Publication Activity Database

    Křůmal, Kamil; Mikuška, Pavel; Večeřová, Kristýna; Urban, Otmar; Pallozzi, E.; Večeřa, Zbyněk

    2016-01-01

    Roč. 153, JUN (2016), s. 260-267 ISSN 0039-9140 R&D Projects: GA MŠk(CZ) LO1415 Institutional support: RVO:68081715 ; RVO:67179843 Keywords : diffusion denuder * monoterpene * biogenic volatile organic compounds * tenax tubes Subject RIV: CB - Analytical Chemistry, Separation; EH - Ecology, Behaviour (UEK-B) Impact factor: 4.162, year: 2016

  11. LTR retrotransposon dynamics in the evolution of the olive (Olea europaea) genome

    Czech Academy of Sciences Publication Activity Database

    Barghini, E.; Natali, L.; Giordani, T.; Cossu, R.M.; Scalabrin, S.; Cattonaro, F.; Šimková, Hana; Vrána, Jan; Doležel, Jaroslav; Morgante, M.; Cavallini, A.

    2015-01-01

    Roč. 22, č. 1 (2015), s. 91-100 ISSN 1340-2838 R&D Projects: GA ČR GBP501/12/G090; GA MŠk(CZ) LO1204 Institutional support: RVO:61389030 Keywords : LTR retrotransposons * next-generation sequencing * olive Subject RIV: EB - Genetics ; Molecular Biology Impact factor: 5.267, year: 2015

  12. Developments for transactinide chemistry experiments behind the gas-filled separator TASCA

    Energy Technology Data Exchange (ETDEWEB)

    Even, Julia

    2011-12-13

    synthesised carbonyl complexes were identified by nuclear decay spectroscopy. Some complexes were studied with isothermal chromatography or thermochromatography methods. The chromatograms were compared with Monte Carlo Simulations to determine the adsorption enthalpyrnon silicon dioxide and on gold. These simulations based on existing codes, that were modified for the different geometries of the chromatography channels. All observed adsorption enthalpies (on silcon oxide as well as on gold) are typical for physisorption. Additionally, the thermalstability of some of the carbonyl complexes was studied. This showed that at temperatures above 200 C therncomplexes start to decompose. It was demonstrated that carbonyl-complex chemistry is a suitable method to study rutherfordium, dubnium, seaborgium, bohrium, hassium, and meitnerium. Until now, only very simple, thermally stable compounds have been synthesized in the gas-phase chemistry of the transactindes. With the synthesis of transactinide-carbonyl complexes a new compound class would be discovered. Transactinide chemistry would reach the border between inorganic and metallorganic chemistry. Furthermore, the in-situ synthesised carbonyl complexes would allow nuclear spectroscopy studies under low background conditions making use of chemically prepared samples. [German] Die vorliegende Arbeit befasst sich mit der Entwicklung von Experimenten hinter dem gasgefuellten Separator TASCA (TransActinide Separator and Chemistry Apparatus) zur Studie des chemischen Verhaltens der Transactinide. Zum einen wurde die Moeglichkeit der elektrochemischen Abscheidung kurzlebiger Isotope der Elemente Ruthenium und Osmium auf Goldelektroden im Hinblick auf ein Experiment mit Hassium untersucht. Aus der Literatur ist bekannt, dass bei der elektrochemischen Abscheidung einzelner Atome das Abscheidepotential signifikant vom Nernst-Potential abweicht. Die Verschiebung des Potentials haengt von der Adsorptionsenthalpie des abzuscheidenden Elements

  13. Structure of a PKA RIα Recurrent Acrodysostosis Mutant Explains Defective cAMP-Dependent Activation.

    Science.gov (United States)

    Bruystens, Jessica Gh; Wu, Jian; Fortezzo, Audrey; Del Rio, Jason; Nielsen, Cole; Blumenthal, Donald K; Rock, Ruth; Stefan, Eduard; Taylor, Susan S

    2016-12-04

    Most disease-related mutations that impair cAMP protein kinase A (PKA) signaling are present within the regulatory (R) PKA RI alpha-subunit (RIα). Although mutations in the PRKAR1A gene are linked to Carney complex (CNC) disease and, more recently, to acrodysostosis-1 (ACRDYS1), the two diseases show contrasting phenotypes. While CNC mutations cause increased PKA activity, ACRDYS1 mutations result in decreased PKA activity and cAMP resistant holoenzymes. Mapping the ACRDYS1 disease mutations reveals their localization to the second of two tandem cAMP-binding (CNB) domains (CNB-B), and here, we characterize a recurrent deletion mutant where the last 14 residues are missing. The crystal structure of a monomeric form of this mutant (RIα92-365) bound to the catalytic (C)-subunit reveals the dysfunctional regions of the RIα subunit. Beyond the missing residues, the entire capping motif is disordered (residues 357-379) and explains the disrupted cAMP binding. Moreover, the effects of the mutation extend far beyond the CNB-B domain and include the active site and N-lobe of the C-subunit, which is in a partially open conformation with the C-tail disordered. A key residue that contributes to this crosstalk, D267, is altered in our structure, and we confirmed its functional importance by mutagenesis. In particular, the D267 interaction with Arg241, a residue shown earlier to be important for allosteric regulation, is disrupted, thereby strengthening the interaction of D267 with the C-subunit residue Arg194 at the R:C interface. We see here how the switch between active (cAMP-bound) and inactive (holoenzyme) conformations is perturbed and how the dynamically controlled crosstalk between the helical domains of the two CNB domains is necessary for the functional regulation of PKA activity. Copyright © 2016 Elsevier Ltd. All rights reserved.

  14. A simple idea for reducing the cost and weight of plaster-cast orthoses Uma ideia simples para diminuir custo e peso das talas gessadas

    Directory of Open Access Journals (Sweden)

    André Esmanhotto

    2013-01-01

    Full Text Available OBJECTIVE: To reduce the cost and weight of plaster molded orthosis (increasing patient comfort, keeping the same resistance. METHODS: 22 plaster orthosis were analysed, 11 with conventional shape and 11 with pyramidal shape. It was compared, in theory (mathematcally and practice, the change of weight (and consequently cost and flexion resistance between conventional shape and pyramidal shape. RESULTS: Theorical analysis: weight and cost decrease of 26.7%-38.9%, according to the layers disposition of the cast. Laboratorial analysis: cast´s weight decrease of 34.5% (p = 0.000005 and resistance increase of 26.7% (p = 0.03. CONCLUSION: plaster molded orthosis made in a pyramidal shape, have a statistically significant decrease of weight (and consequently cost and statistically significant increase of resistance if compared with traditional shape. OBJETIVO: Diminuir o custo e o peso (aumentando o conforto para o paciente das talas gessadas, mantendo resistência semelhante. MÉTODOS: Foram analisadas 22 talas de gesso, 11 com formato convencional e 11 com formato piramidal. Foi feita comparação, teórica (matemática e prática, entre as talas convencionais e as piramidais quanto à mudança de peso (e consequentemente de custo e à resistência à flexão. RESULTADOS: Análise matemática – diminuição peso e custo entre 26,7% e 38,9%, variando conforme a disposição das camadas da tala. Análise prática – diminuição do peso em 34,5% (p = 0,000005 e resistência aumentada em 26,7% (p = 0,03. CONCLUSÃO: A tala gessada com formato piramidal apresenta diminuição estatisticamente significativa de peso (e consequentemente de custo, com aumento estatisticamente significativo da resistência, se comparada à tala de formato convencional.

  15. Subunit Rotavirus Vaccine Administered Parenterally to Rabbits Induces Active Protective Immunity

    Science.gov (United States)

    Ciarlet, Max; Crawford, Sue E.; Barone, Christopher; Bertolotti-Ciarlet, Andrea; Ramig, Robert F.; Estes, Mary K.; Conner, Margaret E.

    1998-01-01

    Virus-like particles (VLPs) are being evaluated as a candidate rotavirus vaccine. The immunogenicity and protective efficacy of different formulations of VLPs administered parenterally to rabbits were tested. Two doses of VLPs (2/6-, G3 2/6/7-, or P[2], G3 2/4/6/7-VLPs) or SA11 simian rotavirus in Freund’s adjuvants, QS-21 (saponin adjuvant), or aluminum phosphate (AlP) were administered. Serological and mucosal immune responses were evaluated in all vaccinated and control rabbits before and after oral challenge with 103 50% infective doses of live P[14], G3 ALA lapine rotavirus. All VLP- and SA11-vaccinated rabbits developed high levels of rotavirus-specific serum and intestinal immunoglobulin G (IgG) antibodies but not intestinal IgA antibodies. SA11 and 2/4/6/7-VLPs afforded similar but much higher mean levels of protection than 2/6/7- or 2/6-VLPs in QS-21. The presence of neutralizing antibodies to VP4 correlated (P < 0.001, r = 0.55; Pearson’s correlation coefficient) with enhanced protection rates, suggesting that these antibodies are important for protection. Although the inclusion of VP4 resulted in higher mean protection levels, high levels of protection (87 to 100%) from infection were observed in individual rabbits immunized with 2/6/7- or 2/6-VLPs in Freund’s adjuvants. Therefore, neither VP7 nor VP4 was absolutely required to achieve protection from infection in the rabbit model when Freund’s adjuvant was used. Our results show that VLPs are immunogenic when administered parenterally to rabbits and that Freund’s adjuvant is a better adjuvant than QS-21. The use of the rabbit model may help further our understanding of the critical rotavirus proteins needed to induce active protection. VLPs are a promising candidate for a parenterally administered subunit rotavirus vaccine. PMID:9765471

  16. Structural insights into the interaction of the conserved mammalian proteins GAPR-1 and Beclin 1, a key autophagy protein

    Energy Technology Data Exchange (ETDEWEB)

    Li, Yue; Zhao, Yuting; Su, Minfei; Glover, Karen; Chakravarthy, Srinivas; Colbert, Christopher L.; Levine, Beth; Sinha, Sangita C.

    2017-08-29

    Mammalian Golgi-associated plant pathogenesis-related protein 1 (GAPR-1) is a negative autophagy regulator that binds Beclin 1, a key component of the autophagosome nucleation complex. Beclin 1 residues 267–284 are required for binding GAPR-1. Here, sequence analyses, structural modeling, mutagenesis combined with pull-down assays, X-ray crystal structure determination and small-angle X-ray scattering were used to investigate the Beclin 1–GAPR-1 interaction. Five conserved residues line an equatorial GAPR-1 surface groove that is large enough to bind a peptide. A model of a peptide comprising Beclin 1 residues 267–284 docked onto GAPR-1, built using theCABS-dockserver, indicates that this peptide binds to this GAPR-1 groove. Mutation of the five conserved residues lining this groove, H54A/E86A/G102K/H103A/N138G, abrogates Beclin 1 binding. The 1.27 Å resolution X-ray crystal structure of this pentad mutant GAPR-1 was determined. Comparison with the wild-type (WT) GAPR-1 structure shows that the equatorial groove of the pentad mutant is shallower and more positively charged, and therefore may not efficiently bind Beclin 1 residues 267–284, which include many hydrophobic residues. Both WT and pentad mutant GAPR-1 crystallize as dimers, and in each case the equatorial groove of one subunit is partially occluded by the other subunit, indicating that dimeric GAPR-1 is unlikely to bind Beclin 1. SAXS analysis of WT and pentad mutant GAPR-1 indicates that in solution the WT forms monomers, while the pentad mutant is primarily dimeric. Thus, changes in the structure of the equatorial groove combined with the improved dimerization of pentad mutant GAPR-1 are likely to abrogate binding to Beclin 1.

  17. Search Results | Page 139 | IDRC - International Development ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Gender 422 Apply Gender filter · POLICY MAKING 267 Apply POLICY MAKING ... The Philippines is one of the leading sources of migrant workers in the world. ... Latin American societies continue to struggle with high income inequality as a source ... The feminization of poverty in Sénégal seems largely related to women's ...

  18. effet de la macrofaune et des modes de gestion de la fertilité sur le ...

    African Journals Online (AJOL)

    crop in semi-arid West Africa. PhD Thesis. University and research centre, Wagenin- gen, The Netherland, 193 p. Ouédraogo E., Mando A., Brussaard L., 2004. Soil macrofaunal-mediated organic resource disappearance in semi-arid West Africa. Appl. Soil Ecol, 27 : 259 - 267. Ouédraogo E., Mando A., Stroosnijder L., 2006.

  19. Using waterjet in reverse logistic operations in discarded munitions processing

    Czech Academy of Sciences Publication Activity Database

    Hloch, S.; Tozan, H.; Yagimli, M.; Valíček, Jan; Rokosz, K.

    2011-01-01

    Roč. 18, č. 2 (2011), s. 267-271 ISSN 1330-3651 Institutional research plan: CEZ:AV0Z30860518 Keywords : abrasive waterjet * anti tank bullet * automatic line Subject RIV: JQ - Machines ; Tools Impact factor: 0.347, year: 2011 http://hrcak.srce.hr/search/?q=Using+waterjet+in+reverse+logistic+operations+in+discarded+munitions+processing

  20. CERN: Digital image analysis in the world's largest research center for particle physics

    CERN Multimedia

    2005-01-01

    Those interested in researching into the smallest building blocks that matter is made up of need the largest instruments. CERN, near Geneva, Switzerland is where the most powerful circular accelerator in the world is being built: the Large Hadron Collider (LHC) for proton collisions. It has a circumference of 26.7 km (4 pages)

  1. A Comparison of Evidential Networks and Compositional Models

    Czech Academy of Sciences Publication Activity Database

    Vejnarová, Jiřina

    2014-01-01

    Roč. 50, č. 2 (2014), s. 246-267 ISSN 0023-5954 R&D Projects: GA ČR GA13-20012S Institutional support: RVO:67985556 Keywords : evidence theory * graphical models * conditional independence Subject RIV: BA - General Mathematics Impact factor: 0.541, year: 2014 http://library.utia.cas.cz/separaty/2014/MTR/vejnarova-0439574.pdf

  2. BOEKBESPREKINGS P.P. BOOK REVIEWS

    African Journals Online (AJOL)

    LOCAL ANAESTHESIA. Physiology and Pharmacology oj Local Anesthesia. By R. H. de Jong, M.D. Pp. xiv + 267. Illustrated. $12.50. Spring- field, Ill.: Charles C. Thomas. 1970. This book fills a gap in anaesthetic literature. It is written in lucid style, with ideas logically, if repetitively developed with clear figures and useful ...

  3. 30~kb~sp•.~kjngs ,.130016. R~~j~ws

    African Journals Online (AJOL)

    Z-plan, 'n grootskaalse aanbouprogram. (p. 267) was op 9 Februarie 1939 goedgekeur en sou eers in 1944 ... v!ootvoog, Adm. Marshall, lei (p. 114 e.v.) en met laasgenoemde vervanging deur Vise-. Adm Gunther ... die plan se uitvoering is deur Hitler willens en wetens uitgestel omdat hy uiteindelik ge- reken het dat die ...

  4. 1.4 million cubic metres of achievement

    International Nuclear Information System (INIS)

    Anon.

    1988-01-01

    After five years of civil engineering work, the accent at CERN's 26.7 kilometre LEP electron-positron collider is now on installation. The first 2.8 kilometre section is now virtually complete and awaits the first positron test beam this summer, while the preparations for the four big detectors enter their final phase. (orig./HSI).

  5. Here comes the bad news: Doctor robot taking over

    NARCIS (Netherlands)

    Hoorn, J.F.; Winter, S.D.

    2017-01-01

    To test in how far the Media Equation and Computers Are Social Actors (CASA) validly explain user responses to social robots, we manipulated how a bad health message was framed and the language that was used. In the wake of Experiment 2 of Burgers et al. (Patient Educ Couns 89(2):267–273, 2012.

  6. An improvement of dimension-free Sobolev imbeddings in r spaces

    Czech Academy of Sciences Publication Activity Database

    Fiorenza, A.; Krbec, Miroslav; Schmeisser, H.-J.

    2014-01-01

    Roč. 267, č. 1 (2014), s. 243-261 ISSN 0022-1236 R&D Projects: GA ČR GAP201/10/1920 Institutional support: RVO:67985840 Keywords : imbedding theorem * small Lebesgue space * rearrangement-invariant Banach Subject RIV: BA - General Mathematics Impact factor: 1.322, year: 2014 http://www.sciencedirect.com/science/article/pii/S0022123614001724

  7. Analysis of Hydraulic Fluids and Lubricating Oils for the Formation of Trimethylolpropane Phosphate (TMP-P)

    Science.gov (United States)

    1989-08-09

    as to whether TMP-P was actually present, or wether the result represented only a campound which co-chromatographed at the same retention time as TMP...X E 841 76. Milbrath, Dean S., Engel, Judith L., Verkade, john G., and Casida, John E. Structure-Toxicity relationsips of 1-substituted-4-alkyl-2,6,7

  8. Roostetav legomaja / Karen Jagodin ; kommenteerinud Laila Põdra

    Index Scriptorium Estoniae

    Jagodin, Karen, 1982-

    2009-01-01

    Betoonelementidest eramu (267 m²) Tabasalus. Arhitekt Laila Põdra, insener Indrek Laul. Sisekujundus: Laila Põdra koos omanikega. Projekt: 2005-2007, valmis: 2008. Betoon on viimistluspinnaks ka interjööris. Läbivaks tooniks sise- ja välisviimistluses on roostepunane, teiseks põhitooniks on valge. Konkursil "Aasta Betoonehitis 2008" pälvis tellija eripreemia

  9. Selected topics related to the transport and superconductivity in boron-doped diamond

    Czech Academy of Sciences Publication Activity Database

    Mareš, Jiří J.; Hubík, Pavel; Krištofik, Jozef; Nesládek, Miloš

    2008-01-01

    Roč. 9, č. 4 (2008), 044101/1-044101/6 ISSN 1468-6996 R&D Projects: GA AV ČR IAA1010404; GA ČR(CZ) GA202/06/0040 Institutional research plan: CEZ:AV0Z10100521 Keywords : nanocrystalline diamond * temperature Subject RIV: BM - Solid Matter Physics ; Magnetism Impact factor: 1.267, year: 2008

  10. Thermally Induced Structural Transformations of Fe40Ni40P14B6 Amorphous Alloy

    Czech Academy of Sciences Publication Activity Database

    Vasić, M.; Roupcová, Pavla; Pizúrová, Naděžda; Stevanović, S.; Blagojević, V. A.; Žák, Tomáš; Minić, Dragica M.

    47A, č. 1 (2016), s. 260-267 ISSN 1073-5623 R&D Projects: GA MŠk 1M0512 Institutional support: RVO:68081723 Keywords : Fe-Ni-P * soft-magnetic properties * metallic glasses * corrosion resistance * supercooled liquid * crystallization * phase * temperature * Mossbauer Subject RIV: BM - Solid Matter Physics ; Magnetism Impact factor: 1.874, year: 2016

  11. EST Table: FS795138 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available FS795138 E_FL_ffbm_17H02_F_0 10/09/28 92 %/267 aa ref|NP_001036831.1| saposin-relat...a gnl|Amel|GB16561-PA 10/09/10 55 %/106 aa gi|91077504|ref|XP_966852.1| PREDICTED: similar to saposin isoform 1 [Tribolium castaneum] FS791050 ffbm ...

  12. Journal of Genetics | Indian Academy of Sciences

    Indian Academy of Sciences (India)

    Home; Journals; Journal of Genetics. G. Padma. Articles written in Journal of Genetics. Volume 88 Issue 3 December 2009 pp 267-272 Research Article. GJB2 and GJB6 gene mutations found in Indian probands with congenital hearing impairment · G. Padma P. V. Ramchander U. V. Nandur T. Padma · More Details ...

  13. Control of Yersinia enterocolitica in pigs at herd level

    DEFF Research Database (Denmark)

    Skjerve, Eystein; Lium, Bjørn; Nielsen, Bent

    1998-01-01

    of slaughter pigs (OR = 0.44) also lowered the herd prevalence. The most expressed risk factor was using an own farm vehicle for transport of slaughter pigs to abattoirs (OR = 12.92). Separation between clean and unclean section in herds (OR = 2.67), daily observations of a cat with kittens on the farm (OR = 2...

  14. Mikromechanistické aspekty vlivu délky trhliny na lomovou houževnatost a tranzitní chování ocelí

    Czech Academy of Sciences Publication Activity Database

    Chlup, Zdeněk; Dlouhý, Ivo

    2002-01-01

    Roč. 40, č. 4 (2002), s. 254-267 ISSN 0023-432X R&D Projects: GA AV ČR IAA2041003; GA AV ČR IBS2041001 Institutional research plan: CEZ:AV0Z2041904 Keywords : fracture toughness * transition behaviour * constraint Subject RIV: JL - Materials Fatigue, Friction Mechanics Impact factor: 0.493, year: 2002

  15. Half a century of succession in a temperate oakwood: from species-rich community to mesic forest

    Czech Academy of Sciences Publication Activity Database

    Hédl, Radim; Kopecký, M.; Komárek, J.

    2010-01-01

    Roč. 16, č. 2 (2010), s. 267-276 ISSN 1366-9516 R&D Projects: GA AV ČR IAA600050812; GA ČR GD206/08/H049 Institutional research plan: CEZ:AV0Z60050516 Keywords : homogenization * long-term change * biodiversity loss Subject RIV: EF - Botanics Impact factor: 4.248, year: 2010

  16. Hepatic lipase, genetically elevated high-density lipoprotein, and risk of ischemic cardiovascular disease

    DEFF Research Database (Denmark)

    Johannsen, Trine Holm; Kamstrup, Pia R; Andersen, Rolf V

    2008-01-01

    73M, N193S, S267F, L334F, T383M, and -480c>t influence levels of lipids, lipoproteins, and apolipoproteins and risk of ICD. DESIGN: For the cross-sectional study, we genotyped 9003 individuals from the Copenhagen City Heart Study; hereof were 8971 individuals included in the prospective study, 1747...

  17. 77 FR 57985 - National Organic Program (NOP); Amendment to the National List of Allowed and Prohibited...

    Science.gov (United States)

    2012-09-19

    ... and beverages have grown from $1 billion in 1990 to $26.7 billion in 2010. Sales in 2010 represented 7... 3, Special Studies, Part 2, AC-07- SS-2, Tables 10 & 11, pp 69-91. http://www.agcensus.usda.gov... studies. Some commenters also raised concerns about the environmental impacts of poultry diets with lower...

  18. Anti-Proliferative Activity of Meroditerpenoids Isolated from the Brown Alga Stypopodium flabelliforme against Several Cancer Cell Lines

    Directory of Open Access Journals (Sweden)

    Patricia Valentao

    2011-05-01

    Full Text Available The sea constitutes one of the most promising sources of novel compounds with potential application in human therapeutics. In particular, algae have proved to be an interesting source of new bioactive compounds. In this work, six meroditerpenoids (epitaondiol, epitaondiol diacetate, epitaondiol monoacetate, stypotriol triacetate, 14-ketostypodiol diacetate and stypodiol isolated from the brown alga Stypopodium flabelliforme were tested for their cell proliferation inhibitory activity in five cell lines. Cell lines tested included human colon adenocarcinoma (Caco-2, human neuroblastoma (SH-SY5Y, rat basophilic leukemia (RBL-2H3, murine macrophages (RAW.267 and Chinese hamster fibroblasts (V79. Antimicrobial activity of the compounds was also evaluated against Staphylococcus aureus, Salmonella typhimurium, Proteus mirabilis, Bacillus cereus, Enterococcus faecalis and Micrococcus luteus. Overall, the compounds showed good activity against all cell lines, with SH-SY5Y and RAW.267 being the most susceptible. Antimicrobial capacity was observed for epitaondiol monoacetate, stypotriol triacetate and stypodiol, with the first being the most active. The results suggest that these molecules deserve further studies in order to evaluate their potential as therapeutic agents.

  19. Optical properties of tungsten oxide thin films by non-reactive sputtering

    International Nuclear Information System (INIS)

    Acosta, M.; Gonzalez, D.; Riech, I.

    2009-01-01

    Tungsten oxide thin films were grown on glass substrates by RF sputtering at room temperature using a tungsten trioxide target for several values of the argon pressure (P Ar ). The structural and morphological properties of these films were studied using X-ray diffraction and atomic force microscopy. The as-deposited films were amorphous irrespective of the argon pressure, and crystallized in a mixture of hexagonal and monoclinic phases after annealing at a temperature of 350 o C in air. Surface-roughness increased by an order of magnitude (from 1 nm to 20 nm) after thermal treatment. The argon pressure, however, had a strong influence on the optical properties of the films. Three different regions are clearly identified: deep blue films for P Ar ≤ 2.67 Pa with low transmittance values, light blue films for 2.67 Pa Ar Ar ≥ 6 Pa with high transmittance values. We suggest that the observed changes in optical properties are due to an increasing number of oxygen vacancies as the growth argon pressure decreases.

  20. Substituting oat hay or maize silage for portion of alfalfa hay affects growth performance, ruminal fermentation, and nutrient digestibility of weaned calves

    Science.gov (United States)

    Zou, Yang; Zou, XinPing; Li, XiZhi; Guo, Gang; Ji, Peng; Wang, Yan; Li, ShengLi; Wang, YaJing; Cao, ZhiJun

    2018-01-01

    Objective The impact of forage feeding strategy on growth performance, ruminal fermentation and nutrient digestibility in post-weaning calves was investigated. Methods Forty-five female Holstein calves (body weight [BW] = 79.79±0.38 kg) were enrolled in the 35-d study at one week after weaning and randomly assigned to one of three dietary treatments. All diets were fed as total mixed ration containing 60% (dry matter [DM] basis) of basal starter feed and 40% (DM basis) of forage, but varied in composition of forage source including i) alfalfa (40% DM, AH); ii) alfalfa hay (26.7% DM)+oat hay (13.3% DM; OH); iii) alfalfa hay (26.7% DM)+corn silage (13.3% DM; WS). Results Dry matter intake was not different among treatment groups (p>0.05). However, BW (pcalves fed AH and OH were greater than WS-fed calves, whereas heart girth was greater in OH-fed calves than those fed AH and WS (pfeeding oat hay to postweaning calves increased crude protein digestibility (pcalves. PMID:28728373

  1. Qualitative pattern classification of shear wave elastography for breast masses: how it correlates to quantitative measurements.

    Science.gov (United States)

    Yoon, Jung Hyun; Ko, Kyung Hee; Jung, Hae Kyoung; Lee, Jong Tae

    2013-12-01

    To determine the correlation of qualitative shear wave elastography (SWE) pattern classification to quantitative SWE measurements and whether it is representative of quantitative SWE values with similar performances. From October 2012 to January 2013, 267 breast masses of 236 women (mean age: 45.12 ± 10.54 years, range: 21-88 years) who had undergone ultrasonography (US), SWE, and subsequent biopsy were included. US BI-RADS final assessment and qualitative and quantitative SWE measurements were recorded. Correlation between pattern classification and mean elasticity, maximum elasticity, elasticity ratio and standard deviation were evaluated. Diagnostic performances of grayscale US, SWE parameters, and US combined to SWE values were calculated and compared. Of the 267 breast masses, 208 (77.9%) were benign and 59 (22.1%) were malignant. Pattern classifications significantly correlated with all quantitative SWE measurements, showing highest correlation with maximum elasticity, r = 0.721 (P0.05). Pattern classification shows high correlation to maximum stiffness and may be representative of quantitative SWE values. When combined to grayscale US, SWE improves specificity of US. Copyright © 2013 Elsevier Ireland Ltd. All rights reserved.

  2. Omega-3 phospholipids from fish suppress hepatic steatosis by integrated inhibition of biosynthetic pathways in dietary obese mice

    Czech Academy of Sciences Publication Activity Database

    Rossmeisl, Martin; Medříková, Daša; van Schothorst, E. M.; Pavlišová, Jana; Kuda, Ondřej; Hensler, Michal; Bardová, Kristina; Flachs, Pavel; Staňková, B.; Vecka, M.; Tvrzická, E.; Žák, A.; Keijer, J.; Kopecký, Jan

    2014-01-01

    Roč. 1841, č. 2 (2014), s. 267-278 ISSN 1388-1981 R&D Projects: GA MŠk(CZ) 7E10059; GA ČR(CZ) GAP301/11/0226 Institutional support: RVO:67985823 Keywords : obesity * NAFLD * marine phospholipids * PUFA * lipogenesis * high-fat diet Subject RIV: FB - Endocrinology, Diabetology, Metabolism, Nutrition Impact factor: 5.162, year: 2014

  3. Temperature effect on carbachol-induced depression of spontaneous quantal transmitter release in frog neuromuscular junction

    Czech Academy of Sciences Publication Activity Database

    Strunsky, E. G.; Borisover, M. D.; Nikolsky, E. E.; Vyskočil, František

    2001-01-01

    Roč. 26, 8-9 (2001), s. 891-897 ISSN 0364-3190 R&D Projects: GA AV ČR IAA7011902; GA MŠk OK 267 Grant - others:RFBR(RU) 99-04-48286; EU(XX) Nesting Institutional research plan: CEZ:AV0Z5011922 Keywords : carbachol * temperature * acetylcholine release Subject RIV: ED - Physiology Impact factor: 1.638, year: 2001

  4. New superconductor LaRhSb

    International Nuclear Information System (INIS)

    Nishigori, S.; Moriwaki, H.; Suzuki, T.; Fujita, T.; Tanaka, H.; Takabatake, T.; Fujii, H.

    1994-01-01

    Superconductivity in LaRhSb was newly found below the transition temperature T c = 2.67 K by the measurements of the electrical resistivity, magnetic susceptibility and specific heat in magnetic fields. The characteristics of the superconductivity determined in this study indicate that LaRhSb is a type II superconductor following the BCS theory. (orig.)

  5. The consequences upon patient care of moving Brits Hospital: A ...

    African Journals Online (AJOL)

    Background. In 2001, North West Province took the decision to increase bed capacity at Brits Hospital from 66 beds to 267 beds. After careful consideration of costs and an assessment of available land, it was decided to demolish the existing hospital and rebuild the new hospital on the same site. It was planned that during ...

  6. Correction to Hilton et al. (2004)

    Science.gov (United States)

    Hilton, N. Zoe; Harris, Grant T.; Rice, Marnie E.; Lang, Carol; Cormier, Catherine A.; Lines, Kathryn J.

    2005-01-01

    This paper reports errors in the article "A Brief Actuarial Assessment for the Prediction of Wife Assault Recidivism: The Ontario Domestic Assault Risk Assessment," by N. Zoe Hilton, Grant T. Harris, Marnie E. Rice, Carol Lang, Catherine A. Cormier, and Kathryn J. Lines (Psychological Assessment, 2004, Vol. 16, No. 3, pp. 267-275). On page 272,…

  7. Conception of pharmacological knowledge and needs amongst ...

    African Journals Online (AJOL)

    Students who are taking/have taken the medical pharmacology course completed an 18-question survey within 10min by marking one/more choices from ... and 31.1% different drugs in a group; 45.8% prefer to study lecturers' notes, 26.7% textbooks, 9.8% the Internet, and 2.7% journals; 46.7% use standard textbooks, ...

  8. Groundwater Monitoring Plan for the 216-S-10 Pond and Ditch, Interim Change Notice 1

    International Nuclear Information System (INIS)

    Williams, Bruce A.

    2003-01-01

    During 2003, the upgradient well 299-W26-7 went dry and one new groundwater monitoring well was installed downgradient (well 299-W26-14) of the 216-S-10 pond and ditch. This ICN updates the groundwater monitoring wells for the 216-S-10 pond and ditch and adds a revised well location map to the plan

  9. Body size, body proportions, and mobility in the Tyrolean "Iceman"

    Czech Academy of Sciences Publication Activity Database

    Ruff, C. B.; Holt, B. M.; Sládek, Vladimír; Berner, M.; Murphy, W. A.; zur Nedden, D.; Seidler, H.; Recheis, W.

    2006-01-01

    Roč. 51, č. 1 (2006), s. 91-101 ISSN 0047-2484 R&D Projects: GA ČR GP206/01/D018 Grant - others:National Science Foundation(US) SBR 9530828 Institutional research plan: CEZ:AV0Z60930519 Keywords : European prehistory * biomechanics * body mass Subject RIV: AC - Archeology, Anthropology, Ethnology Impact factor: 3.267, year: 2006

  10. Empirical estimates in stochastic programs with probability and second order stochastic dominance constraints

    Czech Academy of Sciences Publication Activity Database

    Omelchenko, Vadym; Kaňková, Vlasta

    2015-01-01

    Roč. 84, č. 2 (2015), s. 267-281 ISSN 0862-9544 R&D Projects: GA ČR GA13-14445S Institutional support: RVO:67985556 Keywords : Stochastic programming problems * empirical estimates * light and heavy tailed distributions * quantiles Subject RIV: BB - Applied Statistics, Operational Research http://library.utia.cas.cz/separaty/2015/E/omelchenko-0454495.pdf

  11. Impact of daily consumption of Moringa ( Moringa oleifera ) dry leaf ...

    African Journals Online (AJOL)

    A randomized study was conducted to test the efficacy of Moringa powder on iron status and weight gain in women. In an open-labelled randomized trial, 82 moderately anaemic, lactating women, aged 26.7 6.5 years, received a weekly dose of either 100g of Moringa powder(Moringa group) or 120 mg iron sulphate with ...

  12. Monitoring for Equality? Asylum Seekers and Refugees' Retention and Achievement in English for Speakers of Other Languages (ESOL)

    Science.gov (United States)

    Phillimore, Jenny

    2011-01-01

    Interest in the integration of refugees has grown with the increase in numbers of asylum seekers dispersed across the UK. The ability to communicate effectively in English is seen as the key priority in facilitating integration, while a lack of English language is seen as one of the major barriers to refugee employment. Some 267 million British…

  13. Gender Differences in Adolescents' Choice of Heroes and Admired Adults in Five Countries

    Science.gov (United States)

    Estrada, Juan Diego; García-Ael, Cristina; Martorell, José Luis

    2015-01-01

    Seven hundred and sixty-eight adolescents from five countries and regions (USA, Spain, Hong Kong, Qatar, and Malaysia), aged 13-19 (M?=?15.78; SD?=?1.28) years, responded to a questionnaire designed to determine who was their most admired famous adult or hero. Male heroes clearly outnumbered admired females (73.3% vs. 26.7%). There was a pattern…

  14. Bulletin of Materials Science | Indian Academy of Sciences

    Indian Academy of Sciences (India)

    Home; Journals; Bulletin of Materials Science. D K Avasthi. Articles written in Bulletin of Materials Science. Volume 27 Issue 3 June 2004 pp 263-267 Polymers. Electrical properties of ion irradiated polypropylene films · N L Singh Anita Sharma V Shrinet A K Rakshit D K Avasthi · More Details Abstract Fulltext PDF. The effect ...

  15. Bulletin of Materials Science | Indian Academy of Sciences

    Indian Academy of Sciences (India)

    Home; Journals; Bulletin of Materials Science. V Shrinet. Articles written in Bulletin of Materials Science. Volume 27 Issue 3 June 2004 pp 263-267 Polymers. Electrical properties of ion irradiated polypropylene films · N L Singh Anita Sharma V Shrinet A K Rakshit D K Avasthi · More Details Abstract Fulltext PDF. The effect of ...

  16. Bulletin of Materials Science | Indian Academy of Sciences

    Indian Academy of Sciences (India)

    Home; Journals; Bulletin of Materials Science. A K Rakshit. Articles written in Bulletin of Materials Science. Volume 27 Issue 3 June 2004 pp 263-267 Polymers. Electrical properties of ion irradiated polypropylene films · N L Singh Anita Sharma V Shrinet A K Rakshit D K Avasthi · More Details Abstract Fulltext PDF. The effect ...

  17. 76 FR 33400 - Petition for Exemption; Summary of Petition Received

    Science.gov (United States)

    2011-06-08

    ... 202-493-2251. Hand Delivery: Bring comments to the Docket Management Facility in Room W12-140 of the... Avenue SW., Renton, WA 98057-3356, or Fran Shaver, (202-267-4059), Office of Rulemaking, ARM-207, Federal... that the door would not adversely affect safety. [FR Doc. 2011-14144 Filed 6-8-11; 8:45 am] BILLING...

  18. Quasi-Banach spaces of almost universal disposition

    Czech Academy of Sciences Publication Activity Database

    Sánchez, C. F.; Garbulińska, J.; Kubiś, Wieslaw

    2014-01-01

    Roč. 267, č. 3 (2014), s. 744-771 ISSN 0022-1236 R&D Projects: GA ČR(CZ) GAP201/12/0290 Institutional support: RVO:67985840 Keywords : p-Gurarii space * space of universal disposition * isometry Subject RIV: BA - General Mathematics Impact factor: 1.322, year: 2014 http://www.sciencedirect.com/science/article/pii/S0022123614002043

  19. 1722-IJBCS-Article-Ahadji Dabla Koffi M

    African Journals Online (AJOL)

    hp

    were sampled near the Zio River in a rice field. (N 06°20'87''; 01°7'24'' ..... J. Eco. Entomol., 18: 265-267. Adasi K, Hemingway J. 2008. Susceptibility to three pyrethroids and detection of knockdown resistance mutation in. Ghanaian Anopheles gambiae sensu stricto. Journal of Vector Ecology, 33(2):. 255-262. Ahadji-Dabla ...

  20. Two new characterizations of universal integrals on the scale [ 0, 1

    Czech Academy of Sciences Publication Activity Database

    Greco, S.; Mesiar, Radko; Rindone, F.

    2014-01-01

    Roč. 267, č. 1 (2014), s. 217-224 ISSN 0020-0255 R&D Projects: GA ČR GAP402/11/0378 Institutional support: RVO:67985556 Keywords : universal integral * non-additive integral * fuzzy measure Subject RIV: BA - General Mathematics Impact factor: 4.038, year: 2014 http://library.utia.cas.cz/separaty/2014/E/mesiar-0432225.pdf

  1. Update of monotherapy trials with the new anti-androgen, Casodex (ICI 176,334). International Casodex Investigators

    DEFF Research Database (Denmark)

    Iversen, P

    1994-01-01

    Casodex (ICI 176,334) is a non-steroidal anti-androgen, which has a half-life compatible with once-daily oral dosing. In an open, phase II study on 267 patients given Casodex, 50 mg/day, an overall objective response (i.e. partial regression) was seen in 55.5% of patients (146 of 263) with a furt...

  2. Kohakaasluskorras töötamise tingimuste määrustik

    Index Scriptorium Estoniae

    1989-01-01

    Lisatud tööde loetelu, mida ei peeta kohakaasluseks. Vene keeles: В помощь профсоюзному активисту 1989 nr. 3, lk. 9-14. Selgitused vt. Nõukogude Õigus 1989 nr. 4, lk. 267-268

  3. L'huile des graines de neem, un fongicide alternatif à l'oxyde de ...

    African Journals Online (AJOL)

    SARAH

    27 févr. 2013 ... d'huile et de tourteau. Thèse en vue de l'obtention du Doctorat de l'Université de. Toulouse délivré par l'Institut Polytechnique de. Toulouse (INP Toulouse). 267 pages. Osman M Z and Port GR, 1990. Systemic action of neem seed substances against Pieris brassicae. Entomologia Experimentalis et.

  4. The Stochastic Galerkin Method for Darcy Flow Problem with Log-Normal Random

    Czech Academy of Sciences Publication Activity Database

    Beres, Michal; Domesová, Simona

    2017-01-01

    Roč. 15, č. 2 (2017), s. 267-279 ISSN 1336-1376 R&D Projects: GA MŠk LQ1602 Institutional support: RVO:68145535 Keywords : Darcy flow * Gaussian random field * Karhunen-Loeve decomposition * polynomial chaos * Stochastic Galerkin method Subject RIV: BA - General Mathematics OBOR OECD: Applied mathematics http://advances.utc.sk/index.php/AEEE/article/view/2280

  5. "Exercise Dependence"--A Problem or Natural Result of High Activity?

    Science.gov (United States)

    Phelan, Suzanne; Bond, Dale S.; Lang, Wei; Jordan, Dustin; Wing, Rena R.

    2011-01-01

    Objectives: To compare physical activity (PA) and exercise dependence (ED) in 267 weight-loss maintainers (WLM) and 213 normal-weight (NW) controls. Methods: PA and ED assessed via accelerometery and the Exercise Dependence Questionnaire. Results: WLM had higher PA levels and ED scores than those of NW (P less than 0.0001). WLM status (P = 0.006)…

  6. Importance socioculturelle de Artocarpus altilis (Parkinson) Fosberg ...

    African Journals Online (AJOL)

    SARAH

    31 mars 2014 ... conducted to evaluate the economic value of the species and to clarify the parental relationship between the two local forms of ..... arecaceae, an understory palm used for roof thatching in the Peruvian Amazon. Economic. Botany 54 (3), 267–277. Goussanou AC, Tente B, Djègo J, Agbani P, Sinsin B,. 2011.

  7. Pramana – Journal of Physics | Indian Academy of Sciences

    Indian Academy of Sciences (India)

    Home; Journals; Pramana – Journal of Physics. L Sriramkumar. Articles written in Pramana – Journal of Physics. Volume 72 Issue 1 January 2009 pp 263-267. WHEPP-X: Report of the working group on cosmology · M Kaplinghat L Sriramkumar A Berera P Chingangbam R K Jain M Joy J Martin S Mohanty A Nautiyal R ...

  8. Livestock associated epidemiological information profiling in New Sandwip Island (Jahajerchar of the Meghna estuary, Noakhali using participatory disease searching tool

    Directory of Open Access Journals (Sweden)

    SK Shaheenur Islam

    2017-09-01

    Conclusion: This place is potential for sheep and buffalo raising rather than cattle. The study has validated the significance of accepting participatory disease searching tool in order to capture voluntarily submitted epidemiological data towards establishing a cost effective, unique national disease surveillance system in Bangladesh. [J Adv Vet Anim Res 2017; 4(3.000: 267-273

  9. Cleantech Region Stedendriehoek

    NARCIS (Netherlands)

    Heidema, A. (Andries)

    2016-01-01

      http://dx.doi.org/10.14261/postit/B1917A51-5AA6-4723-9EDF87AB64EC267B Keynote speech. In 2015 and 2016, Saxion University of Applied Sciences organized the 2nd and 3rd edition of the Regional Innovation and Entrepreneurship Conference (RIEC).  It just so happens that innovation and

  10. Factors affecting arsenic injury to lowbush blueberry foliage

    Energy Technology Data Exchange (ETDEWEB)

    Hall, I V; Lockhart, C L; Newbery, R J; Wood, G W

    1971-01-01

    In a laboratory study calcium arsenate dust applied at 70% relative humidity did not cause any appreciable injury to foliage of lowbush blueberry. At 90% relative humidity there was marked burning and considerable defoliation. There was no apparent difference in the amount of injury when the dust was applied at 8.9, 17.8, or 26.7 kg/ha.

  11. 75 FR 33698 - Safety Zones; Annual Firework Displays Within the Captain of the Port, Puget Sound Area of...

    Science.gov (United States)

    2010-06-15

    ... to http://www.regulations.gov , inserting USCG-2010-0063 in the ``Keyword'' box, and then clicking..., Regulatory Planning and Review, and does not require an assessment of potential costs and benefits under... Eagle Harbor 47[deg] 37.267' N 122[deg] 31.583' W Whaling Days Dyes Inlet 47[deg] 38.65' N 122[deg] 41...

  12. Perturbations in dopamine synthesis lead to discrete physiological effects and impact oxidative stress response in Drosophila

    Czech Academy of Sciences Publication Activity Database

    Hanna, M. E.; Bednářová, Andrea; Rakshit, K.; Chaudhuri, A.; O’Donnell, J. M.; Krishnan, N.

    2015-01-01

    Roč. 73, Feb 1 (2015), s. 11-19 ISSN 0022-1910 R&D Projects: GA MŠk(CZ) LH14047 Grant - others:GA JU(CZ) 140/2014/P Institutional support: RVO:60077344 Keywords : Catecholamine * circadian * dopamine Subject RIV: ED - Physiology Impact factor: 2.267, year: 2015 http://www.sciencedirect.com/science/article/pii/S0022191015000037

  13. Suicidality and Associated Risk Factors among Lesbian, Gay, and Bisexual Compared to Heterosexual Austrian Adults

    Science.gov (United States)

    Ploderl, Martin; Fartacek, Reinhold

    2005-01-01

    This is the first study in German-speaking countries to compare the suicidality of lesbian, gay, and bisexual adults (n = 358) with matched heterosexual adults (n = 267). The former had significantly elevated incidences of current suicide ideation (28% vs. 13%) and lifetime suicide attempts defined in three ways (14% vs. 1% to 10% vs. 2%),…

  14. Three-dimensional velocity model of the crust of the Bohemian Massif and its effects on seismic tomography of the upper mantle

    Czech Academy of Sciences Publication Activity Database

    Karousová, Hana; Plomerová, Jaroslava; Babuška, Vladislav

    2012-01-01

    Roč. 56, č. 1 (2012), s. 249-267 ISSN 0039-3169 R&D Projects: GA ČR GA205/07/1088; GA AV ČR IAA300120709 Institutional research plan: CEZ:AV0Z30120515 Keywords : crustal structure * seismic methods * Bohemian Massif * teleseismic tomography Subject RIV: DC - Siesmology, Volcanology, Earth Structure Impact factor: 0.975, year: 2012

  15. Characterisation of Ni+ implanted PEEK, PET and PI

    Czech Academy of Sciences Publication Activity Database

    Macková, Anna; Bočan, Jiří; Khaibulline, R.; Valeev, V. F.; Slepička, P.; Sajdl, P.; Švorčík, V.

    2009-01-01

    Roč. 267, - (2009), s. 1549-1552 ISSN 0168-583X R&D Projects: GA MŠk(CZ) LC06041; GA AV ČR(CZ) KJB100480601 Institutional research plan: CEZ:AV0Z10480505 Keywords : Ion implantation * Polymers * TRIDYN * RBS * XPS * Depth profiles Subject RIV: BG - Nuclear, Atomic and Molecular Physics, Colliders Impact factor: 1.156, year: 2009

  16. Journal of Genetics | Indian Academy of Sciences

    Indian Academy of Sciences (India)

    Wheat line CSP44, a selection from an Australian bread wheat cultivar Condor, has shown resistance to stripe rust in India since the last twenty years. Seedlings and adult plants of CSP44 showed susceptible infection types against stripe rust race 46S119 but displayed average terminal disease severity of 2.67 on adult ...

  17. Regional vegetation management standards for commercial pine ...

    African Journals Online (AJOL)

    Trial sites were selected across different physiographic regions such that a range of altitudinal, climatic and environmental gradients were represented. ... Two of the trials were situated at lower-altitude sites (900 m and 1 000 m above sea level [asl]), one at a mid-altitude site (1 267 m asl), and one at a higher-altitude site (1 ...

  18. Complete mitochondrial genome of the fennec fox (Vulpes zerda).

    Science.gov (United States)

    Yang, Xiufeng; Zhao, Chao; Zhang, Honghai; Zhang, Jin; Chen, Lei; Sha, Weilai; Liu, Guangshuai

    2016-01-01

    In this study, the complete mitochondrial genome of the fennec fox (Vulpes zerda) was sequenced using blood samples obtained from a female individual in Shanghai wildlife Park. Sequence analysis showed that the content of T (26.7%) in total composition was no more than C (27.2%), which is different from most of Canide individuals sequenced previously.

  19. Numerical modeling of aluminium foam on two scales

    Czech Academy of Sciences Publication Activity Database

    Němeček, J.; Denk, F.; Zlámal, Petr

    Roč. 267, September (2015), s. 506-516 ISSN 0096-3003 R&D Projects: GA ČR(CZ) GAP105/12/0824 Institutional support: RVO:68378297 Keywords : closed-cell aluminium foam * Alporas * multiscale modeling * homogenization * FFT * finite element modeling Subject RIV: JI - Composite Materials Impact factor: 1.345, year: 2015 http://www.sciencedirect.com/science/article/pii/S0096300315001162

  20. 40 CFR 799.2700 - Methyl ethyl ketoxime.

    Science.gov (United States)

    2010-07-01

    ... population of the seminiferous tubules in immature rats.” “American Journal of Anatomy.” 100:241-267. (1957... Fertilization.” Austin, R. and Short R.V., eds. New York, NY: Cambridge Press. Chapter 4. (1978). (4) Mattison....” “Journal of Reproduction and Fertility.” 17:555-557. (1968). (6) Spencer, P.S., Bischoff, M., and...

  1. Flight Control Requirements for Weapon Delivery. Volume 1. Development of the Terminal Aerial Weapon Delivery Simulation (TAWDS) Programs and Their Use in Formulating Flying Qualities Guidelines for Manually Coupled Aircraft Weapon Delivery Systems

    Science.gov (United States)

    1976-03-01

    t) AT(t) + B(t) Q(t) BT(t) X XX 1 267 ■■ ^"""■’■"-’■ «-I ...,r^.-^^ Mitm *<^ «^r*.»*** ■..fin^....^ ■"■""■"""■"" ■ ■»IM II Uli« svn^im^M

  2. Bulletin of Materials Science | Indian Academy of Sciences

    Indian Academy of Sciences (India)

    Home; Journals; Bulletin of Materials Science. N L Singh. Articles written in Bulletin of Materials Science. Volume 27 Issue 3 June 2004 pp 263-267 Polymers. Electrical properties of ion irradiated polypropylene films · N L Singh Anita Sharma V Shrinet A K Rakshit D K Avasthi · More Details Abstract Fulltext PDF. The effect ...

  3. DEVELOPMENT OF A PROGRAMED TEXT IN SALESMANSHIP FOR FEASIBILITY TESTING IN ADULT EDUCATION. FINAL REPORT.

    Science.gov (United States)

    RUSSELL, RAYMOND B.

    A PROGRAMED TEXT ON SALESMANSHIP WAS DEVELOPED, FIELD TESTED FOR CLARITY, AND REVIEWED BY AN ADVISORY COMMITTEE. PROMOTION OF THE TEXT IN A RANDOM SAMPLE OF 10 TOWNS OF 2,000 TO 7,000 POPULATION WAS CONDUCTED. THE PROMOTION CONSISTED OF CONTACT WITH THE LOCAL CHAMBER OF COMMERCE. SIX COMMUNITIES ACCEPTED. WITH 267 ADULTS ENROLLED UNDER LOCAL…

  4. Microwave plasma ion sources for selected ion flow tube mass spectrometry: Optimizing their performance and detection limits for trace gas analysis

    Czech Academy of Sciences Publication Activity Database

    Španěl, Patrik; Dryahina, Kseniya; Smith, D.

    2007-01-01

    Roč. 267, 1-3 (2007), s. 117-124 ISSN 1387-3806 R&D Projects: GA ČR GA202/06/0776 Institutional research plan: CEZ:AV0Z40400503 Keywords : microwave plasma ion source * selected ion flow tube mass spectrometry * SIFT-MS * breath analysis Subject RIV: CF - Physical ; Theoretical Chemistry Impact factor: 2.411, year: 2007

  5. Pramana – Journal of Physics | Indian Academy of Sciences

    Indian Academy of Sciences (India)

    Home; Journals; Pramana – Journal of Physics. A Nautiyal. Articles written in Pramana – Journal of Physics. Volume 72 Issue 1 January 2009 pp 263-267. WHEPP-X: Report of the working group on cosmology · M Kaplinghat L Sriramkumar A Berera P Chingangbam R K Jain M Joy J Martin S Mohanty A Nautiyal R ...

  6. Genome-wide association study identifies a sequence variant within the DAB2IP gene conferring susceptibility to abdominal aortic aneurysm

    NARCIS (Netherlands)

    Gretarsdottir, Solveig; Baas, Annette F.; Thorleifsson, Gudmar; Holm, Hilma; den Heijer, Martin; de Vries, Jean-Paul P. M.; Kranendonk, Steef E.; Zeebregts, Clark J. A. M.; van Sterkenburg, Steven M.; Geelkerken, Robert H.; van Rij, Andre M.; Williams, Michael J. A.; Boll, Albert P. M.; Kostic, Jelena P.; Jonasdottir, Adalbjorg; Jonasdottir, Aslaug; Walters, G. Bragi; Masson, Gisli; Sulem, Patrick; Saemundsdottir, Jona; Mouy, Magali; Magnusson, Kristinn P.; Tromp, Gerard; Elmore, James R.; Sakalihasan, Natzi; Limet, Raymond; Defraigne, Jean-Olivier; Ferrell, Robert E.; Ronkainen, Antti; Ruigrok, Ynte M.; Wijmenga, Cisca; Grobbee, Diederick E.; Shah, Svati H.; Granger, Christopher B.; Quyyumi, Arshed A.; Vaccarino, Viola; Patel, Riyaz S.; Zafari, A. Maziar; Levey, Allan I.; Austin, Harland; Girelli, Domenico; Pignatti, Pier Franco; Olivieri, Oliviero; Martinelli, Nicola; Malerba, Giovanni; Trabetti, Elisabetta; Becker, Lewis C.; Becker, Diane M.; Reilly, Muredach P.; Rader, Daniel J.; Mueller, Thomas; Dieplinger, Benjamin; Haltmayer, Meinhard; Urbonavicius, Sigitas; Lindblad, Bengt; Gottsater, Anders; Gaetani, Eleonora; Pola, Roberto; Wells, Philip; Rodger, Marc; Forgie, Melissa; Langlois, Nicole; Corral, Javier; Vicente, Vicente; Fontcuberta, Jordi; Espana, Francisco; Grarup, Niels; Jorgensen, Torben; Witte, Daniel R.; Hansen, Torben; Pedersen, Oluf; Aben, Katja K.; de Graaf, Jacqueline; Holewijn, Suzanne; Folkersen, Lasse; Franco-Cereceda, Anders; Eriksson, Per; Collier, David A.; Stefansson, Hreinn; Steinthorsdottir, Valgerdur; Rafnar, Thorunn; Valdimarsson, Einar M.; Magnadottir, Hulda B.; Sveinbjornsdottir, Sigurlaug; Olafsson, Isleifur; Magnusson, Magnus Karl; Palmason, Robert; Haraldsdottir, Vilhelmina; Andersen, Karl; Onundarson, Pall T.; Thorgeirsson, Gudmundur; Kiemeney, Lambertus A.; Powell, Janet T.; Carey, David J.; Kuivaniemi, Helena; Lindholt, Jes S.; Jones, Gregory T.; Kong, Augustine; Blankensteijn, Jan D.; Matthiasson, Stefan E.; Thorsteinsdottir, Unnur; Stefansson, Kari

    We performed a genome-wide association study on 1,292 individuals with abdominal aortic aneurysms (AAAs) and 30,503 controls from Iceland and The Netherlands, with a follow-up of top markers in up to 3,267 individuals with AAAs and 7,451 controls. The A allele of rs7025486 on 9q33 was found to

  7. Search for weakly decaying (Lambda n)over-bar and Lambda Lambda exotic bound states in central Pb-Pb collisions at root S-NN=2.76 TeV

    Czech Academy of Sciences Publication Activity Database

    Adam, J.; Adamová, Dagmar; Bielčík, J.; Bielčíková, Jana; Brož, M.; Čepila, J.; Contreras, J. G.; Eyyubova, G.; Ferencei, Jozef; Křelina, M.; Křížek, Filip; Kučera, Vít; Kushpil, Svetlana; Mareš, Jiří A.; Petráček, V.; Pospíšil, Jan; Schulc, M.; Špaček, M.; Šumbera, Michal; Vajzer, Michal; Vaňát, Tomáš; Závada, Petr

    2016-01-01

    Roč. 752, JAN (2016), s. 267-277 ISSN 0370-2693 R&D Projects: GA MŠk(CZ) LG13031 Institutional support: RVO:68378271 ; RVO:61389005 Keywords : ALICE collaboration * heavy ion collisions * matter Subject RIV: BG - Nuclear, Atomic and Molecular Physics , Colliders; BF - Elementary Particles and High Energy Physics (FZU-D) Impact factor: 4.807, year: 2016

  8. ORF Alignment: NC_002162 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_002162 gi|13358063 >1t71A 5 267 1 262 2e-78 ... ref|NP_078337.1| hypothetical protein UU500 [Ureap...lasma parvum serovar 3 str. ATCC ... 700970] gb|AAF30912.1| conserved hypothetical ... [Ureap...[imported] - ... Ureaplasma urealyticum ... Length = 262 ... Query: 1 ...ery: 121 GNSIDMKGLQTNPFESLDKIIAFNEAPIHIVDFHAETTSEKNALFLDFKSKLSLVYGTHT 180 ... ... ... GNSIDMKGLQTNPFESLDKIIAFNEAPIHIVDFHAETTSEKNALFLDFKSKLSLVYGTHT Sbjct: 121 GNSIDMKGLQTNPFESLDKIIAFNEAPIHIVD

  9. Pramana – Journal of Physics | Indian Academy of Sciences

    Indian Academy of Sciences (India)

    Home; Journals; Pramana – Journal of Physics. R K Jain. Articles written in Pramana – Journal of Physics. Volume 72 Issue 1 January 2009 pp 263-267. WHEPP-X: Report of the working group on cosmology · M Kaplinghat L Sriramkumar A Berera P Chingangbam R K Jain M Joy J Martin S Mohanty A Nautiyal R ...

  10. Assessment of mobile phone use pattern among undergraduates in ...

    African Journals Online (AJOL)

    The finding on the average time spent on the Mobile Phone daily showed that 33.5% of the ... It further revealed that 26.7 % of the students uses the Mobile Phone during lecture to chat with ... Use ,Pattern, Undergraduates, University ... Browse By Country · List All Titles · Free To Read Titles This Journal is Open Access.

  11. Tight bounds on angle sums of nonobtuse simplices

    Czech Academy of Sciences Publication Activity Database

    Brandts, J.; Cihangir, A.; Křížek, Michal

    2015-01-01

    Roč. 267, 15 September (2015), s. 397-408 ISSN 0096-3003 R&D Projects: GA ČR GA14-02067S Institutional support: RVO:67985840 Keywords : nonobtuse simplex * angle sum s * spherical geometry * polar simplex Subject RIV: BA - General Mathematics Impact factor: 1.345, year: 2015 http://www.sciencedirect.com/science/article/pii/S0096300315002155

  12. Wadati method as a simple tool to study seismically active fault zones: a case study from the West-Bohemia/Vogtland region, central Europe

    Czech Academy of Sciences Publication Activity Database

    Novotný, O.; Málek, Jiří; Boušková, Alena

    2016-01-01

    Roč. 60, č. 2 (2016), s. 248-267 ISSN 0039-3169 R&D Projects: GA ČR GAP210/12/2336; GA MŠk LM2010008 Institutional support: RVO:67985530 ; RVO:67985891 Keywords : velocity ratio * earthquake swarm * West-Bohemia/Vogtland * Wadati method * tectonic fault Subject RIV: DC - Siesmology, Volcanology, Earth Structure Impact factor: 0.764, year: 2016

  13. Cervical cancer in South Africa: An overview of current status and ...

    African Journals Online (AJOL)

    Current estimates are that 493 243 women are diagnosed with cervical cancer per year and 273 505 die from the disease.1. Globally it is the second most common cancer in women and the most common in developing countries. In Africa, which has a population of 267.9 million women aged 15 years or greater, it is

  14. Better compliance with hypofractionation vs. conventional fractionation in adjuvant breast cancer radiotherapy. Results of a single, institutional, retrospective study

    Energy Technology Data Exchange (ETDEWEB)

    Rudat, Volker; Nour, Alaa; Hammoud, Mohamed; Abou Ghaida, Salam [Saad Specialist Hospital, Department of Radiation Oncology, Al Khobar (Saudi Arabia)

    2017-05-15

    The aim of the study was to identify factors significantly associated with the occurrence of unintended treatment interruptions in adjuvant breast cancer radiotherapy. Patients treated with postoperative radiotherapy of the breast or chest wall between March 2014 and August 2016 were evaluated. The radiotherapy regimens and techniques applied were either conventional fractionation (CF; 28 daily fractions of 1.8 Gy or 25 fractions of 2.0 Gy) or hypofractionation (HF; 15 daily fractions of 2.67 Gy) with inverse planned intensity-modulated radiotherapy (IMRT) or three-dimensional planned conformal radiotherapy (3DCRT). Logistic regression analysis was used to identify factors associated with noncompliance. Noncompliance was defined as the missing of at least one scheduled radiotherapy fraction. In all, 19 of 140 (13.6%) patients treated with HF and 39 of 146 (26.7%) treated with CF experienced treatment interruptions. Of 23 factors tested, the fractionation regimen emerged as the only independent significant prognostic factor for noncompliance on multivariate analysis (CF; p = 0.007; odds ratio, 2.3; 95% confidence interval, 1.3-4.2). No statistically significant differences concerning the reasons for treatment interruptions could be detected between patients treated with CF or HF. HF is significantly associated with a better patient compliance with the prescribed radiotherapy schedule compared with CF. The data suggest that this finding is basically related to the shorter overall treatment time of HF. (orig.) [German] Ziel der Untersuchung war es, Faktoren zu identifizieren, die mit ungeplanten Behandlungsunterbrechungen bei der adjuvanten Strahlentherapie des Mammakarzinoms assoziiert sind. Es wurden Patienten untersucht, die eine adjuvante Strahlentherapie der Mamma oder Brustwand zwischen Maerz 2014 und August 2016 erhielten. Zur Anwendung kamen als Fraktionierungsprotokoll und strahlentherapeutische Technik eine konventionell fraktionierte (CF; 28 Fraktionen mit

  15. Isoflavone and protein content in soybeans grains submitted to flooding at different stages of development Teor de isoflavonas e proteínas nos grãos de soja submetida ao alagamento em diferentes estádios de desenvolvimento

    Directory of Open Access Journals (Sweden)

    Camila Argenta Fante

    2011-12-01

    Full Text Available The stress imposed on plants by soil flooding constitutes a major barrier to growth and productivity. The identification of soybean varieties that produce higher levels of isoflavones, is necessary as soybeans have been used as human food to reduce risks of chronic diseases. Thus, this study was conducted with the objective of quantifying proteins and isoflavones in soybean cultivars subjected to flooding at various stages of development. The cultivars 'BRS267', 'BRS257' and 'BRS213' were subjected to 15 days of flooding, starting at the stages V6 and V8 and 11 days under stress starting at the stage R4. The proteins in the grain were extracted and quantified and analyzed by SDS-PAGE electrophoresis. Isoflavones were extracted, separated and quantified on HPLC. The electrophoretic analysis of the three cultivars under study revealed the same pattern of banding relative to the total protein regardless of the treatment. However, it was noted that flooding led to an increase in the total contents of isoflavones in the BRS 267 plants flooded in stage R4, remaining constant in other cultivars.O estresse imposto às plantas pelo alagamento do solo constitui uma barreira para o crescimento e produtividade destas. A identificação de cultivares de soja que possam produzir maior teor de isoflavonas torna-se necessária à medida que a soja vem sendo utilizada na alimentação humana e para redução dos riscos de doenças crônicas. Dessa forma, o presente estudo foi realizado com o objetivo de quantificar isoflavonas e proteínas em cultivares de soja submetidas ao alagamento em diferentes estádios de desenvolvimento. As cultivares 'BRS 267', 'BRS 257' e 'BRS 213' foram submetidas a 15 dias de alagamento, nos estádios V6 e V8 e 11 dias sob estresse, no estádio R4. As proteínas no grão foram extraídas e quantificadas e analisadas as eletroforeses em SDS-PAGE. Os isoflavonóides foram extraídos, separados e quantificados por HPLC. A análise por

  16. Construction and long term preservation of clonal transgenic silkworms using a parthenogenetic strain

    Czech Academy of Sciences Publication Activity Database

    Zabelina, Valeriya; Uchino, K.; Mochida, Y.; Yonemura, N.; Klymenko, V.; Sezutsu, H.; Tamura, T.; Sehnal, František

    2015-01-01

    Roč. 81, Oct 01 (2015), s. 28-35 ISSN 0022-1910 R&D Projects: GA MŠk(CZ) EE2.3.30.0032; GA ČR GAP502/10/2382 Institutional support: RVO:60077344 Keywords : silkworm * transgenesis * parthenogenesis Subject RIV: EB - Genetics ; Molecular Biology Impact factor: 2.267, year: 2015 http://www.sciencedirect.com/science/article/pii/S0022191015001304

  17. Impact of Positive Emotions Enhancement on Physiological Processes and Psychological Functioning in Military Pilots

    Science.gov (United States)

    2009-10-01

    behavioral therapy for bulimia nervosa: time course and mechanisms of change. Journal of Clinical consulting Psychology 2002, 20, 267-274. [44...RTO-MP-HFM-181 14 - 1 Impact of Positive Emotions Enhancement on Physiological Processes and Psychological Functioning in Military Pilots...practical tool using different techniques in order to improve regulation of emotions before, during and after actions [3]. This psychological training is

  18. Differential freshwater flagellate community response to bacterial food quality with a focus on Limnohabitans bacteria

    Czech Academy of Sciences Publication Activity Database

    Šimek, Karel; Kasalický, Vojtěch; Jezbera, Jan; Horňák, Karel; Nedoma, Jiří; Hahn, M.W.; Bass, D.; Jost, S.; Boenigk, J.

    2013-01-01

    Roč. 7, č. 8 (2013), s. 1519-1530 ISSN 1751-7362 R&D Projects: GA ČR(CZ) GA13-00243S; GA MŠk(CZ) EE2.3.30.0032 Institutional support: RVO:60077344 Keywords : flagellate community composition * food quality of bacteria * Limnohabitans * 454 pyrosequencing * freshwater * flagellate growth Subject RIV: DA - Hydrology ; Limnology Impact factor: 9.267, year: 2013

  19. Descriptive evaluation of holter recordings at a teaching hospital in ...

    African Journals Online (AJOL)

    Wide QRS complex tachycardia was detected in 20.4%, ST segment depression in 47.8% and atrial fibrillation in 28.7%. Asystole was seen in 18% of subjects with a mean duration of 2.17secs, arrest was recorded in 26.7% of those with asystole. The longest duration was 7.58secs. Premature atrial ectopics were seen in ...

  20. Recent Alcohol Use and Episodic Heavy Drinking among American Indian Youths

    Science.gov (United States)

    King, Keith A.; Vidourek, Rebecca A.; Hill, Mallory K.

    2014-01-01

    A total of 366 American Indian students in grades 7 through 12 completed the PRIDE questionnaire. Recent alcohol use was reported by 31.9% of students, whereas 26.7% reported frequent episodic heavy drinking. One in three students felt it was harmful/very harmful to use alcohol and less than half felt alcohol was easy/very easy to obtain. A series…

  1. Some unique activities of the smallest reactor : UTR-KINKI

    International Nuclear Information System (INIS)

    Shibata, Toshikazu

    1992-01-01

    In the UTR-KINKI, school teaches trainings are being done, besides utilizations for research and student experiments. In this paper, some details of the school teachers training course are presented. 267 teachers have attended the training since 1987, the beginning of the program. Drastic impacts by the training were recognized in impressions of the attended teachers about nuclear energy. (author)

  2. Thermal polycondensation of anthracene for carbon precursors

    Czech Academy of Sciences Publication Activity Database

    Valovičová, Věra; Plevová, Eva; Vaculíková, Lenka; Ritz, M.; Vallová, S.

    2016-01-01

    Roč. 124, č. 1 (2016), s. 261-267 ISSN 1388-6150 R&D Projects: GA MŠk ED2.1.00/03.0082; GA MŠk(CZ) LO1406 Institutional support: RVO:68145535 Keywords : anthracene * polycondensation * mesophase Subject RIV: DB - Geology ; Mineralogy Impact factor: 1.953, year: 2016 http://link.springer.com/article/10.1007%2Fs10973-015-5124-9

  3. Swimming ability and physiological response to swimming fatigue in ...

    African Journals Online (AJOL)

    The swimming endurance of kuruma shrimp, Marsupenaeus japonicus (11.04 ± 2.43 g) at five swimming speeds (23.0, 26.7, 31.0, 34.6 and 38.6 cm s-1) was determined in a circulating flume at 25.7 ± 0.7°C. The plasma glucose and total protein, hepatopancreas and pleopods muscle glycogen concentrations were ...

  4. Geochemical discrimination of metasedimentary sequences in the Krkonoše-Jizera Terrane (West Sudetes, Bohemian Massif): paleotectonic and stratigraphic constraints

    Czech Academy of Sciences Publication Activity Database

    Winchester, J. A.; Patočka, František; Kachlík, V.; Melzer, M.; Nawakowski, C.; Crowley, Q. G.; Floyd, P. A.

    2003-01-01

    Roč. 54, č. 5 (2003), s. 267-280 ISSN 1335-0552 R&D Projects: GA AV ČR IAA3111102 Grant - others:CZ-XE(XE) PACE TMR Network ERBFMRXCT97-0136 Institutional research plan: CEZ:AV0Z3013912 Keywords : geochemistry * metasediments * tectonic setting Subject RIV: DD - Geochemistry Impact factor: 0.397, year: 2003 http://www.geologicacarpathica.sk/src/main.php

  5. Fast MATLAB assembly of FEM matrices in 2D and 3D: Edge elements

    Czech Academy of Sciences Publication Activity Database

    Anjam, I.; Valdman, Jan

    2015-01-01

    Roč. 267, č. 1 (2015), s. 252-263 ISSN 0096-3003 R&D Projects: GA ČR GA13-18652S Institutional support: RVO:67985556 Keywords : MATLAB code vectorization * Finite element method * Edge element * Raviart–Thomas element Subject RIV: BA - General Mathematics Impact factor: 1.345, year: 2015 http://library.utia.cas.cz/separaty/2015/MTR/valdman-0444081.pdf

  6. Temperature dependence of the surface tension and 0.1 MPa density for 1-Cn-3-methylimidazolium tris(pentafluoroethyl)trifluorophosphate with n=2, 4, and 6

    Czech Academy of Sciences Publication Activity Database

    Součková, Monika; Klomfar, Jaroslav; Pátek, Jaroslav

    2012-01-01

    Roč. 48, MAY 2012 (2012), s. 267-275 ISSN 0021-9614 R&D Projects: GA ČR GA101/09/0010 Institutional research plan: CEZ:AV0Z20760514 Keywords : ionic liquid s * tris(pentafluoroethyl)trifluorophosphate * surface tension * group contribution method * density Subject RIV: BJ - Thermodynamics Impact factor: 2.297, year: 2012 http://www.sciencedirect.com/science/article/pii/S0021961411004770

  7. Atoms for peace: a success story of mutation breeding in Florist chrysanthemum at Indian Agricultural Research Institute

    International Nuclear Information System (INIS)

    Prasad, K.V.; Kumar, Surendra; Kumar, Sanjay; Raju, D.V.S.; Swarup, Kishan; Singh, Ompal

    2009-01-01

    Florist chrysanthemum (Chrysanthemum morifolium) is the single largest beneficiary of mutation breeding efforts across the world. Nearly 267 mutants that are documented in Mutant Variety Database of IAEA belong to chrysanthemum. Conventional breeding in chrysanthemum is hampered due to excessive length of the ray florets preventing their pollination besides self-incompatibility. Mutation breeding therefore is more amenable to induce variability. (author)

  8. Northeast Isidis

    Science.gov (United States)

    2005-01-01

    7 December 2005 This Mars Global Surveyor (MGS) Mars Orbiter Camera (MOC) image shows a mesa in northeastern Isidis Planitia. The mesa might be a remnant of terrain that once more extensively covered the region. Location near: 20.3oN, 267.7oW Image width: width: 3 km (1.9 mi) Illumination from: lower left Season: Northern Winter

  9. Race, Ethnicity, and Gender of Faculty Members in APA- and CACREP-Accredited Programs: Changes over Five Decades

    Science.gov (United States)

    Baggerly, Jennifer; Tan, Tony Xing; Pichotta, David; Warner, Aisha

    2017-01-01

    This study examined changes in race, ethnicity, and gender of faculty members in APA- and CACREP-accredited counseling programs over 5 decades based on the year of their degree. Of those faculty members working in accredited programs who graduated in the 1960s/1970s, 26.7% were female, 5.6% were racially diverse, and 1.7% were Latina/o. Of those…

  10. 30 CFR 7.46 - Impact test.

    Science.gov (United States)

    2010-07-01

    ... 30 Mineral Resources 1 2010-07-01 2010-07-01 false Impact test. 7.46 Section 7.46 Mineral... MINING PRODUCTS TESTING BY APPLICANT OR THIRD PARTY Battery Assemblies § 7.46 Impact test. (a) Test... individual cells. At the test temperature range of 65 °F -80 °F (18.3 °C-26.7 °C), apply a dynamic force of...

  11. PROGRESS IN SIFT-MS: BREATH ANALYSIS AND OTHER APPLICATIONS

    Czech Academy of Sciences Publication Activity Database

    Španěl, Patrik; Smith, D.

    2011-01-01

    Roč. 30, č. 2 (2011), s. 236-267 ISSN 0277-7037 R&D Projects: GA MPO FT-TA4/124; GA ČR GA202/09/0800; GA ČR GA203/09/0256 Institutional research plan: CEZ:AV0Z40400503 Keywords : SIFT-MS * breath analysis * ion flow tube Subject RIV: CF - Physical ; Theoretical Chemistry Impact factor: 10.461, year: 2011

  12. Recent Naval Postgraduate School Publications.

    Science.gov (United States)

    1981-05-01

    School,, (IPS-.531071O1)p 1W7. 3* Conhri Aceofthecna taraW 8to ncoen 0 mnkionai goostrophic adibxamat with. f1 itt 1 oh1 maduate School, (BPS-531h77041...Nor h Holand , 1977. 267 p. MorAn techniques of 3.A. - dynamic programming (Ch. 141) IN Naval operations analysis, 2nd ed. Naval lust. Press, 1977, p

  13. Heavy metals concentrations in coal and sediments from River ...

    African Journals Online (AJOL)

    The levels of some heavy metals such as; Mn, Cr, Cd, As, Ni, and Pb were analysed in coal and sediment samples from River Ekulu in Enugu, Coal City using Atomic Absorption Spectrophotometer (AAS) model Spectra-AA-10 variant. Mean concentrations of Mn (0.256-0.389mg/kg) and Cr (0.214-0.267 mg/kg) are high ...

  14. Electromagnetic and mechanical design of a 56 mm aperture mode dipole for the LHC

    International Nuclear Information System (INIS)

    Ahlbaeck, J.; Ikaeheimo, J.; Jaervi, J.

    1994-01-01

    The Large Hadron Collider (LHC) project is proposed as the future extension of the CERN accelerator complex. The LHC requires twin aperture superconducting dipoles of highest possible field to guide the proton beams in the existing LEP tunnel of 26.7 km circumference. This paper describes the electromagnetic and mechanical design of a 56 mm aperture model dipole for the LHC

  15. Condensation of rye chromatin in somatic interphase nuclei of Ph1 and ph1b wheat

    Czech Academy of Sciences Publication Activity Database

    Kopecký, David; Allen, D.C.; Duchoslav, M.; Doležel, Jaroslav; Lukaszewski, A.J.

    2007-01-01

    Roč. 119, 3-4 (2007), s. 263-267 ISSN 1424-8581 R&D Projects: GA MŠk(CZ) LC06004 Institutional research plan: CEZ:AV0Z50380511 Source of funding: V - iné verejné zdroje Keywords : hexaploid wheat * Ph1 and ph1b * rye chromatin Subject RIV: EB - Genetics ; Molecular Biology Impact factor: 2.402, year: 2007

  16. Engineering Development of the XM261 Multipurpose Submunition Warhead and the XM267 Submunition Training Warhead

    Science.gov (United States)

    1985-01-01

    C 41 i • 1 *- ( X: — a» «-» ** »o ** -- *o h X» O i a» —• o *J 3 O 41 • o • •-» E flj ...34 *- * • -’--’’’ -"- • - - i’ i • i’ i * i i - iin td mä • i • • • na >Mi*i^BiB*a***ftfc *. *. • ii ^^•^^^^Vf^^V •«’•»•* •"• ^•W^ WT.i« ii, i...c C 3 TD O <Ü (O c* C C*_l oooooooooooooooooo i-H O HOOH i-HOt—«OI-HOOOOOOO CO en oo en en oooocncocncocncncncncncncn OcnH

  17. INTEGRAL detects the recurrent transients XTE J1709-267 and XTE J1739-285 in outburst

    DEFF Research Database (Denmark)

    Sanchez-Fernandez, C.; Chenevez, Jérôme; Pavan, L.

    2012-01-01

    in the 20-40 keV band. We estimate a rough flux of ~8 mCrab (5 sigma) for an effective ISGRI exposure time of 21 ks. A preliminary spectral fit to the JEM-X data is consistent with an absorbed disk blackbody model of temperature ~2.2 keV. The onset of this outburst was also detected by MAXI http://maxi.riken.jp/top/index.php...

  18. Thermodinamic study the uranium-oxygen system within the composition range 2,61 < O/U < 2,67

    International Nuclear Information System (INIS)

    Caneiro, Alberto.

    1983-01-01

    Oxygen partial pressures (Psub(O2)) as a function of composition and temperature were studied in order to determine the thermodynamic properties of the Uranium-Oxygen (U-O) system. To measure and control Psub(O2), an electrochemical system was used, consisting of an oxygen electrochemical pump and a zirconia gauge which allowed a very accurate determination of the CO + 1/2O 2 = CO 2 reaction. In order to determine oxygen composition, a symmetrical thermogravimetric system a Cahn 1000 electrobalance was constructed and coupled to the system for controlling and measuring Psub(O2) so as to constitute an experimental set-up, which is unique in its type at the present. This facility allowed to determine the thermodynamic properties of the (U-O) system within the composition-temperature range 2,61 3 O 8 ) and of a non-stoichiometric phase (U 8 Osub(21+x)), both being separated by a narrow region of coexistence. Analytical expressions were established for the oxygen chemical potential as a function of composition and temperature, for the stable equilibrium states of the U 8 Osub(21+x) phase and for the metastable ones obtained by oxidation of U 8 Osub(21+x). (M.E.L.) [es

  19. Assessment of patient dose and radiogenic risks during endoscopic retrograde cholangiopancreatography

    Energy Technology Data Exchange (ETDEWEB)

    Sulieman, A.; Elzaki, M. [Sudan University of Science and Technology, College of Medical Radiologic Science, P. O. Box 1908, Khartoum 11111 (Sudan); Alkhorayef, M.; Babikir, E. [King Saud University, College of Applied Sciences, Radiological Sciences Department, P. O. Box 10219, Riyadh 11433 (Saudi Arabia); Abuzaid, M. [University of Sharjah, College of Health Sciences, Medical Diagnostic Imaging Department, Sharjah (United Arab Emirates); Dalton, A.; Bradley, D., E-mail: Abdelmoneim_a@yahoo.com [University of Surrey, Centre for Nuclear and Radiation Physics, Department of Physics, GU2-7XH, Guildford, Surrey (United Kingdom)

    2015-10-15

    Endoscopic retrograde cholangiopancreatography (ERCP) is an invasive technique that has been used for over 30 years in the diagnosis and management of pancreaticobiliary disorders. The objectives of this study were to evaluate the patient entrance surface air kerma doses (ESAK) and estimate the organ and effective doses during ERCP in three hospitals in Khartoum. A total of 55 patients were examined in three hospitals in Khartoum state, Sudan. Calibrated thermoluminescence dosimeters (TLD)-Gr-200-A)) were used to measure patients ESAK. The overall mean of ESAK for all ERCP procedures was 42.4 mGy. The mean patient ESAK in Fedail, Soba and Ibn sena centers were 26.7 mGy, 26.0 mGy, 72.4 mGy, respectively. The effective doses in three centers were 1.6, 1.56 and 2.67 mSv in that order and the overall mean effective dose was 2.01 mSv. Patient radiation doses vary widely among the different hospitals. Patient ESAK is low compared to previous studies in the light of the current practice. Patient dose was decreased significantly in the last two decades. (Author)

  20. Assessment of patient dose and radiogenic risks during endoscopic retrograde cholangiopancreatography

    International Nuclear Information System (INIS)

    Sulieman, A.; Elzaki, M.; Alkhorayef, M.; Babikir, E.; Abuzaid, M.; Dalton, A.; Bradley, D.

    2015-10-01

    Endoscopic retrograde cholangiopancreatography (ERCP) is an invasive technique that has been used for over 30 years in the diagnosis and management of pancreaticobiliary disorders. The objectives of this study were to evaluate the patient entrance surface air kerma doses (ESAK) and estimate the organ and effective doses during ERCP in three hospitals in Khartoum. A total of 55 patients were examined in three hospitals in Khartoum state, Sudan. Calibrated thermoluminescence dosimeters (TLD)-Gr-200-A)) were used to measure patients ESAK. The overall mean of ESAK for all ERCP procedures was 42.4 mGy. The mean patient ESAK in Fedail, Soba and Ibn sena centers were 26.7 mGy, 26.0 mGy, 72.4 mGy, respectively. The effective doses in three centers were 1.6, 1.56 and 2.67 mSv in that order and the overall mean effective dose was 2.01 mSv. Patient radiation doses vary widely among the different hospitals. Patient ESAK is low compared to previous studies in the light of the current practice. Patient dose was decreased significantly in the last two decades. (Author)