WorldWideScience

Sample records for dubnium 259

  1. Extraction systems for the study of dubnium

    International Nuclear Information System (INIS)

    Gates, J.M.; Sudowe, R.; Ali, M.N.; Calvert, M.G.; Dragojevic, I.; Ellison, P.A.; Garcia, M.A.; Gharibyan, N.; Gregorich, K.E.; Nelson, S.L.; Neumann, S.H.; Parsons-Moss, T.; Stavsetra, L.; Nitsche, H.

    2007-01-01

    The chemistry of transactinide elements (Z (ge) 104) is a topic of great interest in current nuclear chemistry research. The chemical systems that can be used in these studies are limited by the short half-lives of the isotopes and the small production rates of atoms per minute or even atoms per week. In the initial investigations, the chemistry used had to be very selective to the periodic group of interest to separate the transactinide atom from all the other unwanted nuclear reaction products, e.g., transfer products. By using the Berkeley Gas-filled Separator (BGS) as a physical pre-separator, we are able concentrate on systems that are selective between the members of the group of interest, because all other interfering products and the beam are being suppressed by the BGS [1]. We are developing suitable extraction systems for the study of element 105, dubnium. For this purpose we have studied the extraction of niobium and tantalum, the lighter homologs of dubnium, from mineral acids with different organophosphorus compounds. All studies were performed online, using short-lived niobium and tantalum produced in the 124 Sn( 51 V,5n) 170 Ta and 74 Se( 18 O,p3n) 88 Nb reactions. This allowed for the study of the lighter homologues at metal concentrations of 10 -16 M. At these low metal concentrations, the formation of polymeric species is largely prohibited. As seen in Fig. 1, by varying the extractant and the hydrochloric acid concentration from 1 to 11 M, we are able to see a difference in extraction behavior between niobium and tantalum. While the system is suitable for determining chemical differences between the lighter homologues, the extraction of tantalum from hydrochloric acid shows slow kinetics. Figure 2 shows that after 90 seconds of mixing, the system is not in equilibrium. However, experiments indicate that equilibrium is reached faster at higher acid concentrations. We have studied the influence of hydrogen ion concentration on the extraction

  2. Cold Fusion Production and Decay of Neutron-Deficient Isotopes of Dubnium and Development of Extraction Systems for Group V Elements

    Energy Technology Data Exchange (ETDEWEB)

    Gates, Jacklyn M. [Univ. of California, Berkeley, CA (United States)

    2008-07-31

    Excitation functions for the 1n and 2n exit channels of the 208Pb(51V,xn)259-xDb reaction were measured. A maximum cross section of the 1n exit channel of 2070$+1100\\atop{-760}$ pb was measured at an excitation energy of 16.0 ± 1.8 MeV. For the 2n exit channel, a maximum cross section of 1660$+450\\atop{-370}$ pb was measured at 22.0 ± 1.8 MeV excitation energy. The 1n excitation function for the 209Bi(50Ti,n)258Db reaction was remeasured, resulting in a cross section of 5480$+1730\\atop{-1370}$ pb at an excitation energy of 16.0 ± 1.6 MeV. Differences in cross section maxima are discussed in terms of the fusion probability below the barrier. The extraction of niobium (Nb) and tantalum (Ta) from hydrochloric acid and mixed hydrochloric acid/lithium chloride media by bis(2-ethylhexyl) hydrogen phosphate (HDEHP) and bis(2-ethylhexyl) hydrogen phosphite (BEHP) was studied. The goal of the experiments was to find a system that demonstrates selectivity among the members of group five of the Periodic Table and is also suitable for the study of dubnium (Db, Z = 105). Experiments with niobium and tantalum were performed with carrier (10-6 M), carrier free (10-10 M) and trace (10-16 M) concentrations of metal using hydrochloric acid solution with concentrations ranging from 1 - 11 M. The extraction of niobium and tantalum from mixed hydrochloric acid/lithium chloride media by HDEHP and BEHP as a function of hydrogen ion (H+) concentration was also investigated. The data obtained are used as the basis to discuss the speciation of niobium and tantalum under the conditions studied and to evaluate possible extraction mechanisms. The 74Se(18O,p3n)88gNb excitation function was measured to determine the best energy for producing the 88Nb used in chemistry experiments. A maximum cross section of 495 +- 5 mb was observed at an 18O energy of 74.0 Me

  3. Spontaneous fission of 259Md

    International Nuclear Information System (INIS)

    Hulet, E.K.; Wild, J.F.; Lougheed, R.W.; Baisden, P.A.; Landrum, J.H.; Dougan, R.J.; Mustafa, M.; Ghiorso, A.; Nitschke, J.M.

    1979-01-01

    The mass and kinetic energy distributions of fission fragments from the spontaneous fission of th newly discovered nuclide 259 Md were obtained. 259 Md was identified as the E. C. daughter of 259 No, and was found to decay entirely (> 95%) by spontaneous fission with a 95-min half-life. From the kinetic energies measured for 397 pairs of coincident fragments, a mass distribution was derived that is symmetric with sigma = 13 amu. 259 Md, together with 258 Fm and 259 Fm, form a select group of three nuclides whose mass division in spontaneous fission is highly symmetric. Unlike the total-kinetic-energy (TKE) distributions of 258 Fm and 259 Fm, which peak at approx. = to 240 MeV, this distribution for 259 Md is broad and is 50 MeV lower in energy. Analysis of the mass and energy distributions shows that events near mass symmetry also exhibit a broad TKE distribution, with one-third of the symmetric events having TKEs less than 200 MeV. The associated of low TKEs with symmetric mass division in the fission of very heavy actinides is anomalous and inconsistent with theories based upon the emergence of fragment shells near the scission point. Either three-body fragmentation or peculiar fragment shapes are assumed as the cause for the large consumption of Coulomb energy observed for a significant fraction of symmetric fissions in 259 Md. 6 figures

  4. 49 CFR 234.259 - Warning time.

    Science.gov (United States)

    2010-10-01

    ... 49 Transportation 4 2010-10-01 2010-10-01 false Warning time. 234.259 Section 234.259..., Inspection, and Testing Inspections and Tests § 234.259 Warning time. Each crossing warning system shall be tested for the prescribed warning time at least once every 12 months and when the warning system is...

  5. 16 CFR 259.2 - Advertising disclosures.

    Science.gov (United States)

    2010-01-01

    ... 16 Commercial Practices 1 2010-01-01 2010-01-01 false Advertising disclosures. 259.2 Section 259.2... ADVERTISING FOR NEW AUTOMOBILES § 259.2 Advertising disclosures. (a) No manufacturer or dealer shall make any express or implied representation in advertising concerning the fuel economy of any new automobile 1...

  6. 24 CFR 207.259 - Insurance benefits.

    Science.gov (United States)

    2010-04-01

    ... 24 Housing and Urban Development 2 2010-04-01 2010-04-01 false Insurance benefits. 207.259 Section... Contract of Insurance § 207.259 Insurance benefits. (a) Method of payment. Upon either an assignment of the... of mortgage. If the mortgage is assigned to the Commissioner, the insurance benefits shall be paid in...

  7. 24 CFR 203.259a - Scope.

    Science.gov (United States)

    2010-04-01

    ... MORTGAGE AND LOAN INSURANCE PROGRAMS UNDER NATIONAL HOUSING ACT AND OTHER AUTHORITIES SINGLE FAMILY MORTGAGE INSURANCE Contract Rights and Obligations Mortgage Insurance Premiums-in General § 203.259a Scope... Insurance Premiums—Periodic Payment ...

  8. Characterization of Group V Dubnium Homologs on DGA Extraction Chromatography Resin from Nitric and Hydrofluoric Acid Matrices

    Energy Technology Data Exchange (ETDEWEB)

    Despotopulos, J D; Sudowe, R

    2012-02-21

    Studies of the chemical properties of superheavy elements (SHE) pose interesting challenges due to their short half-lives and low production rates. Chemical systems must have extremely fast kinetics, fast enough kinetics to be able to examine the chemical properties of interest before the SHE decays to another nuclide. To achieve chemistry on such time scales, the chemical system must also be easily automated. Most importantly however, a chemical system must be developed which provides suitable separation and kinetics before an on-line study of a SHE can be performed. Relativistic effects make studying the chemical properties of SHEs interesting due to the impact these effects could have on the SHEs chemical properties. Relativistic effects arise when the velocity of the s orbital electrons approach the speed of light. As this velocity increases, the Bohr radius of the inner electron orbitals decreases and there is an increase in the particles mass. This contraction results in a destabilization of the energy of the outer d and f electron orbitals (5f and 6d in the case of SHE), which can cause these to expand due to their increased shielding from the nuclear charge. Another relativistic effect is the spin-orbit splitting for p, d, and f orbitals into j = 1 {+-} 1/2 states. This can lead most interestingly to a possible increased stability of element 114, which due to large spin-orbit splitting of the 7p orbital and the relativistically stabilized 7p{sub 1/2} and 7s orbital gives rise to a closed shell ground state of 7s{sup 2}7p{sub 1/2}{sup 2}. The homologs of element 105, dubnium (Db), Ta and Nb and the pseudo-homolog Pa, are well known to hydrolyze and form both neutral and non-neutral monoatomic and polyatomic species that may cause issues with extraction from a given chemical system. Early ion-exchange and solvent-extraction studies show mixed results for the behavior of Db. Some studies show Db behaving most similar to Ta, while others show it behaving

  9. 16 CFR 259.1 - Definitions.

    Science.gov (United States)

    2010-01-01

    ... economy of the particular new automobile on which the label is affixed, as determined in accordance with... for the class of new automobiles. The estimated city and highway fuel economy values of the class of... FOR NEW AUTOMOBILES § 259.1 Definitions. For the purposes of this part, the following definitions...

  10. 30 CFR 259.001 - Purpose and scope.

    Science.gov (United States)

    2010-07-01

    ... 30 Mineral Resources 2 2010-07-01 2010-07-01 false Purpose and scope. 259.001 Section 259.001 Mineral Resources MINERALS MANAGEMENT SERVICE, DEPARTMENT OF THE INTERIOR OFFSHORE MINERAL LEASING: DEFINITIONS § 259.001 Purpose and scope. The purpose of this part 259 is to define various terms appearing in...

  11. 14 CFR 259.5 - Customer service plan.

    Science.gov (United States)

    2010-01-01

    ... 14 Aeronautics and Space 4 2010-01-01 2010-01-01 false Customer service plan. 259.5 Section 259.5... REGULATIONS ENHANCED PROTECTIONS FOR AIRLINE PASSENGERS § 259.5 Customer service plan. (a) Adoption of Plan. Each covered carrier shall adopt a Customer Service Plan applicable to its scheduled flights and shall...

  12. 7 CFR 1924.259 - Handling dwelling construction complaints.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 12 2010-01-01 2010-01-01 false Handling dwelling construction complaints. 1924.259 Section 1924.259 Agriculture Regulations of the Department of Agriculture (Continued) RURAL HOUSING... Construction Defects § 1924.259 Handling dwelling construction complaints. This section describes the procedure...

  13. 17 CFR 259.0-1 - Availability of forms.

    Science.gov (United States)

    2010-04-01

    ... may inspect the forms at this address and at the Commission's regional and district offices. (See... 17 Commodity and Securities Exchanges 3 2010-04-01 2010-04-01 false Availability of forms. 259.0-1 Section 259.0-1 Commodity and Securities Exchanges SECURITIES AND EXCHANGE COMMISSION (CONTINUED) FORMS...

  14. 50 CFR 216.259 - Modifications to Letters of Authorization.

    Science.gov (United States)

    2010-10-01

    ... ATMOSPHERIC ADMINISTRATION, DEPARTMENT OF COMMERCE MARINE MAMMALS REGULATIONS GOVERNING THE TAKING AND IMPORTING OF MARINE MAMMALS Taking Marine Mammals Incidental to Conducting Precision Strike Weapon Missions in the Gulf of Mexico § 216.259 Modifications to Letters of Authorization. (a) Except as provided in...

  15. Cleanup Verification Package for the 600-259 Waste Site

    Energy Technology Data Exchange (ETDEWEB)

    J. M. Capron

    2006-02-09

    This cleanup verification package documents completion of remedial action for the 600-259 waste site. The site was the former site of the Special Waste Form Lysimeter, consisting of commercial reactor isotope waste forms in contact with soils within engineered caissons, and was used by Pacific Northwest National Laboratory to collect data regarding leaching behavior for target analytes. A Grout Waste Test Facility also operated at the site, designed to test leaching rates of grout-solidified low-level radioactive waste.

  16. Cleanup Verification Package for the 600-259 Waste Site

    International Nuclear Information System (INIS)

    Capron, J.M.

    2006-01-01

    This cleanup verification package documents completion of remedial action for the 600-259 waste site. The site was the former site of the Special Waste Form Lysimeter, consisting of commercial reactor isotope waste forms in contact with soils within engineered caissons, and was used by Pacific Northwest National Laboratory to collect data regarding leaching behavior for target analytes. A Grout Waste Test Facility also operated at the site, designed to test leaching rates of grout-solidified low-level radioactive waste

  17. 7 CFR 2.59 - Deputy Under Secretaries for Natural Resources and Environment.

    Science.gov (United States)

    2010-01-01

    ... Environment. 2.59 Section 2.59 Agriculture Office of the Secretary of Agriculture DELEGATIONS OF AUTHORITY BY... Under Secretary for Natural Resources and Environment § 2.59 Deputy Under Secretaries for Natural Resources and Environment. Pursuant to § 2.20(a), subject to reservations in § 2.20(b), and subject to...

  18. 28 CFR 25.9 - Retention and destruction of records in the system.

    Science.gov (United States)

    2010-07-01

    ... INFORMATION SYSTEMS The National Instant Criminal Background Check System § 25.9 Retention and destruction of... receives communication of the determination that the transfer may proceed. All other information, except...

  19. Prognostic factorsin inoperable adenocarcinoma of the lung: A multivariate regression analysis of 259 patiens

    DEFF Research Database (Denmark)

    Sørensen, Jens Benn; Badsberg, Jens Henrik; Olsen, Jens

    1989-01-01

    The prognostic factors for survival in advanced adenocarcinoma of the lung were investigated in a consecutive series of 259 patients treated with chemotherapy. Twenty-eight pretreatment variables were investigated by use of Cox's multivariate regression model, including histological subtypes and ...

  20. 24 CFR 207.259a - Waiver of title objection; mortgages formerly Commissioner-held.

    Science.gov (United States)

    2010-04-01

    ... UNDER NATIONAL HOUSING ACT AND OTHER AUTHORITIES MULTIFAMILY HOUSING MORTGAGE INSURANCE Contract Rights and Obligations Rights and Duties of Mortgagee Under the Contract of Insurance § 207.259a Waiver of... any lien or other adverse interest that was senior to the mortgage on the date of the original sale of...

  1. 20 CFR 1002.259 - How does USERRA protect an employee's pension benefits?

    Science.gov (United States)

    2010-04-01

    ... 20 Employees' Benefits 3 2010-04-01 2010-04-01 false How does USERRA protect an employee's pension... REEMPLOYMENT RIGHTS ACT OF 1994 Reemployment Rights and Benefits Pension Plan Benefits § 1002.259 How does USERRA protect an employee's pension benefits? On reemployment, the employee is treated as not having a...

  2. The Ly Alpha Reference Sample. I. Survey Outline and First Results for Markarian 259

    Czech Academy of Sciences Publication Activity Database

    Ostlin, G.; Hayes, M.; Duval, F.; Sandberg, A.; Rivera-Thorsen, T.; Marquart, T.; Orlitová, Ivana; Adamo, A.; Melinder, J.; Guaita, L.; Atek, H.; Cannon, J.M.; Gruyters, P.; Herenz, E.Ch.; Kunth, D.; Laursen, P.; Más-Hesse, J. M.; Micheva, G.; Oti-Floranes, H.; Pardy, S.; Roth, M.; Schaerer, D.; Verhamme, A.

    2014-01-01

    Roč. 797, č. 1 (2014), 11/1-11/23 ISSN 0004-637X R&D Projects: GA ČR(CZ) GP14-20666P Institutional support: RVO:67985815 Keywords : cosmology: observations * galaxies: evolution * galaxies: individual: Mrk 259 Subject RIV: BN - Astronomy, Celestial Mechanics, Astrophysics Impact factor: 5.993, year: 2014

  3. 17 CFR 259.604 - Form TH-Notification of reliance on temporary hardship exemption.

    Science.gov (United States)

    2010-04-01

    ... 17 Commodity and Securities Exchanges 3 2010-04-01 2010-04-01 false Form TH-Notification of... OF 1935 Forms for Electronic Filing § 259.604 Form TH—Notification of reliance on temporary hardship exemption. Form TH shall be filed by any electronic filer who submits to the Commission, pursuant to a...

  4. 14 CFR 259.4 - Contingency plan for lengthy tarmac delays.

    Science.gov (United States)

    2010-01-01

    ... (AVIATION PROCEEDINGS) ECONOMIC REGULATIONS ENHANCED PROTECTIONS FOR AIRLINE PASSENGERS § 259.4 Contingency..., assurance that the air carrier will provide adequate food and potable water no later than two hours after... flights covered in paragraph (b)(2) of this section, and for the trigger point for food and water covered...

  5. 24 CFR 213.259a - Premiums-mortgages insured pursuant to section 238(c) of the Act.

    Science.gov (United States)

    2010-04-01

    .... All of the provisions of §§ 213.253 through 213.259 governing mortgage insurance premiums shall apply... mortgage insurance premiums due on such mortgages in accordance with §§ 213.253 through 213.259 shall be... 24 Housing and Urban Development 2 2010-04-01 2010-04-01 false Premiums-mortgages insured pursuant...

  6. Advanced conceptual design report: T Plant secondary containment and leak detection upgrades. Project W-259

    International Nuclear Information System (INIS)

    Hookfin, J.D.

    1995-01-01

    The T Plant facilities in the 200-West Area of the Hanford site were constructed in the early 1940s to produce nuclear materials in support of national defense activities. T Plant includes the 271-T facility, the 221-T facility, and several support facilities (eg, 2706-T), utilities, and tanks/piping systems. T Plant has been recommended as the primary interim decontamination facility for the Hanford site. Project W-259 will provide capital upgrades to the T Plant facilities to comply with Federal and State of Washington environmental regulations for secondary containment and leak detection. This document provides an advanced conceptual design concept that complies with functional requirements for the T Plant Secondary Containment and Leak Detection upgrades

  7. The role of Glu259 in Escherichia coli elongation factor Tu in ternary complex formation

    DEFF Research Database (Denmark)

    Nautrup Pedersen, Gitte; Rattenborg, Thomas; Knudsen, Charlotte Rohde

    1998-01-01

    Determination of the crystal structure of the ternary complex formed between elongation factor Tu:GTP and aminoacylated tRNA revealed three regions of interaction between elongation factor Tu and tRNA. The structure indicates that the conserved glutamic acid at position 271 in Thermus aquaticus EF-Tu...... could be involved in the binding of the 3' CCA-Phe end of the aminoacylated tRNA. Therefore, the corresponding residue, Glu259, of Escherichia coli EF-Tu was mutated into alanine, aspartic acid, glutamine and tyrosine, in order to substantiate the crystallographic structural evidence and to obtain...... of interaction with tRNA, while mutation to tyrosine abolished completely the interaction with tRNA. Finally, mutation to glutamine resulted in an elongation factor Tu variant behaving like the wild type. In conclusion, the environment around the site binding the CCA-Phe end of the tRNA is very restricted...

  8. 47 CFR 25.259 - Time sharing between NOAA meteorological satellite systems and non-voice, non-geostationary...

    Science.gov (United States)

    2010-10-01

    ... 47 Telecommunication 2 2010-10-01 2010-10-01 false Time sharing between NOAA meteorological... SATELLITE COMMUNICATIONS Technical Standards § 25.259 Time sharing between NOAA meteorological satellite... Atmospheric Administration (“NOAA”) satellite systems. When calculating the protection areas for a NOAA...

  9. 17 CFR 259.5s - Form U5S, for annual reports filed under section 5(c) of the Act.

    Science.gov (United States)

    2010-04-01

    ... 17 Commodity and Securities Exchanges 3 2010-04-01 2010-04-01 false Form U5S, for annual reports filed under section 5(c) of the Act. 259.5s Section 259.5s Commodity and Securities Exchanges SECURITIES... 1935 Forms for Registration and Annual Supplements § 259.5s Form U5S, for annual reports filed under...

  10. The Lyα reference sample. I. Survey outline and first results for Markarian 259

    International Nuclear Information System (INIS)

    Östlin, Göran; Hayes, Matthew; Duval, Florent; Sandberg, Andreas; Rivera-Thorsen, Thøger; Marquart, Thomas; Adamo, Angela; Melinder, Jens; Guaita, Lucia; Micheva, Genoveva; Orlitová, Ivana; Atek, Hakim; Cannon, John M.; Pardy, Stephen A.; Gruyters, Pieter; Herenz, Edmund Christian; Kunth, Daniel; Laursen, Peter; Mas-Hesse, J. Miguel; Otí-Floranes, Héctor

    2014-01-01

    The Lyα Reference Sample (LARS) is a substantial program with the Hubble Space Telescope (HST) that provides a sample of local universe laboratory galaxies in which to study the detailed astrophysics of the visibility and strength of the Lyαline of neutral hydrogen. Lyα is the dominant spectral line in use for characterizing high-redshift (z) galaxies. This paper presents an overview of the survey, its selection function, and HST imaging observations. The sample was selected from the combined GALEX+Sloan Digital Sky Survey catalog at z = 0.028-0.19, in order to allow Lyα to be captured with combinations of long-pass filters in the Solar Blind Channel (SBC) of the Advanced Camera for Surveys (ACS) onboard HST. In addition, LARS utilizes Hα and Hβ narrowband and u, b, i broadband imaging with ACS and the Wide Field Camera 3 (WFC3). In order to study galaxies in which large numbers of Lyα photons are produced (whether or not they escape), we demanded an Hα equivalent width W(Hα) ≥100 Å. The final sample of 14 galaxies covers far-UV (FUV, λ ∼ 1500 Å) luminosities that overlap with those of high-z Lyα emitters (LAEs) and Lyman break galaxies (LBGs), making LARS a valid comparison sample. We present the reduction steps used to obtain the Lyα images, including our LARS eXtraction software (LaXs), which utilizes pixel-by-pixel spectral synthesis fitting of the energy distribution to determine and subtract the continuum at Lyα. We demonstrate that the use of SBC long-pass-filter combinations increase the signal-to-noise ratio by an order of magnitude compared to the nominal Lyα filter available in SBC. To exemplify the science potential of LARS, we also present some first results for a single galaxy, Mrk 259 (LARS #1). This irregular galaxy shows bright and extended (indicative of resonance scattering) but strongly asymmetric Lyα emission. Spectroscopy from the Cosmic Origins Spectrograph on board HST centered on the brightest UV knot shows a moderate

  11. The Lyα reference sample. I. Survey outline and first results for Markarian 259

    Energy Technology Data Exchange (ETDEWEB)

    Östlin, Göran; Hayes, Matthew; Duval, Florent; Sandberg, Andreas; Rivera-Thorsen, Thøger; Marquart, Thomas; Adamo, Angela; Melinder, Jens; Guaita, Lucia; Micheva, Genoveva [Department of Astronomy, Stockholm University, Oscar Klein Centre, AlbaNova, Stockholm SE-106 91 (Sweden); Orlitová, Ivana [Observatoire de Genève, Université de Genève, Chemin des Maillettes 51, 1290 Versoix (Switzerland); Atek, Hakim [Laboratoire d' Astrophysique, Ecole Polytechnique Fédérale de Lausanne, Observatoire de Sauverny, CH-1290 Versoix (Switzerland); Cannon, John M.; Pardy, Stephen A. [Department of Physics and Astronomy, Macalester College, 1600 Grand Avenue, Saint Paul, MN 55105 (United States); Gruyters, Pieter [Department of Physics and Astronomy, Division of Astronomy and Space Physics, Uppsala University, Box 516, 75120 Uppsala (Sweden); Herenz, Edmund Christian [Leibniz-Institute for Astrophysics Potsdam (AIP), innoFSPEC, An der Sternwarte 16, D-14482 Potsdam (Germany); Kunth, Daniel [Institut d' Astrophysique Paris, 98bis Bd Arago, F-75014 Paris (France); Laursen, Peter [Dark Cosmology Centre, Niels Bohr Institute, University of Copenhagen, DK-2100 Copenhagen (Denmark); Mas-Hesse, J. Miguel [Centro de Astrobiologa (CSIC-INTA), Departamento de Astrofsica, POB 78, E-28691, Villanueva de la Cañada (Spain); Otí-Floranes, Héctor [Instituto de Astronoma, Universidad Nacional Autnoma de Mxico, Apdo. Postal 106, Ensenada B. C. 22800 (Mexico); and others

    2014-12-10

    The Lyα Reference Sample (LARS) is a substantial program with the Hubble Space Telescope (HST) that provides a sample of local universe laboratory galaxies in which to study the detailed astrophysics of the visibility and strength of the Lyαline of neutral hydrogen. Lyα is the dominant spectral line in use for characterizing high-redshift (z) galaxies. This paper presents an overview of the survey, its selection function, and HST imaging observations. The sample was selected from the combined GALEX+Sloan Digital Sky Survey catalog at z = 0.028-0.19, in order to allow Lyα to be captured with combinations of long-pass filters in the Solar Blind Channel (SBC) of the Advanced Camera for Surveys (ACS) onboard HST. In addition, LARS utilizes Hα and Hβ narrowband and u, b, i broadband imaging with ACS and the Wide Field Camera 3 (WFC3). In order to study galaxies in which large numbers of Lyα photons are produced (whether or not they escape), we demanded an Hα equivalent width W(Hα) ≥100 Å. The final sample of 14 galaxies covers far-UV (FUV, λ ∼ 1500 Å) luminosities that overlap with those of high-z Lyα emitters (LAEs) and Lyman break galaxies (LBGs), making LARS a valid comparison sample. We present the reduction steps used to obtain the Lyα images, including our LARS eXtraction software (LaXs), which utilizes pixel-by-pixel spectral synthesis fitting of the energy distribution to determine and subtract the continuum at Lyα. We demonstrate that the use of SBC long-pass-filter combinations increase the signal-to-noise ratio by an order of magnitude compared to the nominal Lyα filter available in SBC. To exemplify the science potential of LARS, we also present some first results for a single galaxy, Mrk 259 (LARS #1). This irregular galaxy shows bright and extended (indicative of resonance scattering) but strongly asymmetric Lyα emission. Spectroscopy from the Cosmic Origins Spectrograph on board HST centered on the brightest UV knot shows a moderate

  12. 17 CFR 259.206 - Form U-6B-2, for notification of security issues exempt under section 6(b) of the Act.

    Science.gov (United States)

    2010-04-01

    ... of security issues exempt under section 6(b) of the Act. 259.206 Section 259.206 Commodity and... security issues exempt under section 6(b) of the Act. This form shall be filed pursuant to section 6(b) of the Act as the certificate of notification of the issue, sale, renewal, or guaranty of securities...

  13. Residue 259 in protein-tyrosine phosphatase PTP1B and PTPα determines the flexibility of glutamine 262

    DEFF Research Database (Denmark)

    Peters, Günther H.j.; Iversen, L.F.; Andersen, H.S.

    2004-01-01

    To study the flexibility of the substrate-binding site and in particular of Gln262, we have performed adiabatic conformational search and molecular dynamics simulations on the crystal structure of the catalytic domain of wild-type protein-tyrosine phosphatase (PTP) 1B, a mutant PTP1B(R47V),(D48N...... and second step of the phosphate hydrolysis. Analyses of the trajectories revealed that in the cysteine-phosphor complex of PTP1B, Gln262 oscillates freely between the bound phosphate group and Gly259 frequently forming, as observed in the crystal structure, a hydrogen bond with the backbone oxygen of Gly259...... around Gln262 and the active site Cys215 reveals that the probability of finding a water molecule correctly positioned for catalysis is much larger in PTP1B than in PTP1B(R47V),(D48N),(M258C),(G259Q) and PTPalpha, in accordance with experiments....

  14. Fragrance material review on methyl-2,6,10-trimethylcyclododeca-2,5,9-trien-1-yl ketone.

    Science.gov (United States)

    Scognamiglio, J; Letizia, C S; Api, A M

    2013-12-01

    A toxicologic and dermatologic review of methyl 2,6,10-trimethylcyclododeca-2,5,9-trien-1-yl ketone when used as a fragrance ingredient is presented. Methyl 2,6,10-trimethylcyclododeca-2,5,9-trien-1-yl ketone is a member of the fragrance structural group Alkyl Cyclic Ketones. These fragrances can be described as being composed of an alkyl, R1, and various substituted and bicyclic saturated or unsaturated cyclic hydrocarbons, R2, in which one of the rings may include up to 12 carbons. Alternatively, R2 may be a carbon bridge of C2-C4 carbon chain length between the ketone and cyclic hydrocarbon. This review contains a detailed summary of all available toxicology and dermatology papers that are related to this individual fragrance ingredient and is not intended as a stand-alone document. Available data for methyl 2,6,10-trimethylcyclododeca-2,5,9-trien-1-yl ketone were evaluated then summarized and includes physical properties, acute toxicity, skin irritation, mucous membrane (eye) irritation, skin sensitization, repeated dose, and genotoxicity data. A safety assessment of the entire Alkyl Cyclic Ketones will be published simultaneously with this document; please refer to Belsito et al. (Belsito, D., Bickers, D., Bruze, M., Calow, P., Dagli, M., Fryer, A.D., Greim, H., Miyachi, Y., Saurat, J.H., Sipes, I.G., 2013. A Toxicologic and Dermatologic Assessment of Alkyl Cyclic Ketones When Used as Fragrance Ingredients (submitted for publication)) for an overall assessment of the safe use of this material and all Alkyl Cyclic Ketones in fragrances. Copyright © 2013 Elsevier Ltd. All rights reserved.

  15. The discovery of 260Md and the decay properties of 258Fm, 258m,gMd and 259Md

    International Nuclear Information System (INIS)

    Lougheed, R.W.; Hulet, E.K.; Dougan, R.J.; Wild, J.F.; Dupzyk, R.J.; Henderson, C.M.; Moody, K.J.; Hahn, R.L.; Suemmerer, K.; Bethune, G.

    1986-01-01

    We have discovered a new neutron-rich isotope, 260 Md, from 18 O and 22 Ne bombardments of 254 Es. We observed a spontaneous-fission (SF) activity with a half-life of 32 days in electromagnetically separated fractions with mass number 260 from these bombardments and we measured the mass and kinetic energy distributions of this SF activity. The mass distribution was symmetric with the principal energy peak at a total kinetic energy (TKE) of 234 MeV, similar to previous observations for heavy fermium isotopes. Surprisingly, we also observed a smaller symmetric component with a TKE of 195 MeV. We interpret these two peaks in the TKE distribution as arising from two types of fission in the same nucleus, or bimodal fission. The observed fission activity may be either from the SF decay of 260 Md or from 260 Fm which would arise from electron-capture (EC) decay of 260 Md. We have eliminated the possible β - decay of 260 Md by measuring β - -SF time correlations for the decay of 260 Md and we plan to determine whether 260 Md decays by EC by measuring time correlations between fermium X-rays and SF events. We also measured various properties of the heavy fermium and mendelevium isotopes and obtained 1. more accurate cross-sections for the neutron-rich mendelevium isotopes which we use to predict the production rates of yet undiscovered nuclides, 2. improved half-life measurements for 258m,g Md and 259 Md, 3. confirmation of the EC decay of 258m Md by measurement of the fermium X-rays preceding the SF decay of 258 Fm and 4. very substantially improved mass and TKE distributions for the SF decay of 258 Fm and 259 Md. (orig.)

  16. Opposing effects of cAMP and T259 phosphorylation on plasma membrane diffusion of the water channel aquaporin-5 in Madin-Darby canine kidney cells

    DEFF Research Database (Denmark)

    Koffman, Jennifer Skaarup; Christensen, Eva Arnspang; Marlar, Saw

    2015-01-01

    Aquaporin-5 (AQP5) facilitates passive water transport in glandular epithelia in response to secretory stimuli via intracellular pathways involving calcium release, cAMP and protein kinase A (PKA). In epithelial plasma membranes, AQP5 may be acutely regulated to facilitate water transport...... in the plasma membrane diffusion coefficient of AQP5. We aimed to test the short-term regulatory effects of the above pathways, by measuring lateral diffusion of AQP5 and an AQP5 phospho-mutant, T259A, using k-space Image Correlation Spectroscopy of quantum dot- and EGFP-labeled AQP5. Elevated cAMP and PKA...... inhibition significantly decreased lateral diffusion of AQP5, whereas T259A mutation showed opposing effects; slowing diffusion without stimulation and increasing diffusion to basal levels after cAMP elevation. Thus, lateral diffusion of AQP5 is significantly regulated by cAMP, PKA, and T259 phosphorylation...

  17. Pages 259 - 267.pmd

    African Journals Online (AJOL)

    Administrator

    Peltier CA, Omes C, Ndimubanzi PC et al. Validation of 2006 WHO Prediction Scores for. True HIV Infection in Children less than 18 months with a positive serological HIV test. PLoS ONE I www.plosone.org April 2009; 4. (4): I e5312. 28. Mayaux MJ, Burgard M, Teglas JP,et al. Neonatal characteristics in rapidly progressive ...

  18. Identification and evaluation of the probiotic potential of Lactobacillus paraplantarum FT259, a bacteriocinogenic strain isolated from Brazilian semi-hard artisanal cheese.

    Science.gov (United States)

    Tulini, Fabrício Luiz; Winkelströter, Lizziane Kretli; De Martinis, Elaine C P

    2013-08-01

    This study aimed to identify a bacteriocinogenic Lactobacillus isolate (FT259) obtained from Brazilian semi-hard Minas type cheese and to evaluate its probiotic and antimicrobial potentials. The strain was identified by biochemical tests (at genus level), and by 16S rDNA sequencing combined with recA gene amplification (for species). To determine the inhibitory spectrum towards food borne pathogens and lactic acid bacteria, the spot-on-the-lawn assay was carried out. Moreover, the proteinaceous nature of the antimicrobial compound produced was evaluated by susceptibility to degradation by proteolytic enzymes. The isolated strain was tested for survival in acidified culture media (pH 2.0, 2.5 and 3.5), in vitro tolerance to bile salts and viability under gastric conditions. Adhesion of Lactobacillus paraplantarum FT259 to Caco-2 cells was evaluated by surface plate count on De Man, Rogosa, and Sharpe (MRS) agar and also by FISH method (fluorescent in situ hybridization) with the aid of Eub338 probe for fluorescence microscopy analysis. The isolate was identified as L. paraplantarum FT259 and it produced bacteriocins that inhibited the growth of Listeria monocytogenes, Listeria innocua and several lactic acid bacteria. It was also observed that L. paraplantarum FT259 tolerated exposure to pH 3.5, and bile salts 0.3% for up to 180 min. In experiments with simulated gastric juice, viable cells of L. paraplantarum FT259 decreased from 8.6 log CFU/mL to 3.5 log CFU/mL after 180 min. For the same strain, in studies with Caco-2 cells, 74% of adhesion was observed through plate count and FISH assays. It was also demonstrated isolated FT259 was susceptible to the majority the antibiotics tested. Overall, the results indicated L. paraplantarum FT259 is a potential probiotic and the production of bacteriocin may be an interesting feature for food applications. Copyright © 2013 Elsevier Ltd. All rights reserved.

  19. Function of RSKS-1-AAK-2-DAF-16 signaling cascade in enhancing toxicity of multi-walled carbon nanotubes can be suppressed by mir-259 activation in Caenorhabditis elegans

    Science.gov (United States)

    Zhuang, Ziheng; Li, Min; Liu, Hui; Luo, Libo; Gu, Weidong; Wu, Qiuli; Wang, Dayong

    2016-08-01

    Caenorhabditis elegans is an important non-mammalian alternative assay model for toxicological study. Previous study has indicated that exposure to multi-walled carbon nanotubes (MWCNTs) dysregulated the transcriptional expression of mir-259. In this study, we examined the molecular basis for mir-259 in regulating MWCNTs toxicity in nematodes. Mutation of mir-259 induced a susceptible property to MWCNTs toxicity, and MWCNTs exposure induced a significant increase in mir-259::GFP in pharyngeal/intestinal valve and reproductive tract, implying that mir-259 might mediate a protection mechanisms for nematodes against MWCNTs toxicity. RSKS-1, a putative ribosomal protein S6 kinase, acted as the target for mir-259 in regulating MWCNTs toxicity, and mutation of rsks-1 suppressed the susceptible property of mir-259 mutant to MWCNTs toxicity. Moreover, mir-259 functioned in pharynx-intestinal valve and RSKS-1 functioned in pharynx to regulate MWCNTs toxicity. Furthermore, RSKS-1 regulated MWCNTs toxicity by suppressing the function of AAK-2-DAF-16 signaling cascade. Our results will strengthen our understanding the microRNAs mediated protection mechanisms for animals against the toxicity from certain nanomaterials.

  20. Prospective multicenter observational study of 260 infants born to 259 opiate-dependent mothers on methadone or high-dose buprenophine substitution.

    Science.gov (United States)

    Lejeune, Claude; Simmat-Durand, Laurence; Gourarier, Laurent; Aubisson, Sandrine

    2006-05-20

    Specialized prenatal care and substitution programs improve the perinatal prognoses of pregnant drug-abusers and their infants. Although methadone is well documented, little is known about high-dose buprenorphine (HDB). This prospective, multicenter (n = 35) observational study included 259 women on maintenance during pregnancy: 39% on methadone and 61% on HDB. Major findings were: 46% of them received good prenatal care; 62% had peridural analgesia; 12.3% delivered prematurely (hydrochloride. No baby died. Newborns were discharged with their mothers (96%) or placed in foster care (4%). Comparing methadone with HDB, respectively, mean age at the maximum Lipsitz score was 81 h versus 66 h (P = 0.066). The perinatal medical and social prognoses for these 259 drug addicts and their infants appeared to be improved by specialized prenatal care and was similar for methadone or BHD substitution during pregnancy.

  1. 40 CFR 264.259 - Special requirements for hazardous wastes FO20, FO21, FO22, FO23, FO26, and FO27.

    Science.gov (United States)

    2010-07-01

    ... HAZARDOUS WASTE TREATMENT, STORAGE, AND DISPOSAL FACILITIES Waste Piles § 264.259 Special requirements for hazardous wastes FO20, FO21, FO22, FO23, FO26, and FO27. (a) Hazardous Wastes FO20, FO21, FO22, FO23, FO26... requirements are necessary for piles managing hazardous wastes FO20, FO21, FO22, FO23, FO26, and FO27 in order...

  2. Non-LTE analysis of extremely helium-rich stars. The hot sdO stars LSE 153, 259 and 263

    Science.gov (United States)

    Husfeld, D.; Butler, K.; Heber, U.; Drilling, J. S.

    1989-01-01

    Results of a non-LTE fine analysis based mainly on high-resolution CASPEC spectra for three extremely helium-rich sdO stars are discussed in order to explain hydrogen deficiency in single stars. High temperature (Teff = 70,000 to 75,000 K) and a position in the log Teff - log g diagram were found close to the Eddington limit. Various abundance estimates are derived for hydrogen (upper limits only), carbon, nitrogen, and magnesium. Hydrogen is reduced to less than 10 percent by number in LSE 153 and LSE 263, and to less than 5 percent in LSE 259. The hydrogen deficiency is accompanied by nitrogen- and carbon-enrichment in LSE 153 and LSE 259 only. In LSE 263, carbon is depleted by about 1 dex. Stellar masses obtained by assuming that a core mass-luminosity relation holds for these stars, were found to be in the range 0.6-0.9 solar mass, yielding luminosities log L/L:solar = 3.7-4.5. Two of the program stars (LSE 153 and 259) appear to be possible successors of the R CrB and helium B stars, whereas the third star (LSE 263) displays a much lower carbon content in its photosphere making it an exceptional case among the known hydrogen deficient stars.

  3. Phosphorylation of the norepinephrine transporter at threonine 258 and serine 259 is linked to protein kinase C-mediated transporter internalization

    DEFF Research Database (Denmark)

    Jayanthi, Lankupalle D; Annamalai, Balasubramaniam; Samuvel, Devadoss J

    2006-01-01

    . Most interestingly, the plasma membrane insertion of the WT-hNET and hNET double mutant were not affected by beta-PMA. Although the WT-hNET showed increased endocytosis and redistribution from caveolin-rich plasma membrane domains following beta-PMA treatment, the hNET double mutant was completely......-regulation. These results suggest that Thr-258 and Ser-259 serve as a PKC-specific phospho-acceptor site and that phosphorylation of this motif is linked to PKC-induced NET internalization....

  4. Low-energy fission systematics of the fermium isotopes: the transition from mass asymmetry at fermium-254 to symmetry at fermium-259

    International Nuclear Information System (INIS)

    Hoffman, D.C.

    1976-01-01

    Recent measurements have shown that 259 Fm gives the highest total kinetic energy release and the most symmetric mass division so far observed for spontaneous fission. These results continue the trends observed previously in the fermium isotopes toward higher total kinetic energies and more symmetric mass division with increasing mass of the fermium isotopes. The transition from asymmetric mass division ( 254 Fm) to highly favored symmetric mass division ( 259 Fm) now appears to have been completed. These features are consistent with the simple postulate that the more neutron-rich fermium isotopes show an increase in the yield of symmetric fragments and in the total kinetic energy because symmetric mass division of fermium (Z = 100) nuclei results in two fragments which have the magic proton number of 50 and are close to the magic neutron number of 82. The proximity of the fragments to the doubly magic configuration seems to have a profound effect on the mass division and total kinetic energy release in fission

  5. The Reactivations of Main-Belt Comets 238P/READ, 259P/Garradd, and 288P/(300163) 2006 VW139

    Science.gov (United States)

    Hsieh, Henry H.; Ishiguro, Masateru; Kim, Yoonyoung; Knight, Matthew M.; Lin, Zhong-Yi; Micheli, Marco; Moskovitz, Nicholas; Sheppard, Scott S.; Thirouin, Audrey; Trujillo, Chadwick

    2017-10-01

    We report on the confirmation and monitoring of recurrent activity for main-belt comets (MBCs) 238P/Read and 288P/(300163) 2006 VW139 in 2016 (cf. Agarwal et al. 2016, CBET 4306; Hsieh et al. 2016, CBET 4307), as well as the identification of activity for 288P in Sloan Digital Sky Survey images from November 2000. We will also report on the confirmation of recurrent activity in 2017 (Hsieh et al. 2017, CBET 4388) and the progress of the ongoing monitoring campaign (April 2017 through December 2017) that we are conducting for MBC 259P/Garradd. With these observations, 238P and 288P have now each been observed to be active on three separate orbit passages with intervening periods of inactivity and 259P has been observed to be active on two separate orbit passages, firmly establishing the cometary (i.e., sublimation-driven) nature of their activity. We are currently conducting a multi-facility observing campaign to monitor the photometric and morphological evolution of these objects, using the Canada-France-Hawaii Telescope, the Gemini North and South telescopes (under a Gemini Large and Long Program), the Magellan telescopes, the Discovery Channel Telescope, and the Lulin One-meter Telescope. During their most recent perihelion encounters, 238P was observed to be active as early as 2016 July 8 at a true anomaly of 329 degrees, 288P was observed to be active as early as 2016 June 8 at a true anomaly of 318 degrees, and 259P was observed to be active as early at 2017 April 26 at a true anomaly of 315 degrees. We also report on the results of numerical modeling analyses of the morphological evolution of all three objects aimed at assessing both the properties of their current active episodes and changes in activity strength from one epoch to the next to help constrain the active lifetimes of MBCs, a key parameter for inferring the total number of MBCs in the asteroid belt from survey results. This work was supported by the NASA Solar System Observations program under

  6. ONKALO pose experiment. Geophysical logging and imaging of drillholes ONK-PP223, ONK-PP226, ONK-PP254 and ONK-PP259...261

    International Nuclear Information System (INIS)

    Tarvainen, A.-M.

    2011-08-01

    Suomen Malmi Oy conducted geophysical drillhole logging as well as optical and acoustic imaging of shallow drillholes ONK-PP223, ONK-PP226, ONK-PP254, ONKPP259, ONK-PP260 and ONK-PP261 at ONKALO in the investigation niche ONKTKU- 3 (POSE) between December 2009 and June 2010. The survey is a part of Posiva Oy's detailed investigation program for the final disposal of spent nuclear fuel. The assignment included the field work and data processing. The report describes field operation, equipment as well as processing procedures and shows the obtained results and an analysis of their quality in the appendices. The raw and processed data are delivered digitally in WellCAD, PDF and Excel format. (orig.)

  7. 259 Patients with DCIS of the breast applying USC/Van Nuys prognostic index: a retrospective review with long term follow up.

    Science.gov (United States)

    Di Saverio, Salomone; Catena, Fausto; Santini, Donatella; Ansaloni, Luca; Fogacci, Tommaso; Mignani, Stefano; Leone, Antonio; Gazzotti, Filippo; Gagliardi, Stefano; De Cataldis, Angelo; Taffurelli, Mario

    2008-06-01

    The Van Nuys Prognostic Index (VNPI) is a simple score for predicting the risk of local recurrence (LR) in patients with Ductal Carcinoma In Situ (DCIS) conservatively treated. This score combines three independent predictors of Local Recurrence. The VNPI has recently been updated with the addition of age as a fourth parameter into the scoring system (University of Southern California/ VNPI). Our database consisted of 408 women with DCIS. Applying the USC/VNPI we reviewed retrospectively 259 patients who were treated with breast conserving surgery with or without radiotherapy (RT). Of these patients 63.5% had a low VNPI score, 32% intermediate and 4.5% a high score. In the low score group, the majority of the patients underwent Conservative Surgery (CS) without RT while in the intermediate group, almost half of the patients received RT. Eighty-three percent (83%) of the patients with high VNPI were treated with Conservative Surgery plus RT. Nodal assessment by Sentinel Lymph Node Biopsy was obtained in 32 patients since 2002. Twenty-one Local Recurrences were observed (8%) with a mean follow up of 130 months: sixteen were invasive. No statistically significant differences in Disease Free Survival were reached in all groups of VNPI score between patients treated with Conservative Surgery or Conservative Surgery plus RT. However it was noted that the higher the VNPI score, the lower was the risk of local recurrence in the group treated additionally with RT, even though it was not statistically significant. Further analysis included those patients treated with Conservative Surgery alone and followed up. Disease-free survival (DFS) at 10 years was 94% with low VNPI and 83% in both intermediate and high score (P USC/VNPI is still a simple and reliable scoring system for therapeutic management of DCIS. We did not find any statistically significant advantage in groups treated with the addition of RT. Obtaining wide surgical margins appears to be the strongest prognostic

  8. Assessment of the short-term safety and tolerability of a quantified 80 % ethanol extract from the stem bark of Nauclea pobeguinii (PR 259 CT1) in healthy volunteers: a clinical phase I study.

    Science.gov (United States)

    Mesia, Kahunu; Cimanga, Kanyanga; Tona, Lutete; Mampunza, Ma Miezi; Ntamabyaliro, Nsengi; Muanda, Tsobo; Muyembe, Tamfum; Totté, Jozef; Mets, Tony; Pieters, Luc; Vlietinck, Arnold

    2011-01-01

    The aim of this study was to evaluate the short-term safety and tolerability of an antimalarial herbal medicinal product (PR 259 CT1) consisting of a quantified 80 % ethanol extract from the stem bark of Nauclea pobeguinii when given orally to healthy adult male volunteers. The amount of the major alkaloid strictosamide in the extract was determined by a validated HPLC method and was shown to be 5.6 %. The herbal preparation was formulated in a gelatine capsule form containing 500 mg of PCR 259 CT1. A sample of 15 healthy male volunteers, selected using the Lot Quality Assurance of Sampling (LQAS) method, was eligible for inclusion after fulfillment of the inclusion criteria and clinical examination by a physician. The volunteers were treated in an outpatient clinic with a drug regimen of two 500 mg capsules three times daily (each eight hours) for seven days, during meals. Safety and tolerability were monitored clinically, haematologically, biochemically and by electrocardiographic (ECG) examination at days 0, 1, 3, 7 and 14. Adverse effects were recorded by self-reporting of the participants or by detection of abnormalities in clinical examinations by a physician. The oral administration of PR 259 CT1 at high doses of 2 × 500 mg/capsule/day for 7 days was found to induce no significant changes in the concentration levels of all investigated haematological, biochemical, electrocardiogram and vital sign parameters and physical characteristics after 14 days of treatment compared to those seen in the baseline data. The concentration levels of all evaluated parameters were within the normal limits as reported in the literature. All adverse events noted were mild and self-resolving including increase of appetite (33 %), headache (20 %) and nausea (20 %). Other minor side effects were insomnia, somnolence and asthenia (7 %). Thus, PR 259 CT1 presented a significant safety and tolerability in healthy volunteers to allow its further development by starting a phase II

  9. Jacobo-Velázquez, D.A and Cisneros-Zevallos, L. An Alternative Use of Horticultural Crops: Stressed Plants as Biofactories of Bioactive Phenolic Compounds. Agriculture 2012, 2, 259-271

    Directory of Open Access Journals (Sweden)

    Luis Cisneros-Zevallos

    2013-09-01

    Full Text Available The authors are sorry to report that some data in the text (Section 2, Section 2.1.1. and Section 2.1.2 and Table 1 were incorrect in reference [1], doi: 10.3390/agriculture2030259, website: http://www.mdpi.com/2077-0472/2/3/259. Our mistake was basically in the calculations of changes observed in the reported values in those references; unfortunately we did not detect the errors at the time of publication. However, since we saw them afterwards, we believed it was pertinent to make the corrections. The authors would, therefore, like to make the following corrections to the paper:

  10. Chemical behaviour of a few atoms of rutherfordium (Rf, Z= 104) and of dubnium (Db, Z= 105) produced at Orsay

    International Nuclear Information System (INIS)

    Trubert, D.; Hussonnois, M.; Le Naour, C.; Brillard, L.; Monroy Guzman, F.; Le Du, J.F.; Servajean, V.

    1998-01-01

    The isotopes 261 Rf and 262 Db were produced by irradiation of a 248 Cm target with respectively 18 O and 19 F ions, at the MP Tandem accelerator of Orsay (France). These isotopes were isolated in HF medium, using he RACHEL setup. Moreover, the radioisotope 262 DB was produced by a nuclear reaction. (authors)

  11. Influence of relativistic effects on hydration and hydrolysis of rutherfordium, dubnium and some 6-th row element cations

    International Nuclear Information System (INIS)

    Bilewicz, A.; Siekierski, S.

    1999-01-01

    New evidence for the influence of relativistic effect on coordination number, (CN), and hydrolysis of Rf 4+ and Db 5+ aqua ions has been presented. It has been argued that very strong hydrolysis of the heaviest members of Groups 12, 13 is caused by the low CN of Hg 2+ and Tl 3+ in their aqua ions. Low CN is the result of relativistic effects which stabilize the 6s orbital, increasing thereby the respective promotion energy. That supports our previous view that strong hydrolysis of Rf aq 4+ much greater than that of Hf aq 4+ and Zr aq 4+ , is also a result of lower CN. Since the promotion energy for sp 3 d 4 hybridization (CN 8) seems to be close to that od sp 3 d 2 hybridization (CN 6), and since hybridization energies of Zr 4+ , Hf 4+ and Rf 4+ do not differ very much for hexa- and octahydrates the two aqua ions i.e., M(H 2 O) 6 4+ and M(H 2 O) 8 4+ may coexist in aqueous acid solutions. However, due to relativistic stabilization of 7s and destabilization of 6s orbitals, which increases promotion energy, the Rf 4+ aqua cation should show coordination number 6 rather than 8. A shift of equilibrium toward a lower hydrate increases the tendency to hydrolyse. (author)

  12. Chemical Identification of Dubnium as a Decay Product of Element 115 Produced in the Reaction $\\rm {^{48}Ca}+{^{243}Am}$

    CERN Document Server

    Dmitriev, S N; Utyonkov, V K; Shishkin, S V; Eremin, A V; Lobanov, Yu V; Chepigin, V I; Sokol, E A; Tsyganov, Yu S; Vostokin, G K; Aksenov, N V; Hussonnois, M; Itkis, M G; Aggeler, H W; Schumann, D; Bruchertseifer, H; Eichler, R; Shaughnessy, D A; Wilk, P A; Kenneally, J M; Stoyer, M A; Wild, J F

    2004-01-01

    The results of an experiment designed to identify $^{268}$Db as the terminal isotope in the $\\alpha $-decay chain of element 115 produced via the ${\\rm {^{243}Am}}({\\rm {^{48}Ca}},3n){\\rm {^{288}115}}$ reaction are presented. The $^{243}$Am target was bombarded with a beam dose of $3.4\\cdot 10^{18}$ $^{48}$Ca projectiles at an energy of 247 MeV at the center of the target. The reaction products were collected in the surface layer of a copper catcher block, which was removed with a lathe and then dissolved in concentrated HNO$_{3}$. The group-5 elements were separated by sorption onto Dowex $50{\\times} 8$ cation-exchange resin with subsequent desorption using 1 M HF, which forms anionic fluoride complexes of group-5 elements. The eluent was evaporated onto a 0.4 $\\mu$m thick polyethylene foil that was placed between a pair of semiconductor detectors surrounded by $^{3}$He neutron counters for measurement of $\\alpha$ particles, fission fragments, and neutrons. In the course of the experiment, we observed 15 spo...

  13. Publications | Page 259 | IDRC - International Development ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Use this search tool to locate a specific publication for your field of research. ... from a local treatment plant is being used for supplemental irrigation of cereal crops, ... generation of water leaders" (NGWL) by the International Water Resources.

  14. Publications | Page 259 | IDRC - International Development ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    South Africa has developed considerable expertise in mining and mining ... Exporters incur search costs in identifying a suitable agreement, each with its own ... The prevailing view is that Chinese companies operating in African countries do ...

  15. 39 CFR 259.2 - Red Cross.

    Science.gov (United States)

    2010-07-01

    ... each other, as follows: (1) The Red Cross will use Form 3575, Change of Address Order, as a standard... disaster relief efforts, the Postal Service will establish a separate file of change of address forms... and complete the forms, it will distribute the forms to disaster victims who need them, and it will...

  16. 50 CFR 259.38 - Miscellaneous.

    Science.gov (United States)

    2010-10-01

    ....38 Miscellaneous. (a) Wherever the Secretary prescribes time constraints herein for the submission of... actual date of submission. All required materials may be submitted to any Financial Assistance Division office of the National Marine Fisheries Service. (b) All CCF information received by the Secretary shall...

  17. 50 CFR 259.32 - Conditional fisheries.

    Science.gov (United States)

    2010-10-01

    ... extends to past, present, and future withdrawals in an amount representing up to 100 percent of the cost... causes (within 1 year after the delivery of vessel “Y”) to be permanently removed from all fishing, or... question at the time vessel “Z” was constructed (or, if constructed for a different fishery, the average...

  18. 10 CFR 25.9 - Communications.

    Science.gov (United States)

    2010-01-01

    ... Director, Division of Facilities and Security, Mail Stop T7-D57, and sent either by mail to the U.S... Rockville Pike, Rockville, Maryland; or, where practicable, by electronic submission, for example, Electronic Information Exchange, or CD-ROM. Electronic submissions must be made in a manner that enables the...

  19. Correction: β-Amyrin synthase from Euphorbia tirucalli L. functional analyses of the highly conserved aromatic residues Phe413, Tyr259 and Trp257 disclose the importance of the appropriate steric bulk, and cation-π and CH-π interactions for the efficient catalytic action of the polyolefin cyclization cascade.

    Science.gov (United States)

    Ito, Ryousuke; Nakada, Chika; Hoshino, Tsutomu

    2017-01-18

    Correction for 'β-Amyrin synthase from Euphorbia tirucalli L. functional analyses of the highly conserved aromatic residues Phe413, Tyr259 and Trp257 disclose the importance of the appropriate steric bulk, and cation-π and CH-π interactions for the efficient catalytic action of the polyolefin cyclization cascade' by Ryousuke Ito et al., Org. Biomol. Chem., 2017, 15, 177-188.

  20. Dicty_cDB: AFO259 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available skdfnyililnk*tnkkknkkwmxkmfkl*llimvqvcvklvllvmmlhvlfshqll vvqdtlxlwlvwvkrihmsxmklnqkevf*hlsiqlnmvlspigmiwkks...nk*tnkkknkkwmxkmfkl*llimvqvcvklvllvmmlhvlfshqll vvqdtlxlwlvwvkrihmsxmklnqkevf*hlsiqlnmvlspigmiwkksgiilfimnfx

  1. 40 CFR 180.259 - Propargite; tolerances for residues.

    Science.gov (United States)

    2010-07-01

    ..., meat 0.1 Hog, meat byproducts 0.1 Hop, dried cones 100.0 Horse, fat 0.1 Horse, meat 0.1 Horse, meat... Cattle, fat 0.1 Cattle, meat 0.1 Cattle, meat byproducts 0.1 Citrus, oil 30.0 Corn, field, forage 10.0..., forage 10.0 Corn, sweet, stover 10.0 Cotton, undelinted seed 0.1 Egg 0.1 Goat, fat 0.1 Goat, meat 0.1...

  2. Dicty_cDB: CFE259 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available *fqstssrcfl*ndcrei*fnk r*nr*ilw*isrisr*--- ---**r*ryscssrl*ekcql*kppfkpngkisaanasqisdgasavllvsgrlvkklgl kprarivtctvvgsdpeymllgpipatik...aleksgltkdqidlyeineafasvvlgwkke lnidldkinpnggaiahghplgatgcilmtkmvnelersnkkyalqtmcig

  3. 24 CFR 960.259 - Family information and verification.

    Science.gov (United States)

    2010-04-01

    ... source of income, or any Federal, State or local agency, to furnish or release to the PHA or HUD such...) Other factors that affect the determination of adjusted income or income-based rent. ... scheduled reexamination or an interim reexamination of family income and composition in accordance with HUD...

  4. 1935 15' Quad #259 Aerial Photo Mosaic Index

    Data.gov (United States)

    Earth Data Analysis Center, University of New Mexico — Aerial Photo Reference Mosaics contain aerial photographs that are retrievable on a frame by frame basis. The inventory contains imagery from various sources that...

  5. All projects related to | Page 259 | IDRC - International Development ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    2011-10-20

    Project. Different countries are at different stages of demographic change. Start Date: October 20, 2011. End Date: April 20, 2014. Topic: INTERNATIONAL FINANCE, INTERNATIONAL FINANCIAL MARKET, FINANCIAL POLICY, DEMOGRAPHY, DEMOGRAPHIC CHANGE, DEMOGRAPHIC TRANSITION. Region: Brazil ...

  6. 30 CFR 206.259 - Determination of washing allowances.

    Science.gov (United States)

    2010-07-01

    ... market the production for the mutual benefit of the lessee and the lessor, then MMS shall require that... reported period, including operating and maintenance expenses, overhead, and either depreciation and a... other alternative without approval of the MMS. (A) To compute depreciation, the lessee may elect to use...

  7. 24 CFR 203.259 - Method of payment of MIP.

    Science.gov (United States)

    2010-04-01

    ... URBAN DEVELOPMENT MORTGAGE AND LOAN INSURANCE PROGRAMS UNDER NATIONAL HOUSING ACT AND OTHER AUTHORITIES SINGLE FAMILY MORTGAGE INSURANCE Contract Rights and Obligations Mortgage Insurance Premiums-in General...

  8. Etiology of bacterial meningitis among children aged 2-59 months in Salvador, Northeast Brazil, before and after routine use of Haemophilus influenzae type b vaccine Etiologia da meningite bacteriana em crianças com idade entre 2 e 59 meses em Salvador, Nordeste do Brasil, antes e depois do uso rotineiro da vacina para Haemophilus influenzae tipo b

    Directory of Open Access Journals (Sweden)

    Cristiana M. Nascimento-Carvalho

    2004-06-01

    Full Text Available OBJECTIVE: To describe the frequency of etiologic agents of bacterial meningitis (BM among children aged 2-59 months in a sample of patients in Salvador, Northeast Brazil, with emphasis on the frequency of BM of unknown etiology (BMUE, just before, during and after the implementation of routine immunization of infants with Haemophilus influenzae type b (Hib vaccination. METHOD: Demographic, clinical and cerebrospinal fluid (CSF information was collected from the chart of every patient, aged 2-59 months, whose CSF exam was performed at the CSF Lab - José Silveira Foundation, between January 1989 and December 2001. Every CSF exam was completely performed according to standard methods. The etiologic diagnosis was based on either culture and/or latex-agglutination test. When the agent was only seen on Gram stained smear, the diagnosis was descriptive. BMUE was defined as: glucose 100 mg / dl, white blood cell count > 20 cells / mm³, percentage of neutrophils > 80%. RESULTS: Of 1519 patients, 894 (58.9% had normal exams and BM was diagnosed in 95 (6.2%. Etiologic agents were: Hib (44.2%, meningococcus (13.7%, Gram-negative bacilli (11.6%, Mycobacterium tuberculosis (6.3%, pneumococcus (4.2%, other agents (4.2%; BMUE was diagnosed in 15.8% of cases with BM. By analysing the frequency of BMUE and Hib among all exams performed yearly, the peaks were recorded in 1989 (5.3% and 1990 (16.9%, respectively, decreasing to 0.7% and 0% in 2001. CONCLUSION: It is possible that the implementation of the conjugate Hib vaccine during the 1990's has been decreasing not only the occurrence of Hib meningitis but also of BMUE.OBJETIVO: Descrever a freqüência dos agentes etiológicos de meningite bacteriana (MB em amostra das crianças com idade entre 2 e 59 meses, em Salvador, Nordeste do Brasil, com ênfase na freqüência de MB de etiologia indeterminada (MBEI, antes, durante e após a implementação da imunização rotineira de lactentes com vacina para

  9. 6 CFR 25.9 - Procedures for certification of approved products for Homeland Security.

    Science.gov (United States)

    2010-01-01

    ... Procedures for certification of approved products for Homeland Security. (a) Application Procedure. An applicant seeking a Certification of anti-terrorism Technology as an Approved Product for Homeland Security... application for renewal must be made using the “Application for Certification of an Approved Product for...

  10. Obesity, bariatric surgery and nutritional implications - doi:10.5020/18061230.2007.p259

    Directory of Open Access Journals (Sweden)

    Michele Novaes Ravelli

    2012-01-01

    Full Text Available Obesity is an important nutritional deviation that is exponentially increasing in Brazil and in the world, becoming a public health problem. The World Health Organization verified in 2005 that 1.6 billion people above 15 years old were overweight and 400 million were obese. Among children, 20 million were overweight. Amongst the different treatments for the obesity the bariatric surgery has been used very often nowadays, for being effective against weight excess and associated co-morbidities, both for the adult and youngster populations. The surgical techniques are divided in restrictive, disabsorptive and mixed procedures. Each technique promotes digestive and absorptive distinct alterations, needing, therefore, an exclusive multidisciplinary educational program, directed both to pre and postsurgery periods, emphasizing the habits of physical activity and the necessity to adhere to the restricted dietary recommendations. The surgeries promote a severe reduction in the consumption, which induces to the ingestion of diets that are hypocaloric and deficient in micronutrients, with consequent nutritional complications.

  11. SU-E-T-259: Development of a Primary Standard for LDR Brachytherapy

    Energy Technology Data Exchange (ETDEWEB)

    Shen, H; McEwen, M [National Research Council, Ottawa, ON (Canada)

    2015-06-15

    Purpose: The National Research Council initiated a program in 2012 to develop a primary standard to calibrate I-125 and Pd-103 sources used for LDR brachytherapy and disseminate this through calibration services to Canadian users. This will simplify procedures as Canadian cancer centres currently have to ship instruments to the US. Methods: The standard is based on a commercial version of the wide-angle free air chamber (WAFAC) pioneered by NIST. Significant enhancements were implemented to improve signal-to-noise and measurement reproducibility and eliminate electric field effects. Validation of this ionization chamber was then carried out in a low-energy X -ray beam (∼ 31 keV) where the dose rate had been previously established using the existing NRC primary standard free-air chamber. As a final component of this initial testing, measurements were made with a set of I-125 seeds (with air kerma strength traceable to NIST). Results: Excellent agreement of the two NRC free-air chambers was obtained within the combined standard uncertainty of 0.5 %. However, it was found that the WAFAC response is very sensitive to the beam geometry (distance from the source, diameter of the beam-defining aperture, etc) and Monte Carlo calculations, carried out to evaluate these geometry corrections, have confirmed the experimental results. The results for the seed measurements indicated a precision of better than 1 % is achievable for a reasonable acquisition time and the air kerma strength agreed with the manufacturer (NIST-traceable) value within 2 %. Conclusion: The prototype primary standard for LDR brachytherapy has met accuracy target of 3 % for the determination of air kerma strength. Work is ongoing to refine operation of the device and develop the calibration protocol for clinical users, with an anticipated launch of a calibration service in late 2015.

  12. : tous les projets | Page 259 | CRDI - Centre de recherches pour le ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Date de début : 6 mai 2011. End Date: 6 novembre 2013. Sujet: WOMEN'S PARTICIPATION, POLITICS, POLITICAL LEADERSHIP, WOMEN'S RIGHTS, GENDER EQUALITY. Région: Chile, South America, North and Central America, Argentina. Programme: Gouvernance et justice. Financement total : CA$ 210,900.00.

  13. People and things. CERN Courier Nov 1985, v. 25(9)

    International Nuclear Information System (INIS)

    Anon.

    1985-01-01

    The article reports on achievements of various people, staff changes and position opportunities within the CERN organization and contains news updates on upcoming or past events. The European Committee for Future Accelerators (ECFA) meets in plenary session twice a year. At the meeting at CERN earlier this year, ECFA Chariman Jean Sacton described the trend towards even greater internationalization of partide physics research and how arrangement have been completed to allow the exchange of observers between meetings of Plenary ECFA and the US High Energy Physics Advisory Panel (HEPAP). After the success of the ESO (European Southern Observatory) CERN Symposium on Cosmology, Astronomy and Fundamental Physics, held at CERN in November 1983, the second Symposium is to be held at ESO, Garching bei Munchen, West Germany, from 17 to 21 March next year

  14. 29 CFR 779.259 - What is included in annual gross volume.

    Science.gov (United States)

    2010-07-01

    ... requirements for exemption from the pay provisions of the Act under section 13(a)(2), does not exclude the... establishment is a part. (c) Likewise, where franchise or other arrangements result in the creation of a larger... integral part of the related activities of the enterprise which grants the franchise, right, or concession...

  15. SU-E-J-259: Quantification of Rotational Localization Offset in Radiation Therapy

    International Nuclear Information System (INIS)

    Huang, Y; Nguyen, N; Lee, S; Liu, F

    2014-01-01

    Purpose: To verify the necessity of 6D localization detection and correction in radiation therapy. Methods: An anthropomorphic head and neck phantom was used to test the BrainLab ExacTrac x-ray imaging system. After initial positioning, both ExacTrac and the on-board kV CBCT were used to detect the offset at the same position, using both manual and automatic registration algorithms. Then 6D offset including rotational errors up to 5 degree were introduced. Both ExacTrac and CBCT were used to correct the offsets and the residual errors were evaluated. Finally, 6D offset detected by ExacTrac for a C-Spine patient was reported. Results: The differences in 3D offset detected by ExacTrac and CBCT were 1.5 ± 1.2(Lateral), 2.7 ± 2.7(Vertical), and 4.0 ± 6.3(longitudinal) mm with manual registration while the corresponding differences decreased to 0.6 ± 0.3, 1.0 ± 0.3, and 0.3 ± 0.3 when automatic registration were used. CBCT corrected the translational offset to within 0.5 mm but the rotational errors remained and detected by the ExacTrac system (Yaw=2.1, Roll=1.1, Pitch=1.4 degree). When similar offset was introduced and corrected using ExacTrac, the residual error detected by both CBCT and ExacTrac were within 0.5 mm / 0.5 degree. The average offset from the 112 ExacTrac x-ray corrections for the C-Spine patient was 0.6 ± 1.6 (lateral), 5.4 ± 8(vertical), 1.6±1.1(longitudinal) mm, and 0.7 ± 0.6 (pitch), 0.7 ± 0.4(roll), 1.2 ± 0.7 (yaw) degree. Larger rotational errors, with a maximum of 2.7 degree (corresponds to about 1.5 to 4.5 mm offset for a POI 10 to 30 cm away from the isocenter), were observed when couch rotational were involved. Conclusion: Rotational errors are common in patient localization, especially when couch rotation is involved. Both appropriate imaging system and 6D robotic couch are necessary to detect and correct the rotational localization errors

  16. People and things. CERN Courier Nov 1985, v. 25(9)

    Energy Technology Data Exchange (ETDEWEB)

    Anon.

    1985-11-15

    The article reports on achievements of various people, staff changes and position opportunities within the CERN organization and contains news updates on upcoming or past events. The European Committee for Future Accelerators (ECFA) meets in plenary session twice a year. At the meeting at CERN earlier this year, ECFA Chariman Jean Sacton described the trend towards even greater internationalization of partide physics research and how arrangement have been completed to allow the exchange of observers between meetings of Plenary ECFA and the US High Energy Physics Advisory Panel (HEPAP). After the success of the ESO (European Southern Observatory) CERN Symposium on Cosmology, Astronomy and Fundamental Physics, held at CERN in November 1983, the second Symposium is to be held at ESO, Garching bei Munchen, West Germany, from 17 to 21 March next year.

  17. 259 “Team Pair Solo” Cooperative Learning and Personality Type ...

    African Journals Online (AJOL)

    User

    learning strategy and students' personality type on achievement and attitude to Chemistry. 175 SS2 ... There is increasing concern among practitioners and educational researchers about the .... Teachers' role in a cooperative learning classroom involves a careful design of meaningful ..... Classroom Management. Harry K.

  18. Oral History Project: Advanced ESL Class, Local 259 U.A.W. 1985-86.

    Science.gov (United States)

    Colon, Maria, Comp.; And Others

    A class project undertaken in an English-as-a-Second-Language class is described and presented. Students participating in the project were union employees in a Manhattan electronics factory, and most were native Spanish speakers. The project's objective was to produce an illustrated book and tapes to document work and union experience in the…

  19. 50 CFR 259.34 - Minimum and maximum deposits; maximum time to deposit.

    Science.gov (United States)

    2010-10-01

    ... B objective. A time longer than 10 years, either by original scheduling or by subsequent extension... OCEANIC AND ATMOSPHERIC ADMINISTRATION, DEPARTMENT OF COMMERCE AID TO FISHERIES CAPITAL CONSTRUCTION FUND...) Minimum annual deposit. The minimum annual (based on each party's taxable year) deposit required by the...

  20. Risk factors of severe pneumonia among children aged 2-59 months ...

    African Journals Online (AJOL)

    Introduction Globally, pneumonia is the leading cause of death in children under the age of 5 years. In Kenya, it is the second leading cause of mortality, accounting for greater than 30,000 deaths in this age group annually. This study sought to identify risk factors for severe pneumonia in children under the age of five years.

  1. Changing picture of acute kidney injury in pregnancy: Study of 259 cases over a period of 33 years

    Directory of Open Access Journals (Sweden)

    J Prakash

    2016-01-01

    Full Text Available The incidence of acute kidney injury (AKI in pregnancy is declining in developing countries but still remains a major cause of maternal and fetal morbidity and mortality. The aim of the study was to analyze the changing trends in pregnancy related AKI (PR-AKI over a period of thirty-three years. Clinical characteristics of PR-AKI with respect to incidence, etiology and fetal and maternal outcomes were compared in three study periods, namely 1982-1991,1992-2002 and 2003-2014. The incidence of PR-AKI decreased to 10.4% in 1992-2002, from 15.2% in 1982-1991, with declining trend continuing in 2003-2014 (4.68%.Postabortal AKI decreased to 1.49% in 2003-2014 from 9.4% in 1982-1991of total AKI cases.The AKI related to puerperal sepsis increased to 1.56% of all AKI cases in 2003-2014 from 1.4% in 1982-1991. Preeclampsia/eclampsia associated AKI decreased from 3.5% of total AKI cases in 1982-1991 to 0.54% in 2003-2014. Pregnancy associated - thrombotic microangiopathy and acute fatty liver of pregnancy were uncommon causes of AKI. Hyperemesis gravidarum associated AKI was not observed in our study. Incidence of renal cortical necrosis (RCN decreased to 1.4% in 2003-2014 from 17% in 1982-1991.Maternal mortality reduced to 5.79% from initial high value 20% in 1982-1991. The progression of PR-AKI to ESRD decreased to1.4% in 2003-2014 from 6.15% in 1982-1991. The incidence of PR-AKI has decreased over last three decades, mainly due to decrease in incidence of postabortal AKI. Puerperal sepsis and obstetric hemorrhage were the major causes of PR-AKI followed by preeclampsia in late pregnancy. Maternal mortality and incidence and severity of RCN have significantly decreased in PR-AKI. The progression to CKD and ESRD has decreased in women with AKI in pregnancy in recent decade. However, the perinatal mortality did not change throughout study period.

  2. 50 CFR 259.30 - Application for Interim Capital Construction Fund Agreement (“Interim CCF Agreement”).

    Science.gov (United States)

    2010-10-01

    ... of the applicant's actual intentions. Vague or contingent objectives will not be acceptable. (b...-carrying capacity, age, length, type of fishing gear, number of passengers carried or in the case of...) General characteristics (i.e., net tonnage, fish-carrying capacity, age, length, type of fishing gear...

  3. ARL: A Bimonthly Report on Research Library Issues and Actions from ARL, CNI, and SPARC. Number 259

    Science.gov (United States)

    Barrett, G. Jaia, Ed.

    2008-01-01

    "ARL" is the bimonthly report on research library issues and actions from ARL (Association of Research Libraries), CNI (Coalition of Networked Information), and SPARC (Scholarly Publishing and Academic Resources Coalition). "ARL" reports on current issues of interest to academic and research library administrators, staff, and users; higher…

  4. SU-F-T-259: GPR Tables for the Estimation of Mid-Plane Dose Using EPID

    International Nuclear Information System (INIS)

    Annamalai, Gopiraj; Watanabe, Yoichi

    2016-01-01

    Purpose: To develop a simple method for estimating the mid-plane dose (MPD) of a patient using Electronic Portal imaging Device (EPID). Methods: A Varian TrueBeam with aSi100 EPID was used in this study. The EPID images were acquired for a 30 cm × 30 cm homogeneous slab phantom and a 30 cm diameter 20 cm thick cylindrical phantom in the continuous dosimetry mode. The acquired EPID images in XIM format were imported into in-house MATLAB program for the data analysis. First, the dosimetric characteristics of EPID were studied for dose-response linearity, dose-rate dependence, and field size dependence. Next, the average pixels values of the EPID images were correlated with the MPD measured by an ionisation chamber for various thicknesses of the slab phantom (8 cm – 30 cm) and for various square field sizes (3×3 cm 2 – 25×25 cm 2 at the isocenter). Look-up tables called as GPR tables were then generated for both SSD and SAD setup by taking the ratio of MPD measured by the ionisation chamber and the corresponding EPID pixel values. The accuracy of the GPR tables was evaluated by varying the field size, phantom thickness, and wedge angles with the slab and cylindrical phantoms. Results: The dose response of EPID was linear from 20 MU to 300 MU. The EPID response for different dose rates from 40 MU/min to 600 MU/min was within ±1%. The difference in the doses from the GPR tables and the doses measured by the ionization chambers were within 2% for slab phantoms, and 3% for the cylindrical phantom for various field sizes, phantom thickness, and wedge angles. Conclusion: GPR tables are a ready reckoner for in-vivo dosimetry and it can be used to quickly estimate the MPD value from the EPID images with an accuracy of ±3% for common clinical treatment. project work funded by Union for International cancer control(UICC) under ICRETT fellowship

  5. Formative Assessment and Elementary School Student Academic Achievement: A Review of the Evidence. REL 2017-259

    Science.gov (United States)

    Klute, Mary; Apthorp, Helen; Harlacher, Jason; Reale, Marianne

    2017-01-01

    Formative assessment is a process that engages teachers and students in gathering, interpreting, and using evidence about what and how students are learning in order to facilitate further student learning during a short period of time. The process offers the potential to guide educator decisions about midstream adjustments to instruction that…

  6. SU-E-T-259: Particle Swarm Optimization in Radial Dose Function Fitting for a Novel Iodine-125 Seed

    Energy Technology Data Exchange (ETDEWEB)

    Wu, X [University of Alabama at Birmingham, Birmingham, Al (United States); Duan, J; Popple, R; Huang, M; Shen, S; Brezovich, I [University of Alabama Birmingham, Birmingham, AL (United States); Cardan, R [UAB University of Alabama, Birmingham, Birmingham, AL (United States); Benhabib, S [University of Alabama at Birmingham, Birmingham, AL (United States)

    2014-06-01

    Purpose: To determine the coefficients of bi- and tri-exponential functions for the best fit of radial dose functions of the new iodine brachytherapy source: Iodine-125 Seed AgX-100. Methods: The particle swarm optimization (PSO) method was used to search for the coefficients of the biand tri-exponential functions that yield the best fit to data published for a few selected radial distances from the source. The coefficients were encoded into particles, and these particles move through the search space by following their local and global best-known positions. In each generation, particles were evaluated through their fitness function and their positions were changed through their velocities. This procedure was repeated until the convergence criterion was met or the maximum generation was reached. All best particles were found in less than 1,500 generations. Results: For the I-125 seed AgX-100 considered as a point source, the maximum deviation from the published data is less than 2.9% for bi-exponential fitting function and 0.2% for tri-exponential fitting function. For its line source, the maximum deviation is less than 1.1% for bi-exponential fitting function and 0.08% for tri-exponential fitting function. Conclusion: PSO is a powerful method in searching coefficients for bi-exponential and tri-exponential fitting functions. The bi- and tri-exponential models of Iodine-125 seed AgX-100 point and line sources obtained with PSO optimization provide accurate analytical forms of the radial dose function. The tri-exponential fitting function is more accurate than the bi-exponential function.

  7. SU-F-T-259: GPR Tables for the Estimation of Mid-Plane Dose Using EPID

    Energy Technology Data Exchange (ETDEWEB)

    Annamalai, Gopiraj [Government Arignar Anna Memorial Cancer Hospital & Research Institute, Kanchipuram, TAMILNADU (India); Watanabe, Yoichi [University of Minnesota, Minneapolis, MN (United States)

    2016-06-15

    Purpose: To develop a simple method for estimating the mid-plane dose (MPD) of a patient using Electronic Portal imaging Device (EPID). Methods: A Varian TrueBeam with aSi100 EPID was used in this study. The EPID images were acquired for a 30 cm × 30 cm homogeneous slab phantom and a 30 cm diameter 20 cm thick cylindrical phantom in the continuous dosimetry mode. The acquired EPID images in XIM format were imported into in-house MATLAB program for the data analysis. First, the dosimetric characteristics of EPID were studied for dose-response linearity, dose-rate dependence, and field size dependence. Next, the average pixels values of the EPID images were correlated with the MPD measured by an ionisation chamber for various thicknesses of the slab phantom (8 cm – 30 cm) and for various square field sizes (3×3 cm{sup 2} – 25×25 cm{sup 2} at the isocenter). Look-up tables called as GPR tables were then generated for both SSD and SAD setup by taking the ratio of MPD measured by the ionisation chamber and the corresponding EPID pixel values. The accuracy of the GPR tables was evaluated by varying the field size, phantom thickness, and wedge angles with the slab and cylindrical phantoms. Results: The dose response of EPID was linear from 20 MU to 300 MU. The EPID response for different dose rates from 40 MU/min to 600 MU/min was within ±1%. The difference in the doses from the GPR tables and the doses measured by the ionization chambers were within 2% for slab phantoms, and 3% for the cylindrical phantom for various field sizes, phantom thickness, and wedge angles. Conclusion: GPR tables are a ready reckoner for in-vivo dosimetry and it can be used to quickly estimate the MPD value from the EPID images with an accuracy of ±3% for common clinical treatment. project work funded by Union for International cancer control(UICC) under ICRETT fellowship.

  8. Nuclear envelope alterations in fibroblasts from LGMD1B patients carrying nonsense Y259X heterozygous or homozygous mutation in lamin A/C gene.

    NARCIS (Netherlands)

    Muchir, A.; Engelen, B.G.M. van; Lammens, M.M.Y.; Mislow, J.M.; McNally, E.; Schwartz, K.; Bonne, G.

    2003-01-01

    Mutations in the LMNA gene encoding nuclear lamins A and C are responsible for seven inherited disorders affecting specific tissues. We have analyzed skin fibroblasts from a patient with type 1B limb-girdle muscular dystrophy and from her deceased newborn grandchild carrying, respectively, a

  9. 47 CFR 90.259 - Assignment and use of frequencies in the bands 216-220 MHz and 1427-1432 MHz.

    Science.gov (United States)

    2010-10-01

    ... MHz band are secondary to the Wireless Medical Telemetry Service except in the locations specified in... operations are secondary to the Wireless Medical Telemetry Service in the 1429-1431.5 MHz band. (3) All... 47 Telecommunication 5 2010-10-01 2010-10-01 false Assignment and use of frequencies in the bands...

  10. Digital Humanitarians: How Big Data Is Changing the Face of Humanitarian Response : Patrick Meier, 2015, CRC Press (Boca Raton, FL, 978-1-4822-4839-5, 259 pp.).

    Science.gov (United States)

    Dave, Anushree

    2017-12-01

    This is a review of Patrick Meier's 2015 book, Digital Humanitarians: How Big Data Is Changing the Face of Humanitarian Response. The book explores the role of technologies such as high-resolution satellite imagery, online social media, drones, and artificial intelligence in humanitarian responses during disasters such as the 2010 Haiti earthquake. In this analysis, the book is examined using a humanitarian health ethics perspective.

  11. Multibeam collection for TN259: Multibeam data collected aboard Thomas G. Thompson from 2010-11-23 to 2010-12-22, Seattle, WA to Honolulu, HI

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — This data set is part of a larger set of data called the Multibeam Bathymetry Database (MBBDB) where other similar data can be found at...

  12. Corrigendum to "A mixture-energy-consistent six-equation two-phase numerical model for fluids with interfaces, cavitation and evaporation waves" [J. Comput. Phys. 259 (2014) 331-357

    Science.gov (United States)

    Pelanti, Marica; Shyue, Keh-Ming

    2015-05-01

    The authors regret that one erroneous plot of the numerical results for a dodecane liquid-vapor shock tube problem was included in Fig. 3, p. 346, of the article [1]. Specifically, the graph of the vapor-liquid temperature difference (Tv -Tl) displayed at the bottom-right corner of Fig. 3 in [1] is not correct due to some wrong settings introduced in the temperature visualization tool. The error pertains solely to simulation data post-processing, and it is not related to the numerical methods and programs employed to run the experiment. We display here in Fig. 1 the correct temperature difference plot, generated from our original results computed for the dodecane shock tube test described in [1]. We think that is important to notify this correction to avoid any confusion.

  13. Reseña. James Torres, Minería y moneda en el Nuevo Reino de Granada (Bogotá: Instituto Colombiano de Antropología e Historia, 2013. Pp. 259. ISBN 978-958-8181-99-8

    Directory of Open Access Journals (Sweden)

    Óscar Granados

    2014-12-01

    Full Text Available Este libro es un estudio innovador de la minería y su vinculación con la estructura monetaria y el desempeño económico durante la segunda mitad del siglo XVIII. La obra busca agrupar las tres variables como parte de una renovación historiográfica, y para esto analiza al sector minero desde la perspectiva de los precios relativos, haciendo un profundo trabajo de archivo que fortalece la argumentación para resolver sus hipótesis. Torres vincula a la región con mayor producción de oro de la Nueva Granada, comparándola con otras regiones mineras como el Alto Perú y la Nueva España.

  14. Corrigendum to "Chemical composition and acidity of size-fractionated inorganic aerosols of 2013-14 winter haze in Shanghai and associated health risk of toxic elements" [Atmos. Environ. (2015) 259-271

    Science.gov (United States)

    Behera, Sailesh N.; Cheng, Jinping; Huang, Xian; Zhu, Qiongyu; Liu, Ping; Balasubramanian, Rajasekhar

    2018-03-01

    The authors regret that the sources from which the RfC (reference concentration) and the IUR (inhalation unit risk) values were obtained for estimation of RfD (reference dose, presented in Table 2) and SF (slope factor, presented in Table 3) were not clearly indicated in the published article due to an oversight. The revised tables with improved clarity are given below. a The Risk Assessment Information System (https://rais.ornl.gov/) b USEPA Integrated Risk Information System (IRIS) (http://www.epa.gov/iris) c The California EPA, the office of Environmental Health Hazard Assessment (OEHHA) (https://www.oehha.gov.gov/) d Behera, S.N., Xian, H. and Balasubramanian, R., 2014. Human health risk associated with exposure to toxic elements in mainstream and sidestream cigarette smoke. Science of the Total Environment, 472, pp.947-956.

  15. Science and Technology of Nanostructured Magnetic Materials: Proceedings of a NATO Advanced Study Institute Conference Held in Aghia Pelaghia, Crete, Greece on 24 June -6 July 1990. NATO ASI Series B: Physics. Volume 259

    Science.gov (United States)

    1990-07-06

    C.N. Afonso, A.N. Lagunas , F. Briones and S. Giron J. Magn. Magn. Mat. 62 (1980) 833. B. Martinez, A. Ruiz, A. Labarta, X. Obradors, F. Briones...Magn. Mater. 50, 265 (1985). 35. T. Tokunaga, M. Harada, M. Ohkoshi, S. Honda and T. Kusuda, IEEE Trans. MAG-22, 940 (1986). 36. H. Heitmann, M

  16. Conformance to Regulatory Guide 1.97 Browns Ferry Nuclear Plant, Unit Nos. 1, 2 and 3 (Docket Nos. 50-259, 50-260, and 50-296)

    International Nuclear Information System (INIS)

    Udy, A.C.

    1985-07-01

    This EG and G Idaho, Inc., report reviews the submittals for Regulatory Guide 1.97, Revision 3, for Unit Nos. 1, 2 and 3 of the Browns Ferry Nuclear Plant and identifies areas of nonconformance to the regulatory guide. Exceptions to Regulatory Guide 1.97 are evaluated and those areas where sufficient basis for acceptability is not provided are identified

  17. Thermosalinograph data of the Hawaii Ocean Time-series (HOT) program in the North Pacific 100 miles north of Oahu, Hawaii for cruises HOT259-268 during 2014 (NCEI Accession 0140225)

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — The HOT program makes repeated observations of the physics, biology and chemistry at a site approximately 100 km north of Oahu, Hawaii. The program began in 1988....

  18. Technical evaluation of the electrical, instrumentation, and control design aspects of the proposed license amendment Revision 1 for single-loop operation of Browns Ferry Nuclear Plants (Docket No. 50-259, Unit 1; Docket No. 50-260, Unit 2; Docket No. 50-296, Unit 3)

    International Nuclear Information System (INIS)

    Donich, T.R.

    1983-01-01

    This report documents the technical evaluation of the proposed changes to the plant reactor protection system by the licensee of Browns Ferry Nuclear Power Station, Units 1, 2, and 3, to account for single-loop plant operation. This evaluation is restricted to only the electrical, instrumentation and control design aspects of proposed changes to the plant technical specifications for single-loop operation beyond 24 hours. Conclusion is that the license amendment for single-loop operation has met the review criteria provided sufficient administrative controls are in effect, and any anomalous control room indicators are corrected or warning-tagged for the duration of single-loop operation

  19. Quaderni di filologia e lingue romanze 7 (1992, Supplemento Terza serie, Attidel Convegno "Relazione di viaggi fra Italia e Spagna" Macerata, Università degli Studi, 15-17 dicembre 1992, 259 pp.; 8(1993, 273 pp.; 9(1994, 285 pp.; 10(1995, 346 pp.

    Directory of Open Access Journals (Sweden)

    Pavao Tekavčić

    1996-12-01

    Full Text Available Il periodico maceratese, nato nel 1979, continua ad apparire a ritmo annuale re­ golare. Avendo recensito i voll. 1985-1992 nel numero 34 di «Linguistica», presen­ tiamo qui le annate citate nel titolo, concentrandoci sempre sui contributi di interesse linguistico (o almeno filologico, che continuano ad essere in minoranza di fronte a quelli di argomento letterario.

  20. ORF Alignment: NC_004369 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available RGRYLQHLADAVPTDLSGITVVVDA 180 ... Query: 259 XXXXRCLAVDSDGNIVDGDQIMAILAIAMKENSELRKNTLVATVMSNLGLKLAMEKADIQ 318 ... ... ... RCLAVDSDGNIVDGDQIMAILAIAMKENSELRKNTLVATVMSNLGLKLAMEKADIQ Sbjct: 241 GDADRCLAVDSDGNIVDGDQIMAILA

  1. ORF Alignment: NC_003305 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available ] ... Length = 259 ... Query: 7 ... CFSTLGCSELSLHETADLTERHGIANVELRALSGTIDLIAALTAEFGTPARFAAFLSERN 66 ... ... ... CFSTLGCSELSLHETADLTERHGIANVELRALSGTIDLIAALTAEFGTPARFAAFLSERN Sbjct: 1 ... CFSTLGCSELSLHETADLTERHGIANVELRA

  2. ORF Alignment: NC_003063 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available ] ... Length = 259 ... Query: 7 ... CFSTLGCSELSLHETADLTERHGIANVELRALSGTIDLIAALTAEFGTPARFAAFLSERN 66 ... ... ... CFSTLGCSELSLHETADLTERHGIANVELRALSGTIDLIAALTAEFGTPARFAAFLSERN Sbjct: 1 ... CFSTLGCSELSLHETADLTERHGIANVELRA

  3. ORF Alignment: NC_004668 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available Length = 259 ... Query: 1 ... MIKIIVAGFKGRMGSTATQMVLETADFELVGVYDPHEAQETVSFNDETAIPVFQ...RLEEVL 60 ... MIKIIVAGFKGRMGSTATQMVLETADFELVGVYDPHEAQETVSFNDETAIPVFQRLEEVL Sbjct: 1 ... MIKIIVAGFKGRMGSTATQMVLETADFELVGVYDPHE

  4. ORF Alignment: ch_oct10_gene_aa_db [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NMVQGVLSHQLKR 180 ... Query: 259 YNLKSPIPRQFLSEVNKRFPTLPFSLNMISDEKVARLGVSECIRHNLLYSY...PVITERQGE 318 ... YNLKSPIPRQFLSEVNKRFPTLPFSLNMISDEKVARLGVSECIRHNLLYSYPVITERQGE Sbjct: 241 YNLKSPIPRQFLSEVNKRFPTLPFSLNMISDEKVARLGVSECIRHNLLYSYPVITERQGE 300 ...

  5. Gclust Server: 40687 [Gclust Server

    Lifescience Database Archive (English)

    Full Text Available 40687 HSA_51460703 Cluster Sequences Related Sequences(259) 278 XP_292889.3 PREDICTED: similar to notochord...s(259) Sequence length 278 Representative annotation XP_292889.3 PREDICTED: similar to notochord

  6. ORF Alignment: NC_002942 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available LNELDLIRIRNAAR Sbjct: 121 GYTHVSAPFDGRMGRHLVDVGNLVGHGAATDLATIEQIDPIYVYFNLNELDLIRIRNAAR 180 ... Query: 299 LFVQVRVPISEPS...PKLTIP 317 ... LFVQVRVPISEPSPKLTIP Sbjct: 241 LFVQVRVPISEPSPKLTIP 259

  7. ORF Alignment: NC_006369 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available LNELDLIRIRNAAR Sbjct: 121 GYTHVSAPFDGRMGRHLVDVGNLVGHGAATDLATIEQIDPIYVYFNLNELDLIRIRNAAR 180 ... Query: 295 LFVQVRVPISEPS...PKLTIP 313 ... LFVQVRVPISEPSPKLTIP Sbjct: 241 LFVQVRVPISEPSPKLTIP 259

  8. ORF Alignment: NC_002678 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available MAFF303099] ... Length = 942 ... Query: 200 ... ISHAMAIAAQALDHVGLPAIIRPSFTMGGTGGGIAYNRAEFYDIVQSGLDASPTTEVL...IE 259 ... ISHAMAIAAQALDHVGLPAIIRPSFTMGGTGGGIAYNRAEFYDIVQSGLDASPTTEVLIE Sbjct: 1 ... ISHAMAIAAQALDHVGLPAIIRPSFTM

  9. ORF Alignment: NC_004463 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available ... 110] ... Length = 44 ... Query: 219 HFVNRGDTLASIARKNHISAAELARANGLDPSAKLKLGTKL 259 ... HFVNRGDTLASIARKNHIS...AAELARANGLDPSAKLKLGTKL Sbjct: 1 ... HFVNRGDTLASIARKNHISAAELARANGLDPSAKLKLGTKL 41

  10. Extraction of niobium and tantalum isotopes using organophosphorus compounds. Pt. 1. Extraction of 'carrier-free' metal concentrations from HCl solutions

    International Nuclear Information System (INIS)

    Gates, J.M.; California Univ., Berkeley, CA; Sudowe, R.; Stavsetra, L.

    2009-01-01

    The extraction of niobium (Nb) and tantalum (Ta) from hydrochloric acid media by bis(2-ethylhexyl) hydrogen phosphate (HDEHP) and bis(2-ethylhexyl) hydrogen phosphite (BEHP) was studied. The goal of the experiments is to find a system that demonstrates selectivity between the members of group five of the Periodic Table and is also suitable for the study of dubnium (Db, Z=105). Experiments were performed at the trace level (10 -16 M Nb or Ta) using hydrochloric acid with concentrations ranging from 1-11 M and short-lived isotopes of Nb and Ta produced in nuclear reactions. When HDEHP was used as the extractant, the Nb extraction yield decreased with increasing acid concentrations above 6 M, while the amount of Ta extracted remained over 75% for all acid concentrations studied. Tantalum was found to be extracted by BEHP at acid concentrations above 6 M, while niobium was not significantly extracted. The data obtained are used as the basis to discuss the speciation of Nb and Ta under the conditions studied and to evaluate possible extraction mechanisms. (orig.)

  11. Chemistry of superheavy elements

    International Nuclear Information System (INIS)

    Schaedel, M.

    2012-01-01

    The chemistry of superheavy elements - or transactinides from their position in the Periodic Table - is summarized. After giving an overview over historical developments, nuclear aspects about synthesis of neutron-rich isotopes of these elements, produced in hot-fusion reactions, and their nuclear decay properties are briefly mentioned. Specific requirements to cope with the one-atom-at-a-time situation in automated chemical separations and recent developments in aqueous-phase and gas-phase chemistry are presented. Exciting, current developments, first applications, and future prospects of chemical separations behind physical recoil separators ('pre-separator') are discussed in detail. The status of our current knowledge about the chemistry of rutherfordium (Rf, element 104), dubnium (Db, element 105), seaborgium (Sg, element 106), bohrium (Bh, element 107), hassium (Hs, element 108), copernicium (Cn, element 112), and element 114 is discussed from an experimental point of view. Recent results are emphasized and compared with empirical extrapolations and with fully-relativistic theoretical calculations, especially also under the aspect of the architecture of the Periodic Table. (orig.)

  12. Chemistry of the superheavy elements.

    Science.gov (United States)

    Schädel, Matthias

    2015-03-13

    The quest for superheavy elements (SHEs) is driven by the desire to find and explore one of the extreme limits of existence of matter. These elements exist solely due to their nuclear shell stabilization. All 15 presently 'known' SHEs (11 are officially 'discovered' and named) up to element 118 are short-lived and are man-made atom-at-a-time in heavy ion induced nuclear reactions. They are identical to the transactinide elements located in the seventh period of the periodic table beginning with rutherfordium (element 104), dubnium (element 105) and seaborgium (element 106) in groups 4, 5 and 6, respectively. Their chemical properties are often surprising and unexpected from simple extrapolations. After hassium (element 108), chemistry has now reached copernicium (element 112) and flerovium (element 114). For the later ones, the focus is on questions of their metallic or possibly noble gas-like character originating from interplay of most pronounced relativistic effects and electron-shell effects. SHEs provide unique opportunities to get insights into the influence of strong relativistic effects on the atomic electrons and to probe 'relativistically' influenced chemical properties and the architecture of the periodic table at its farthest reach. In addition, they establish a test bench to challenge the validity and predictive power of modern fully relativistic quantum chemical models. © 2015 The Author(s) Published by the Royal Society. All rights reserved.

  13. Aqueous chemistry of transactinides

    International Nuclear Information System (INIS)

    Schaedel, M.

    2001-01-01

    The aqueous chemistry of the first three transactinide elements is briefly reviewed with special emphasis given to recent experimental results. Short introductory remarks are discussing the atom-at-a-time situation of transactinide chemistry as a result of low production cross-sections and short half-lives. In general, on-line experimental techniques and, more specifically, the automated rapid chemistry apparatus, ARCA, are presented. Present and future developments of experimental techniques and resulting perspectives are outlined at the end. The central part is mainly focussing on hydrolysis and complex formation aspects of the superheavy group 4, 5, and 6 transition metals with F - and Cl - anions. Experimental results are compared with the behaviour of lighter homologous elements and with relativistic calculations. It will be shown that the chemical behaviour of the first superheavy elements is already strongly influenced by relativistic effects. While it is justified to place rutherfordium, dubnium and seaborgium in the Periodic Table of the Elements into group 4, 5 and 6, respectively, it is no more possible to deduce from this position in detail the chemical properties of these transactinide or superheavy elements. (orig.)

  14. ORF Alignment: NC_006350 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available pseudomallei K96243] ... Length = 259 ... Query: 12 ... ADRWVDTGRGRLFARCWPAPHRAHMPDDAPPIVLLHDSLGCVRMWRTFPR...TLAACAGRRV 71 ... ADRWVDTGRGRLFARCWPAPHRAHMPDDAPPIVLLHDSLGCVRMWRTFPRTLAACA...GRRV Sbjct: 1 ... ADRWVDTGRGRLFARCWPAPHRAHMPDDAPPIVLLHDSLGCVRMWRTFPRTLAACAGRRV 60 ... Query: 132 EFASACDALITESAQA

  15. ORF Alignment: NC_002944 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available h = 155 ... Query: 200 HTQMAPAASKPPEVANLATKMFQALMPSRSGAIQKPAGSQTIGRATDNDIVIQDVLASRH 259 ... HTQMAPA...ASKPPEVANLATKMFQALMPSRSGAIQKPAGSQTIGRATDNDIVIQDVLASRH Sbjct: 5 ... HTQMAPAASKPPEVANLATK... ... protein MAP3465 [Mycobacterium avium subsp. ... paratuberculosis str. k10] ... Lengt

  16. Seasonal variations in carbon budget in water column off Princess Astrid coast, Antarctica

    Digital Repository Service at National Institute of Oceanography (India)

    Dhargalkar, V.K.; Matondkar, S.G.P.; Verlecar, X.N.

    stream_size 8 stream_content_type text/plain stream_name DOD_Tech_Pub_1996_10_259.pdf.txt stream_source_info DOD_Tech_Pub_1996_10_259.pdf.txt Content-Encoding ISO-8859-1 Content-Type text/plain; charset=ISO-8859-1 ...

  17. The Attitudes of Israeli Arab and Jewish High School Students towards Extrinsic and Intrinsic Values

    Science.gov (United States)

    Gross, Zehavit

    2013-01-01

    The aim of this research was to investigate the attitudes of Israeli Arab (n = 259) and Jewish (n = 259) high school students toward extrinsic and intrinsic values. A questionnaire, which consisted of eight value scales in two groups--extrinsic and intrinsic values--was administered. Participants were asked to state whether they agreed or…

  18. Distribution of iron, cobalt , zinc and selenium in macrofungi

    Czech Academy of Sciences Publication Activity Database

    Borovička, Jan; Řanda, Zdeněk

    2007-01-01

    Roč. 6, č. 4 (2007), s. 249-259 ISSN 1617-416X Institutional research plan: CEZ:AV0Z10480505 Keywords : ectomycorrhizal fungi * instrumental neutron activation analysis * terrestrial saprobes Subject RIV: CH - Nuclear ; Quantum Chemistry Impact factor: 1.259, year: 2007

  19. Journal of Earth System Science | Indian Academy of Sciences

    Indian Academy of Sciences (India)

    Home; Journals; Journal of Earth System Science; Volume 113; Issue 3. Volume 113, Issue 3. September 2004, pages 259-515. pp 259-267. Delineation of structures favourable to groundwater occurrence employing seismic refraction method — A case study from Tiruvuru, Krishna district, Andhra Pradesh · N Sundararajan ...

  20. Two Isoforms of Yersinia pestis Plasminogen Activator Pla: Intraspecies Distribution, Intrinsic Disorder Propensity, and Contribution to Virulence.

    Science.gov (United States)

    Dentovskaya, Svetlana V; Platonov, Mikhail E; Svetoch, Tat'yana E; Kopylov, Pavel Kh; Kombarova, Tat'yana I; Ivanov, Sergey A; Shaikhutdinova, Rima Z; Kolombet, Lyubov' V; Chauhan, Sadhana; Ablamunits, Vitaly G; Motin, Vladimir L; Uversky, Vladimir N; Anisimov, Andrey P

    2016-01-01

    It has been shown previously that several endemic Y. pestis isolates with limited virulence contained the I259 isoform of the outer membrane protease Pla, while the epidemic highly virulent strains possessed only the T259 Pla isoform. Our sequence analysis of the pla gene from 118 Y. pestis subsp. microtus strains revealed that the I259 isoform was present exclusively in the endemic strains providing a convictive evidence of more ancestral origin of this isoform. Analysis of the effects of the I259T polymorphism on the intrinsic disorder propensity of Pla revealed that the I259T mutation slightly increases the intrinsic disorder propensity of the C-terminal tail of Pla and makes this protein slightly more prone for disorder-based protein-protein interactions, suggesting that the T259 Pla could be functionally more active than the I259 Pla. This assumption was proven experimentally by assessing the coagulase and fibrinolytic activities of the two Pla isoforms in human plasma, as well as in a direct fluorometric assay with the Pla peptide substrate. The virulence testing of Pla-negative or expressing the I259 and T259 Pla isoforms Y. pestis subsp. microtus and subsp. pestis strains did not reveal any significant difference in LD50 values and dose-dependent survival assays between them by using a subcutaneous route of challenge of mice and guinea pigs or intradermal challenge of mice. However, a significant decrease in time-to-death was observed in animals infected with the epidemic T259 Pla-producing strains as compared to the parent Pla-negative variants. Survival curves of the endemic I259 Pla+ strains fit between them, but significant difference in mean time to death post infection between the Pla-strains and their I259 Pla+ variants could be seen only in the isogenic set of subsp. pestis strains. These findings suggest an essential role for the outer membrane protease Pla evolution in Y. pestis bubonic infection exacerbation that is necessary for intensification

  1. Satellite gravity gradient grids for geophysics

    Czech Academy of Sciences Publication Activity Database

    Bouman, J.; Ebbing, J.; Fuchs, M.; Sebera, Josef; Lieb, V.; Szwillus, W.; Haagmans, R.; Novák, P.

    2016-01-01

    Roč. 6, February (2016), 21050/1-21050/11 ISSN 2045-2322 Institutional support: RVO:67985815 Keywords : atlantic region * GOCE * model Subject RIV: BN - Astronomy, Celestial Mechanics, Astrophysics Impact factor: 4.259, year: 2016

  2. Cerium oxide for the destruction of chemical warfare agents: A comparison of synthetic routes

    Czech Academy of Sciences Publication Activity Database

    Janos, P.; Henych, Jiří; Pelant, O.; Pilařová, V.; Vrtoch, L.; Kormunda, M.; Mazanec, K.; Štengl, Václav

    2016-01-01

    Roč. 304, MAR (2016), s. 259-268 ISSN 0304-3894 Institutional support: RVO:61388980 Keywords : Cerium oxide * Chemical warfare agents * Organophosphate compounds * Decontamination Subject RIV: CA - Inorganic Chemistry Impact factor: 6.065, year: 2016

  3. Impact of ICTs on Local Democracy : Transparency and Citizen ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Impact of ICTs on Local Democracy : Transparency and Citizen Participation in the ... is characterized by great socioeconomic diversity and strong social networks ... of the population has access to computers, 25.9% of which use the Internet.

  4. Epiphytic diatoms in lotic and lentic waters - diversity and representation of species complexes

    Czech Academy of Sciences Publication Activity Database

    Kollár, J.; Fránková, Markéta; Hašler, P.; Letáková, M.; Poulíčková, A.

    2015-01-01

    Roč. 15, č. 2 (2015), s. 259-271 ISSN 1802-5439 Institutional support: RVO:67985939 Keywords : diatoms * epiphyton * species comlexes * lotic and lentic waters Subject RIV: EF - Botanics Impact factor: 2.026, year: 2015

  5. Data of evolutionary structure change: 1CG5B-2ZLWD [Confc[Archive

    Lifescience Database Archive (English)

    Full Text Available 1CG5B-2ZLWD 1CG5 2ZLW B D VKLSEDQEHYIKGVWKDVDHKQITAKALERVFVVYPWTT.../seq1> VQLSGEEKAAVLALWDKVNEEEVGGEALGRLLVVYPWTQRFFDSFGDLSNPGAVMGNPKVKAHGKKVLHSFGEGVHHLDNLKGTFAALSELHCDK...224 GLY CA 259 2ZLW D 2ZLWD...W D 2ZLWD ELHCDKLHVDP

  6. Asymmetric Preorganization of Inverted Pair Residues in the Sodium-Calcium Exchanger

    Czech Academy of Sciences Publication Activity Database

    Giladi, M.; Almagor, L.; Van Dijk, L.; Hiller, R.; Man, Petr; Forest, E.; Khananshvili, D.

    2016-01-01

    Roč. 6, FEB15 (2016), s. 20753 ISSN 2045-2322 Institutional support: RVO:61388971 Keywords : MASS-SPECTROMETRY * STRUCTURAL BASIS * NA+/CA2+ EXCHANGER Subject RIV: CE - Biochemistry Impact factor: 4.259, year: 2016

  7. Fulltext PDF

    Indian Academy of Sciences (India)

    259. Gopalakrishna G S. Hydrothermal synthesis, structure and characterization of new .... Silver nanoparticles of variable morphology synthesized in aqueous foams as ... Thermal and structural properties of spray pyrolysed CdS thin film. 233.

  8. 78 FR 57889 - Notice of Quarterly Report (April 1 2013-June 30, 2013)

    Science.gov (United States)

    2013-09-20

    ... time; hours per week. Restructure and rehabilitate primary and secondary pipelines (kilometers... Project $42,045,259 Increase the $31,725,167 Screening for adoption of hypertension (percent). behaviors... management and implementation. [[Page 57901

  9. Historic and ancient tsunamis uncovered on the Jalisco-Colima Pacific coast, the Mexican subduction zone

    Czech Academy of Sciences Publication Activity Database

    Ramírez-Herrera, M.-T.; Bógalo, M.-F.; Černý, Jan; Goguitchaichvili, A.; Corona, N.; Machain, M. L.; Edwards, A. C.; Sosa, S.

    2016-01-01

    Roč. 259, April 15 (2016), s. 90-104 ISSN 0169-555X Institutional support: RVO:67985831 Keywords : Earthquake * magnetic properties * Mexican subduction * tsunami deposit Subject RIV: DB - Geology ; Mineralogy Impact factor: 2.958, year: 2016

  10. 'Transatlantic Print Culture, 1880-1940: Emerging Media, Emerging Modernisms', edited by Ann Ardis and Patrick Collier

    Directory of Open Access Journals (Sweden)

    Janet Floyd

    2009-11-01

    Full Text Available A review of 'Transatlantic Print Culture, 1880-1940: Emerging Media, Emerging Modernisms', edited by Ann Ardis and Patrick Collier (London: Palgrave Macmillan, 2008. Hardback, 259 pages, £50, ISBN 9780554269.

  11. College Drinking

    Science.gov (United States)

    ... range of counseling options and policies related to sales and access. Yet, while school officials should be ... 18–24: changes from 1998 to 2001. Annual Review of Public Health 26: 259–279, 2005. PMID: ...

  12. Drug Metabolism

    Indian Academy of Sciences (India)

    Home; Journals; Resonance – Journal of Science Education; Volume 19; Issue 3. Drug Metabolism: A Fascinating Link Between Chemistry and Biology. Nikhil Taxak Prasad V Bharatam. General Article Volume 19 Issue 3 March 2014 pp 259-282 ...

  13. AUTHOR INDEX

    Indian Academy of Sciences (India)

    symmetric po- tentials. 323. Arpornthip Tanwa. Conduction bands in classical periodic potentials. 259. Asfaw A see Chaudhary A K. 731. Aslan Ö see Özdemir Z Guven. 755. Asnani Himanshu. Effective mass theory of a two-dimen-.

  14. Discovery of Orally Available Prodrugs of the Glutamate Carboxypeptidase II (GCPII) Inhibitor 2-Phosphonomethylpentanedioic Acid (2-PMPA)

    Czech Academy of Sciences Publication Activity Database

    Majer, Pavel; Jančařík, Andrej; Krečmerová, Marcela; Tichý, Tomáš; Tenora, Lukáš; Wozniak, K.; Wu, Y.; Pommier, E.; Ferraris, D.; Rais, R.; Slusher, B. S.

    2016-01-01

    Roč. 59, č. 6 (2016), s. 2810-2819 ISSN 0022-2623 Institutional support: RVO:61388963 Keywords : glutamate carboxypeptidase II * glutamate * 2-PMPA * prodrug Subject RIV: CC - Organic Chemistry Impact factor: 6.259, year: 2016

  15. Effects of elevated CO2 and ozone on phenolic glycosides of trembling aspen

    Science.gov (United States)

    James K. Nitao; Muraleedharan G. Nair; William J. Mattson; Daniel A. Herms; Bruce A. Birr; Mark D. Coleman; Terry M. Trier; J. G. Isebrands

    1996-01-01

    We tested the effects of elevated CO2 and ozone on concentrations of the phenolic glycosides salicortin and tremulacin in immature and mature foliage of the trembling aspen (Populus tremuloides) clones 216, 259, and 271.

  16. Lidová hudba a zvukový záznam

    Czech Academy of Sciences Publication Activity Database

    Kratochvíl, Matěj

    2006-01-01

    Roč. 93, č. 3 (2006), s. 259-267 ISSN 0009-0794 Institutional research plan: CEZ:AV0Z90580513 Keywords : folk music * sound recording * phonograph * technology * media Subject RIV: AC - Archeology, Anthropology, Ethnology

  17. Herbivory in the soft coral Sinularia flexibilis (Alcyoniidae)

    Czech Academy of Sciences Publication Activity Database

    Piccinetti, C.C.; Ricci, R.; Pennesi, C.; Radaelli, G.; Totti, C.; Norici, A.; Giordano, Mario; Olivotto, I.

    2016-01-01

    Roč. 6, MAR 8 (2016), s. 22679 ISSN 2045-2322 Institutional support: RVO:61388971 Keywords : DIATOM THALASSIOSIRA-PSEUDONANA * STYLOPHORA-PISTILLATA * SCLERACTINIAN CORALS Subject RIV: EE - Microbiology, Virology Impact factor: 4.259, year: 2016

  18. Deciphering the relationship among phosphate dynamics, electron-dense body and lipid accumulation in the green alga Parachlorella kessleri

    Czech Academy of Sciences Publication Activity Database

    Ota, S.; Yoshihara, M.; Yamazaki, T.; Takeshita, T.; Hirata, A.; Konomi, M.; Oshima, K.; Hattori, M.; Bišová, Kateřina; Zachleder, Vilém; Kawano, S.

    2016-01-01

    Roč. 6, MAY 16 (2016), s. 25731 ISSN 2045-2322 Institutional support: RVO:61388971 Keywords : electron-dense body * lipid accumulation * Parachlorella kessleri Subject RIV: EE - Microbiology, Virology Impact factor: 4.259, year: 2016

  19. Tetra(3,4-pyrido)porphyrazines Caught in the Cationic Cage: Toward Nanomolar Active Photosensitizers

    Czech Academy of Sciences Publication Activity Database

    Macháček, M.; Demuth, J.; Čermák, P.; Vavrečková, M.; Hrubá, L.; Jedličková, A.; Kubát, Pavel; Šimůnek, T.; Nováková, V.; Zimčík, P.

    2016-01-01

    Roč. 59, č. 20 (2016), s. 9443-9456 ISSN 0022-2623 Institutional support: RVO:61388955 Keywords : TARGETED PHOTODYNAMIC THERAPY * SINGLET OXYGEN * PHOTOPHYSICAL PROPERTIES Subject RIV: CF - Physical ; Theoretical Chemistry Impact factor: 6.259, year: 2016

  20. Human Estimation of Slope, Distance, and Height of Terrain in Simulated Lunar Conditions

    Science.gov (United States)

    2009-02-01

    9643 APPENDIX J DEVON ISLAND DISTANCE REFERENCE 259 Distance References NBA Basketball Court Width 15 meters 50 feet...Cockpit Hours: Simulator Airframe: Hours: Sports Baseball Years: Beginner Intermediate Advanced Basketball Years: Beginner

  1. Journal of Genetics | Indian Academy of Sciences

    Indian Academy of Sciences (India)

    RESEARCH ARTICLE Volume 96 Issue 2 June 2017 pp 251-259 ... is a chronic immuno-inflammatory disease characterized by inflammatory mediators and ... no notable differences between the multiple comparisons of rs28362491– rs696 ...

  2. Testosterone Test

    Science.gov (United States)

    ... Testing Triglycerides Troponin Tryptase Tumor Markers Uric Acid Urinalysis Urine Albumin and Albumin/Creatinine Ratio Urine Culture ... 2010) 2536–259. Centers for Disease Control Hormone Standardization website(HoST). Available online at http://www.cdc. ...

  3. EHR Incentive Programs - Data and Reports

    Data.gov (United States)

    U.S. Department of Health & Human Services — As of March 2013, more than 259,000 health care providers received payment for participating in the Medicare and Medicaid Electronic Health Record (EHR) Incentive...

  4. A combined approach of DNA probe and RFLP for family and species identification of larval stages of commercially important aquatic species: A study on the surfclam Spisula solidissima

    Digital Repository Service at National Institute of Oceanography (India)

    Achuthankutty, C.T.

    fragment length polymorphism (RFLP) analysis. An oilgonucleotide sequence designed from the 18S ribosomal RNA gene (nucleotide position 259-276) provided a sensitive probe for the Family Mactridae, to which S. solidissima belongs. DNA of unknown larvae...

  5. Elementõ polititsheskoi mifologii Tjuttsheva (kommentari k state 1844 g.) / Aleksandr Ospovat

    Index Scriptorium Estoniae

    Ospovat, Aleksandr

    1999-01-01

    Bibl. lk. 259-263. Kokkuvõte inglise k. lk. 321. Kiri ajalehe "Allgemeine Zeitung" (Augsburg) toimetajale Gustav Kolbile (1844, prantsuse k.). Artikli venek. versioon (pealk. "Venemaa ja Saksamaa") publitseeriti ajakirjas Russki arhiv (1873, nr. 10)

  6. Intercalation of tartrazine into ZnAl and MgAl layered double hydroxides

    Czech Academy of Sciences Publication Activity Database

    Beneš, L.; Melánová, Klára; Zima, Vítězslav; Svoboda, Jan

    2005-01-01

    Roč. 70, č. 2 (2005), s. 259-267 ISSN 0010-0765 Institutional research plan: CEZ:AV0Z40500505 Keywords : intercalation * hydrotalcite Subject RIV: CA - Inorganic Chemistry Impact factor: 0.949, year: 2005

  7. 2003 Reson 8101ER Multibeam Sonar Data from Cruise OES-03-07/AHI-03-07, Data Set Name Rota.

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — Reson 8101ER multibeam Data were collected between 16-17 September 2003 (JD 259-260) aboard NOAA Survey Launch Acoustic Habitat Investigator (AHI) at Rota Island in...

  8. Discovery of 6-Diazo-5-oxo-L-norleucine (DON) Prodrugs with Enhanced CSF Delivery in Monkeys: A Potential Treatment for Glioblastoma

    Czech Academy of Sciences Publication Activity Database

    Rais, R.; Jančařík, Andrej; Tenora, Lukáš; Nedelcovych, M.; Alt, J.; Englert, J.; Rojas, C.; Le, A.; Elgogary, A.; Tan, J.; Monincová, Lenka; Pate, K.; Adams, R.; Ferraris, D.; Powell, J.; Majer, Pavel; Slusher, B. S.

    2016-01-01

    Roč. 59, č. 18 (2016), s. 8621-8633 ISSN 0022-2623 Institutional support: RVO:61388963 Keywords : phase I * glutamine metabolism * adjuvant temozolomide Subject RIV: CC - Organic Chemistry Impact factor: 6.259, year: 2016

  9. Qualitative study on maternal referrals in rural Tanzania: Decision ...

    African Journals Online (AJOL)

    Administrator

    discussions (FGDs) with health workers and community members, stratified by age and ..... health facilities and not listening carefully ..... Projects. Int J Gynaecol Obstet. 1997(59). S259-S265. 22. Campbell O, Koblinsky M, Taylor P. Off to.

  10. Temperature-Dependent Kinetics of Grape Seed Phenolic Compounds Extraction: Experiment and Model

    Czech Academy of Sciences Publication Activity Database

    Bucic´-Kojic´, A.; Sovová, Helena; Planinic´, M.; Tomas, S.

    2013-01-01

    Roč. 136, 3-4 (2013), s. 1136-1140 ISSN 0308-8146 Institutional support: RVO:67985858 Keywords : kinetics modelling * temperature * grape seed Subject RIV: CI - Industrial Chemistry, Chemical Engineering Impact factor: 3.259, year: 2013

  11. Enabling Teachers to Develop Pedagogically Sound and Technically Executable Learning Designs

    NARCIS (Netherlands)

    Miao, Yongwu; Van der Klink, Marcel; Boon, Jo; Sloep, Peter; Koper, Rob

    2008-01-01

    Miao, Y., Van der Klink, M., Boon, J., Sloep, P. B., & Koper, R. (2009). Enabling Teachers to Develop Pedagogically Sound and Technically Executable Learning Designs [Special issue: Learning Design]. Distance Education, 30(2), 259-276.

  12. Socio-Cultural Dimensions and Attitude of Women and Community ...

    African Journals Online (AJOL)

    Toshiba

    freedom = 6, P < 0.01 and Contingency coefficient (C) of 0.259. Vol. ..... For the sake of marital harmony in the contemporary time when .... mental view or disposition. Attitudes are .... Integrating the Prevention and Management of the Health.

  13. Review of the cyanobacterial genera implaying planktic species after recent taxonomic revisions according to polyphasic methods: state as of 2014.

    Czech Academy of Sciences Publication Activity Database

    Komárek, Jiří

    2016-01-01

    Roč. 764, č. 1 (2016), s. 259-270 ISSN 0018-8158 Institutional support: RVO:67985939 Keywords : cyanobacteria * plankton * taxonomic revisions Subject RIV: EH - Ecology, Behaviour Impact factor: 2.056, year: 2016

  14. Resting electrical network activity in traps of the aquatic carnivorous plants of the genera Aldrovanda and Utricularia

    Czech Academy of Sciences Publication Activity Database

    Masi, E.; Ciszak, M.; Colzi, I.; Adamec, Lubomír; Mancuso, S.

    2016-01-01

    Roč. 6, e24989 (2016), s. 1-11 ISSN 2045-2322 Institutional support: RVO:67985939 Keywords : electrophysiology * multielectrode array * aquatic carnivorous plants Subject RIV: ED - Physiology Impact factor: 4.259, year: 2016

  15. Jak vzniká něco nového? Založení a transcendence

    Czech Academy of Sciences Publication Activity Database

    Puc, Jan

    2017-01-01

    Roč. 72, č. 4 (2017), s. 259-270 ISSN 0046-385X R&D Projects: GA ČR(CZ) GAP401/11/1747 Institutional support: RVO:67985955 Keywords : institution * transcendence * creativity * temporality * emergence * novelty * Husserl * Patočka * Merleau-Ponty * Bergson * phenomenology * expressivity Subject RIV: AA - Philosophy ; Religion OBOR OECD: Philosophy, History and Philosophy of science and technology http://www.klemens.sav.sk/fiusav/doc/filozofia/2017/4/259-270.pdf

  16. The higher phylogeny of Leptophlebiidae (Insecta: Ephemeroptera), with description of a new species of Calliarcys Eaton, 1881

    Czech Academy of Sciences Publication Activity Database

    Godunko, Roman J.; Sroka, Pavel; Soldán, Tomáš; Bojková, J.

    2015-01-01

    Roč. 73, č. 2 (2015), s. 259-280 ISSN 1863-7221 R&D Projects: GA ČR GA206/08/1389 Institutional support: RVO:60077344 Keywords : Calliarcyinae * systematics * phylogeny Subject RIV: EG - Zoology Impact factor: 1.655, year: 2015 http://www.senckenberg.de/files/content/forschung/publikationen/arthropodsystematics/asp_73_2/03_asp_73_2_godunko_259-279.pdf

  17. Contributing to the Global Agenda

    DEFF Research Database (Denmark)

    Enemark, Stig

    2008-01-01

    Stig Enemark, President of the International Federation of Surveyors, explains the organisation's role in the areas of geospatial information and land management. Link to full text: http://www.euinfrastructure.com/currentissue/article.asp?art=273895&issue=259......Stig Enemark, President of the International Federation of Surveyors, explains the organisation's role in the areas of geospatial information and land management. Link to full text: http://www.euinfrastructure.com/currentissue/article.asp?art=273895&issue=259...

  18. Dynamics Determine Signaling in a Multicomponent System Associated with Rheumatoid Arthritis.

    Science.gov (United States)

    Lindgren, Cecilia; Tyagi, Mohit; Viljanen, Johan; Toms, Johannes; Ge, Changrong; Zhang, Naru; Holmdahl, Rikard; Kihlberg, Jan; Linusson, Anna

    2018-05-24

    Strategies that target multiple components are usually required for treatment of diseases originating from complex biological systems. The multicomponent system consisting of the DR4 major histocompatibility complex type II molecule, the glycopeptide CII259-273 from type II collagen, and a T-cell receptor is associated with development of rheumatoid arthritis (RA). We introduced non-native amino acids and amide bond isosteres into CII259-273 and investigated the effect on binding to DR4 and the subsequent T-cell response. Molecular dynamics simulations revealed that complexes between DR4 and derivatives of CII259-273 were highly dynamic. Signaling in the overall multicomponent system was found to depend on formation of an appropriate number of dynamic intramolecular hydrogen bonds between DR4 and CII259-273, together with the positioning of the galactose moiety of CII259-273 in the DR4 binding groove. Interestingly, the system tolerated modifications at several positions in CII259-273, indicating opportunities to use analogues to increase our understanding of how rheumatoid arthritis develops and for evaluation as vaccines to treat RA.

  19. Developments for transactinide chemistry experiments behind the gas-filled separator TASCA

    Energy Technology Data Exchange (ETDEWEB)

    Even, Julia

    2011-12-13

    synthesised carbonyl complexes were identified by nuclear decay spectroscopy. Some complexes were studied with isothermal chromatography or thermochromatography methods. The chromatograms were compared with Monte Carlo Simulations to determine the adsorption enthalpyrnon silicon dioxide and on gold. These simulations based on existing codes, that were modified for the different geometries of the chromatography channels. All observed adsorption enthalpies (on silcon oxide as well as on gold) are typical for physisorption. Additionally, the thermalstability of some of the carbonyl complexes was studied. This showed that at temperatures above 200 C therncomplexes start to decompose. It was demonstrated that carbonyl-complex chemistry is a suitable method to study rutherfordium, dubnium, seaborgium, bohrium, hassium, and meitnerium. Until now, only very simple, thermally stable compounds have been synthesized in the gas-phase chemistry of the transactindes. With the synthesis of transactinide-carbonyl complexes a new compound class would be discovered. Transactinide chemistry would reach the border between inorganic and metallorganic chemistry. Furthermore, the in-situ synthesised carbonyl complexes would allow nuclear spectroscopy studies under low background conditions making use of chemically prepared samples. [German] Die vorliegende Arbeit befasst sich mit der Entwicklung von Experimenten hinter dem gasgefuellten Separator TASCA (TransActinide Separator and Chemistry Apparatus) zur Studie des chemischen Verhaltens der Transactinide. Zum einen wurde die Moeglichkeit der elektrochemischen Abscheidung kurzlebiger Isotope der Elemente Ruthenium und Osmium auf Goldelektroden im Hinblick auf ein Experiment mit Hassium untersucht. Aus der Literatur ist bekannt, dass bei der elektrochemischen Abscheidung einzelner Atome das Abscheidepotential signifikant vom Nernst-Potential abweicht. Die Verschiebung des Potentials haengt von der Adsorptionsenthalpie des abzuscheidenden Elements

  20. Promotion of adipogenesis by an EP2 receptor agonist via stimulation of angiogenesis in pulmonary emphysema.

    Science.gov (United States)

    Tsuji, Takao; Yamaguchi, Kazuhiro; Kikuchi, Ryota; Itoh, Masayuki; Nakamura, Hiroyuki; Nagai, Atsushi; Aoshiba, Kazutetsu

    2014-08-01

    Body weight loss is a common manifestation in patients with chronic obstructive pulmonary disease (COPD), particularly those with severe emphysema. Adipose angiogenesis is a key mediator of adipogenesis and use of pro-angiogenic agents may serve as a therapeutic option for lean COPD patients. Since angiogenesis is stimulated by PGE2, we examined whether ONO-AE1-259, a selective E-prostanoid (EP) 2 receptor agonist, might promote adipose angiogenesis and adipogenesis in a murine model of elastase-induced pulmonary emphysema (EIE mice). Mice were intratracheally instilled with elastase or saline, followed after 4 weeks by intraperitoneal administration of ONO-AE1-259 for 4 weeks. The subcutaneous adipose tissue (SAT) weight decreased in the EIE mice, whereas in the EIE mice treated with ONO-AE1-259, the SAT weight was largely restored, which was associated with significant increases in SAT adipogenesis, angiogenesis, and VEGF protein production. In contrast, ONO-AE1-259 administration induced no alteration in the weight of the visceral adipose tissue. These results suggest that in EIE mice, ONO-AE1-259 stimulated adipose angiogenesis possibly via VEGF production, and thence, adipogenesis. Our data pave the way for the development of therapeutic interventions for weight loss in emphysema patients, e.g., use of pro-angiogenic agents targeting the adipose tissue vascular component. Copyright © 2014 Elsevier Inc. All rights reserved.

  1. Developments for transactinide chemistry experiments behind the gas-filled separator TASCA

    International Nuclear Information System (INIS)

    Even, Julia

    2011-01-01

    synthesised carbonyl complexes were identified by nuclear decay spectroscopy. Some complexes were studied with isothermal chromatography or thermochromatography methods. The chromatograms were compared with Monte Carlo Simulations to determine the adsorption enthalpyrnon silicon dioxide and on gold. These simulations based on existing codes, that were modified for the different geometries of the chromatography channels. All observed adsorption enthalpies (on silcon oxide as well as on gold) are typical for physisorption. Additionally, the thermalstability of some of the carbonyl complexes was studied. This showed that at temperatures above 200 C therncomplexes start to decompose. It was demonstrated that carbonyl-complex chemistry is a suitable method to study rutherfordium, dubnium, seaborgium, bohrium, hassium, and meitnerium. Until now, only very simple, thermally stable compounds have been synthesized in the gas-phase chemistry of the transactindes. With the synthesis of transactinide-carbonyl complexes a new compound class would be discovered. Transactinide chemistry would reach the border between inorganic and metallorganic chemistry. Furthermore, the in-situ synthesised carbonyl complexes would allow nuclear spectroscopy studies under low background conditions making use of chemically prepared samples. [de

  2. Femoropopliteal laser recanalization - a multicenterstudy

    International Nuclear Information System (INIS)

    Lammer, J.; Pilger, E.; Karnel, F.; Schurawitzki, H.; Horvath, W.; Oertl, M.; Riedl, M.; Umek, H.; Klein, G.E.; Schreyer, H.; Neumayer, K.; Einspieler, R.; Olbert, F.; Polterauer, P.; Haidinger, D.; Partsch, H.; Graz Univ.; Vienna Univ.; Vienna Univ.; Krankenhaus der Barmherzigen Brueder, Linz; Wilhelminenspital, Vienna

    1990-01-01

    Laser-assisted angioplasty was performed in four different hospitalcenters, following the same treatment protocol and using a Nd-YAG laser with a sapphire-probe catheter. The initial recanalization rate of 259 femoro-popliteal occlusions with a mean length of 7.5 cm was 84%. Dissections or perforations were observed in 10%. An emergency surgical intervention was required in 1.1%. The long-term patency rate of the successfully recanalized arteries was 74% after 2 years. The cumulative cure rate of all 259 patients was 62%. (orig.) [de

  3. Nuclear structure studies in the seaborgium region at SHIP

    Energy Technology Data Exchange (ETDEWEB)

    Antalic, S., E-mail: Stanislav.Antalic@fmph.uniba.sk; Andel, B. [Comenius University in Bratislava, 84248 Bratislava (Slovakia); Heßberger, F. P.; Khuyagbaatar, J. [GSI - Helmhotzzentrum für Schwerionenforschung GmbH, 64291 Darmstadt (Germany); Helmholtz Institute in Mainz, 55099 Mainz (Germany); Ackermann, D. [GSI - Helmhotzzentrum für Schwerionenforschung GmbH, 64291 Darmstadt (Germany); GANIL, 14074 Caen (France); Heinz, S.; Hofmann, S.; Kindler, B.; Laatiaoui, M.; Lommel, B. [GSI - Helmhotzzentrum für Schwerionenforschung GmbH, 64291 Darmstadt (Germany); Kalaninová, Z. [Comenius University in Bratislava, 84248 Bratislava (Slovakia); Laboratory of Nuclear Problems, JINR, 141980 Dubna (Russian Federation); Piot, J.; Vostinar, M. [GANIL, 14074 Caen (France)

    2015-10-15

    New decay data for the isotopes {sup 259}Sg and {sup 255}Rf were obtained at the velocity filter SHIP using an α-decay spectroscopy measurement. Both isotopes were produced and studied via a one neutron evaporation channel in the compound fusion reaction {sup 54}Cr+{sup 208}Pb. New isomeric states were observed and the single-particle level systematics for isotones with 151 and 153 neutrons were extended. A change of the ground-state configuration for the heaviest N = 151 isotones was observed. Detailed Monte-Carlo simulation for the α decay of {sup 259}Sg applying the GEANT4 toolkit was performed and compared with experimental data.

  4. La inútil añoranza de la normalidad

    Directory of Open Access Journals (Sweden)

    Margarita Valencia

    2012-01-01

    Full Text Available Litchis de Madagascar. Aquiles Cuervo. Editorial Elfin de la noche. Buenos Aires, 2011, 91 págs. El ruido de las cosas al caer. Juan Gabriel Vásquez. Premio Alfaguara de novela 2011. Alfaguara. Bogotá. 2011, 259 págs. Tres ataúdes blancos. Antonio Ungar. Premio Herralde de Novela. Editorial Anagrama. Barcelona. 2010, 259 págs. Suicídame. Andrés Arias. Ediciones B. Bogotá, 2010, 261 págs. C.M. no récord. Juan Álvarez. Alfaguara. Bogotá, 2010, 262 págs.

  5. Review of climatic input data for wind load design in accordance with SANS 10160-3

    CSIR Research Space (South Africa)

    Goliger, Adam MW

    2017-12-01

    Full Text Available factor QWE that provides for the wind engineering procedures, such as the wind speed profile and pressure coefficients. The characteristic wind load is then given by Equation 4, where CoV is the coefficient of variation (σV/µV): QW,k = QWE (µV + 2....59 σV)2 = QWE µVk2(1+ 2.59 CoVV)2 (6) Design wind load The design wind load can be obtained by determining the wind speed according to Equation 4 for an exceedance probability (PF) that corresponds with the appropriate target reliability (β...

  6. International measures project for rational energy use (Survey project of the analysis tool of Asian energy consumption efficiency). List of errata; 1998 nendo kokusai energy shiyo gorika nado taisaku jigyo seigohyo. Asia energy shohi koritsuka bunseki tool chosa jigyo

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    1999-03-01

    The list of errata was prepared for the data book of the international measures project for rational energy use (Survey project of the analysis tool of Asian energy consumption efficiency). Corrected pages of the data book 1 (1990) are as follows: 187-190, 223-226, 259-262, 295- 298, 369-370, 387-388 and 405-406 on Malaysian data. Corrected pages of the data book 2 (1985) are as follows: 102-105 on Chinese data, 154 on common data, and 187-190, 223-226, 259-262, 295-298, 369-370, 387-388 and 405-406 on Malaysian data. (NEDO)

  7. AcEST: BP916642 [AcEST

    Lifescience Database Archive (English)

    Full Text Available ides f... 35 0.20 sp|Q9NRI5|DISC1_HUMAN Disrupted in schizophrenia 1 protein OS=Ho... 34 0.34 sp|O94386|YGS9...EL----QAHADEVEELRRKMAQ-KISEYEEQLEALLNKCSSLEKQKSR 258 Query: 145 L 143 L Sbjct: 259 L 259 >sp|Q9NRI5|DISC1_HUMAN Disrupted in schizoph...renia 1 protein OS=Homo sapiens GN=DISC1 PE=1 SV=3 Length = 854 Score = 34.3 bits (

  8. Book Review Ngozi Ezenwa-Ohaeto* http://dx.doi.org/10.4314/og ...

    African Journals Online (AJOL)

    Dean SPGS NAU

    When Dr. Paul Ifeanyi called me on phone, informing me about this book and requesting that ... indiscipline, brazen embezzlement of public funds by people in authority ... money laundering” (Ifeanyi, 259). OJY just .... devastating effects of societal lawlessness, of insecurity, of materialism ... accountable investment. It makes ...

  9. Optical observations of enhanced activity of the 2005 Draconid meteor shower

    Czech Academy of Sciences Publication Activity Database

    Koten, Pavel; Borovička, Jiří; Spurný, Pavel; Štork, Rostislav

    2007-01-01

    Roč. 466, č. 2 (2007), s. 729-735 ISSN 0004-6361 R&D Projects: GA AV ČR KJB300030502; GA ČR GA205/05/0543 Institutional research plan: CEZ:AV0Z10030501 Keywords : meteors * meteor shower s * Draconids Subject RIV: BN - Astronomy, Celestial Mechanics, Astrophysics Impact factor: 4.259, year: 2007

  10. 4-Bromoselenoanisole

    DEFF Research Database (Denmark)

    Sørensen, Henning Osholm; Stuhr-Hansen, Nicolai

    2009-01-01

    The title compound, 1-bromo-4-methylselenobenzene, C7H7BrSe, was prepared by methylation of 4-bromoselenophenolate with methyl iodide, and crystals suitable for structure determination were obtained by sublimation. The molecule is essentially planar; the Se-Me bond is rotated by only 2.59 (19)° out...

  11. New sections in Taraxacum

    Czech Academy of Sciences Publication Activity Database

    Kirschner, Jan; Štěpánek, Jan

    2004-01-01

    Roč. 39, č. 3 (2004), s. 259-274 ISSN 0015-5551 R&D Projects: GA AV ČR KSK6005114; GA ČR GA206/02/0346 Institutional research plan: CEZ:AV0Z6005908 Keywords : Asteraceae * Compositae * Lactuceae Subject RIV: EF - Botanics Impact factor: 0.968, year: 2004

  12. Genetic Variation in the Leptin Receptor Gene, Leptin, and Weight Gain in Young Dutch Adults

    NARCIS (Netherlands)

    Rossum, van C.T.M.; Hoebee, B.; Baak, van M.A.; Mars, M.; Saris, W.H.M.; Seidell, J.C.

    2003-01-01

    Objective: To investigate the association between leptin levels, polymorphisms in the leptin receptor (LEPR) gene, and weight gain. Research Methods and Procedures: From two large prospective cohorts in The Netherlands (n = 17, 500), we compared the baseline leptin of 259 subjects who had gained an

  13. matthew 28:19

    African Journals Online (AJOL)

    2010-03-05

    –93; Viljoen 2007:259). Scholars have noticed the co-existence of universalism and particularism (Guthrie 1990:29–30). Readers too would have been prepared regarding this matter (Hubbard 1974:86). For example, we may ...

  14. Gardening in the zone of death: an experimental assessment of the absolute elevation limit of vascular plants

    Czech Academy of Sciences Publication Activity Database

    Dvorský, Miroslav; Chlumská, Zuzana; Altman, Jan; Čapková, K.; Řeháková, Klára; Macek, Martin; Kopecký, Martin; Liancourt, Pierre; Doležal, Jiří

    2016-01-01

    Roč. 6, č. 24440 (2016), s. 1-10 ISSN 2045-2322 R&D Projects: GA ČR GA13-13368S Institutional support: RVO:67985939 Keywords : Tibetan Plateau * warming * elevational limit Subject RIV: EH - Ecology, Behaviour Impact factor: 4.259, year: 2016

  15. G-Quadruplex Identification in the Genome of Protozoan Parasites Points to Naphthalene Diimide Ligands as New Antiparasitic Agents

    Czech Academy of Sciences Publication Activity Database

    Belmonte-Reche, E.; Martínez-García, M.; Guédin, A.; Zuffo, M.; Arevalo-Ruiz, M.; Doria, F.; Campos-Salinas, J.; Maynadier, M.; Lopez-Rubio, J.J.; Freccero, M.; Mergny, Jean-Louis; Maria Perez-Victoria, J.; Carlos Morales, J.

    2018-01-01

    Roč. 61, č. 3 (2018), s. 1231-1240 ISSN 0022-2623 R&D Projects: GA MŠk EF15_003/0000477 Institutional support: RVO:68081707 Keywords : terminal repeat promoter * plasmodium-falciparum Subject RIV: CE - Biochemistry OBOR OECD: Biochemistry and molecular biology Impact factor: 6.259, year: 2016

  16. A new formulation of Bacillus thuringiensis: UV protection and sustained release mosquito larvae studies

    Czech Academy of Sciences Publication Activity Database

    Zhang, L.; Zhang, X.; Zhang, Y.; Wu, S.; Gelbič, Ivan; Xu, L.; Guan, X.

    2016-01-01

    Roč. 6, DEC 22 (2016), č. článku 39425. ISSN 2045-2322 Institutional support: RVO:60077344 Keywords : Bacillus thuringiensis * pest control * UV protection Subject RIV: EE - Microbiology, Virology Impact factor: 4.259, year: 2016 http://www.nature.com/articles/srep39425

  17. 02 Barnard WEB 02.pmd

    African Journals Online (AJOL)

    Owner

    and consensual sex is shown to be problematic in the relationship between David ... Sheila Jeffreys (Prostitution 259) does not use the word rape, but calls ... The canzone or ballad “La donna è mobile” is from Verdi's opera Rigoletto and can.

  18. Determination of dissociation constants of cytokinins by capillary zone electrophoresis

    Czech Academy of Sciences Publication Activity Database

    Barták, P.; Bednář, P.; Stránský, Z.; Boček, Petr; Vespalec, Radim

    2000-01-01

    Roč. 878, č. 2 (2000), s. 249-259 ISSN 0021-9673 R&D Projects: GA MŠk VS96021; GA AV ČR IAA4031703; GA ČR GA203/99/0044 Subject RIV: CB - Analytical Chemistry, Separation Impact factor: 2.551, year: 2000

  19. Status Of Strategic Management Practices Of Secondary School ...

    African Journals Online (AJOL)

    The purpose of the study was to determine the extent to which principals practice strategic management skills in students' administration in secondary schools in Anambra State. All the two hundred and fifty-nine (259) secondary school principals of the six education zones of Anambra State were used for the study.

  20. Kalivodův zápas o marxismus bez pověr a iluzí

    Czech Academy of Sciences Publication Activity Database

    Zumr, Josef

    2012-01-01

    Roč. 60, mimořádné číslo 2 (2012), s. 259-267 ISSN 0015-1831 Institutional support: RVO:67985955 Keywords : Robert Kalivoda * Marx ism * Hussite movement * Karl Marx * Sigmund Freud Subject RIV: AA - Philosophy ; Religion OBOR OECD: Philosophy, History and Philosophy of science and technology

  1. Chemical degradation of trimethyl phosphate as surrogate for organo-phosporus pesticides on nanostructured metal oxides

    Czech Academy of Sciences Publication Activity Database

    Štengl, Václav; Henych, Jiří; Matys Grygar, Tomáš; Pérez, Raul

    2015-01-01

    Roč. 61, JAN (2015), s. 259-269 ISSN 0025-5408 R&D Projects: GA ČR(CZ) GAP106/12/1116 Institutional support: RVO:61388980 Keywords : Nanostructured oxides * Stoichiometric degradation * Trimethyl phosphate Subject RIV: CA - Inorganic Chemistry Impact factor: 2.435, year: 2015

  2. How do lay people assess the quality of physicians' communicative responses to patients' emotional cues and concerns? An international multicentre study based on videotaped medical consultations.

    NARCIS (Netherlands)

    Mazzi, M.A.; Bensing, J.; Rimondini, M.; Fletcher, I.; Vliet, L. van; Zimmermann, C.; Deveugele, M.

    2013-01-01

    Objective: To establish which kind of physician communicative responses to patient cues and concerns are appreciated by lay people. Methods: A balanced sample (259 people) was recruited in public places to participate in a full day observation of four videotaped standardized medical consultations.

  3. A Gateway((R)) -compatible bacterial adenylate cyclase-based two-hybrid system

    Czech Academy of Sciences Publication Activity Database

    Ouellette, S. P.; Gauliard, E.; Antošová, Zuzana; Ladant, D.

    2014-01-01

    Roč. 6, č. 3 (2014), s. 259-267 ISSN 1758-2229 Institutional support: RVO:67985823 Keywords : bacterial two-hybrid system * protein–protein interactions * cell division * Gateway((R))(GW) cloning system Subject RIV: EE - Microbiology, Virology Impact factor: 3.293, year: 2014

  4. Blood lactate levels as a biomarker for angling-induced stress in ...

    African Journals Online (AJOL)

    These data suggest that longer angling time significantly increases physiological stress, which may have an impact on breading success and mortality in tigerfish. Keywords: catch-and-release angling; fish; physiology; recreational fisheries management; stress. African Journal of Aquatic Science 2009, 34(3): 255–259 ...

  5. Physiological and genomic insights into the lifestyle of arsenite-oxidizing Herminiimonas arsenitoxidans

    Czech Academy of Sciences Publication Activity Database

    Koh, H.W.; Hur, M.; Kang, M.S.; Ku, Y.B.; Ghai, Rohit; Park, S.J.

    2017-01-01

    Roč. 7, Nov (2017), č. článku 15007. ISSN 2045-2322 R&D Projects: GA ČR GA17-04828S Institutional support: RVO:60077344 Keywords : sp-nov. * escherichia-coli * oxidative stress * molecular characterization * drinking-water Subject RIV: EE - Microbiology, Virology OBOR OECD: Microbiology Impact factor: 4.259, year: 2016

  6. Productivity convergence across industries and countries : The importance of theory-based measurement

    NARCIS (Netherlands)

    Inklaar, R.; Timmer, M.P.

    Cross-country studies of economic growth have been hampered by the scarcity of reliable data on productivity at the industry level; see Bernard and Jones [American Economic Review, 91 (4) (2001) 1168-1169] and Rogerson [Journal of Political Economy, 116 (2) (2008), 235-259]. We bring together

  7. Extradition To and From the United States: Overview of the Law and Recent Treaties

    Science.gov (United States)

    2010-03-17

    extradition treaty would unconstitutionally infringe upon the President’s treaty- making power. Id. at 258-259. However, the court avoided striking down...109 F.3d 165, 167-68 (3d Cir. 1997); Abbas v. Department of Homeland Sec., Civil Action No. 09-0169, 2009 WL 2512844, at *3-4 (U.S.W.D.La.,2009

  8. Internal dynamics of intense twin beams and their coherence

    Czech Academy of Sciences Publication Activity Database

    Peřina Jr., J.; Haderka, Ondřej; Allevi, A.; Bondani, M.

    2016-01-01

    Roč. 6, Feb (2016), 1-8, č. článku 22320. ISSN 2045-2322 R&D Projects: GA ČR GAP205/12/0382 Institutional support: RVO:68378271 Keywords : dynamics of intense * twin beams * pump-depleted parametric * down-conversion * coherence Subject RIV: BH - Optics, Masers, Lasers Impact factor: 4.259, year: 2016

  9. Simultaneous effect of organic modifier and physicochemical parameters of barbiturates on their retention on a narrow-bore PGC column

    Czech Academy of Sciences Publication Activity Database

    Forgács, E.; Cserháti, T.; Mikšík, Ivan; Eckhardt, Adam; Deyl, Zdeněk

    2004-01-01

    Roč. 800, č. 1-2 (2004), s. 259-262 ISSN 1570-0232 Grant - others:CZ - HU(CZ) Cooperation programme Institutional research plan: CEZ:AV0Z5011922 Keywords : barbiturates * porous graphitized carbon Subject RIV: CB - Analytical Chemistry, Separation Impact factor: 2.176, year: 2004

  10. 77 FR 30514 - Native Hawaiian Career and Technical Education Program; Final Waiver and Extension of Project Period

    Science.gov (United States)

    2012-05-23

    ... DEPARTMENT OF EDUCATION Native Hawaiian Career and Technical Education Program; Final Waiver and... Career and Technical Education Program Catalog of Federal Domestic Assistance (CFDA) Number: 84.259A... Technical Education Program (NHCTEP), the Secretary hereby waives 34 CFR 75.261(c)(2) in order to extend the...

  11. affect rice in integrated rice-fish culture in Lake Victoria Basin, Kenya?

    African Journals Online (AJOL)

    AGHOGHO A

    Rice field ecology and fish culture - an overview. Hydrobiologia 259:91-113. Fernando CH, Halwart M (2000). Fish farming in irrigation systems. Fisheries Management and Ecol. 7:45-54. Frei M, Razzak MA, Hossain MM, Ochme M, Dewan S, Becker K. (2007). Performance of common carp, Cyprinus carpio L. and Nile.

  12. Myogenic nature of insect heartbeat and intestinal peristalsis, revealed by neuromuscular paralysis caused by the sting of a braconid wasp

    Czech Academy of Sciences Publication Activity Database

    Sláma, Karel; Lukáš, J.

    2011-01-01

    Roč. 57, č. 2 (2011), s. 251-259 ISSN 0022-1910 Grant - others:MZe ČR(CZ) 002 700 604 Institutional research plan: CEZ:AV0Z50070508 Keywords : autonomic heartbeat * myogenic heartbeat * anterograde heartbeat Subject RIV: ED - Physiology Impact factor: 2.236, year: 2011

  13. Synthesis and Evaluation of Asymmetric Acyclic Nucleoside Bisphosphonates as Inhibitors of Plasmodium falciparum and Human Hypoxanthine-Guanine-(Xanthine) Phosphoribosyltransferase

    Czech Academy of Sciences Publication Activity Database

    Špaček, Petr; Keough, D. T.; Chavchich, M.; Dračínský, Martin; Janeba, Zlatko; Naesens, L.; Edstein, M. D.; Guddat, L. W.; Hocková, Dana

    2017-01-01

    Roč. 60, č. 17 (2017), s. 7539-7554 ISSN 0022-2623 R&D Projects: GA ČR(CZ) GA16-06049S Institutional support: RVO:61388963 Keywords : hypoxanthine-guanine phosphoribosyltransferase * 2nd phosphonate group * 6-oxopurine phosphoribosyltransferases Subject RIV: CC - Organic Chemistry OBOR OECD: Organic chemistry Impact factor: 6.259, year: 2016

  14. Halogen Bonding in Nucleic Acid Complexes

    Czech Academy of Sciences Publication Activity Database

    Kolář, Michal H.; Tabarrini, O.

    2017-01-01

    Roč. 60, č. 21 (2017), s. 8681-8690 ISSN 0022-2623 Institutional support: RVO:61388963 Keywords : aldose reductase inhibition * minor groove binders * medicinal chemistry Subject RIV: CF - Physical ; Theoretical Chemistry OBOR OECD: Physical chemistry Impact factor: 6.259, year: 2016

  15. Coupling of seasonal variations in the zooplankton community within the limnetic and littoral zones of a shallow pond

    Czech Academy of Sciences Publication Activity Database

    Šorf, M.; Devetter, Miloslav

    2011-01-01

    Roč. 47, č. 3 (2011), s. 259-268 ISSN 0003-4088 Institutional research plan: CEZ:AV0Z60660521 Keywords : limnetic zone * littoral zone * seasonal succession Subject RIV: EH - Ecology, Behaviour Impact factor: 0.930, year: 2011

  16. ISSN 1727-3781

    African Journals Online (AJOL)

    HP4510s

    Fissse en Bucy, sien Du Toit en Pienaar PER 2011 44-57. 9. Artikel 12.1(1) Criminal Code Act 1995. 10. Artikel 12.1(2) Criminal Code Act 1995. 11. Artikel 12.2 Criminal Code Act 1995. 12. Clough en Mulhern Prosecution of Corporations 139; Woolf 1997 Crim LJ 259-261; Wilkinson. 2003 Canterbury Law Review 173.

  17. Citizen science shows systematic changes in the temperature difference between air and inland waters with global warming

    Czech Academy of Sciences Publication Activity Database

    Weyhenmeyer, G. A.; Mackay, M.; Stockwell, J. D.; Thiery, W.; Grossart, H. P.; Augusto-Silva, P. B.; Baulch, H. M.; de Eyto, E.; Hejzlar, Josef; Kangur, K.; Kirillin, G.; Pierson, D. C.; Rusak, J. A.; Sadro, S.; Woolway, R. I.

    2017-01-01

    Roč. 7, March (2017), č. článku 43890. ISSN 2045-2322 R&D Projects: GA ČR GA15-13750S Institutional support: RVO:60077344 Keywords : dissolved organic-carbon * transfer velocity * energy fluxes * lake * evaporation Subject RIV: DA - Hydrology ; Limnology OBOR OECD: Hydrology Impact factor: 4.259, year: 2016

  18. Collins and Sivers asymmetries in muonproduction of pions and kaons off transversely polarised protons

    Czech Academy of Sciences Publication Activity Database

    Adolph, C.; Akhunzyanov, R.; Alexeev, M.; Alexeev, G. D.; Amoroso, A.; Andrieux, V.; Anosov, V.; Austregesilo, A.; Badelek, B.; Balestra, F.; Barth, J.; Baum, G.; Beck, R.; Bedfer, Y.; Berlin, A.; Bernhard, J.; Bicker, K.; Bielert, E. R.; Bieling, J.; Birsa, R.; Bisplinghoff, J.; Bodlák, M.; Boer, M.; Bordalo, P.; Bradamante, F.; Braun, C.; Bressan, A.; Büchele, M.; Burtin, E.; Capozza, L.; Chiosso, M.; Chung, S. U.; Cicuttin, A.; Crespo, M.; Curiel, Q.; Dalla Torre, S.; Dasgupta, S. S.; Dasgupta, S.; Denisov, O.; Donskov, S. V.; Doshita, N.; Duic, V.; Dunnweber, W.; Dziewiecki, M.; Efremov, A.; Elia, C.; Eversheim, P.D.; Eyrich, W.; Faessler, M.; Ferrero, A.; Finger, M.; Finger jr., M.; Fischer, H.; Franco, C.; Fresne von Hohenesche, N.; Friedrich, J. M.; Frolov, V.; Gautheron, F.; Gavrichtchouk, O. P.; Gerassimov, S.; Geyer, R.; Gnesi, I.; Gobbo, B.; Goertz, S.; Gorzellik, M.; Grabmüller, S.; Grasso, A.; Grube, B.; Grussenmeyer, T.; Guskov, A.; Haas, F.; von Harrach, D.; Hahne, D.; Hashimoto, R.; Heinsius, F. H.; Herrmann, E.; Hinterberger, F.; Höppner, Ch.; Horikawa, N.; d´Hose, N.; Huber, S.; Ishimoto, S.; Ivanov, A.; Ivanshin, Yu.; Iwata, T.; Jahn, R.; Jarý, V.; Jasinski, P.; Jörg, P.; Joosten, R.; Kabuss, E.; Ketzer, B.; Khaustov, G. V.; Khokhlov, Yu. A.; Kisselev, Y.; Klein, F.; Klimaszewski, K.; Koivuniemi, J. H.; Kolosov, V. N.; Kondo, K.; Königsmann, K.; Konorov, I.; Konstantinov, V. F.; Kotzinian, A. M.; Kouznetsov, O.; Krämer, M.; Kroumchtein, Z. V.; Kuchinski, N.; Kunne, F.; Kurek, K.; Kurjata, R. P.; Lednev, A. A.; Lehmann, A.; Levillain, M.; Levorato, S.; Lichtenstadt, J.; Maggiora, A.; Magnon, A.; Makke, N.; Mallot, G.; Marchand, C.; Martin, A.; Marzec, J.; Matoušek, J.; Matsuda, H.; Matsuda, T.; Meshcheryakov, G.; Meyer, W.; Michigami, T.; Mikhailov, Yu. V.; Miyachi, Y.; Nagaytsev, A.; Nagel, T.; Nerling, F.; Neubert, S.; Neyret, D.; Nový, J.; Nowak, W. D.; Nunes, A.S.; Olshevsky, A. G.; Orlov, I.; Ostrick, M.; Panknin, R.; Panzieri, D.; Parsamyan, B.; Paul, S.; Pesaro, G.; Peshekhonov, D. V.; Platchkov, S.; Pochodzalla, J.; Polyakov, V.; Pretz, J.; Quaresma, M.; Quintans, C.; Ramos, S.; Regali, C.; Reicherz, G.; Rocco, E.; Rossiyskaya, N. S.; Ryabchikov, D.; Rychter, A.; Samoylenko, V. D.; Sandacz, A.; Sarkar, S.; Savin, I. A.; Sbrizzai, G.; Schiavon, P.; Schill, C.; Schlüter, T.; Schmidt, K.; Schmieden, H.; Schönning, K.; Schopferer, S.; Schott, M.; Shevchenko, O. Yu.; Silva, L.; Sinha, L.; Sirtl, S.; Slunecka, M.; Sosio, S.; Sozzi, F.; Srnka, Aleš; Steiger, L.; Stolarski, M.; Šulc, M.; Sulej, R.; Suzuki, H.; Szabelski, A.; Szameitat, T.; Sznajder, P.; Takekawa, S.; Ter Wolbeek, J.; Tessaro, S.; Tessarotto, F.; Thibaud, F.; Uhl, S.; Uman, I.; Virius, M.; Wang, L.; Weisrock, T.; Wilfert, M.; Windmolders, R.; Wollny, H.; Zaremba, K.; Zavertyaev, M.; Zemlyanichkina, E.; Ziembicki, M.; Zink, A.

    2015-01-01

    Roč. 744, MAY 11 (2015), s. 250-259 ISSN 0370-2693 R&D Projects: GA MŠk(CZ) LO1212 Institutional support: RVO:68081731 Keywords : single spin asymmetries * scattering * distributions * ratio Subject RIV: BH - Optics, Masers, Lasers Impact factor: 4.787, year: 2015

  19. Cold tolerance is unaffected by oxygen availability despite changes in anaerobic metabolism

    Czech Academy of Sciences Publication Activity Database

    Boardman, L.; Sorensen, J. G.; Košťál, Vladimír; Šimek, Petr; Terblanche, J. S.

    2016-01-01

    Roč. 6, SEPT 13 (2016), č. článku 32856. ISSN 2045-2322 R&D Projects: GA ČR GA13-18509S Institutional support: RVO:60077344 Keywords : hypoxia * cold * insect Subject RIV: ED - Physiology Impact factor: 4.259, year: 2016 http://www.nature.com/articles/srep32856

  20. Transcobalamin C776G genotype modifies the association between vitamin B12 and homocysteine in older hispanics

    Science.gov (United States)

    Background: A common polymorphism, C776G, in the plasma B12 transport protein transcobalamin (TC), encodes for either proline or arginine at codon 259. This polymorphism may affect the affinity of TC for B12 and subsequent delivery of B12 to tissues. Methods: TC genotype and its associations with i...

  1. Intentions to Participate in Counselling among Front-Line, At-Risk Irish Government Employees: An Application of the Theory of Planned Behaviour

    Science.gov (United States)

    Hyland, Philip E.; McLaughlin, Christopher G.; Boduszek, Daniel; Prentice, Garry R.

    2012-01-01

    The study set out to examine intentions to engage in counselling among at-risk Irish government employees and the differential utility of two alternative theory of planned behaviour (TPB) models of behaviour to explain intentions to participate in counselling. Individuals (N = 259) employed in a front-line, at-risk occupation for the Irish…

  2. Portfolio optimization with short-selling and spin-glass

    NARCIS (Netherlands)

    Schianchi, A.; Bongini, L.; Degli Esposti, M.; Giardinà, C.

    2002-01-01

    n this paper, we solve a general problem of optimizing a portfolio in a futures markets framework, extending the previous work of Galluccio et al. [Physica A 259, 449 (1998)]. We allow for long buying/short selling of a relatively large number of assets, assuming a fixed level of margin requirement.

  3. Resonance – Journal of Science Education | News

    Indian Academy of Sciences (India)

    The Central Dogma of Molecular Biology - A Retrospective after Fifty Years · Michel Morange · More Details Fulltext PDF. pp 248-258 General Article. Chemistry is Everygreen - 2008 Nobel Prize in Chemistry · Swagata Dasgupta · More Details Fulltext PDF. pp 259-271 Series Article. Snippets of Physics - Hubble Expansion ...

  4. Susceptibility of Some Bacterial Contaminants Recovered from ...

    African Journals Online (AJOL)

    Tropical Journal of Pharmaceutical Research February 2014; 13 (2): 255-259. ISSN: 1596-5996 (print); .... buffer pH 7. ... of each container are also given in Table 1. .... This investigation was performed to find out .... Microbiological quality of.

  5. Proton irradiation: a key to the challenge of N-glycosidic bond formation in a prebiotic context

    Czech Academy of Sciences Publication Activity Database

    Saladino, R.; Bizzarri, B.M.; Botta, L.; Šponer, Jiří; Šponer, Judit E.; Georgelin, T.; Jaber, M.; Rigaud, B.; Kapralov, M.; Timoshenko, G. N.; Rozanov, A.; Krasavin, E.; Timperio, A.M.; Di Mauro, E.

    2017-01-01

    Roč. 7, NOV2017 (2017), č. článku 14709. ISSN 2045-2322 R&D Projects: GA ČR GA17-05076S Institutional support: RVO:68081707 Keywords : aqueous-solution * nucleic-acids * formamide * radicals Subject RIV: CE - Biochemistry OBOR OECD: Biochemistry and molecular biology Impact factor: 4.259, year: 2016

  6. 76 FR 62165 - Endangered and Threatened Wildlife and Plants; 12-Month Finding on a Petition To List Texas...

    Science.gov (United States)

    2011-10-06

    ... shell). They may also feed on organic particles in sediment using the large, muscular foot (an organ... detritus (Yeager et al. 1994, pp. 253-259). Mussels tend to grow relatively rapidly for the first few years.... Juvenile freshwater mussels burrow into interstitial substrates and grow to a larger size that is less...

  7. Regional coherency of boreal forest growth defines Arctic driftwood provenancing

    Czech Academy of Sciences Publication Activity Database

    Hellmann, L.; Agafonov, L.; Churakova (Sidorova), O.; Düthorn, E.; Eggertsson, O.; Esper, J.; Kirdyanov, A. V.; Knorre, A. A.; Moiseev, P.; Myglan, V. S.; Nikolaev, A. N.; Reinig, F.; Schweingruber, F.; Solomina, O.; Tegel, W.; Büntgen, Ulf

    2016-01-01

    Roč. 39, sep (2016), s. 3-9 ISSN 1125-7865 Institutional support: RVO:67179843 Keywords : mackenzie river driftwood * tree-ring data * central siberia * origin * archipelago * holocene * ocean * sea * ice * circulation * Driftwood * Arctic * Dendro-provenancing * Boreal Subject RIV: EF - Botanics Impact factor: 2.259, year: 2016

  8. Millennial cycles of mean sea level excited by earth´s orbital variations

    Czech Academy of Sciences Publication Activity Database

    Chapanov, Y.; Ron, Cyril; Vondrák, Jan

    2015-01-01

    Roč. 12, č. 3 (2015), s. 259-266 ISSN 1214-9705 R&D Projects: GA ČR GA13-15943S Institutional support: RVO:67985815 Keywords : millenial cycles * mean sea level * Earth's insolation Subject RIV: BN - Astronomy, Celestial Mechanics, Astrophysics Impact factor: 0.561, year: 2015

  9. Numerical modelling of the reinforcing effect of geosynthetic material used in a ballasted railway tracks

    Czech Academy of Sciences Publication Activity Database

    Jiroušek, Ondřej; Jíra, J.; Hrdlička, Ondřej; Kunecký, Jiří; Kytýř, Daniel; Vyčichl, J.; Doktor, Tomáš

    2010-01-01

    Roč. 224, č. 4 (2010), s. 259-267 ISSN 0954-4097 Institutional research plan: CEZ:AV0Z20710524 Keywords : railway track bed * reinforcing geogrid * finite-element modelling * settlement reduction * contact analysis * ballast material Subject RIV: JN - Civil Engineering Impact factor: 0.389, year: 2010 http://journals.pepublishing.com/content/k561040632411117/

  10. A highly diverse spectrum of naphthoquinone derivatives produced by the endophytic fungus Biatriospora sp CCF 4378

    Czech Academy of Sciences Publication Activity Database

    Stodůlková, Eva; Man, Petr; Kuzma, Marek; Černý, J.; Císařová, I.; Kubátová, A.; Chudíčková, Milada; Kolařík, Miroslav; Flieger, Miroslav

    2015-01-01

    Roč. 60, č. 3 (2015), s. 259-267 ISSN 0015-5632 R&D Projects: GA MŠk(CZ) LD13039; GA ČR GA13-16565S Institutional support: RVO:61388971 Keywords : NECTRIA-HAEMATOCOCCA * ASCOMYCETOUS FUNGUS * BIOLOGICAL-ACTIVITY Subject RIV: EE - Microbiology, Virology Impact factor: 1.335, year: 2015

  11. Bidirectional Influences between Maternal Parenting and Children's Peer Problems: A Longitudinal Monozygotic Twin Difference Study

    Science.gov (United States)

    Yamagata, Shinji; Takahashi, Yusuke; Ozaki, Koken; Fujisawa, Keiko K.; Nonaka, Koichi; Ando, Juko

    2013-01-01

    This twin study examined the bidirectional relationship between maternal parenting behaviors and children's peer problems that were not confounded by genetic and family environmental factors. Mothers of 259 monozygotic twin pairs reported parenting behaviors and peer problems when twins were 42 and 48 months. Path analyses on monozygotic twin…

  12. Intergenerational Solidarity and Support Between Adult Siblings

    NARCIS (Netherlands)

    Voorpostel, Marieke; Blieszner, Rosemary

    2008-01-01

    Using a Dutch national sample containing 1,259 triads (two siblings, one parent), we examined whether practical support and emotional support between siblings are enhanced by intergenerational solidarity and how this differs for brothers and sisters. Sibling support was affected by sibling dyad

  13. ADHD Medication Vacations and Parent-Child Interactions by Gender

    Science.gov (United States)

    Barnard-Brak, Lucy; Schmidt, Marcelo; Sulak, Tracey

    2013-01-01

    Objective: The purpose of the current study was to examine medication vacations among children with ADHD according to parent-child dyads (e.g., mother-son, father-daughter, mother-daughter, and father-son). Method: In a survey study of 259 parents of children with ADHD, the use of medication vacations according to parent-child sex dyads was…

  14. White-nose syndrome without borders: Pseudogymnoascus destructans infection tolerated in Europe and Palearctic Asia but not in North America

    Czech Academy of Sciences Publication Activity Database

    Zukal, Jan; Banďouchová, H.; Brichta, J.; Cmoková, A.; Jaron, K. S.; Kolařík, Miroslav; Kováčová, V.; Kubátová, A.; Nováková, Alena; Orlov, O.; Pikula, J.; Presetnik, P.; Šuba, J.; Zahradníková Jr., A.; Martínková, Natália

    2016-01-01

    Roč. 6, č. 19829 (2016), č. článku 19829. ISSN 2045-2322 R&D Projects: GA ČR(CZ) GAP506/12/1064 Institutional support: RVO:68081766 ; RVO:61388971 Keywords : White-nose syndrome * zoonotic viruses * emerging disease Subject RIV: EG - Zoology; EE - Microbiology, Virology (MBU-M) Impact factor: 4.259, year: 2016

  15. Effects of Tropospheric O3 on Trembling Aspen and Interaction with CO2: Results From An O3-Gradient and a Face Experiment

    Science.gov (United States)

    D.F. Karnosky; B. Mankovska; K. Percy; R.E. Dickson; G.K. Podila; J. Sober; A. Noormets; G. Hendrey; Mark D. Coleman; M. Kubiske; K.S. Pregitzer; J.G. Isebrands

    1999-01-01

    Abstract. Over the years, a series of trembling aspen (Populus tremuloides Michx.) clones differing in O3 sensitivity have been identified from OTC studies. Three clones (216 and 271[(O3 tolerant] and 259 [O3 sensitive]) have been characterized for O3...

  16. Ultra-low gossypol cottonseed: gene-silencing opens up a vast, but underutilized protein resource for human nutrition

    Science.gov (United States)

    Cotton, grown mainly for its fiber, is a major crop in several developing and developed countries across the globe. In 2012, 48.8 million metric tons (MMT) of cottonseed was produced worldwide as a by-product of the 25.9 MMT of cotton lint production (FAO Production Statistics). This amount of cot...

  17. Nasal Staphylococcus aureus and methicillin-resistant Staphylococcus aureus carriage among college student athletes in northern Taiwan

    Directory of Open Access Journals (Sweden)

    Hong-Kai Wang

    2017-08-01

    Full Text Available Of 259 college students in northern Taiwan surveyed, nasal carriage rate of Staphylococcus aureus and methicillin-resistant S. aureus (MRSA was 22.4% and 1.54%, respectively and no significant difference was found between athlete students and non-athlete students. Three of four MRSA isolates belonged to sequence type 59, the endemic community clone.

  18. An Evaluation of Two Different Methods of Assessing Independent Investigations in an Operational Pre-University Level Examination in Biology in England.

    Science.gov (United States)

    Brown, Chris

    1998-01-01

    Explored aspects of assessment of extended investigation ("project") practiced in the operational examinations of The University of Cambridge Local Examinations Syndicate (UCLES) for the perspective of construct validity. Samples of the 1993 (n=333) and 1996 (n=259) biology test results reveal two methods of assessing the project. (MAK)

  19. Novel electrochemical route to cleaner fuel dimethyl ether

    Czech Academy of Sciences Publication Activity Database

    Cassone, Giuseppe; Pietrucci, F.; Saija, F.; Guyot, Y.; Šponer, Jiří; Šponer, Judit E.; Saitta, A. M.

    2017-01-01

    Roč. 7, JUL2017 (2017), č. článku 6901. ISSN 2045-2322 Institutional support: RVO:68081707 Keywords : initio molecular-dynamics * solid-acid catalysts * electric-fields Subject RIV: CG - Electrochemistry OBOR OECD: Electrochemistry (dry cells, batteries, fuel cells, corrosion metals, electrolysis) Impact factor: 4.259, year: 2016

  20. Impaired binding of 14-3-3 to C-RAF in noonan syndrome suggests new approaches in diseases with increased ras signaling

    NARCIS (Netherlands)

    Molzan, M.; Schumacher, B.; Ottmann, C.; Baljuls, A.; Polzien, L.; Weyand, M.; Thiel, P.; Rose, R.; Rose, M.; Kuhenne, P.; Kaiser, M.; Rapp, U.R.; Kuhlmann, J.; Ottmann, C.

    2010-01-01

    The Ras-RAF-mitogen-activated protein kinase (Ras-RAF-MAPK) pathway is overactive in many cancers and in some developmental disorders. In one of those disorders, namely, Noonan syndrome, nine activating C-RAF mutations cluster around Ser(259), a regulatory site for inhibition by 14-3-3 proteins. We

  1. Mitochondrial biogenesis in brown adipose tissue is associated with differential expression of transcription regulatory factors

    Czech Academy of Sciences Publication Activity Database

    Villena, J. A.; Carmona, M. C.; Rodriguez de la Concepción, M.; Rossmeisl, Martin; Vinas, O.; Mampel, T.; Iglesias, R.; Giralt, M.; Villarroya, F.

    2002-01-01

    Roč. 59, č. 11 (2002), s. 1934-1944 ISSN 1420-682X Grant - others:Ministerio de Ciencia y Tecnología (ES) PM98.0188 Institutional research plan: CEZ:AV0Z5011922 Keywords : brown adipose tissue * mitochondria * transcription factors Subject RIV: EB - Genetics ; Molecular Biology Impact factor: 5.259, year: 2002

  2. Correction circuits of 'Saturne' synchrotron

    International Nuclear Information System (INIS)

    Neyret, G.; Parain, J.

    1960-01-01

    The main defects of the magnetic field concern the index value, the position of the magnetic median plane and the residual ripple. For each of the defects, the methods of correcting are explained as well as their practical realisation and some experimental results are given. Reprint of a paper published in Nuclear Instruments and Methods in Physics Research, 5, p. 259-265, 1959

  3. Paradoxical Effects of Warning in the Production of Children's False Memories

    Science.gov (United States)

    Del Prete, Francesco; Mirandola, Chiara; Konishi, Mahiko; Cornoldi, Cesare; Ghetti, Simona

    2014-01-01

    The effects of warning on false recognition and associated subjective experience of false recollection and familiarity were investigated in 7-to 13-year-old children and young adults (N = 259) using the Deese-Roediger-McDermott (DRM) paradigm. Two warning conditions (warning with an example of a critical lure and warning without an example of a…

  4. Brief Report: Anal Cancer in the HIV-Positive Population: Slowly Declining Incidence After a Decade of cART

    NARCIS (Netherlands)

    Richel, Olivier; van der Zee, Ramon P.; Smit, Colette; de Vries, Henry J. C.; Prins, Jan M.

    2015-01-01

    We surveyed trends in incidence (1995-2012) and risk factors for anal cancer in the Dutch HIV-positive population. After an initial increase with a peak incidence in 2005-2006 of 114 [95% confidence interval (CI): 74 to 169] in all HIV+ patients and 168 (95% CI: 103 to 259) in HIV+ men who have sex

  5. Variability of space-use patterns in a free living eusocial rodent, Ansell’s mole-rat indicates age-based rather than caste polyethism

    Czech Academy of Sciences Publication Activity Database

    Šklíba, Jan; Lövy, M.; Burda, H.; Šumbera, R.

    2016-01-01

    Roč. 6, DEC 06 (2016), č. článku 37497. ISSN 2045-2322 EU Projects: European Commission(XE) 669609 - Diversity6continents Institutional support: RVO:60077344 Keywords : eusocial rodent * mole-rats * Fukomys anselli Subject RIV: EG - Zoology OBOR OECD: Zoology Impact factor: 4.259, year: 2016 https://www.nature.com/articles/srep37497

  6. ETHNOBOTANICAL STUDIES OF WEST AFRICAN OKRA ...

    African Journals Online (AJOL)

    Administrator

    18-87 years old. Of this number, 259 (48%) ... Traditional uses of the crop include food (100%) and non- ... inter-relationship studies between people and plants in the ..... of economic plants sold in the market of Benin City (Edo State). Nigeria.

  7. Experimental study and thermodynamic modelling of the B-Fe-Mn ternary system

    Czech Academy of Sciences Publication Activity Database

    Repovský, P.; Homolová, V.; Čiripová, L.; Kroupa, Aleš; Zemanová, Adéla

    2016-01-01

    Roč. 55, DEC (2016), s. 252-259 ISSN 0364-5916 R&D Projects: GA ČR GA14-15576S Institutional support: RVO:68081723 Keywords : thermodynamic modelling * phase diagram * borides Subject RIV: BJ - Thermodynamic s Impact factor: 1.600, year: 2016

  8. Myocardial scintigraphy. Clinical use and consequence in a non-invasive cardiological department

    DEFF Research Database (Denmark)

    Dümcke, Christine Elisabeth; Graff, J; Rasmussen, SPL

    2006-01-01

    to analyse the clinical use of MPI in a university hospital without invasive cardiological laboratory. MATERIAL AND METHODS: In the period 01.01.2002 to 31.12.2003, 259 patients (141 women, 118 men) were referred to MPI from our department of cardiology. RESULTS: Normal MPI was seen in 111 patients (43...

  9. Entanglement and nonclassicality in four-mode Gaussian states generated via parametric down-conversion and frequency up-conversion

    Czech Academy of Sciences Publication Activity Database

    Arkhipov, Ie.I.; Peřina Jr., J.; Haderka, Ondřej; Allevi, A.; Bondani, M.

    2016-01-01

    Roč. 6, Sep (2016), 1-12, č. článku 33802. ISSN 2045-2322 Institutional support: RVO:68378271 Keywords : four-mode Gaussian states * parametric down-conversion Subject RIV: BH - Optics, Masers, Lasers Impact factor: 4.259, year: 2016

  10. Effects of feeding corn silage, pelleted, ensiled, or pelleted and ...

    African Journals Online (AJOL)

    2017-09-14

    Sep 14, 2017 ... However, lambs fed CS gained weight 21.3% faster than lambs fed AH (259 versus 213 ... ground, pelleted alfalfa more closely resembles a concentrate feed in terms of particle size. .... Vitamin E, 44 IU/g .... feed to reach their market weight versus 102.5 kg of feed for the lambs fed alfalfa haylage (P <0.01).

  11. Rb–Sr and Sm–Nd study of granite–charnockite association in the ...

    Indian Academy of Sciences (India)

    tinent along the Cauvery Shear Zone (CSZ), a site ... affect the time-related accumulation of radiogenic isotopes of Sr and Nd in a ... KKPT shear zone separates these two domains of ..... In some patches, grain size increases from the margin ...... Petrol. 40(3) 259–273. Endo T, Tsunogae T and Santosh M 2012 Mineral equi-.

  12. The Palin Parent Rating Scales: Parents' Perspectives of Childhood Stuttering and Its Impact

    Science.gov (United States)

    Millard, Sharon K.; Davis, Stephen

    2016-01-01

    Purpose: The goal of this study is to explore the psychometric properties of the Parent Rating Scales-V1 (S. K. Millard, S. Edwards, & F. M. Cook, 2009), an assessment tool for parents of children who stutter, and to refine the measure accordingly. Method: We included 259 scales completed prior to therapy. An exploratory factor analysis…

  13. Field-induced exciton condensation in LaCoO.sub.3./sub.

    Czech Academy of Sciences Publication Activity Database

    Sotnikov, A.; Kuneš, Jan

    2016-01-01

    Roč. 6, Jul (2016), 1-6, č. článku 30510. ISSN 2045-2322 EU Projects: European Commission(XE) 646807 - EXMAG Institutional support: RVO:68378271 Keywords : exciton condensation * LaCoO 3 * dynamical mean-field theory Subject RIV: BM - Solid Matter Physics ; Magnetism Impact factor: 4.259, year: 2016

  14. Lipid Driven Nanodomains in Giant Lipid Vesicles are Fluid and Disordered

    Czech Academy of Sciences Publication Activity Database

    Koukalová, Alena; Amaro, Mariana; Aydogan, Gokcan; Gröbner, G.; Williamson, P. T. F.; Mikhalyov, I.; Hof, Martin; Šachl, Radek

    2017-01-01

    Roč. 7, JUL 2017 (2017), č. článku 5460. ISSN 2045-2322 R&D Projects: GA ČR GA17-03160S Institutional support: RVO:61388955 Keywords : FLUORESCENCE CORRELATION SPECTROSCOPY * PLASMA-MEMBRANE VESICLES * RESONANCE ENERGY-TRANSFER Subject RIV: CF - Physical ; Theoretical Chemistry OBOR OECD: Physical chemistry Impact factor: 4.259, year: 2016

  15. Additional observations on Philometra spp. (Nematoda: Philometridae) in marine fishes off Iraq, with the description of two new species

    Czech Academy of Sciences Publication Activity Database

    Moravec, František; Ali, A. H.

    2014-01-01

    Roč. 87, č. 3 (2014), s. 259-271 ISSN 0165-5752 R&D Projects: GA ČR GBP505/12/G112 Institutional support: RVO:60077344 Keywords : systematic status * India * Philometridae Subject RIV: EA - Cell Biology Impact factor: 1.336, year: 2014

  16. Sadhana | Indian Academy of Sciences

    Indian Academy of Sciences (India)

    Home; Journals; Sadhana. R Bremananth. Articles written in Sadhana. Volume 31 Issue 3 June 2006 pp 259-276. New methodology for a person identification system · R Bremananth A Chitra · More Details Abstract Fulltext PDF. Reliable person identification is a key factor for any safety measure. Unlike other biometrics ...

  17. Role of guard rings in improving the performance of silicon detectors

    Indian Academy of Sciences (India)

    number of free charge carriers thus produced is proportional to the energy deposited. 259 .... grounding the innermost guard ring of a strip detector of geometry 60 × 60 mm2. ... The guard ring was kept floating with no electrical connection .... ment of maintaining high-quality semiconductor properties during high temperature.

  18. Circulating nucleic acids as a new diagnostic tool

    Czech Academy of Sciences Publication Activity Database

    Urbanová, Markéta; Plzák, J.; Strnad, Hynek; Betka, J.

    2010-01-01

    Roč. 15, č. 2 (2010), s. 242-259 ISSN 1425-8153 R&D Projects: GA MŠk 2B06106 Institutional research plan: CEZ:AV0Z50520514 Keywords : circulating nucleic acids * diagnostics * cancer Subject RIV: EB - Genetics ; Molecular Biology Impact factor: 1.455, year: 2010

  19. Cyclin a down - regulation in TGFb1 - arrested follicular lymphoma cells

    Czech Academy of Sciences Publication Activity Database

    Djaborkhel, Rashed; Tvrdík, Daniel; Eckschlager, T.; Raška, Ivan; Müller, Julius

    2000-01-01

    Roč. 261, - (2000), s. 250-259 ISSN 0014-4827 R&D Projects: GA ČR GA304/00/1481 Institutional research plan: CEZ:AV0Z5039906 Subject RIV: EB - Genetics ; Molecular Biology Impact factor: 3.860, year: 2000

  20. Resonance – Journal of Science Education | News

    Indian Academy of Sciences (India)

    More Details Fulltext PDF. pp 257-258. Author Index · More Details Fulltext PDF. pp 259-264. Subject Index · More Details Fulltext PDF. pp 265-266. Index · More Details Fulltext PDF. pp 267-267 Flowering Trees. Prima Vera · More Details Fulltext PDF. pp 268-268 Featured Scientist. C. V. Raman · More Details Fulltext PDF ...

  1. Genetic variation in ABC transporter A1 contributes to HDL cholesterol in the general population

    DEFF Research Database (Denmark)

    Frikke-Schmidt, Ruth; Nordestgaard, Børge G; Jensen, Gorm B

    2004-01-01

    on lipid traits in 9,259 individuals from the general population. Heterozygosity for ABCA1 mutations was identified in 10% of individuals with low HDL-C only. Three of 6 nonsynonymous SNPs (V771M, V825I, and R1587K) were associated with increases or decreases in HDL-C in women in the general population...

  2. 78 FR 31599 - Notice of Quarterly Report (January 2013-March 31, 2013)

    Science.gov (United States)

    2013-05-24

    ... and secondary pipelines (kilometers). Restructure and rehabilitate tertiary pipelines (kilometers...,259 Increase the $30,030,971 Screening for adoption of hypertension behaviors that (percent). reduce... implementation. Secondary National Roads $214,493,000 Reduce $27,440,528 Kilometers of road Development Project...

  3. Forensic Index and Substance Abuse among Psychiatric Patients ...

    African Journals Online (AJOL)

    Although forensic index and substance use are crucial issues in clinical work among mentally ill patients, studies emanating from psychiatric facilities in nonwestern cultures have been relatively scarce. This paper examines this issue in a tertiary health institution. Participants were 259 mentally ill patients (124 inpatients ...

  4. The co-evolutionary relationship between bitterling fishes and freshwater mussels: insights from interspecific comparisons

    Czech Academy of Sciences Publication Activity Database

    Reichard, Martin; Liu, H.; Smith, C.

    2007-01-01

    Roč. 9, č. 2 (2007), s. 239-259 ISSN 1522-0613 Grant - others:NSFC(CN) 30470237 Institutional research plan: CEZ:AV0Z60930519 Keywords : brood parasitism * co-evolution * egg ejection * host-parasite relationship * mutualism * oviposition Subject RIV: EG - Zoology Impact factor: 1.409, year: 2007

  5. Combined astrometric catalogue EOC-3 An improved reference frame for long-term Earth rotation studies

    Czech Academy of Sciences Publication Activity Database

    Vondrák, Jan; Štefka, Vojtěch

    2007-01-01

    Roč. 463, č. 2 (2007), s. 783-788 ISSN 0004-6361 R&D Projects: GA MŠk(CZ) LC506 Institutional research plan: CEZ:AV0Z10030501 Keywords : reference systems * astrometry * catalogs Subject RIV: BN - Astronomy, Celestial Mechanics, Astrophysics Impact factor: 4.259, year: 2007

  6. The Effect of Participation in Professional Development on Perceived Change in Teaching Practice by Minnesota K-12 Physical Education Teachers

    Science.gov (United States)

    Sertich, Sally Krause

    2013-01-01

    This study used a conceptual framework of professional development theory to identify characteristics of effective learning activities specific to 259 Minnesota K-12 public school physical education and developmental adapted physical education (PE/DAPE) teachers during 2012-2013. Study results confirmed that as PE/DAPE teacher participation in…

  7. Tallink võttis kompromissi vastu, ametiühing mitte / Helga Koger

    Index Scriptorium Estoniae

    Koger, Helga, 1945-

    2008-01-01

    Tallink võttis vastu riikliku lepitaja kompromissettepaneku ja on valmis tõstma Eesti lipu all sõitvate laevade töötajate eelmises palgaleppes fikseeritud palka järgmisel kolmel aastal vastavalt 25,9 ja 6 protsendi võrra

  8. New taxa and new records of oribatid mites of the family Galumnidae (Acari: Oribatida) from Ecuador

    Czech Academy of Sciences Publication Activity Database

    Ermilov, S.G.; Starý, Josef; Sandmann, D.; Marian, F.; Maraun, M.

    2013-01-01

    Roč. 3700, č. 2 (2013), s. 259-270 ISSN 1175-5326 Institutional research plan: CEZ:AV0Z60660521 Institutional support: RVO:60077344 Keywords : Oribatida * Galumnidae * new species * Ecuador Subject RIV: EG - Zoology Impact factor: 1.060, year: 2013

  9. Chemically different non-thermal plasmas target distinct cell death pathways

    Czech Academy of Sciences Publication Activity Database

    Lunov, O.; Zablotskyy, V.; Chrupina, O.; Lunova, M.; Jirsa, M.; Dejneka, A.; Kubinová, Šárka

    2017-01-01

    Roč. 7, apr (2017), s. 600 ISSN 2045-2322 R&D Projects: GA MŠk(CZ) LO1309 Institutional support: RVO:68378041 Keywords : chemically different * non-thermal plasmas * target distinct cell death pathways Subject RIV: FP - Other Medical Disciplines OBOR OECD: Biophysics Impact factor: 4.259, year: 2016

  10. Influence of doxorubicin on model cell membrane properties: insights from in vitro and in silico studies

    Czech Academy of Sciences Publication Activity Database

    Alves, A. C.; Magarkar, Aniket; Horta, M.; Lima, J. L. F. C.; Bunker, A.; Nunes, C.; Reis, S.

    2017-01-01

    Roč. 7, Jul 24 (2017), č. článku 6343. ISSN 2045-2322 Institutional support: RVO:61388963 Keywords : P-glycoprotein * molecular dynamics * multidrug resistance Subject RIV: CF - Physical ; Theoretical Chemistry OBOR OECD: Physical chemistry Impact factor: 4.259, year: 2016 https://www.nature.com/articles/s41598-017-06445-z

  11. A rare-earth free magnesium alloy with improved intrinsic ductility

    Czech Academy of Sciences Publication Activity Database

    Sandlöbes, S.; Friák, Martin; Korte-Ketzel, S.; Pei, Z.; Neugebauer, J.; Raabe, D.

    2017-01-01

    Roč. 7, SEP (2017), č. článku 10458. ISSN 2045-2322 Institutional support: RVO:68081723 Keywords : MECHANICAL-PROPERTIES * MG-ZN * PRISMATIC-SLIP * DEFORMATION-BEHAVIOR Subject RIV: BM - Solid Matter Physics ; Magnetism OBOR OECD: Condensed matter physics (including formerly solid state physics, supercond.) Impact factor: 4.259, year: 2016

  12. Magnetoelasticity of UNi.sub.2./sub.Si.sub.2./sub..

    Czech Academy of Sciences Publication Activity Database

    Honda, F.; Oomi, G.; Andreev, Alexander V.; Sechovský, V.; Menovsky, A. A.

    259-261, - (1999), s. 256-257 ISSN 0921-4526 R&D Projects: GA AV ČR IAA1010614 Grant - others:GA UK(CZ) 40/97 Institutional research plan: CEZ:AV0Z1010914 Subject RIV: BM - Solid Matter Physics ; Magnetism Impact factor: 0.725, year: 1999

  13. Back-transformation of treatment differences - an approximate method

    DEFF Research Database (Denmark)

    Laursen, Rikke Pilmann; Dalskov, Stine-Mathilde; Damsgaard, Camilla Trab

    2014-01-01

    Background/Objectives:Transformation of outcomes is frequently used in the analysis of studies in clinical nutrition. However, back-transformation of estimated treatment means and differences is complicated by the nonlinear nature of the transformations. It is not straightforward to obtain an est...... publication, 11 December 2013; doi:10.1038/ejcn.2013.259....

  14. Changes in white blood cells in sheep blood during selenium supplementation

    Czech Academy of Sciences Publication Activity Database

    Písek, L.; Trávníček, J.; Salát, Jiří; Kroupová, V.; Soch, M.

    2008-01-01

    Roč. 53, č. 5 (2008), s. 255-259 ISSN 0375-8427 R&D Projects: GA ČR GD523/03/H076 Institutional research plan: CEZ:AV0Z60220518 Keywords : ewes * immunity * T lymphocytes * CD4(+) * CD8(+) Subject RIV: GG - Livestock Rearing Impact factor: 0.659, year: 2008

  15. Selenium protects the immature rat heart against ischemia/reperfusion injury

    Czech Academy of Sciences Publication Activity Database

    Ošťádalová, Ivana; Vobecký, Miloslav; Chvojková, Zuzana; Miková, D.; Hampl, V.; Wilhelm, J.; Ošťádal, Bohuslav

    2007-01-01

    Roč. 300, 1-2 (2007), s. 259-267 ISSN 0300-8177 R&D Projects: GA MŠk(CZ) 1M0510 Institutional research plan: CEZ:AV0Z50110509; CEZ:AV0Z40310501 Keywords : selenium * immature heart * ischemia Subject RIV: ED - Physiology Impact factor: 1.707, year: 2007

  16. Parenting and Family Stress as Mediators of the Long-Term Effects of Child Abuse.

    Science.gov (United States)

    Wind, Tiffany Weissmann; Silvern, Louise

    1994-01-01

    Data on child physical/sexual abuse, family stress histories, perceived parental warmth, and current psychological functioning were gathered from 259 working women. Multiple regression analyses showed that parental warmth strongly influenced or mediated the relationship of intrafamilial child abuse to depression and self-esteem levels. However,…

  17. Photosystem II electron transport rates and oxygen production in natural waterblooms of freshwater cyanobacteria during a diel cycle

    Czech Academy of Sciences Publication Activity Database

    Masojídek, Jiří; Grobbelaar, J. U.; Pechar, Libor; Koblížek, Michal

    2001-01-01

    Roč. 23, č. 1 (2001), s. 57-66 ISSN 0142-7873 R&D Projects: GA ČR GA206/96/1222 Institutional research plan: CEZ:AV0Z5020903 Keywords : electron transport * evolution Subject RIV: CE - Biochemistry Impact factor: 1.259, year: 2001

  18. T Plant secondary containment and leak detection upgrades

    International Nuclear Information System (INIS)

    Carlson, T.A.

    1995-01-01

    The W-259 project will provide upgrades to the 2706-T/TA Facility to comply with Federal and State of Washington environmental regulations for secondary containment and leak detection. The project provides decontamination activities supporting the environmental restoration mission and waste management operations on the Hanford Site

  19. Are Chileans exposed to dietary furan?

    DEFF Research Database (Denmark)

    Mariotti, Maria; Toledo, Carla; Hevia, Karen

    2013-01-01

    ) and low moisture starchy products like crisps and “soda”-type crackers showed the highest furan concentrations (259 and 91 ng g−1, respectively). Furthermore, furan was also found in samples of breakfast cereals (approximately 20 ng g−1), jarred fruit baby foods (8.5 ng g−1) and orange juice (7.0 ng g−1...

  20. Vegetable and animal products as determinants of colon cancer risk in Dutch men and women

    NARCIS (Netherlands)

    Kampman, E.; Verhoeven, D.; Sloots, L.; Veer, P. van 't

    1995-01-01

    To examine the relationship between colon cancer and food groups from vegetable or animal sources and their possible interactions with gender, we analyzed data from a Dutch case-control study. Dietary patterns were assessed for 232 colon cancer cases and 259 population controls. In multivariate

  1. Reproductive and hormonal factors in male and female colon cancer

    NARCIS (Netherlands)

    Kampman, E.; Bijl, A.J.; Kok, C.; Veer, P. van 't

    1994-01-01

    We analysed data from a case-control study in the Netherlands in order to investigate whether reproductive events and hormonal factors are similarly related to colon cancer risk in men and women after adjustment for dietary factors. In total, 232 colon cancer cases (102 women, 130 men) and 259

  2. p53 Over-expression and p53 mutations in colon carcinomas: Relation to dietary risk factors

    NARCIS (Netherlands)

    Voskuil, D.W.; Kampman, E.; Kraats, A.A. van; Balder, H.F.; Muijen, G.N.P. van; Goldbohm, R.A.; Veer, P. van 't

    1999-01-01

    Epidemiological studies have suggested that dietary factors may differently affect p53-dependent and p53-independent pathways to colon cancer. Results of such studies may depend on the method used to assess p53 status. This case-control study of 185 colon-cancer cases and 259 controls examines this

  3. Journal for Language Teaching - Vol 36, No 3-4 (2002)

    African Journals Online (AJOL)

    Shortcomings of the written survey questionnaire for discovering language learner perceptions: reflections of a researcher · EMAIL FULL TEXT EMAIL FULL TEXT · DOWNLOAD FULL TEXT DOWNLOAD FULL TEXT. Gary P. Barkhuizen, 259-272. http://dx.doi.org/10.4314/jlt.v36i3-4.5991 ...

  4. Operational test report for 2706-T complex liquid transfer system

    International Nuclear Information System (INIS)

    BENZEL, H.R.

    1999-01-01

    This document is the Operational Test Report (OTR). It enters the Record Copy of the W-259 Operational Test Procedure (HNF-3610) into the document retrieval system. Additionally, the OTR summarizes significant issues associated with testing the 2706-T waste liquid transfer and storage system

  5. N-terminal tetrapeptide T/SPLH motifs contribute to multimodal activation of human TRPA1 channel

    Czech Academy of Sciences Publication Activity Database

    Hynková, Anna; Maršáková, Lenka; Vašková, Jana; Vlachová, Viktorie

    2016-01-01

    Roč. 6, Jun 27 (2016), s. 28700 ISSN 2045-2322 R&D Projects: GA ČR(CZ) GA15-15839S Institutional support: RVO:67985823 Keywords : ankyrin receptor subtype 1 * transient receptor potential * gating * ankyrin repeat * whole-cell electrophysiology * N-terminus * mutagenesis Subject RIV: FH - Neurology Impact factor: 4.259, year: 2016

  6. The Hardy inequality with boundary or intermediate conditions

    Czech Academy of Sciences Publication Activity Database

    Kufner, Alois

    2017-01-01

    Roč. 8, č. 2 (2017), s. 105-109 ISSN 2077-9879 Institutional support: RVO:67985840 Keywords : Hardy's inequality * boundary conditions Subject RIV: BA - General Mathematics OBOR OECD: Pure mathematics http://www.mathnet.ru/ php /archive.phtml?wshow=paper&jrnid=emj&paperid=259&option_lang=eng

  7. The effect of the position of oxygen group to the aromatic ring to emission performance in a heavy-duty diesel engine

    NARCIS (Netherlands)

    Zhou, L.; Boot, M.D.; Goey, de L.P.H.

    2012-01-01

    In this paper the soot-NOx trade-off and fuel efficiency of various aromatic oxygenates is investigated in a modern DAF heavy-duty diesel engine. All oxygenates were blended to diesel fuel such that the blend oxygen concentration was 2.59 wt.-%. The oxygenates in question, anisole, benzyl alcohol

  8. Comparison of Biomass and Lipid Production under Ambient Carbon Dioxide Vigorous Aeration and 3% Carbon Dioxide Condition Among the Lead Candidate Chlorella Strains Screened by Various Photobioreactor Scales

    Energy Technology Data Exchange (ETDEWEB)

    Kobayashi, Naoko [Univ. of Nebraska, Lincoln, NE (United States); Barnes, Austin [Univ. of Nebraska, Lincoln, NE (United States); Jensen, Travis [Univ. of Nebraska, Lincoln, NE (United States); Noel, Eric [Univ. of Nebraska, Lincoln, NE (United States); Andlay, Gunjan [Synaptic Research, Baltimore, MD (United States); Rosenberg, Julian N. [Johns Hopkins Univ., Baltimore, MD (United States); Betenbaugh, Michael J. [Johns Hopkins Univ., Baltimore, MD (United States); Guarnieri, Michael T. [National Renewable Energy Lab. (NREL), Golden, CO (United States); Oyler, George A. [Univ. of Nebraska, Lincoln, NE (United States); Johns Hopkins Univ., Baltimore, MD (United States); Synaptic Research, Baltimore, MD (United States)

    2015-09-01

    Chlorella species from the UTEX collection, classified by rDNA-based phylogenetic analysis, were screened based on biomass and lipid production in different scales and modes of culture. Lead candidate strains of C. sorokiniana UTEX 1230 and C. vulgaris UTEX 395 and 259 were compared between conditions of vigorous aeration with filtered atmospheric air and 3% CO2 shake-flask cultivation. We found that the biomass of UTEX 1230 produced 2 times higher at 652 mg L-1 dry weight under both ambient CO2 vigorous aeration and 3% CO2 conditions, while UTEX 395 and 259 under 3% CO2 increased to 3 times higher at 863 mg L-1 dry weight than ambient CO2 vigorous aeration. The triacylglycerol contents of UTEX 395 and 259 increased more than 30 times to 30% dry weight with 3% CO2, indicating that additional CO2 is essential for both biomass and lipid accumulation in UTEX 395 and 259.

  9. Production of human papillomavirus type16 E7 oncoprotein fused with ß-glucuronidase in transgenic tomato and potato

    Czech Academy of Sciences Publication Activity Database

    Bříza, Jindřich; Pavingerová, Daniela; Vlasák, Josef; Ludvíková, V.; Niedermeierová, Hana

    2007-01-01

    Roč. 51, č. 2 (2007), s. 268-276 ISSN 0006-3134 R&D Projects: GA ČR GA521/05/2092 Institutional research plan: CEZ:AV0Z50510513 Keywords : transgenic plants * human papillomavirus Subject RIV: EB - Genetics ; Molecular Biology Impact factor: 1.259, year: 2007

  10. Weak tidal correlation of NW-Bohemia/Vogtland earthquake swarms

    Czech Academy of Sciences Publication Activity Database

    Fischer, Tomáš; Kalenda, Pavel; Skalský, Lumír

    2006-01-01

    Roč. 424, č. 3-4 (2006), s. 259-269 ISSN 0040-1951 R&D Projects: GA AV ČR IAA3012308 Institutional research plan: CEZ:AV0Z30460519 Keywords : Earth tides * earthquake swarm * triggered earthquakes Subject RIV: DC - Siesmology, Volcanology, Earth Structure Impact factor: 1.675, year: 2006

  11. Weak tidal correlation of NW-Bohemia/Vogtland earthquake swarms

    Czech Academy of Sciences Publication Activity Database

    Fischer, Tomáš; Kalenda, Pavel; Skalský, Lumír

    2006-01-01

    Roč. 424, č. 3-4 (2006), s. 259-269 ISSN 0040-1951 R&D Projects: GA AV ČR IAA3012308 Institutional research plan: CEZ:AV0Z30120515; CEZ:AV0Z30460519 Keywords : Earth tides * earthquake swarm * triggered earthquakes Subject RIV: DC - Siesmology, Volcanology, Earth Structure Impact factor: 1.675, year: 2006

  12. Dynamics of the biotopes at the edge of a medieval town: pollen analysis of Vltava river sediments in Prague, Czech Republic

    Czech Academy of Sciences Publication Activity Database

    Kozáková, Radka; Pokorný, Petr

    2007-01-01

    Roč. 79, - (2007), s. 259-281 ISSN 0032-7786 R&D Projects: GA AV ČR(CZ) IAAX00020701 Institutional research plan: CEZ:AV0Z80020508 Keywords : pollen analysis Subject RIV: AC - Archeology, Anthropology, Ethnology Impact factor: 2.064, year: 2007

  13. Discovery of the first dual inhibitor of the 5-lipoxygenase-activating protein and soluble epoxide hydrolase using pharmacophore-based virtual screening

    Czech Academy of Sciences Publication Activity Database

    Temml, V.; Garscha, U.; Romp, E.; Schubert, G.; Gerstmeier, J.; Kutil, Zsófia; Matuszczak, B.; Waltenberger, B.; Stuppner, H.; Werz, O.; Schuster, D.

    2017-01-01

    Roč. 7, FEB 20 (2017), č. článku 42751. ISSN 2045-2322 Institutional support: RVO:61389030 Keywords : activating protein * drug discovery * leukotriene biosynthesis * inflammatory diseases * conformer generation * arachidonic-acid * flap * challenges * asthma * risk Subject RIV: CE - Biochemistry OBOR OECD: Physiology (including cytology) Impact factor: 4.259, year: 2016

  14. effet de la macrofaune et des modes de gestion de la fertilité sur le ...

    African Journals Online (AJOL)

    crop in semi-arid West Africa. PhD Thesis. University and research centre, Wagenin- gen, The Netherland, 193 p. Ouédraogo E., Mando A., Brussaard L., 2004. Soil macrofaunal-mediated organic resource disappearance in semi-arid West Africa. Appl. Soil Ecol, 27 : 259 - 267. Ouédraogo E., Mando A., Stroosnijder L., 2006.

  15. 78 FR 25939 - Submission for OMB Review; Comment Request

    Science.gov (United States)

    2013-05-03

    ...) is predominate, or designate land on which HEL is predominated to be set aside, diverted, devoted to... erosion. Description of Respondents: Individuals or households; Business or other for-profit; Not-for-profit institutions; Federal Government; State, Local or Tribal Government. Number of Respondents: 259...

  16. liver cirrhosis from autoimmune hepatitis in a nigerian woman

    African Journals Online (AJOL)

    Autoimmune hepatitis (AIH) is a rare cause of chronic liver disease (CLD). It presents with ... chronic viral hepatitis and alcoholic liver disease, making it difficult to diagnose in .... effects.2,5,9 We opted for the Budesonide/AZA therapy because ...

  17. Central Gi(2) proteins, sympathetic nervous system and blood pressure regulation

    Czech Academy of Sciences Publication Activity Database

    Zicha, Josef

    2016-01-01

    Roč. 216, č. 3 (2016), s. 258-259 ISSN 1748-1708 Institutional support: RVO:67985823 Keywords : inhibitory G proteins * sympathetic nervous system * central blood pressure control Subject RIV: FA - Cardiovascular Diseases incl. Cardiotharic Surgery Impact factor: 4.867, year: 2016

  18. Sourcing in Professional Education: Do Text Factors Make Any Difference?

    Science.gov (United States)

    Bråten, Ivar; Strømsø, Helge I.; Andreassen, Rune

    2016-01-01

    The present study investigated the extent to which the text factors of source salience and emphasis on risk might influence readers' attention to and use of source information when reading single documents to make behavioral decisions on controversial health-related issues. Participants (n = 259), who were attending different bachelor-level…

  19. Calciopetersite from Domašov nad Bystřicí, Northen Moravia (Czech Republic), a new mineral species of the mixite group

    Czech Academy of Sciences Publication Activity Database

    Sejkora, J.; Novotný, P.; Novák, M.; Šrein, Vladimír; Berlepsch, P.

    2005-01-01

    Roč. 43, č. 4 (2005), 1393-1400 ISSN 0008-4476 Institutional research plan: CEZ:AV0Z30460519 Keywords : calciopetersite * new mineral species * X-ray poder diffraction Subject RIV: DB - Geology ; Mineralogy Impact factor: 1.259, year: 2005

  20. Atmospheric deceleration and light curves of Draconid meteors and implications for the structure of cometary dust

    Czech Academy of Sciences Publication Activity Database

    Borovička, Jiří; Spurný, Pavel; Koten, Pavel

    2007-01-01

    Roč. 473, č. 2 (2007), s. 661-672 ISSN 0004-6361 R&D Projects: GA ČR GA205/05/0543; GA AV ČR KJB300030502 Institutional research plan: CEZ:AV0Z10030501 Keywords : meteor * meteoroid * comet Subject RIV: BN - Astronomy, Celestial Mechanics, Astrophysics Impact factor: 4.259, year: 2007

  1. Příběh války. Vědecko-pedagogická konference v Poslanecké sněmovně Parlamentu ČR

    Czech Academy of Sciences Publication Activity Database

    Beranská, Veronika

    2017-01-01

    Roč. 104, č. 2 (2017), s. 259-261 ISSN 0009-0794 Institutional support: RVO:68378076 Keywords : World War II * Association of the Czechs from Volynia and their friends * Volynia Czechs * Chamber of deputies Parliament of the Czech Republic Subject RIV: AC - Archeology, Anthropology, Ethnology OBOR OECD: Antropology, ethnology

  2. Untitled

    African Journals Online (AJOL)

    presence of NaOEt led to d-diketones (1) in good yields compared to the ... (8) which further undergoes a Michael addition with a second molecule of acetophenone. .... 27. 12. - 1691, 1679. 其过. | ca81. | 259. 174L 165. | le,. NO.,. NO. 35. - f . F.

  3. Influence of non-thermal plasma on structural and electrical properties of globular and nanostructured conductive polymer polypyrrole in water suspension

    Czech Academy of Sciences Publication Activity Database

    Galář, P.; Khun, J.; Kopecký, D.; Scholtz, V.; Trchová, Miroslava; Fučíková, A.; Jirešová, J.; Fišer, L.

    2017-01-01

    Roč. 7, 08 November (2017), s. 1-10, č. článku 15068. ISSN 2045-2322 R&D Projects: GA ČR(CZ) GA17-04109S Institutional support: RVO:61389013 Keywords : conductive polymer * polypyrrole * plasma Subject RIV: CD - Macromolecular Chemistry OBOR OECD: Polymer science Impact factor: 4.259, year: 2016

  4. Probiotic activities of Rhizobium laguerreae on growth and quality of spinach

    Czech Academy of Sciences Publication Activity Database

    Jimenez-Gomez, A.; Flores-Felix, J.D.; García-Fraile, Paula; Mateos, P.F.; Menéndez, E.; Velazquez, E.; Rivas, R.

    2018-01-01

    Roč. 8, JAN 10 (2018), č. článku 295. ISSN 2045-2322 Institutional support: RVO:61388971 Keywords : ZEA-MAYS L. * PROMOTING RHIZOBACTERIA * MEDITERRANEAN DIET Subject RIV: EE - Microbiology, Virology OBOR OECD: Microbiology Impact factor: 4.259, year: 2016

  5. An Approach to Reduce the Sample Consumption for LIBS based Identification of Explosive Materials

    Czech Academy of Sciences Publication Activity Database

    Anubham, S.K.; Junjuri, R.; Myakalwar, A.K.; Gundawar, M.K.

    2017-01-01

    Roč. 67, č. 3 (2017), s. 254-259 ISSN 0011-748X Institutional support: RVO:67985882 Keywords : Laser induced breakdown spectroscopy * K - Nearest neighbour * Synthetic spectra Subject RIV: JB - Sensors, Measurment, Regulation OBOR OECD: Electrical and electronic engineering Impact factor: 0.500, year: 2016

  6. Polyaniline cryogels: Biocompatibility of novel conducting macroporous material

    Czech Academy of Sciences Publication Activity Database

    Humpolíček, P.; Radaszkiewicz, K. A.; Capáková, Z.; Pacherník, J.; Bober, Patrycja; Kašpárková, V.; Rejmontová, P.; Lehocký, M.; Ponížil, P.; Stejskal, Jaroslav

    2018-01-01

    Roč. 8, 09 January (2018), s. 1-12, č. článku 135. ISSN 2045-2322 R&D Projects: GA ČR(CZ) GA17-05095S Institutional support: RVO:61389013 Keywords : polyaniline * cryogel * biocompatibility Subject RIV: CD - Macromolecular Chemistry OBOR OECD: Polymer science Impact factor: 4.259, year: 2016

  7. Binary asteroid population. 1. Angular momentum content

    Czech Academy of Sciences Publication Activity Database

    Pravec, Petr; Harris, A. W.

    2007-01-01

    Roč. 190, č. 1 (2007), s. 250-259 ISSN 0019-1035 R&D Projects: GA ČR(CZ) GA205/05/0604 Institutional research plan: CEZ:AV0Z10030501 Keywords : asteroids * satellites of asteroids Subject RIV: BN - Astronomy, Celestial Mechanics, Astrophysics Impact factor: 2.869, year: 2007

  8. Vliv podmínek sladování na obsah dextrinů v meziproduktech výroby piva

    Czech Academy of Sciences Publication Activity Database

    Psota, V.; Čmelík, Richard; Sachambula, L.

    2011-01-01

    Roč. 57, 7-8 (2011), 253-259 ISSN 0023-5830 R&D Projects: GA MŠk 2B06037 Institutional research plan: CEZ:AV0Z40310501 Keywords : malting * dextrin * beer Subject RIV: CB - Analytical Chemistry, Separation

  9. Sickness absence and return to work rates in women with breast cancer

    NARCIS (Netherlands)

    Roelen, Corne A. M.; Koopmans, Petra C.; de Graaf, Jan H.; Balak, Fulya; Groothoff, Johan W.

    Most women are diagnosed with breast cancer when they are of working age. How long are breast cancer patients absent? How many of them return to work? ArboNed Occupational Health Services documents sickness absence data of 1 million workers of whom 40% were women. Between 2001 and 2005, 2,259 women

  10. Experimental Study of the Effect of Si/Al Composition on the Aluminum Distribution in (Al)MCM-41

    Czech Academy of Sciences Publication Activity Database

    Dědeček, Jiří; Žilková, Naděžda; Čejka, Jiří

    44-45, 1/3 (2001), s. 259-266 ISSN 1387-1811 R&D Projects: GA AV ČR IAA4040001; GA AV ČR IBS4040017 Institutional research plan: CEZ:AV0Z4040901 Keywords : (Al)MCM-41 * Al distribution * VIS spectroscopy Subject RIV: CF - Physical ; Theoretical Chemistry Impact factor: 2.497, year: 2001

  11. Characterization and crystal structure of a 17-membered macrocyclic Schiff base compound MeO-sal-pn-bn

    Czech Academy of Sciences Publication Activity Database

    Khalaji, A.D.; Ghoran, S.H.; Rohlíček, Jan; Dušek, Michal

    2015-01-01

    Roč. 56, č. 2 (2015), s. 259-265 ISSN 0022-4766 Grant - others:AV ČR(CZ) Praemium Academiae Institutional support: RVO:68378271 Keywords : macrocyclic * Schiff base * spectroscopy * powder diffraction * orthorhombic Subject RIV: BM - Solid Matter Physics ; Magnetism Impact factor: 0.536, year: 2015

  12. A Static Model of Abiotic Predictors and Forest Ecosystem Receptor Designed Using Dimensionality Reduction and Regression Analysis

    Czech Academy of Sciences Publication Activity Database

    Samec, P.; Rychtecká, P.; Tuček, P.; Bojko, J.; Zapletal, Miloš; Cudlín, Pavel

    2016-01-01

    Roč. 22, č. 2 (2016), s. 259-274 ISSN 1392-1355 R&D Projects: GA MŠk(CZ) LO1415 Institutional support: RVO:67179843 Keywords : forest state monitoring * EMEP-LRTAP * floodplain * mountain forests * canonical correlation analysis Subject RIV: EH - Ecology, Behaviour Impact factor: 0.635, year: 2016

  13. New methodology for a person identification system

    Indian Academy of Sciences (India)

    Home; Journals; Sadhana; Volume 31; Issue 3. New methodology for a person identification system. R Bremananth A Chitra. Volume 31 Issue 3 June 2006 pp 259-276 ... Experimental results illustrate that the proposed method has been easily espoused in elections, bank transactions and other security applications.

  14. Comparative assessment of fungal augmentation treatments of a fine-textured and historically oil-contaminated soil

    Czech Academy of Sciences Publication Activity Database

    Covino, Stefano; Stella, Tatiana; D'Annibale, A.; Lladó, Salvador; Baldrian, Petr; Čvančarová, Monika; Cajthaml, Tomáš; Petruccioli, M.

    2016-01-01

    Roč. 566, OCT1 (2016), s. 250-259 ISSN 0048-9697 R&D Projects: GA ČR(CZ) GA15-02328S Institutional support: RVO:61388971 Keywords : Oil-contaminated soil * Bioremediation * Contaminant bioavailability Subject RIV: EE - Microbiology, Virology Impact factor: 4.900, year: 2016

  15. The Effects of Changes in Racial Identity and Self-Esteem on Changes in African American Adolescents' Mental Health

    Science.gov (United States)

    Mandara, Jelani; Gaylord-Harden, Noni K.; Richards, Maryse H.; Ragsdale, Brian L.

    2009-01-01

    This study assessed the unique effects of racial identity and self-esteem on 259 African American adolescents' depressive and anxiety symptoms as they transitioned from the 7th to 8th grades (ages 12-14). Racial identity and self-esteem were strongly correlated with each other for males but not for females. For both males and females, an increase…

  16. Pán a pán, který běží – vývoj kresby v mladším školním věku

    Czech Academy of Sciences Publication Activity Database

    Vágnerová, M.; Janošová, Pavlína

    2017-01-01

    Roč. 51, č. 4 (2017), s. 240-259 ISSN 0555-5574 Grant - others:AV ČR(CZ) StrategieAV21/14 Program:StrategieAV Institutional support: RVO:68081740 Keywords : development of drawing * early school age * running human figure drawing * diagnostic possibilitie of drawing Subject RIV: AN - Psychology OBOR OECD: Psychology (including human - machine relations)

  17. Three-dimensional 10-ring zeolites: The activities in toluene alkylation and disproportionation

    Czech Academy of Sciences Publication Activity Database

    Kubů, Martin; Žilková, Naděžda; Zones, S. I.; Chen, C.-Y.; Al-Khattaf, S.; Čejka, Jiří

    2016-01-01

    Roč. 259, JAN 2016 (2016), s. 97-106 ISSN 0920-5861 R&D Projects: GA ČR GBP106/12/G015 Institutional support: RVO:61388955 Keywords : 10-ring zeolites * TUN * IMF Subject RIV: CF - Physical ; Theoretical Chemistry Impact factor: 4.636, year: 2016

  18. Malakostratigrafie holocenního pěnovce na Babině u Hradiště pod Vrátnom (jihozápadní Slovensko)

    Czech Academy of Sciences Publication Activity Database

    Ložek, Vojen

    2013-01-01

    Roč. 2012, Prosinec (2013), s. 259-262 ISSN 0514-8057 Institutional research plan: CEZ:AV0Z30130516 Institutional support: RVO:67985831 Keywords : SW Slovakia * Holocene * tufa * buried soils * molluscan succession Subject RIV: DB - Geology ; Mineralogy http://www.geology.cz/zpravy/obsah/2012/Zpravy_2012-52.pdf

  19. Magnetically responsive yeast cells: methods of preparation and applications

    Czech Academy of Sciences Publication Activity Database

    Šafařík, Ivo; Maděrová, Zdeňka; Pospišková, K.; Horská, Kateřina; Šafaříková, Miroslava

    2015-01-01

    Roč. 32, č. 1 (2015), s. 227-237 ISSN 0749-503X R&D Projects: GA MŠk(CZ) LD13023; GA MŠk(CZ) LD13021 Institutional support: RVO:67179843 Keywords : yeast cells * Saccharomyces * Kluyveromyces * Rhodotorula * Yarrowia * magnetic modification Subject RIV: CE - Biochemistry Impact factor: 2.259, year: 2015

  20. Robustness of one-dimensional viscous fluid motion under multidimensional perturbations

    Czech Academy of Sciences Publication Activity Database

    Feireisl, Eduard; Sun, Y.

    2015-01-01

    Roč. 259, č. 12 (2015), s. 7529-7539 ISSN 0022-0396 EU Projects: European Commission(XE) 320078 - MATHEF Institutional support: RVO:67985840 Keywords : compressible Navier-Stokes equations * 1-D compressible fluid flow * relative energy Subject RIV: BA - General Mathematics Impact factor: 1.821, year: 2015 http://www.sciencedirect.com/science/article/pii/S0022039615004325

  1. A comprehensive study of soft magnetic materials based on FeSi spheres and polymeric resin modified by silica nanorods

    Czech Academy of Sciences Publication Activity Database

    Strečková, M.; Füzer, J.; Kobera, Libor; Brus, Jiří; Fáberová, M.; Bureš, R.; Kollár, P.; Lauda, M.; Medvecký, L.; Girman, V.; Hadraba, Hynek; Baťková, M.; Baťko, I.

    2014-01-01

    Roč. 147, č. 3 (2014), s. 649-660 ISSN 0254-0584 Institutional support: RVO:61389013 ; RVO:68081723 Keywords : composite materials * magnetic materials * chemical synthesis Subject RIV: CD - Macromolecular Chemistry; JH - Ceramics, Fire-Resistant Materials and Glass (UFM-A) Impact factor: 2.259, year: 2014

  2. Determination of iodine in Asian diets by epithermal and radiochemical neutron activation analysis

    Czech Academy of Sciences Publication Activity Database

    Kučera, Jan; Iyengar, GV.; Řanda, Zdeněk; Parr, RM.

    2004-01-01

    Roč. 259, č. 3 (2004), s. 505-509 ISSN 0236-5731 R&D Projects: GA AV ČR IAA4048301 Institutional research plan: CEZ:AV0Z1048901 Keywords : iodine * Asian diets Subject RIV: BG - Nuclear, Atomic and Molecular Physics, Colliders Impact factor: 0.457, year: 2004

  3. In-situ prepared polyaniline-silver composites: single- and two-step strategies

    Czech Academy of Sciences Publication Activity Database

    Bober, Patrycja; Stejskal, Jaroslav; Trchová, Miroslava; Prokeš, J.

    2014-01-01

    Roč. 122, 10 March (2014), s. 259-266 ISSN 0013-4686 R&D Projects: GA ČR(CZ) GA13-00270S Institutional support: RVO:61389013 Keywords : composites * conducting polymer * polyaniline Subject RIV: CD - Macromolecular Chemistry Impact factor: 4.504, year: 2014

  4. 78 FR 3911 - Big Stone National Wildlife Refuge, Big Stone and Lac Qui Parle Counties, MN; Final Comprehensive...

    Science.gov (United States)

    2013-01-17

    ... DEPARTMENT OF THE INTERIOR Fish and Wildlife Service [FWS-R3-R-2012-N259; FXRS1265030000-134-FF03R06000] Big Stone National Wildlife Refuge, Big Stone and Lac Qui Parle Counties, MN; Final Comprehensive... significant impact (FONSI) for the environmental assessment (EA) for Big Stone National Wildlife Refuge...

  5. Evolutionary plasticity of restorer-of-fertility-like proteins in rice

    Czech Academy of Sciences Publication Activity Database

    Melonek, J.; Stone, James D.; Small, I.

    2016-01-01

    Roč. 6, Oct 24 (2016), s. 1-12, č. článku 35152. ISSN 2045-2322 Institutional support: RVO:67985939 Keywords : cytoplasmic male-sterility * genome-wide analysis * PPR protein Subject RIV: EF - Botanics Impact factor: 4.259, year: 2016

  6. Genomic study of the Ket: a Paleo-Eskimo-related ethnic group with significant ancient North Eurasian ancestry

    Czech Academy of Sciences Publication Activity Database

    Flegontov, P.; Changmai, P.; Zidkova, A.; Logacheva, M.D.; Altınışık, N. E.; Flegontova, Olga; Gelfand, M. S.; Gerasimov, E. S.; Khrameeva, E. E.; Konovalova, O. P.; Neretina, T.; Nikolsky, Y. V.; Starostin, G.; Stepanova, V. V.; Travinsky, I. V.; Tříska, M.; Tříska, P.; Tatarinova, T. V.

    2016-01-01

    Roč. 6, FEB 11 (2016), č. článku 20768. ISSN 2045-2322 Institutional support: RVO:60077344 Keywords : human populations * genetic variation * wide patterns * sequence * association * europeans * admixture * history * origin * tool Subject RIV: EB - Genetics ; Molecular Biology Impact factor: 4.259, year: 2016

  7. Skill/Knowledge Commonalities in Selected Electronics Specialties.

    Science.gov (United States)

    1986-10-01

    Maintenance Specialist 241 19 30750 Telecomunications Systems Control Specialist 498 35 30950A Missile Det and Warning Radar Specialistc 18 30 309506... Telecomunications Systems Control Specialist 59 ( 5) 125 (10) 259 (21) :. aNumbers in parenthesis are percentage of total possible (1,257). bBased on principles

  8. Measles, Mumps, and Rubella - Vaccine Use and Strategies for Elimination of Measles, Rubella, and Congenital Rubella Syndrome and Control of Mumps: Recommendations of the Advisory Committee on Immunization Practices (ACIP). Vol. 47/No. RR-8.

    Science.gov (United States)

    1998-05-22

    onset an average of 16-18 days after exposure. Parotitis may be preceded by fever, headache, malaise, myalgia, and anorexia . Only 30%-40% of mumps...six- " teen -year follow-up in the Hawaiian Islands. JAMA 1988;259:3133-6 98 Hillary IB, Griffith AH. Persistence of antibody 10 years after

  9. Influence of Active Immunization Against Angiotensin AT1 or AT2 Receptor on Hypertension Development in Young and Adult SHR

    Czech Academy of Sciences Publication Activity Database

    Železná, Blanka; Veselský, Leopold; Velek, Jiří; Dobešová, Zdenka; Zicha, Josef; Kuneš, Jaroslav

    1999-01-01

    Roč. 48, č. 4 (1999), s. 259-265 ISSN 0862-8408 R&D Projects: GA MŠk OK 170; GA AV ČR IAA7011711; GA AV ČR IPP2020702 Grant - others:Coperincus(FR) CT94-0239 Subject RIV: EB - Genetics ; Molecular Biology Impact factor: 0.521, year: 1999

  10. Human-Centered Technology for Maintainability: Workshop Proceedings

    Science.gov (United States)

    1991-06-01

    INT E RNAL) POPLITEAL STATION-ANKLE JOINT-- -* A (LOCATOR) AFTANKLE .... -. REANKLE ANKLE JOINT HT., STANDING---... - , FOREFOOT AFTFOOT...to strike down missile containers in the weapons elevator nwd stack them within the confines of the magazine. 259 Mechanized support equipment models

  11. Universal growth modes of high-elevation conifers

    Czech Academy of Sciences Publication Activity Database

    Datsenko, N. M.; Sonechkin, D. M.; Büntgen, Ulf; Yang, B.

    2016-01-01

    Roč. 38, JUN (2016), s. 38-50 ISSN 1125-7865 Institutional support: RVO:67179843 Keywords : tree-ring chronologies * summer temperature-variations * northeastern tibetan plateau * climate signal * fennoscandian summers * annual precipitation * density * variability * qinghai * Growth modes * Ring width and maximum latewood density * Eigenvector analysis Subject RIV: EF - Botanics Impact factor: 2.259, year: 2016

  12. Spatial distribution of organic pollutants (PAHs and polar pesticides) in the floodplain of the Ohře (Eger) River, Czech Republic

    Czech Academy of Sciences Publication Activity Database

    Fikarová, J.; Kříženecká, S.; Elznicová, J.; Faměra, Martin; Lelková, T.; Matkovič, J.; Matys Grygar, Tomáš

    2018-01-01

    Roč. 18, č. 1 (2018), s. 259-275 ISSN 1439-0108 R&D Projects: GA ČR(CZ) GA15-00340S Institutional support: RVO:61388980 Keywords : Chemostratigraphy * Floodplain architecture * Organic pollutants * PAH * Pesticides Subject RIV: DD - Geochemistry OBOR OECD: Environmental sciences (social aspects to be 5.7) Impact factor: 2.522, year: 2016

  13. Heterodera schachtii Tyrosinase-like protein a novel nematode effector modulating plant hormone homeostasis

    Czech Academy of Sciences Publication Activity Database

    Habash, S.; Radakovic, Z.S.; Vaňková, Radomíra; Siddique, S.; Dobrev, Petre; Gleason, C.; Grundler, F.M.W.; Elashry, A.

    2017-01-01

    Roč. 7, JUL 31 (2017), č. článku 6874. ISSN 2045-2322 Institutional support: RVO:61389030 Keywords : arabidopsis-thaliana * cyst-nematode * parasitic nematode * transient expression * host plants * sequence * identification * infection * model * transformation Subject RIV: ED - Physiology OBOR OECD: Plant sciences, botany Impact factor: 4.259, year: 2016

  14. Reduced host-specificity in a parasite infecting non-littoral Lake Tanganyika cichlids evidenced by intraspecific morphological and genetic diversity

    Czech Academy of Sciences Publication Activity Database

    Kmentová, N.; Gelnar, M.; Mendlová, M.; Van Steenberge, M.; Koblmüller, Stephan; Vanhove, M. P. M.

    2016-01-01

    Roč. 6, č. 39605 (2016), č. článku 39605. ISSN 2045-2322 R&D Projects: GA ČR(CZ) GBP505/12/G112 Institutional support: RVO:68081766 Keywords : Monogenean parasites * Ancyrocephalidae * adaptive radiation * statistical tests * population growth * DNA polymorphism * fish families * Teleostei * phylogeny Subject RIV: EG - Zoology Impact factor: 4.259, year: 2016

  15. AcEST: BP917978 [AcEST

    Lifescience Database Archive (English)

    Full Text Available IC6|VGLG_LNYV Glycoprotein G OS=Lettuce necrotic yellows v... 29 9.4 sp|A6VMF8|MEND_ACTSZ 2-succinyl-5-enolp...SPQKVVIENSWAFRNGINY 259 Query: 218 WKD 210 W D Sbjct: 260 WND 262 >sp|Q9DIC6|VGLG_LNYV Glycoprotein G OS=Lettuce

  16. Better theory-of-mind skills in children hearing voices mitigate the risk of secondary delusion formation

    NARCIS (Netherlands)

    Bartels-Velthuis, A. A.; Blijd-Hoogewys, E. M. A.; van Os, J.

    Objective: To examine the social cognitive vulnerabilities mediating delusion formation in children presenting with hallucinatory experiences. Method: A sample of 259 12- and 13-year-old children, from a baseline case-control sample of children with and without auditory hallucinations (AH), were

  17. Review: Julie Coleman: A History of Cant and Slang Dictionaries ...

    African Journals Online (AJOL)

    Julie Coleman. A History of Cant and Slang Dictionaries. Volume I: 1567– 1784. 2004, xii + 259 pp. ISBN 0 19 925471 0 (Hb.). Oxford: Oxford University Press. Price: £115. Julie Coleman. A History of Cant and Slang Dictionaries. Volume II: 1785– 1858. 2004, xiv + 338 pp. ISBN 0 19 925470 2 (Hb.). Oxford: Oxford ...

  18. Spindle Cell Metaplastic Breast Cancer: Case Report

    Directory of Open Access Journals (Sweden)

    Dursun Ozgur Karakas

    2013-08-01

    Conclusion: Spindle cell metaplastic breast cancer must be considered in differential diagnosis of breast cancers, and preoperative immunohistochemical examination, including cytokeratin and vimentin, must be added to pathological examination in intervening cases. [Arch Clin Exp Surg 2013; 2(4.000: 259-262

  19. High-yield fabrication and properties of 1.4 nm nanodiamonds with narrow size distribution

    Czech Academy of Sciences Publication Activity Database

    Stehlík, Štěpán; Varga, Marián; Ledinský, Martin; Miliaieva, Daria; Kozak, Halyna; Skakalova, V.; Mangler, C.; Pennycook, T. J.; Meyer, J.C.; Kromka, Alexander; Rezek, Bohuslav

    2016-01-01

    Roč. 6, Dec (2016), 1-8, č. článku 38419. ISSN 2045-2322 R&D Projects: GA ČR GA15-01809S Institutional support: RVO:68378271 Keywords : detonation nanodiamonds * Raman-spectroscopy * diamond nanoparticles * selective oxidation * ion-implantation Subject RIV: BM - Solid Matter Physics ; Magnetism Impact factor: 4.259, year: 2016

  20. Effect of Machine Geometry on Higher Harmonics Content in Air-Gap Magnetic Field of Synchronous Reluctance Machine

    Czech Academy of Sciences Publication Activity Database

    Schreier, Luděk; Chomát, Miroslav; Doležel, Ivo

    2001-01-01

    Roč. 176, č. 1500 (2001), s. 259-266 ISSN 0072-4688 R&D Projects: GA ČR GA102/01/0181 Keywords : synchronous reluctance machine * torque pulsation Subject RIV: JA - Electronics ; Optoelectronics, Electrical Engineering

  1. Dicty_cDB: Contig-U13120-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available id:none) Chromocleista malachitea isolate C... 311 2e-83 FJ358413_1( FJ358413 |pid:none) Leucothecium emdeni...pid:none) Gymnoascus reesii isolate CBS 259.... 312 1e-83 FJ358409_1( FJ358409 |p

  2. Network Inference and Maximum Entropy Estimation on Information Diagrams

    Czech Academy of Sciences Publication Activity Database

    Martin, E.A.; Hlinka, J.; Meinke, A.; Děchtěrenko, Filip; Tintěra, J.; Oliver, I.; Davidsen, J.

    2017-01-01

    Roč. 7, č. 1 (2017), s. 1-15, č. článku 7062. ISSN 2045-2322 R&D Projects: GA ČR GA13-23940S Institutional support: RVO:68081740 Keywords : complex networks * mutual information * entropy maximization * fMRI Subject RIV: AN - Psychology OBOR OECD: Cognitive sciences Impact factor: 4.259, year: 2016

  3. Escitalopram in the Treatment of Adolescent Depression: A Randomized Placebo-Controlled Multisite Trial

    Science.gov (United States)

    Emslie, Graham J.; Ventura, Daniel; Korotzer, Andrew; Tourkodimitris, Stavros

    2009-01-01

    A randomized, double-blind, placebo-controlled trial that involves 312 male and female patients aged 12-17 reveal the effectiveness of escitalopram in the treatment of depressed adolescents. Eighty-three percent of the participants or 259 participants completed the 8 weeks therapy period.

  4. Prevalence of intestinal parasites among school children in a rural ...

    African Journals Online (AJOL)

    Prevalence of intestinal parasites among school children in a rural area close to the southeast of Lake Langano, Ethiopia. ... Ethiopian Journal of Health Development ... Methods: In April 2003, fresh stool samples were collected from 259 students enrolled in two primary schools located in southeast of Lake Langano.

  5. Pattern of gastrointestinal opportunistic infections among HIV ...

    African Journals Online (AJOL)

    Twenty-two per cent (22%) of these had mixed parasitosis of cryptosporidium and hookworm. There was no significant association of CD4 cells count with intestinal parasitosis. x2 = 5.286 and p=0.259. However marital status was significantly associated with gastrointestinal opportunistic parasitosis with x2 of 12.693, ...

  6. Two flagellar BAR domain proteins in Trypanosoma brucei with stage-specific regulation

    Czech Academy of Sciences Publication Activity Database

    Číčová, Z.; Dejung, M.; Skalický, Tomáš; Eisenhuth, N.; Hanselmann, S.; Morriswood, B.; Figueiredo, L.M.; Butter, F.; Janzen, C. J.

    2016-01-01

    Roč. 6, 25 October (2016), č. článku 35826. ISSN 2045-2322 Institutional support: RVO:60077344 Keywords : variant surface glycoprotein * attachment zone filament * blood stream forms * life cycle stages * paraflagellar rod * stable transformation * cell morphogenesis * ortholog groups * psi blast * membrane Subject RIV: EB - Genetics ; Molecular Biology Impact factor: 4.259, year: 2016

  7. Sadhana | Indian Academy of Sciences

    Indian Academy of Sciences (India)

    Home; Journals; Sadhana. Anil Gupta. Articles written in Sadhana. Volume 37 Issue 2 April 2012 pp 241-259. A review of designing machine tool for leanness · Anil Gupta T K Kundra · More Details Abstract Fulltext PDF. As an ideology, Leanness is not a new concept but still researchers strive for developing new methods ...

  8. Male knowledge of danger signs of obstetric complications in an ...

    African Journals Online (AJOL)

    cannot be overlooked in this regard. The aim of this study was to determine men's knowledge of danger signs in pregnancy and their role in pregnancy related decision making. Methods: A cross sectional survey was conducted among 259 men aged 15-65 years in selected communities in Ibadan, Oyo State by multistage

  9. The relationship between generic and diabetes specific psychological factors and glycaemic control in adults with type 1 diabetes

    DEFF Research Database (Denmark)

    Shaban, C.; Fosbury, J. A.; Cavan, D. A.

    2009-01-01

    259 adults with type 1 diabetes completed measure of anxiety, depression and diabetes specific distress, HbA1c from medical records. Anxiety not depression predicted HbA1c, this association was mediated by illness specific cognitions. Targeting illness specific cognitions may be more productive...

  10. TropJrnal Vol 29 No 1 for PDF

    African Journals Online (AJOL)

    Mr Olusoji

    (25.9%), Husband's opposition (24.2%), desire for more children (17.2%), Religious prohibition (13.8%), lack of ... Strategies to improving access and utilization to family planning methods should therefore include; the .... marketing of the condom in response to the HIV ... personnel towards building their capacity in offering.

  11. Low Membership in Czech Political Parties: Party Strategy or Structural Determinants?

    Czech Academy of Sciences Publication Activity Database

    Linek, Lukáš; Pecháček, Š.

    2007-01-01

    Roč. 23, č. 2 (2007), s. 259-275 ISSN 1352-3279 R&D Projects: GA MPS 1J004/04-DP1 Institutional research plan: CEZ:AV0Z70280505 Keywords : political parties * party membership * antiparty sentiments * party organization Subject RIV: AD - Politology ; Political Sciences

  12. 77 FR 13141 - Notice of Intent To Prepare a Master Leasing Plan, Amendments to the Resource Management Plans...

    Science.gov (United States)

    2012-03-05

    ... Northrup, Project Manager, BLM Moab Field Office, 82 East Dogwood, Moab, UT 84532, telephone (435) 259-2151... Instruction Memorandum No. 2010-117. The MLP process will provide additional planning and analysis for areas... with varying mitigation levels for leasing. The planning area covers about 783,000 acres in east...

  13. A Survey of Exemplar Teachers' Perceptions, Use, and Access of Computer-Based Games and Technology for Classroom Instruction

    Science.gov (United States)

    Proctor, Michael D.; Marks, Yaela

    2013-01-01

    This research reports and analyzes for archival purposes surveyed perceptions, use, and access by 259 United States based exemplar Primary and Secondary educators of computer-based games and technology for classroom instruction. Participating respondents were considered exemplary as they each won the Milken Educator Award during the 1996-2009…

  14. ISSN 1727-3781

    African Journals Online (AJOL)

    HP4510s

    place the question is addressed how a monist or dualist approach regarding the ... humanitarian law, customary international law, and the law and practice of States. ... Law 171 et seq; Boothby 2006 Intervention 244-259; Cohn 1991 IJRL 100-111; ...... as victims because of their emotional, mental and intellectual immaturity.

  15. 2015-2016 Travel and Hospitality Expense Reports for Joanne ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Ruxandra Staicu

    Destination(s):. Delhi (India). Airfare: $11,659.58. Other. Transportation: $106.70. Accommodation: $2,913.67. Meals and. Incidentals: $847.77. Other: $259.25. Total: $15,786.97. Comments: 2015-2016 Travel and Hospitality Expense. Reports for Joanne Charette, Vice-President,. Corporate Strategy and Communications.

  16. Priority choice experimental two-qubit tomography: measuring one by one all elements of density matrices

    Czech Academy of Sciences Publication Activity Database

    Bartkiewicz, K.; Černoch, Antonín; Lemr, K.; Miranowicz, A.

    2016-01-01

    Roč. 6, Jan (2016), 1-7, č. článku 19610. ISSN 2045-2322 R&D Projects: GA ČR GAP205/12/0382 Institutional support: RVO:68378271 Keywords : entangled photons * state tomography Subject RIV: BH - Optics, Masers, Lasers Impact factor: 4.259, year: 2016

  17. Deformation pattern in vibrating microtubule: Structural mechanics study based on an atomistic approach

    Czech Academy of Sciences Publication Activity Database

    Havelka, Daniel; Deriu, M.A.; Cifra, Michal; Kučera, Ondřej

    2017-01-01

    Roč. 7, č. 1 (2017), č. článku 4227. ISSN 2045-2322 R&D Projects: GA ČR(CZ) GA15-17102S Institutional support: RVO:67985882 Keywords : Continuum model * Protein microtubules * Molecular-dymamics Subject RIV: BO - Biophysics OBOR OECD: Biophysics Impact factor: 4.259, year: 2016

  18. Structural changes in alginate-based microspheres exposed to in vivo environment as revealed by confocal Raman microscopy

    Czech Academy of Sciences Publication Activity Database

    Kroneková, Z.; Pelach, M.; Mazancová, P.; Uhelská, L.; Treľová, D.; Rázga, F.; Némethová, V.; Szalai, S.; Chorvát, D.; McGarrigle, J. J.; Omami, M.; Isa, D.; Ghani, S.; Majková, E.; Oberholzer, J.; Raus, Vladimír; Šiffalovič, P.; Lacík, I.

    2018-01-01

    Roč. 8, 26 January (2018), s. 1-12, č. článku 1637. ISSN 2045-2322 Institutional support: RVO:61389013 Keywords : confocal Raman microscopy * alginate * microcapsule Subject RIV: CD - Macromolecular Chemistry OBOR OECD: Polymer science Impact factor: 4.259, year: 2016

  19. Spatial mapping of metals in tissue-sections using combination of mass-spectrometry and histology through image registration

    Czech Academy of Sciences Publication Activity Database

    Anýz, J.; Vysloužilová, L.; Vaculovič, T.; Tvrdoňová, M.; Kanický, V.; Haase, H.; Horák, Vratislav; Štěpánková, O.; Heger, Z.; Adam, V.

    2017-01-01

    Roč. 7, č. 1 (2017), č. článku 40169. ISSN 2045-2322 R&D Projects: GA MŠk(CZ) LO1609 Institutional support: RVO:67985904 Keywords : melanoma patients * mixed effects models * bearing Libechov minipig Subject RIV: EB - Genetics ; Molecular Biology OBOR OECD: Biochemical research methods Impact factor: 4.259, year: 2016

  20. RGD delivery of truncated coagulase to tumor vasculature affords local thrombotic activity to induce infarction of tumors in mice

    Czech Academy of Sciences Publication Activity Database

    Jahanban-Esfahlan, R.; Seidi, K.; Monhemi, H.; Adli, A.D.F.; Minofar, Babak; Zare, P.; Farajzadeh, D.; Farajnia, S.; Behzadi, R.; Abbasi, M.M.; Zarghami, N.; Javaheri, T.

    2017-01-01

    Roč. 7, AUG 15 (2017), s. 1-14, č. článku 8126. ISSN 2045-2322 Institutional support: RVO:61388971 Keywords : TISSUE-FACTOR * FACTOR-VIIA * STAPHYLOCOAGULASE Subject RIV: EE - Microbiology, Virology OBOR OECD: Microbiology Impact factor: 4.259, year: 2016

  1. Biomonitoring of occupational exposure: Neutron activation determination of selected metals in the body tissues and fluids of workers manufacturing stainless steel vessels

    Czech Academy of Sciences Publication Activity Database

    Kučera, Jan; Bencko, V.; Tejral, J.; Borská, L.; Soukal, L.; Řanda, Zdeněk

    2004-01-01

    Roč. 259, č. 1 (2004), s. 7-11 ISSN 0236-5731 R&D Projects: GA AV ČR KSK4055109 Institutional research plan: CEZ:AV0Z1048901 Keywords : occupational exposure * biomonitoring * neutron activation analysis Subject RIV: DN - Health Impact of the Environment Quality Impact factor: 0.457, year: 2004

  2. Photoacoustic Sounds from Meteors

    Czech Academy of Sciences Publication Activity Database

    Spalding, R.; Tencer, J.; Sweatt, W.; Conley, B.; Hogan, R.; Boslough, M.B.; Gonzales, G.; Spurný, Pavel

    2017-01-01

    Roč. 7, February (2017), 41251/1-41251/6 ISSN 2045-2322 Institutional support: RVO:67985815 Keywords : photoacoustic coupling * experimental results * numerical models Subject RIV: BN - Astronomy, Celestial Mechanics, Astrophysics OBOR OECD: Astronomy (including astrophysics,space science) Impact factor: 4.259, year: 2016

  3. The molecular structure effects in hydrogenation of cycloalkylsubstituted alkynes and alkenes on platinum and palladium catalysts

    Czech Academy of Sciences Publication Activity Database

    Kačer, P.; Kuzma, Marek; Červený, L.

    2004-01-01

    Roč. 259, - (2004), s. 179-183 ISSN 0926-860X R&D Projects: GA ČR GA104/00/1009 Institutional research plan: CEZ:AV0Z5020903 Keywords : adsorptivity * competitive hydrogenation * substituent effects Subject RIV: EE - Microbiology, Virology Impact factor: 2.378, year: 2004

  4. Ježekite, Na.sub.8./sub.[(UO.sub.2./sub.)(CO.sub.3./sub.).sub.3./sub.](SO.sub.4./sub.).sub.2./sub..3H.sub.2./sub.O, a new uranyl mineral from Jáchymov, Czech Republic

    Czech Academy of Sciences Publication Activity Database

    Plášil, Jakub; Hloušek, J.; Kasatkin, A.V.; Belakovskiy, D. I.; Čejka, J.; Chernyshov, D.

    2015-01-01

    Roč. 60, č. 4 (2015), 259-267 ISSN 1802-6222 R&D Projects: GA ČR GP13-31276P Institutional support: RVO:68378271 Keywords : ježekite * new mineral * uranyl carbonate-sulfate * crystal structure * Jáchymov Subject RIV: DB - Geology ; Mineralogy Impact factor: 1.326, year: 2015

  5. Vavraia culicis (Weiser, 1947) Weiser, 1977 revisited: cytological characterisation of a Vavraia culicis-like microsporidium isolated from mosquitoes in Florida and the establishment of Vavraia culicis floridensis subsp. n

    Czech Academy of Sciences Publication Activity Database

    Vávra, Jiří; Becnel, J. J.

    2007-01-01

    Roč. 54, č. 4 (2007), s. 259-271 ISSN 0015-5683 R&D Projects: GA ČR GA524/07/1003 Institutional research plan: CEZ:AV0Z60220518 Keywords : Vavraia * Aedes albopictus * mosquito es * parasites * microsporidia * ultrastructure Subject RIV: GJ - Animal Vermins ; Diseases, Veterinary Medicine Impact factor: 1.000, year: 2007

  6. Pillai, Prof. Valliyil Narayanan Rajasekharan

    Indian Academy of Sciences (India)

    Date of birth: 20 October 1949. Specialization: Bio-organic Chemistry, Synthetic Organic Chemistry & Macromolecular Science Address: Harishree, S-31, Medical College Road, Gandhinagar P.O., Kottayam 686 008, Kerala Contact: Residence: (0481) 259 7885. Mobile: 99958 24472. Email: rajasekharpillai@gmail.com, ...

  7. Tributyltin-resistant Methanothermobacter thermautotrophicus mutant with mutational substitutions in the A.sub.1./sub.A.sub.0./sub.-ATP synthase operon

    Czech Academy of Sciences Publication Activity Database

    Nováková, Z.; Bobálová, Janette; Vidová, M.; Hapala, I.; Šmigáň, P.

    2009-01-01

    Roč. 298, č. 2 (2009), s. 255-259 ISSN 0378-1097 Institutional research plan: CEZ:AV0Z40310501 Keywords : methanoarchaea * bioenergetics * tributyltin resistance Subject RIV: CB - Analytical Chemistry, Separation Impact factor: 2.199, year: 2009

  8. The Contribution of Counseling Providers to the Success or Failure of Marriages

    Science.gov (United States)

    Ansah-Hughes, Winifred

    2015-01-01

    This study is an investigation into the contribution of counseling providers to the success or failure of marriages. The purposive and the simple random sampling methods were used to select eight churches and 259 respondents (married people) in the Techiman Municipality. The instrument used to collect data was a 26-item questionnaire including a…

  9. Investigation of the clinical features and therapeutic methods for the ...

    African Journals Online (AJOL)

    Purpose: To establish if there are different classes of inflammatory lacrimal punctum diseases (ILPDs) and to examine the various strategies by which they can be managed therapeutically. Methods: Two hundred and fifty nine (259) patients with inflammatory punctum lacrimal disease were identified and used as subjects for ...

  10. Success factors in new ventures : A meta-analysis

    NARCIS (Netherlands)

    Song, Michael; Podoynitsyna, Ksenia; van der Bijl, H.M.; Halman, Johannes I.M.

    2008-01-01

    Technology entrepreneurship is key to economic development. New technology ventures (NTVs) can have positive effects on employment and could rejuvenate industries with disruptive technologies. However, NTVs have a limited survival rate. In our most recent empirical study of 11,259 NTVs established

  11. Success factors in new ventures : a meta-analysis

    NARCIS (Netherlands)

    Song, Michael; Podoynitsyna, K.S.; Bij, van der J.D.; Halman, J.I.M.

    2008-01-01

    Technology entrepreneurship is key to economic development. New technology ventures (NTVs) can have positive effects on employment and could rejuvenate industries with disruptive technologies. However, NTVs have a limited survival rate. In our most recent empirical study of 11,259 NTVs established

  12. New mixed ligand complexes of ruthenium(II) that incorporate a ...

    Indian Academy of Sciences (India)

    Unknown

    infrared, UV-Vis, steady-state emission and 1H NMR spectroscopic methods. Results ... Deionised, triply distilled water was used for preparing various buffers. .... 259 nm in CH3CN containing a drop of HCl (acid was added to ensure complete.

  13. ORF Alignment: NC_005296 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_005296 gi|39936538 >1u07A 13 88 186 259 1e-09 ... emb|CAE28917.1| possible energy ...transducer TonB [Rhodopseudomonas palustris CGA009] ... ref|NP_948814.1| possible energy transducer T

  14. 30 CFR 250.242 - What information must accompany the DPP or DOCD?

    Science.gov (United States)

    2010-07-01

    ... § 250.248; (g) Air emissions information required by § 250.249; (h) Oil and hazardous substance spills...? 250.242 Section 250.242 Mineral Resources MINERALS MANAGEMENT SERVICE, DEPARTMENT OF THE INTERIOR....258; (q) Sulphur operations information required by § 250.259; (r) Coastal zone management information...

  15. Effect of enzyme/substrate ratio on the antioxidant properties of ...

    African Journals Online (AJOL)

    Dr (Mrs) O.Fasasi

    2012-06-21

    Jun 21, 2012 ... Department of Food Science and Technology, P. M. B. 704, Federal University of Technology, ... of East Africa and it is cultivated for both its seeds and ..... inhibit lipid oxidation in cooked pork patties, Meat Sci., 64: 259-263.

  16. The correlation theory of the chemical bond

    Czech Academy of Sciences Publication Activity Database

    Szalay, S.; Barcza, G.; Szilvási, T.; Veis, Libor; Legeza, Ö.

    2017-01-01

    Roč. 7, MAY 2017 (2017), č. článku 2237. ISSN 2045-2322 R&D Projects: GA ČR GA16-12052S Institutional support: RVO:61388955 Keywords : density matrix * quantum chemistry * theoretical model Subject RIV: CF - Physical ; Theoretical Chemistry OBOR OECD: Physical chemistry Impact factor: 4.259, year: 2016

  17. Nonlinear magnetoelectric effect in paraelectric state of Co4Nb2O9 single crystal

    Czech Academy of Sciences Publication Activity Database

    Cao, Ym.; Deng, Gc.; Beran, Přemysl; Feng, Zj.; Kang, Bj.; Zhang, Jc.; Guiblin, N.; Dkhil, B.; Ren, W.; Cao, Sx.

    2017-01-01

    Roč. 7, č. 10 (2017), č. článku 14079. ISSN 2045-2322 Institutional support: RVO:61389005 Keywords : magnetoelectric * single crystal * neutron diffraction Subject RIV: BM - Solid Matter Physics ; Magnetism OBOR OECD: Condensed matter physics (including formerly solid state physics, supercond.) Impact factor: 4.259, year: 2016

  18. Recent advances in the diagnosis of Cushing’s syndrome in dogs

    NARCIS (Netherlands)

    Kooistra, H.S.; Galac, S.

    2010-01-01

    Vet Clin North Am Small Anim Pract. 2010 Mar;40(2):259-67. Recent advances in the diagnosis of Cushing's syndrome in dogs. Kooistra HS, Galac S. Department of Clinical Sciences of Companion Animals, Faculty of Veterinary Medicine, Utrecht University, Yalelaan 108, 3584 CM Utrecht, The Netherlands.

  19. On the linear problem arising from motion of a fluid around a moving rigid body

    Czech Academy of Sciences Publication Activity Database

    Nečasová, Šárka; Wolf, J.

    2015-01-01

    Roč. 140, č. 2 (2015), s. 241-259 ISSN 0862-7959 R&D Projects: GA ČR(CZ) GAP201/11/1304 Institutional support: RVO:67985840 Keywords : incompressible fluid * rotating rigid body * strong solution Subject RIV: BA - General Mathematics http://hdl.handle.net/10338.dmlcz/144329

  20. Synthesis of the silky sifaka's distribution (Propithecus candidus )

    African Journals Online (AJOL)

    SR) in 2015 are also extremely low at 1.9 individuals. (indiv.)/km² (north-east near Ambodisatrana) and 0.29 indiv./km². (central-east near Camp Indri), though higher in the western ex- tension at 2.59 indiv./km² (south-west near Ampoanaomby).

  1. Secreted Isoform of Human Lynx1 (SLURP-2): Spatial Structure and Pharmacology of Interactions with Different Types of Acetylcholine Receptors

    Czech Academy of Sciences Publication Activity Database

    Lyukmanova, E. N.; Shulepko, M. A.; Shenkarev, Z. O.; Bychkov, M. L.; Paramonov, A. S.; Chugunov, A. O.; Kulbatskii, D. S.; Arvaniti, M.; Dolejší, Eva; Schaer, T.; Arseniev, A. S.; Efremov, R. G.; Thomsen, M. S.; Doležal, Vladimír; Bertrand, D.; Dolgikh, D. A.; Kirpichnikov, M. P.

    2016-01-01

    Roč. 6, Aug 3 (2016), s. 30698 ISSN 2045-2322 R&D Projects: GA ČR(CZ) GA14-05696S Institutional support: RVO:67985823 Keywords : ion channel * signalling * molecular modelling * protein–protein interaction networks * solution-state NMR Subject RIV: ED - Physiology Impact factor: 4.259, year: 2016

  2. Maximum effort in the minimum-effort game

    Czech Academy of Sciences Publication Activity Database

    Engelmann, Dirk; Normann, H.-T.

    2010-01-01

    Roč. 13, č. 3 (2010), s. 249-259 ISSN 1386-4157 Institutional research plan: CEZ:AV0Z70850503 Keywords : minimum-effort game * coordination game * experiments * social capital Subject RIV: AH - Economics Impact factor: 1.868, year: 2010

  3. Diurnal and seasonal fluctuations in wood ant (.i.Formica polyctena./i.) nest temperature in two geographically distant populations along a south-north gradient

    Czech Academy of Sciences Publication Activity Database

    Frouz, Jan; Finer, L.

    2007-01-01

    Roč. 54, - (2007), s. 251-259 ISSN 0020-1812 Grant - others:Academy of Finland(FI) 200870 Institutional research plan: CEZ:AV0Z60660521 Source of funding: V - iné verejné zdroje Keywords : ant nests * thermoregulation * Formica rufa group Subject RIV: EH - Ecology, Behaviour Impact factor: 1.391, year: 2007

  4. Effect of inhibition of biosynthesis of phenylpropanoids on sessile oak somatic embryogenesis

    Czech Academy of Sciences Publication Activity Database

    Cvikrová, Milena; Malá, J.; Hrubcová, Marie; Eder, Josef; Zoń, J.; Macháčková, Ivana

    2003-01-01

    Roč. 41, č. 3 (2003), s. 251-259 ISSN 0981-9428 R&D Projects: GA MŠk LN00A081 Institutional research plan: CEZ:AV0Z5038910 Keywords : Inhibition of phenylpropanoid biosynthesis * Somatic embryogenesis * Oak Subject RIV: CE - Biochemistry Impact factor: 1.729, year: 2003

  5. FERO (Finding Extreme Relativistic Objects): statistics of relativistic broad Fe Kalpha lines in AGN

    Czech Academy of Sciences Publication Activity Database

    Longinotti, A. L.; de La Calle, I.; Bianchi, S.; Guainazzi, M.; Dovčiak, Michal

    2008-01-01

    Roč. 79, č. 1 (2008), s. 259-261 ISSN 0037-8720. [ Simbol -X: The hard X-ray Universe in focus. Bologna, 14.05.2007-16.05.2007] Institutional research plan: CEZ:AV0Z10030501 Keywords : active galaxies * X-raylLines-iron Subject RIV: BN - Astronomy, Celestial Mechanics, Astrophysics

  6. Outcomes of repeated exposure of the carp (Cyprinus carpio L.) to cyanobacteria extract

    Czech Academy of Sciences Publication Activity Database

    Palíková, M.; Navrátil, S.; Krejčí, R.; Štěrba, F.; Tichý, F.; Kubala, Lukáš; Maršálek, Blahoslav; Bláha, L.

    2004-01-01

    Roč. 73, č. 2 (2004), s. 259-265 ISSN 0001-7213 R&D Projects: GA ČR GP524/01/P027 Institutional research plan: CEZ:AV0Z5004920 Keywords : erythrocytes * leukocytes * plasma enzymes Subject RIV: BO - Biophysics Impact factor: 0.449, year: 2004

  7. Leukotriene-mediated neuroinflammation, toxic brain damage, and neurodegeneration in acute methanol poisoning

    Czech Academy of Sciences Publication Activity Database

    Zakharov, S.; Kotíková, K.; Nurieva, O.; Hlušička, J.; Kačer, P.; Urban, P.; Vaněčková, M.; Seidl, Z.; Diblík, P.; Kuthan, P.; Navrátil, Tomáš; Pelclová, D.

    2017-01-01

    Roč. 55, č. 4 (2017), s. 249-259 ISSN 1556-3650 Institutional support: RVO:61388955 Keywords : brain damage * leukotrienes * methanol poisoning * Neuroinflammation * nontraumatic brain injury * sequelae of poisoning Subject RIV: CG - Electrochemistry OBOR OECD: Electrochemistry (dry cells, batteries, fuel cells, corrosion metals, electrolysis) Impact factor: 3.677, year: 2016

  8. Non-uniform self-assembly: On the anisotropic architecture of alpha-synuclein supra-fibrillar aggregates

    Czech Academy of Sciences Publication Activity Database

    Semerdzhiev, S. A.; Shvadchak, Volodymyr V.; Subramaniam, V.; Claessens, M. M. A. E.

    2017-01-01

    Roč. 7, Aug 9 (2017), č. článku 7699. ISSN 2045-2322 Institutional support: RVO:61388963 Keywords : liquid crystal spherulites * Parkinson's disease * Alzheimer's disease Subject RIV: BO - Biophysics OBOR OECD: Biophysics Impact factor: 4.259, year: 2016 https://www.nature.com/articles/s41598-017-06532-1

  9. Novel structural aspect of the diatom thylakoid membrane: lateral segregation of photosystem I under red-enhanced illumination

    Czech Academy of Sciences Publication Activity Database

    Bína, David; Herbstová, Miroslava; Gardian, Zdenko; Vácha, František; Litvín, Radek

    2016-01-01

    Roč. 6, MAY 2016 (2016), č. článku 25583. ISSN 2045-2322 R&D Projects: GA ČR GBP501/12/G055 Institutional support: RVO:60077344 Keywords : Light-harvesting complexes * Supramolecular organization * Protein complexes Subject RIV: BO - Biophysics Impact factor: 4.259, year: 2016

  10. Modus operandi onderzoek naar door informatie en communicatie technologie (ICT) gefaciliteerde criminaliteit

    NARCIS (Netherlands)

    Junger, Marianne; Montoya, L.; Hartel, Pieter H.; Karemaker, M.

    Dit onderzoek beschrijft de invloed van ICT op de 'traditionele' misdrijven door te onderzoeken hoe delicten als inbraak, overvallen en fraude doordrongen zijn van ICT. In totaal zijn 136 woninginbraken, 140 commerciële inbraken, 259 bedreigingen en 274 fraudeza-ken onderzocht. Uit de resultaten

  11. The N-terminal domain plays a crucial role in the structure of a full-length human mitochondrial Lon protease

    Czech Academy of Sciences Publication Activity Database

    Kereiche, S.; Kováčik, L.; Bednár, J.; Pevala, V.; Kunová, N.; Ondrovičová, G.; Bauer, J.; Ambro, L.; Bellová, J.; Kutejová, Eva; Raška, I.

    2016-01-01

    Roč. 6, SEP 16 (2016), s. 33631 ISSN 2045-2322 R&D Projects: GA MŠk(CZ) ED1.1.00/02.0109 Institutional support: RVO:61388971 Keywords : ESCHERICHIA-COLI LON * SUBSTRATE TRANSLOCATION * PROTEOLYTIC MACHINE Subject RIV: EE - Microbiology, Virology Impact factor: 4.259, year: 2016

  12. Arginine side chain interactions and the role of arginine as a gating charge carrier in voltage sensitive ion channels

    Czech Academy of Sciences Publication Activity Database

    Armstrong, C. T.; Mason, Philip E.; Anderson, J. L. R.; Dempsey, Ch. E.

    2016-01-01

    Roč. 6, Feb 22 (2016), č. článku 21759. ISSN 2045-2322 Institutional support: RVO:61388963 Keywords : K+ channel * potassium channels * sensing domain Subject RIV: CF - Physical ; Theoretical Chemistry Impact factor: 4.259, year: 2016 http://www.nature.com/articles/srep21759

  13. Binding of N-methylscopolamine to the extracellular domain of muscarinic acetylcholine receptors

    Czech Academy of Sciences Publication Activity Database

    Jakubík, Jan; Randáková, Alena; Zimčík, Pavel; El-Fakahany, E. E.; Doležal, Vladimír

    2017-01-01

    Roč. 7, Jan 16 (2017), č. článku 40381. ISSN 2045-2322 R&D Projects: GA ČR(CZ) GBP304/12/G069 Institutional support: RVO:67985823 Keywords : muscarinic acetylcholine receptors * N-methylscopolamine * ligand binding * molecular dynamics Subject RIV: ED - Physiology OBOR OECD: Physiology (including cytology) Impact factor: 4.259, year: 2016

  14. Iron(II) supramolecular helicates interfere with the HIV-1 Tat-TAR RNA interaction critical for viral replication

    Czech Academy of Sciences Publication Activity Database

    Malina, Jaroslav; Hannon, Michael J.; Brabec, Viktor

    2016-01-01

    Roč. 6, JUL2016 (2016) ISSN 2045-2322 R&D Projects: GA ČR(CZ) GA16-03517S Institutional support: RVO:68081707 Keywords : DINUCLEAR RUTHENIUM(II) COMPLEX * METALLOSUPRAMOLECULAR CYLINDERS * BIOLOGICAL EVALUATION Subject RIV: BO - Biophysics Impact factor: 4.259, year: 2016

  15. Stress among Secondary School Teachers in Ebonyi State, Nigeria: Suggested Interventions in the Worksite Milieu

    Science.gov (United States)

    Nwimo, Ignatius O.; Onwunaka, Chinagorom

    2015-01-01

    The aim of the study was to determine the level of stress experienced by secondary school teachers in Ebonyi State. The dimensions of stress studied included physical stress, mental stress, emotional stress and social stress. The study adopted the cross-sectional survey design using a sample of 660 (male 259, female 401) teachers randomly drawn…

  16. Cystathionine .gamma.-lyase: Clinical, metabolic, genetic, and structural studies

    Czech Academy of Sciences Publication Activity Database

    Kraus, J. P.; Hašek, Jindřich; Kožich, V.; Collard, R.; Venezia, S.; Janošíková, B.; Wang, J.; Stabler, S. P.; Allen, R. H.; Jakobs, C.; Finn, C. T.; Chien, Y. H.; Hwu, W. L.; Hegele, R. A.; Mudd, S. H.

    2009-01-01

    Roč. 97, č. 4 (2009), s. 250-259 ISSN 1096-7192 R&D Projects: GA ČR GA305/07/1073 Institutional research plan: CEZ:AV0Z40500505 Keywords : cystathionine gamma-lyase * cystathioninuria * hypercystathioninemia Subject RIV: CD - Macromolecular Chemistry Impact factor: 2.897, year: 2009

  17. The Predictive Value of Selected Extrinsic and Intrinsic Indicators of Overall Job Satisfaction in Diagnostic Radiological Technology, Radiation Therapy, and Nuclear Medicine Technology Allied Health Faculty

    Science.gov (United States)

    Beavers, Gregory S.

    2010-01-01

    Healthcare is the largest industry in the United States and 60 percent of its 14 million workers are in allied health jobs. The need to attract and retain allied health faculty is critical to preparing a competent workforce in healthcare. This study reports the results of a survey of 259 faculty members working in diagnostic radiologic technology,…

  18. Romantika jako epistemologická alternativa otevřená Kantovou Kritikou soudnosti

    Czech Academy of Sciences Publication Activity Database

    Ďurďovič, Martin

    2014-01-01

    Roč. 36, č. 3 (2014), s. 259-281 ISSN 1210-0250 Institutional support: RVO:68378025 Keywords : epistemology * German romanticism * philosophy of arts * teleology * aesthetics Subject RIV: AA - Philosophy ; Religion http://teorievedy.flu.cas.cz/index.php/tv/article/view/244/281

  19. Is the dark matter halo of the Milky Way flattened?

    Czech Academy of Sciences Publication Activity Database

    Růžička, Adam; Palouš, Jan; Theis, Ch.

    2007-01-01

    Roč. 461, č. 1 (2007), s. 155-169 ISSN 0004-6361 R&D Projects: GA MŠk(CZ) LC06014 Institutional research plan: CEZ:AV0Z10030501 Keywords : N-body simulations * galaxies * interactions * Magellanic clouds Subject RIV: BN - Astronomy, Celestial Mechanics, Astrophysics Impact factor: 4.259, year: 2007

  20. Click chemistry-based tracking reveals putative cell wall-located auxin binding sites in expanding cells

    Czech Academy of Sciences Publication Activity Database

    Mravec, J.; Kračun, S. K.; Zemlyanskaya, E.; Rydahl, M. G.; Guo, X.; Pičmanová, M.; Sørensen, K.; Růžička, Kamil; Willats, W.G.T.

    2017-01-01

    Roč. 7, NOV 22 (2017), č. článku 15988. ISSN 2045-2322 R&D Projects: GA MŠk(CZ) LQ1601 Institutional support: RVO:61389030 Keywords : MEMBRANE H+-ATPASE * BIOLOGICAL-ACTIVITY * AZIDO AUXINS Subject RIV: EB - Genetics ; Molecular Biology OBOR OECD: Cell biology Impact factor: 4.259, year: 2016

  1. Barrier crossing in small avian migrants: individual tracking reveals prolonged nocturnal flights into the day as a common migratory strategy

    Czech Academy of Sciences Publication Activity Database

    Adamík, P.; Emmenegger, T.; Briedis, M.; Gustafsson, L.; Henshaw, I.; Krist, M.; Laaksonen, T.; Liechti, F.; Procházka, Petr; Salewski, V.; Hahn, S.

    2016-01-01

    Roč. 6, č. 21560 (2016), s. 21560 ISSN 2045-2322 R&D Projects: GA ČR GA13-06451S Institutional support: RVO:68081766 Keywords : Animal behaviour * Animal migration Subject RIV: EG - Zoology Impact factor: 4.259, year: 2016

  2. Insulin-like Growth Factor 1 Analogs Clicked in the C Domain: Chemical Synthesis and Biological Activities

    Czech Academy of Sciences Publication Activity Database

    Macháčková, Kateřina; Collinsová, Michaela; Chrudinová, Martina; Selicharová, Irena; Pícha, Jan; Buděšínský, Miloš; Vaněk, Václav; Žáková, Lenka; Brzozowski, A. M.; Jiráček, Jiří

    2017-01-01

    Roč. 60, č. 24 (2017), s. 10105-10117 ISSN 0022-2623 Institutional support: RVO:61388963 Keywords : IGF-1 * receptor * synthesis * triazole Subject RIV: CE - Biochemistry OBOR OECD: Biochemistry and molecular biology Impact factor: 6.259, year: 2016 http://pubs.acs.org/doi/full/10.1021/acs.jmedchem.7b01331

  3. Progress and prospects in rat genetics: a community view

    Czech Academy of Sciences Publication Activity Database

    Aitman, T. J.; Critser, J.K.; Cuppen, E.; Dominiczak, A.; Fernandez-Suarez, X.M.; Flint, J.; Gauguier, D.; Geurts, A.M.; Gould, M.; Harris, P.C.; Holmdahl, R.; Hubner, N.; Izsvák, Z.; Jacob, H. J.; Kuramoto, T.; Kwitek, A.E.; Marrone, A.; Mashimo, T.; Moreno, C.; Mullins, J.; Mullins, L.; Olsson, T.; Pravenec, Michal; Riley, L.; Saar, K.; Serikawa, T.; Shull, J.D.; Szpirer, C.; Twigger, S.N.; Voigt, B.; Worley, K.

    2008-01-01

    Roč. 40, č. 5 (2008), s. 516-522 ISSN 1061-4036 Institutional research plan: CEZ:AV0Z50110509 Keywords : white paper * rat * genetics Subject RIV: EB - Genetics ; Molecular Biology Impact factor: 30.259, year: 2008

  4. African Zoology - Vol 24, No 4 (1989)

    African Journals Online (AJOL)

    Fine structure of endogenous stages of Eimeria turcicus developing in gall bladder epithelium of the gecko Hemidactylus turcicus · EMAIL FREE FULL TEXT EMAIL FREE FULL TEXT · DOWNLOAD FULL TEXT DOWNLOAD FULL TEXT. I Paperna, J.H. Landsberg, 251-259 ...

  5. A solution of David Galeďs lion and man problem

    Czech Academy of Sciences Publication Activity Database

    Sgall, Jiří

    2001-01-01

    Roč. 259, 1-2 (2001), s. 663-670 ISSN 0304-3975 R&D Projects: GA AV ČR IAA1019901; GA ČR GA201/97/P038 Keywords : combinatorial game theory Subject RIV: BA - General Mathematics Impact factor: 0.468, year: 2001

  6. Differential distribution of Y-chromosome haplotypes in Swiss and Southern European goat breeds

    Czech Academy of Sciences Publication Activity Database

    Vidal, O.; Drögemüller, C.; Obexer-Ruff, G.; Reber, I.; Jordana, J.; Martínez, A.; Bâlteanu, V. A.; Delgado, J. V.; Eghbalsaied, S.; Landi, V.; Goyache, F.; Traore, A.; Pazzola, M.; Vacca, G.M.; Badaoui, B.; Pilla, F.; D'Andrea, M.; Álvarez, I.; Capote, J.; Sharaf, Abdoallah; Pons, A.; Amills, M.

    2017-01-01

    Roč. 7, NOV 23 (2017), č. článku 16161. ISSN 2045-2322 Institutional support: RVO:60077344 Keywords : mitochondrial-dna * nucleotide diversity * genetic diversity * domestication * origins * phylogenies * east Subject RIV: EB - Genetics ; Molecular Biology OBOR OECD: Genetics and heredity (medical genetics to be 3) Impact factor: 4.259, year: 2016

  7. FMNH2-dependent monooxygenases initiate catabolism of sulfonamides in Microbacterium sp strain BR1 subsisting on sulfonamide antibiotics

    Czech Academy of Sciences Publication Activity Database

    Ricken, B.; Kolvenbach, B.A.; Bergesch, C.; Benndorf, D.; Kroll, K.; Strnad, Hynek; Vlček, Čestmír; Adaixo, R.; Hammes, F.; Shahgaldian, P.; Schaeffer, A.; Kohler, H.P.E.; Corvini, P.F.X.

    2017-01-01

    Roč. 7, podzim (2017), č. článku 15783. ISSN 2045-2322 Institutional support: RVO:68378050 Keywords : resistance mechanism * clinical specimens * sulfamethoxazole * bacteria * degradation * benzylpenicillin * biodegradation * genes * sulfadiazine * arthrobacter Subject RIV: EB - Genetics ; Molecular Biology OBOR OECD: Microbiology Impact factor: 4.259, year: 2016

  8. EJOTMAS 23

    African Journals Online (AJOL)

    AUNTY TEE

    people as well as other peoples in Nigeria and the world over. These cultural ... This very popular global story connects us, the Benin people, to other parts of ..... for Local History, Cultural Heritage and Folk Studies, 6 (2), 259-. 279. Omoera ...

  9. Demand and Supply of Teachers to Secondary Schools in Anambra ...

    African Journals Online (AJOL)

    This study investigated the demand and supply of teachers to secondary schools in Anambra State of Nigeria due to school type. The survey design approach was adopted for this study. The population of the study comprised of all the secondary school principals, numbering 259 in the six education zones of Anambra State.

  10. Potent Antidiuretic Agonists, Deamino-Vasopressin and Desmopressin, and Their Inverso Analogs: NMR Structure and Interactions With Micellar and Liposomic Models of Cell Membrane

    Czech Academy of Sciences Publication Activity Database

    Lubecka, E. A.; Sikorska, E.; Sobolewski, D.; Prahl, A.; Slaninová, Jiřina; Ciarkowski, J.

    2016-01-01

    Roč. 106, č. 3 (2016), s. 245-259 ISSN 0006-3525 Institutional support: RVO:61388963 Keywords : desmopressin * deamino-vasopressin * anionic-zwitterionic micelles * liposomes * inverso analogs Subject RIV: CE - Biochemistry Impact factor: 1.908, year: 2016

  11. Early diagnosis and treatment of unilateral or asymmetrical hearing loss in childhood: 2017 CODEPEH recommendations

    Directory of Open Access Journals (Sweden)

    Faustino Núñez Batalla

    2018-06-01

    Full Text Available Núñez, F. et al. (2018: “Diagnóstico y tratamiento precoz de la hipoacusia unilateral o asimétrica en la infancia: recomendaciones CODEPEH 2017”. Revista Española de Discapacidad, 6 (I: 259-280.

  12. Application of the information, motivation and behavioural skills ...

    African Journals Online (AJOL)

    This paper discusses the application of an information, motivation and behavioural skills (IMB) model in a school-based programme for the reduction of HIV risk behaviour among 259 Grade 11 learners in two high schools in Alexandra township, Johannesburg. School 1 was the Experimental group, while School 2 was the ...

  13. How a high-gradient magnetic field could affect cell life

    Czech Academy of Sciences Publication Activity Database

    Zablotskyy, Vitaliy A.; Polyakova, Tetyana; Lunov, Oleg; Dejneka, Alexandr

    2016-01-01

    Roč. 6, Nov (2016), 1-12, č. článku 37407. ISSN 2045-2322 Grant - others:AV ČR(CZ) Fellowship J. E. Purkyně Institutional support: RVO:68378271 Keywords : high-gradient magnetic field * cell Subject RIV: BO - Biophysics Impact factor: 4.259, year: 2016

  14. Rural Principal Leadership Skill Proficiency and Student Achievement

    Science.gov (United States)

    Winn, Pam; Erwin, Sue; Gentry, Jim; Cauble, Mary

    2009-01-01

    Because of the importance of developing highly skilled rural school leaders, statewide assessments of 259 rural Texas public school administrators were analyzed to determine principal confidence levels in leadership skill domains identified by the National Policy Board of Educational Administration (NPBEA). Important findings indicate differences…

  15. [Combined physiotherapy of chronic infectious prostatitis].

    Science.gov (United States)

    Churakov, A A; Popkov, V M; Zemskov, S P; Glybochko, P V; Bliumberg, B I

    2007-01-01

    Our experience with therapy of 259 outpatients with chronic infectious prostatitis (CIP) aged 16-55 years has demonstrated that combined treatment of CIP with rectal digital massage of the prostate, electrophoresis of chimotripsin solution with dimexide and local magnetotherapy (Intramag unit) significantly raises treatment efficacy, shortens treatment, prevents complications.

  16. Perceptions of physical activity, activity preferences and health ...

    African Journals Online (AJOL)

    "Weight loss," "health concerns" and "increased energy," were top motivators for PA. "Can't find the time," "work/family obligations," and "don't have a facility" were top barriers. Presence of hypertension, hypercholesterolemia and prior weight loss correlated with the slimming motivator (adjusted odds ratio 2.59, p=0.008; ...

  17. Buckling of plate strip subjected to localized corrosion a stochastic model

    Czech Academy of Sciences Publication Activity Database

    Sadovský, Z.; Drdácký, Miloš

    2001-01-01

    Roč. 39, č. 3 (2001), s. 247-259 ISSN 0263-8231 R&D Projects: GA ČR GA103/97/S051 Grant - others:GA SR(SK) GA2/5102/20 Subject RIV: JK - Corrosion ; Surface Treatment of Materials Impact factor: 0.429, year: 2001

  18. 75 FR 64781 - Additional Designations, Foreign Narcotics Kingpin Designation Act

    Science.gov (United States)

    2010-10-20

    ... framework for the President to impose sanctions against significant foreign narcotics traffickers and their...., Martin L. Guzman 259-3, Colonia Villa de Cortes, Delegacion Benito Juarez, Mexico City, Mexico; Folio Mercantil No. 325909 (Mexico); (ENTITY) [BPI-SDNTK] 2. TATES DESARROLLO, S.A. DE C.V., Mexico City, Mexico...

  19. Seismic communication in demon African mole rat Tachyoryctes daemon from Tanzania

    Czech Academy of Sciences Publication Activity Database

    Hrouzková, E.; Dvořáková, V.; Jedlička, Petr; Šumbera, R.

    2013-01-01

    Roč. 31, č. 3 (2013), s. 255-259 ISSN 0289-0771 Institutional support: RVO:67985530 Keywords : seismic communication * substrate-borne vibration * subterranean mammal Subject RIV: DC - Siesmology, Volcanology, Earth Structure Impact factor: 0.790, year: 2013

  20. Differential effects of v-Jun and c-Jun proteins on v-myb-transformed monoblasts

    Czech Academy of Sciences Publication Activity Database

    Ševčíková, S.; Souček, Karel; Kubala, Lukáš; Bryja, Vítězslav; Šmarda, J.

    2002-01-01

    Roč. 59, č. 10 (2002), s. 1690-1705 ISSN 1420-682X R&D Projects: GA ČR GA301/01/0040 Institutional research plan: CEZ:AV0Z5004920 Keywords : v-myb * Jun * differentiation Subject RIV: BO - Biophysics Impact factor: 5.259, year: 2002

  1. The lateral distance between a proton pump and ATP synthase determines the ATP-synthesis rate

    Czech Academy of Sciences Publication Activity Database

    Sjöholm, C.; Bergstrand, J.; Nilsson, T.; Šachl, Radek; von Ballmoos, Ch.; Widengren, J.; Brzezinski, P.

    2017-01-01

    Roč. 7, č. 1 (2017), č. článku 2926. ISSN 2045-2322 Institutional support: RVO:61388955 Keywords : biological energy -conversion * cytochrome-c-oxidase * membrane-surface * rhodobacter-sphaeroides Subject RIV: CF - Physical ; Theoretical Chemistry OBOR OECD: Physical chemistry Impact factor: 4.259, year: 2016

  2. Direct fabrication of 3D graphene on nanoporous anodic alumina by plasma-enhanced chemical vapor deposition

    Czech Academy of Sciences Publication Activity Database

    Zhan, H.; Garrett, D.J.; Apollo, N.V.; Ganesan, K.; Lau, D.; Prawer, S.; Červenka, Jiří

    2016-01-01

    Roč. 6, Jan (2016), 1-8, č. článku 19822. ISSN 2045-2322 Institutional support: RVO:68378271 Keywords : double-layer capacitors * carbon nanotube arrays * amorphous-carbon * supercapacitor applications * Raman-spectroscopy * energy -storage Subject RIV: BM - Solid Matter Physics ; Magnetism Impact factor: 4.259, year: 2016

  3. Aromatic and proteomic analyses corroborate the distinction between Mediterranean landraces and modern varieties of durum wheat

    Czech Academy of Sciences Publication Activity Database

    Federico, V.; Pompeiano, Antonio; Gu, Z.; Lo Presti, E.; Whitney, L.; Monti, M.; Di Miceli, G.; Giambalvo, D.; Ruisi, P.; Guglielminetti, L.; Mancuso, S.

    2016-01-01

    Roč. 6, oct (2016), č. článku 34619. ISSN 2045-2322 Institutional support: RVO:67179843 Keywords : PTR-TOF-MS * volatile compounds * gluten strength * rapid characterization * protein-composition * extrusion-cooking * quality * cultivars * flour * subunits Subject RIV: GC - Agronomy Impact factor: 4.259, year: 2016

  4. Increased core body temperature in astronauts during long-duration space missions

    Czech Academy of Sciences Publication Activity Database

    Stahn, A. C.; Werner, A.; Opatz, O.; Maggioni, M. A.; Steinach, M.; von Ahlefeld, V. W.; Moore, A.; Crucian, B. E.; Smith, S. M.; Zwart, S. R.; Schlabs, T.; Mendt, S.; Trippel, T.; Koralewski, E.; Koch, J.; Chouker, A.; Reitz, Guenther; Shang, P.; Rocker, L.; Kirsch, K. A.; Gunga, H-C.

    2017-01-01

    Roč. 7, č. 11 (2017), č. článku 16180. ISSN 2045-2322 Institutional support: RVO:61389005 Keywords : core body temperature * astonauts' CBT * spaceflights Subject RIV: JA - Electronics ; Optoelectronics, Electrical Engineering OBOR OECD: Electrical and electronic engineering Impact factor: 4.259, year: 2016

  5. Letopis na cestě ke kronice. Počátky beletrizace analistického textu

    Czech Academy of Sciences Publication Activity Database

    Černá, Alena M.

    2012-01-01

    Roč. 4, č. 2 (2012), s. 259-270 ISSN 1804-0977 R&D Projects: GA ČR(CZ) GBP405/12/G148 Institutional support: RVO:68378092 Keywords : Old Bohemian Annals * Old Czech * historical stylistics Subject RIV: AI - Linguistics

  6. Glacial refugia and the prediction of future habitat coverage of the South American lichen species Ochrolechia austroamericana

    Czech Academy of Sciences Publication Activity Database

    Kukwa, M.; Kolanowska, Marta

    2016-01-01

    Roč. 6, dec (2016), č. článku 38779. ISSN 2045-2322 R&D Projects: GA ČR GB14-36098G Institutional support: RVO:67179843 Keywords : glacial refugia * prediction of future * Ochrolechia austroamericana Subject RIV: EH - Ecology, Behaviour Impact factor: 4.259, year: 2016

  7. Spatiotemporal variability of stone pine (Pinus pinea L.) growth response to climate across the Iberian Peninsula

    Czech Academy of Sciences Publication Activity Database

    Natalini, F.; Alejano, R.; Vazquez-Pique, J.; Pardos, M.; Calama, R.; Büntgen, Ulf

    2016-01-01

    Roč. 40, dec (2016), s. 72-84 ISSN 1125-7865 Institutional support: RVO:67179843 Keywords : tree-rings * genetically depauperate * mediterranean climate * phenotypic plasticity * cambial activity * fagus-sylvatica * spain * drought * widespread * halepensis * Climate change * Dendroecology * Growth plasticity * Mediterranean * Tree rings * Drought Subject RIV: EH - Ecology, Behaviour Impact factor: 2.259, year: 2016

  8. Neutron diffraction study of Lu.sub.2./sub.Fe.sub.17./sub. under pressure

    Czech Academy of Sciences Publication Activity Database

    Prokhnenko, Olexandr; Ritter, C.; Medvedeva, I.; Arnold, Zdeněk; Kamarád, Jiří; Kuchin, A.

    258-259, - (2003), s. 564-566 ISSN 0304-8853 R&D Projects: GA ČR GA202/02/0739; GA AV ČR IAA1010018 Institutional research plan: CEZ:AV0Z1010914 Keywords : intermetallic compounds * neutron scattering * magnetic structure Subject RIV: BM - Solid Matter Physics ; Magnetism Impact factor: 0.910, year: 2003

  9. Vitamin B2 as a virulence factor in Pseudogymnoascus destructans skin infection

    Czech Academy of Sciences Publication Activity Database

    Flieger, Miroslav; Banďouchová, H.; Černý, J.; Chudíčková, Milada; Kolařík, Miroslav; Kováčová, V.; Martínková, Natália; Novák, Petr; Šebesta, O.; Stodůlková, Eva; Pikula, J.

    2016-01-01

    Roč. 6, č. 33200 (2016), s. 33200 ISSN 2045-2322 R&D Projects: GA ČR(CZ) GAP506/12/1064 Institutional support: RVO:61388971 ; RVO:68081766 Keywords : riboflavin * white-nose syndrome (WNS) * bats Subject RIV: EG - Zoology; EE - Microbiology, Virology (MBU-M) Impact factor: 4.259, year: 2016

  10. Characterization of natural leaf senescence in tobacco (Nicotiana tabacum) plants grown in vitro

    Czech Academy of Sciences Publication Activity Database

    Uzelac, B.; Janošević, D.; Simonović, A.; Motyka, Václav; Dobrev, Petre; Budimir, S.

    2016-01-01

    Roč. 253, č. 2 (2016), s. 259-275 ISSN 0033-183X R&D Projects: GA ČR(CZ) GAP506/11/0774 Institutional support: RVO:61389030 Keywords : Leaf senescence * Mesophyll ultrastructure * Phytohormones Subject RIV: EF - Botanics Impact factor: 2.870, year: 2016

  11. Two New Faces of Amifostine: Protector from DNA Damage in Normal Cells and Inhibitor of DNA Repair in Cancer Cells

    Czech Academy of Sciences Publication Activity Database

    Hofer, Michal; Falk, Martin; Komůrková, Denisa; Falková, Iva; Bačíková, Alena; Klejdus, B.; Pagáčová, Eva; Štefančíková, Lenka; Weiterová, Lenka; Angelis, Karel; Kozubek, Stanislav; Dušek, L.; Galbavy, S.

    2016-01-01

    Roč. 59, č. 7 (2016), s. 3003-3017 ISSN 0022-2623 R&D Projects: GA ČR GBP302/12/G157; GA ČR(CZ) GA16-12454S Institutional support: RVO:68081707 Keywords : alternative splicing variant * order chromatin -structure Subject RIV: BO - Biophysics Impact factor: 6.259, year: 2016

  12. TALE-directed local modulation of H3K9 methylation shapes exon recognition

    Czech Academy of Sciences Publication Activity Database

    Bieberstein, Nicole; Kozáková, Eva; Huranová, Martina; Thakur, P.K.; Krchňáková, Zuzana; Krausová, Michaela; Oesterreich, F.C.; Staněk, David

    2016-01-01

    Roč. 6, jaro (2016), č. článku 29961. ISSN 2045-2322 R&D Projects: GA ČR(CZ) GBP305/12/G034 Institutional support: RVO:68378050 Keywords : histone h3 * human genome * efficient design * chromatin * methyltransferase * transcription * trimethylation * identification * recruitment * annotation Subject RIV: EB - Genetics ; Molecular Biology Impact factor: 4.259, year: 2016

  13. Prevalence of Demodex spp among alcohol-dependent patients

    Directory of Open Access Journals (Sweden)

    Mehmet Hanifi Kokacya

    2016-06-01

    Conclusion: Demodex spp. are more common in alcohol-dependent patients due conditions of reduced self-care and immunosuppression. Demodex parasites should be considered in alcohol-dependent patients with skin lesions, especially on the face, and should to be treated if needed. [Cukurova Med J 2016; 41(2.000: 259-263

  14. Development of a human vasopressin V-1a-receptor antagonist from an evolutionary-related insect neuropeptide

    Czech Academy of Sciences Publication Activity Database

    Di Giglio, M. G.; Muttenthaler, M.; Harpsoe, K.; Liutkeviciute, Z.; Keov, P.; Eder, T.; Rattei, T.; Arrowsmith, S.; Wray, S.; Marek, Aleš; Elbert, Tomáš; Alewood, P. F.; Gloriam, D. E.; Gruber, C. W.

    2017-01-01

    Roč. 7, Feb 1 (2017), č. článku 41002. ISSN 2045-2322 Institutional support: RVO:61388963 Keywords : neuropeptide * inotocin * V1aR-antagonist Subject RIV: CE - Biochemistry OBOR OECD: Biochemistry and molecular biology Impact factor: 4.259, year: 2016 https://www.nature.com/articles/srep41002

  15. Intricate disorder in defect fluorite/pyrochlore: a concord of chemistry and crystallography

    Czech Academy of Sciences Publication Activity Database

    Simeone, D.; Thorogood, G.J.; Huo, D.; Luneville, L.; Baldinozzi, G.; Petříček, Václav; Porcher, F.; Ribis, J.; Mazerolles, L.; Largeau, L.; Berar, J.F.; Surble, S.

    2017-01-01

    Roč. 7, Jun (2017), 1-7, č. článku 3727. ISSN 2045-2322 Institutional support: RVO:68378271 Keywords : disorder * atomic scale * metallic allys * oxides * fluorite/pyrochlore Subject RIV: BM - Solid Matter Physics ; Magnetism OBOR OECD: Condensed matter physics (including formerly solid state physics, supercond.) Impact factor: 4.259, year: 2016

  16. FEM simulation of a sono-reactor accounting for vibrations of the boundaries

    Czech Academy of Sciences Publication Activity Database

    Louisnard, O.; González-Garcia, J.; Tudela, I.; Klíma, Jiří; Sáez, V.; Vargas-Hernandez, Y.

    2009-01-01

    Roč. 16, č. 2 (2009), s. 250-259 ISSN 1350-4177 R&D Projects: GA MŠk 1P05OC074 Institutional research plan: CEZ:AV0Z40400503 Keywords : finite elements * ultrasound * standing waves Subject RIV: CF - Physical ; Theoretical Chemistry Impact factor: 2.993, year: 2009

  17. Journal of Biosciences | Indian Academy of Sciences

    Indian Academy of Sciences (India)

    Home; Journals; Journal of Biosciences. Sangappa. Articles written in Journal of Biosciences. Volume 30 Issue 2 March 2005 pp 259-268 Articles. Crystal structure of raw pure Mysore silk fibre based on (Ala-Gly)2-Ser-Gly peptide sequence using Linked-Atom-Least-Squares method · Sangappa S S Mahesh R Somashekar.

  18. 17 CFR 250.57 - Notices and reports to be filed under section 33.

    Science.gov (United States)

    2010-04-01

    ... section 33. (a) Notification of Status as Foreign Utility Company. Form U-57 (§ 259.207 of this chapter), notification of status as a foreign utility company, may be filed by, or on behalf of, an entity that seeks to... COMMISSION (CONTINUED) GENERAL RULES AND REGULATIONS, PUBLIC UTILITY HOLDING COMPANY ACT OF 1935 Regulation...

  19. Review of James L. Baughman, Jennifer Ratner-Rosenhagen, and James P. Danky, eds, Protest on the Page: Essays on Print and the Culture of Dissent since 1865 (2015

    Directory of Open Access Journals (Sweden)

    Maria Zirra

    2017-12-01

    Full Text Available James L. Baughman, Jennifer Ratner-Rosenhagen, and James P. Danky, eds, Protest on the Page: Essays on Print and the Culture of Dissent since 1865 (Madison: University of Wisconsin Press, 2015. xv + 259 pp. ISBN 978-0-299-30284-9.

  20. ORF Alignment: NC_005085 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_005085 gi|34499386 >1qgiA 1 259 102 360 4e-95 ... gb|AAQ61593.1| probable chitosan...ase A [Chromobacterium violaceum ATCC 12472] ... ref|NP_903601.1| probable chitosanase A [Chromobacte

  1. Use of indigenous knowledge in the management of field and ...

    African Journals Online (AJOL)

    EJIRO

    African Journal of Environmental Science and Technology Vol. 3 (9), pp. 251-259 .... that an acre can to produce between 3 and 72 bags ..... Leaves of Eucalyptus are taken, air dried and grinded, and the resulting powder is mixed with the ...

  2. ORF Alignment: NC_002939 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_002939 gi|39995137 >1u07A 13 88 186 259 1e-09 ... emb|CAE28917.1| possible energy ...transducer TonB [Rhodopseudomonas palustris CGA009] ... ref|NP_948814.1| possible energy transducer T

  3. ORF Alignment: NC_002678 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_002678 gi|13471241 >1u07A 13 88 186 259 1e-09 ... emb|CAE28917.1| possible energy ...transducer TonB [Rhodopseudomonas palustris ... CGA009] ref|NP_948814.1| possible energy transducer ...

  4. ORF Alignment: NC_004463 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_004463 gi|27379019 >1u07A 13 88 186 259 1e-09 ... emb|CAE28917.1| possible energy ...transducer TonB [Rhodopseudomonas palustris CGA009] ... ref|NP_948814.1| possible energy transducer T

  5. Nitrate reducing activity pervades surface waters during upwelling.

    Digital Repository Service at National Institute of Oceanography (India)

    Fernandes, S.O.; Halarnekar, R.; Malik, A.; Vijayan, V.; Varik, S.; RituKumari; Jineesh V.K.; Gauns, M.U.; Nair, S.; LokaBharathi, P.A.

    .A., Roson, G., Perez, F.F., Figueiras, F.G., Pazos, Y., 1996. Nitrogen cycling in an estuarine upwelling system, the Ria de Arousa (NW Spain). Short-time-scale patterns of hydrodynamic and biogeochemical circulation. Mar. Ecol. Prog. Ser. 135, 259...

  6. Journal of Biosciences | Indian Academy of Sciences

    Indian Academy of Sciences (India)

    Home; Journals; Journal of Biosciences. Anurag Kumar Mishra. Articles written in Journal of Biosciences. Volume 27 Issue 3 June 2002 pp 251-259 Articles. Cloning and sequencing of complete -crystallin cDNA from embryonic lens of Crocodylus palustris · Raman Agrawal Reena Chandrashekhar Anurag Kumar Mishra ...

  7. On the hydrogen neutral outflowing disks of B[e] supergiants

    Czech Academy of Sciences Publication Activity Database

    Kraus, Michaela; Borges Fernandes, M.; de Araújo, F. X.

    2007-01-01

    Roč. 463, č. 2 (2007), s. 627-634 ISSN 0004-6361 R&D Projects: GA ČR GA205/04/1267 Institutional research plan: CEZ:AV0Z10030501 Keywords : supergiants * winds * outflows Subject RIV: BN - Astronomy, Celestial Mechanics, Astrophysics Impact factor: 4.259, year: 2007

  8. Transcobalamin 776C-->G polymorphism is associated with peripheral neuropathy in elderly with high folate intake

    Science.gov (United States)

    Background: The 776C-->G polymorphism of the vitamin B-12 transport protein transcobalamin gene (TCN2) (rs1801198; Pro259Arg) is associated with a lower holotranscobalamin concentration in plasma. This effect may reduce the availability of vitamin B-12 to tissues even when vitamin B-12 intake is ade...

  9. Silver salt of 4,6-diazido-N-nitro-1,3,5-triazine-2-amine - characterization of this primary explosive

    Czech Academy of Sciences Publication Activity Database

    Musil, T.; Matyáš, R.; Vala, R.; Růžička, A.; Vlček, Milan

    2014-01-01

    Roč. 39, č. 2 (2014), s. 251-259 ISSN 0721-3115 Institutional support: RVO:61389013 Keywords : primary explosive * AgDANT * silver salt of 4,6-diazido-N-nitro-1,3,5-triazine-2-amine Subject RIV: CC - Organic Chemistry Impact factor: 1.604, year: 2014

  10. Gas stripping in galaxy clusters: a new SPH simulation approach

    Czech Academy of Sciences Publication Activity Database

    Jáchym, Pavel; Palouš, Jan; Köppen, J.; Combes, F.

    2007-01-01

    Roč. 472, č. 1 (2007), s. 5-20 ISSN 0004-6361 R&D Projects: GA MŠk(CZ) LC06014 Institutional research plan: CEZ:AV0Z10030501 Keywords : galaxie s * interactions * intergalactic medium Subject RIV: BN - Astronomy, Celestial Mechanics, Astrophysics Impact factor: 4.259, year: 2007

  11. Voltammetric and X-ray diffraction analysis of the early stages of the thermal crystallization of mixed Cu,Mn oxides

    Czech Academy of Sciences Publication Activity Database

    Grygar, Tomáš; Rojka, T.; Bezdička, Petr; Večerníková, Eva; Kovanda, F.

    2004-01-01

    Roč. 8, č. 4 (2004), s. 252-259 ISSN 1432-8488 R&D Projects: GA MŠk LN00A028 Institutional research plan: CEZ:AV0Z4032918 Keywords : amorphous phases * Cu,Mn oxides * hydrotalcite Subject RIV: CA - Inorganic Chemistry Impact factor: 0.984, year: 2004

  12. Pseudotrichonympha leei, Pseudotrichonympha lifesoni, and Pseudotrichonympha pearti, new species of parabasalian flagellates and the description of a rotating subcellular structure

    Czech Academy of Sciences Publication Activity Database

    del Campo, J.; James, E. R.; Hirakawa, Y.; Fiorito, R.; Kolísko, Martin; Irwin, N. A.T.; Mathur, V.; Boscaro, V.; Hehenberger, E.; Karnkowska, A.; Scheffrahn, R. H.; Keeling, P. J.

    2017-01-01

    Roč. 7, NOV 27 (2017), č. článku 16349. ISSN 2045-2322 Institutional support: RVO:60077344 Keywords : lower termites * phylogeny * symbiosis * protozoa * primers * tool Subject RIV: EB - Gene tics ; Molecular Biology OBOR OECD: Biochemistry and molecular biology Impact factor: 4.259, year: 2016

  13. Adipokinetic hormones control amylase activity in the cockroach (Periplaneta americana) gut

    Czech Academy of Sciences Publication Activity Database

    Bodláková, K.; Jedlička, Pavel; Kodrík, Dalibor

    2017-01-01

    Roč. 24, č. 2 (2017), s. 259-269 ISSN 1672-9609 R&D Projects: GA ČR GA14-07172S Institutional support: RVO:61388963 ; RVO:60077344 Keywords : AKH * AKH receptor * amylase * enzyme * gene expression * midgut Subject RIV: ED - Physiology OBOR OECD: Entomology; Biochemistry and molecular biology (BC-A) Impact factor: 2.026, year: 2016

  14. Hypersaline sapropels act as hotspots for microbial dark matter

    Czech Academy of Sciences Publication Activity Database

    Andrei, Adrian-Stefan; Baricz, A.; Robeson, M. S.; Pauşan, M. R.; Tamaş, T.; Chiriac, C.; Szekeres, E.; Barbu-Tudoran, L.; Levei, E. A.; Coman, C.; Podar, M.; Banciu, H.L.

    2017-01-01

    Roč. 7, č. 1 (2017), č. článku 6150. ISSN 2045-2322 Institutional support: RVO:60077344 Keywords : 16S RIBOSOMAL-RNA * HALOPHILIC ARCHAEA * lake-sediments Subject RIV: EE - Microbiology, Virology OBOR OECD: Microbiology Impact factor: 4.259, year: 2016

  15. Nanoparticle core stability and surface functionalization drive the mTOR signaling pathway in hepatocellular cell lines.

    Czech Academy of Sciences Publication Activity Database

    Lunova, M.; Prokhorov, A.; Jirsa, M.; Hof, M.; Olžyńska, A.; Jurkiewicz, P.; Kubinová, Šárka; Lunov, O.; Dejneka, A.

    2017-01-01

    Roč. 7, č. 1 (2017), s. 16049 ISSN 2045-2322 R&D Projects: GA MŠk(CZ) LO1309 Institutional support: RVO:68378041 Keywords : mesoporous silica nanoparticles * iron-oxide nanoparticles * double-stranded-rna * drug-delivery Subject RIV: FP - Other Medical Disciplines OBOR OECD: Biophysics Impact factor: 4.259, year: 2016

  16. The Impact of "DSM-5" A-Criteria Changes on Parent Ratings of ADHD in Adolescents

    Science.gov (United States)

    Sibley, Margaret H.; Yeguez, Carlos E.

    2014-01-01

    Objective: Diagnostic and Statistical Manual of Mental Disorders (5th ed.; DSM-5) A-criteria for ADHD were expanded to include new descriptors referencing adolescent and adult symptom manifestations. This study examines the effect of these changes on symptom endorsement in a sample of adolescents with ADHD (N = 259; age range = 10.72-16.70).…

  17. Science Credit for Agriculture: Perceived Support, Preferred Implementation Methods and Teacher Science Course Work.

    Science.gov (United States)

    Johnson, Donald M.

    1996-01-01

    Arkansas agriculture teachers (213 of 259 surveyed) expressed support for granting science credit for agriculture (88.8%); 65.6% supported science credit for a limited number of agriculture courses. Blanket endorsement for all certified agriculture teachers was favored by 71.5%; 56.6% preferred endorsement only for certified teachers completing an…

  18. Phase morphology of PP/COC blends

    Czech Academy of Sciences Publication Activity Database

    Šlouf, Miroslav; Kolařík, Jan; Fambri, L.

    2003-01-01

    Roč. 91, č. 1 (2003), s. 253-259 ISSN 0021-8995 R&D Projects: GA ČR GP106/02/P029 Institutional research plan: CEZ:AV0Z4050913 Keywords : polypropylene * norbornene * polyolefin Subject RIV: CD - Macromolecular Chemistry Impact factor: 1.017, year: 2003

  19. The enigma of the lower gut-associated lymphoid tissue (GALT)

    Czech Academy of Sciences Publication Activity Database

    Butler, J. E.; Šinkora, Marek

    2013-01-01

    Roč. 94, č. 2 (2013), s. 259-270 ISSN 0741-5400 R&D Projects: GA ČR GAP502/10/0038; GA ČR GAP502/12/0110 Institutional support: RVO:61388971 Keywords : B lymphocytes * lymphogenesis * B cell development Subject RIV: EC - Immunology Impact factor: 4.304, year: 2013

  20. Costly neighbours: Heterospecific competitive interactions increase metabolic rates in dominant species

    Czech Academy of Sciences Publication Activity Database

    Janča, M.; Gvoždík, Lumír

    2017-01-01

    Roč. 7, č. 5177 (2017), č. článku 5177. ISSN 2045-2322 R&D Projects: GA ČR(CZ) GA15-07140S Institutional support: RVO:68081766 Keywords : interference competition * intraspecific variation * terrestrial salamander * energy metabolism * natural selection * newts Subject RIV: EG - Zoology OBOR OECD: Zoology Impact factor: 4.259, year: 2016

  1. Elicitation threshold of cobalt chloride

    DEFF Research Database (Denmark)

    Fischer, Louise A; Johansen, Jeanne D; Voelund, Aage

    2016-01-01

    : On the basis of five included studies, the ED10 values of aqueous cobalt chloride ranged between 0.0663 and 1.95 µg cobalt/cm(2), corresponding to 30.8-259 ppm. CONCLUSIONS: Our analysis provides an overview of the doses of cobalt that are required to elicit allergic cobalt contactdermatitis in sensitized...

  2. Mathematical description of the nonlinear chemical reactions with ...

    Indian Academy of Sciences (India)

    more complex and different. In this paper, we ... for complex oscillations with an autocatalytic stage in .... A) with sodium hydroxide (used as a reagent X). 0. 10. 20. 30 ... Time [a.u.] ..... Decroly O and Goldbeter A 1984 Physics Letters 105A. 259.

  3. Social Adjustment of College Freshmen: The Importance of Gender and Living Environment

    Science.gov (United States)

    Enochs, Wendy K.; Roland, Catherine B.

    2006-01-01

    The relationship between living environment, gender and both overall adjustment to college and social adjustment in freshmen students was examined in this study. The College Adjustment Scales were administered to 511 freshmen students living in on-campus housing. There were 259 students living in Freshmen Year Experience (FYE) Halls verses 252…

  4. Curriculum Orientations of Pre-Service Teachers in Jordan: A Required Reform Initiative for Professional Development

    Science.gov (United States)

    Ashour, Rateb; Khasawneh, Samer; Abu-Alruz, Jamal; Alsharqawi, Subhi

    2012-01-01

    The primary purpose of this study was to determine the curriculum orientations of pre-service teachers at a university in Jordan. Rigorous translation procedures were utilized to validate an Arabic version of the Curriculum Orientation Inventory (COI) for use in Jordan. The validated COI was administered to a sample of 259 pre-service teachers who…

  5. Relationship between Tobacco Advertising and Youth Smoking: Assessing the Effectiveness of a School-Based Antismoking Intervention Program.

    Science.gov (United States)

    Beltramini, Richard F.; Bridge, Patrick D.

    2001-01-01

    The Hazards of Tobacco (C) program, which focuses on smoking prevention among youth, was completed by 259 suburban sixth graders (199 controls) and 166 urban fifth through seventh graders. Participation significantly changed understanding of the role of tobacco advertising and the intention to smoke in both samples. (Contains 49 references.) (SK)

  6. Accessibility of women farmers to agricultural information in South ...

    African Journals Online (AJOL)

    Furthermore, the women farmers were accessible to technical information on improved seeds (x = 2.59), storage methods (x = 2.44), but poor access to operating farm machinery (x =0.49) and weather forecast (x =0.68). With regard to economic information they were accessible to market locations (x =2.40), but had low ...

  7. Influence of seeing effects on cloud model inversions

    Czech Academy of Sciences Publication Activity Database

    Tziotziou, K.; Heinzel, Petr; Tsiropoula, G.

    2007-01-01

    Roč. 472, č. 1 (2007), s. 287-292 ISSN 0004-6361 Institutional research plan: CEZ:AV0Z10030501 Keywords : cloud model * inversions * seeing effects Subject RIV: BN - Astronomy, Celestial Mechanics, Astrophysics Impact factor: 4.259, year: 2007

  8. Critical Climate: Relations among Sexual Harassment, Climate, and Outcomes for High School Girls and Boys

    Science.gov (United States)

    Ormerod, Alayne J.; Collinsworth, Linda L.; Perry, Leigh Ann

    2008-01-01

    This study examined the relationships among peer-to-peer sexual harassment, school climate, adult-to-student harassment, and outcomes (psychological and physical well-being; school withdrawal and safety) for high school girls (n = 310) and boys (n = 259) recruited from seven public high schools in a Midwestern state. More frequent, severe peer…

  9. Regional Fears of Western Primacy and the Future of U.S. Middle Eastern Basing Policy

    Science.gov (United States)

    2006-12-01

    8, 2006, internet. 166. “ Green Energy Gambit,” The Pearl (Magazine of the State of Qatar), March 2005, p. 4. 167. Michael R. Gordon and Lieutenant...The Middle East, October 2005, pp. 16-17. 259. Hamad Bin Isa al Khalifa, First Light: Modern Bahrain and Its Heritage, London and New York: Kegan

  10. Draft genome sequence of Xylella fastidiosa pear leaf scorch strain in Taiwan

    Science.gov (United States)

    The draft genome sequence of Xylella fastidiosa pear leaf scorch strain (PLS229) isolated from pear cultivar Hengshan (Pyrus pyrifolia) in Taiwan is reported. The bacterium has a genome size of 2,733,013 bp with a G+C content of 53.1%. The PLS229 strain genome was annotated to have 3,259 open readin...

  11. Electron microscopy and molecular characterization of phytoplasmas associated with strawflower yellows in the Czech Republic

    Czech Academy of Sciences Publication Activity Database

    Fránová, Jana; Přibylová, Jaroslava; Šimková, Marie; Navrátil, M.; Válová, P.

    2003-01-01

    Roč. 109, - (2003), s. 883-887 ISSN 0929-1873 R&D Projects: GA ČR GA522/98/0792; GA AV ČR IBS5051014 Institutional research plan: CEZ:AV0Z5051902 Keywords : Helichrysum bracteatum Subject RIV: EE - Microbiology, Virology Impact factor: 1.259, year: 2003

  12. 76 FR 4250 - Operating Certain Railroad Tank Cars in Excess of 263,000 Pounds Gross Rail Load; Approval

    Science.gov (United States)

    2011-01-25

    ..., thicknesses, materials of construction, and working pressures were as follows: Working Tank car specification..., wheels, draft systems, springs and trucks. S-259, however, does not allow for the free interchange among...-jacketed tank cars constructed with ASTM 516-70 steel and having only the minimum plate thickness required...

  13. HANSENULA WICKERHAMII SP. N., A NEW YEAST FROM FINNISH SOIL

    Science.gov (United States)

    Capriotti, Augusto

    1961-01-01

    Capriotti, Augusto (l'Università di Perugia, Perugia, Italy). Hansenula wickerhamii sp. n., a new yeast from Finnish soil. J. Bacteriol. 82:259–360. 1961.—Hansenula wickerhamii sp. n. is described; it was isolated from a Finnish soil, and is named in honor of Lynferd J. Wickerham. Images PMID:13690638

  14. Substituted 2-hydroxy-N-(arylalkyl)benzamides induce apoptosis in cancer cell lines

    Czech Academy of Sciences Publication Activity Database

    Imramovský, A.; Jorda, Radek; Pauk, K.; Řezníčková, Eva; Dušek, J.; Hanousek, J.; Kryštof, Vladimír

    2013-01-01

    Roč. 68, č. 2013 (2013), s. 253-259 ISSN 0223-5234 R&D Projects: GA ČR GAP305/12/0783; GA ČR GA301/08/1649 Institutional research plan: CEZ:AV0Z50380511 Keywords : Diamides * Apoptosis * Cytotoxicity Subject RIV: CE - Biochemistry Impact factor: 3.432, year: 2013

  15. Microwave Assisted Synthesis of Magnetically Responsive Composite Materials

    Czech Academy of Sciences Publication Activity Database

    Šafařík, Ivo; Pospišková, K.; Maděrová, Zdeňka; Baldíková, E.; Horská, Kateřina; Šafaříková, Miroslava

    2015-01-01

    Roč. 32, č. 1 (2015), s. 239-243 ISSN 0749-503X R&D Projects: GA MŠk(CZ) LD13023; GA ČR(CZ) GAP503/11/2263 Institutional support: RVO:67179843 Keywords : saccharomyces cerevisiae * cells immobilization * chitosan * magnetite * microwave irradiation * yeast Subject RIV: EH - Ecology, Behaviour Impact factor: 2.259, year: 2015

  16. Functional groups of fossil marattialeans: chemotaxonomic implications for Pennsylvanian tree ferns and pteridophylls

    Czech Academy of Sciences Publication Activity Database

    Pšenička, J.; Zodrow, E. L.; Mastalerz, M.; Bek, Jiří

    2005-01-01

    Roč. 61, 3-4 (2005), s. 259-280 ISSN 0166-5162 R&D Projects: GA AV ČR(CZ) IAA3013902 Institutional research plan: CEZ:AV0Z30130516 Keywords : interdisciplinary approach * functional groups * FTIR Subject RIV: DB - Geology ; Mineralogy Impact factor: 1.397, year: 2005

  17. Salvage radiation therapy following radical prostatectomy. A national Danish study

    DEFF Research Database (Denmark)

    Ervandian, Maria; Høyer, Morten; Petersen, Stine Elleberg

    2015-01-01

    BACKGROUND: The purpose of this observational cohort study was to evaluate the outcome and prognostic factors following salvage radiotherapy (SRT) in a consecutive national cohort. MATERIAL AND METHODS: Between 2006 and 2010, 259 patients received SRT in Denmark. Patient- and cancer-related chara...

  18. Holocaust Education in Jewish Schools in Israel: Goals, Dilemmas, Challenges

    Science.gov (United States)

    Gross, Zehavit

    2010-01-01

    Research has shown the Holocaust to be the primary component of Jewish identity (Farago in Yahadut Zmanenu 5:259-285, 1989; Gross in Influence of the trip to Poland within the framework of the Ministry of Education on the working through of the Holocaust. Unpublished M.A. thesis, Ben-Gurion University, Beer Sheva, 2000; "Herman in Jewish…

  19. Genotype dependent callus induction and shoot regeneration in ...

    African Journals Online (AJOL)

    This study aims to observe the effect of genotype, hormone and culture conditions on sunflower (Helianthus annuus L.) callus induction and indirect plant regeneration. Calli were obtained from hypocotyl and cotyledon explants of five different sunflower genotypes; Trakya 80, Trakya 129, Trakya 259, Trakya 2098 and ...

  20. PATTERNS OF SEVEN AND COMPLICATED MALARIA IN CHILDREN

    African Journals Online (AJOL)

    GB

    2Department of Health Management and Economics, School of Public Health, Tehran University of Medical Sciences, ... Algeria, Brazil, Colombia, Iran, and Syria. (5). ..... Statistics Center of Iran. 2013: 259- 60. [Persian]. 24. Reithinger R. Leishmaniases' burden of disease: ways forward for getting from speculation to reality.

  1. Keywords

    African Journals Online (AJOL)

    Femi

    Only about half of surveyed men were found to use ... Influencing men's attitude towards the uptake of ... survey of 259 men aged 15-65 years with at least one child less than 3 years of age was conducted ... been fully explored in Nigeria.

  2. 78 FR 38304 - Applications for New Awards; Native Hawaiian Career and Technical Education Program (NHCTEP...

    Science.gov (United States)

    2013-06-26

    ... DEPARTMENT OF EDUCATION Applications for New Awards; Native Hawaiian Career and Technical Education Program (NHCTEP); Correction Catalog of Federal Domestic Assistance (CFDA), Number: 84.259A... Register and the Code of Federal Regulations is available via the Federal Digital System at: www.gpo.gov...

  3. Experimental temporal quantum steering

    Czech Academy of Sciences Publication Activity Database

    Bartkiewicz, K.; Černoch, Antonín; Lemr, K.; Miranowicz, A.; Nori, F.

    2016-01-01

    Roč. 6, Nov (2016), 1-8, č. článku 38076. ISSN 2045-2322 R&D Projects: GA ČR GAP205/12/0382 Institutional support: RVO:68378271 Keywords : temporal quantum steering * EPR steering Subject RIV: BH - Optics, Masers, Lasers Impact factor: 4.259, year: 2016

  4. Inhibition of nuclear factor kappaB proteins-platinated DNA interactions correlates with cytotoxic effectiveness of the platinum complexes

    Czech Academy of Sciences Publication Activity Database

    Brabec, Viktor; Kašpárková, Jana; Kostrhunová, Hana; Farrell, N.P.

    2016-01-01

    Roč. 6, AUG2016 (2016), č. článku 28474. ISSN 2045-2322 R&D Projects: GA MŠk(CZ) LH13096 Institutional support: RVO:68081707 Keywords : interstrand cross-links * group domain proteins Subject RIV: BO - Biophysics Impact factor: 4.259, year: 2016

  5. Studies on improved Agrobacterium-mediated transformation in two ...

    African Journals Online (AJOL)

    Administrator

    168-169. Saharan V,Yadav RC,Yadav NR, Chapagain BP (2004). High frequency plant regeneration from desiccated calli of indica rice. (Oryza sativa L.). Afr. J. Biotechnol. 3:256-259. Sivamani E, Huet H, Shen P, Ong C, Kochko A, Beachy RN ...

  6. SALO, a novel classical pathway complement inhibitor from saliva of the sand fly Lutzomyia longipalpis

    Czech Academy of Sciences Publication Activity Database

    Ferreira, V.P.; Vale, V.F.; Pangburn, M.K.; Abdeladhim, M.; Mendes-Sousa, A.F.; Coutinho-Abreu, I.V.; Rasouli, M.; Brandt, E.A.; Meneses, C.; Lima, K.F.; Araújo, R.N.; Pereira, M.H.; Kotsyfakis, Michalis; Oliveira, F.; Kamhawi, S.; Ribeiro, J.M.C.; Gontijo, N.F.; Collin, N.; Valenzuela, J. G.

    2016-01-01

    Roč. 6, JAN 13 (2016), č. článku 19300. ISSN 2045-2322 R&D Projects: GA ČR GAP502/12/2409 Institutional support: RVO:60077344 Keywords : leishmania * immunity * glands Subject RIV: EB - Genetics ; Molecular Biology Impact factor: 4.259, year: 2016

  7. Genome-wide association analysis of symbiotic nitrogen fixation in common bean

    Science.gov (United States)

    A genome-wide association study (GWAS) was conducted to explore the genetic basis of variation for symbiotic nitrogen fixation (SNF) and related traits in the Andean diversity panel (ADP) comprised of 259 common bean (Phaseolus vulgaris) genotypes. The ADP was evaluated for SNF and related traits in...

  8. Determination of radon concentration in spring gases with a portable semiconductor detector

    International Nuclear Information System (INIS)

    Endo, K.; Yanaga, M.; Yoshikawa, H.; Horiuchi, K.; Nakahara, H.; Murakami, Y.

    1985-01-01

    A portable integrating radon meter, alpha METER-400, was tested. The instrument detects α-rays of energy greater than 2.59 MeV. With this detector, the concentration of 222 Rn in spring gases at volcanic regions was determined. The results were compared with those observed by the liquid scintillation counting method. (author)

  9. Using Application-Domain Knowledge in the Runtime Support of Multi-Experiment Computational Studies

    Science.gov (United States)

    2009-01-01

    259, 1993. [20] Carlos A Coello, David A Van Veldhuizen , and Gary B Lamont. Evolu- tionary Algorithms for Solving Multi-Objective Problems. Kluwer...Applications, 20(2):255–285, 2006. [56] Robert Van Liere, Jurriaan D. Mulder, and Jarke J. van Wijk. Compu- tational steering. Future Generation Computer

  10. 75 FR 70279 - Agency Information Collection Activities: Submitted for Office of Management and Budget Review...

    Science.gov (United States)

    2010-11-17

    ... is required to obtain benefits for Forms MMS-4292 and MMS-4293. Frequency: Monthly, annually, and on... depreciation--use either straight-line, or a unit of production method. 1206.259(c)(1)(ii) and (c)(2)(iii... transportation 1 1 1 allowance on Form MMS-4430 for depreciation--use either straight-line, or a unit of...

  11. Electrochemical and Quantum Chemical Study of Reactivity of Orthophthalaldehyde with Aliphatic Primary Amines

    Czech Academy of Sciences Publication Activity Database

    Donkeng Dazie, Joel; Liška, Alan; Ludvík, Jiří

    2016-01-01

    Roč. 163, č. 9 (2016), G127-G132 ISSN 0013-4651 R&D Projects: GA ČR GA13-21704S Institutional support: RVO:61388955 Keywords : electrochemistry * quantum chemical study * amines Subject RIV: CG - Electrochemistry Impact factor: 3.259, year: 2016

  12. Eestlased riisusid Balti fotovõistlusel koore

    Index Scriptorium Estoniae

    2011-01-01

    Eesti, Läti ja Leedu fotovõistlusest, kus valiti Baltikumi parimad loodusfotod ja maaelu kajastavad fotod. Osales 259 fotograafi. Parim loodusfoto oli Kaido Haageni "Kus sa oled, mu sõber" ning parim foto maaelu kategoorias Arne Aderi "Jõuluks koju"

  13. Global warming not so harmful for all plants-response of holomycotrophic orchid species for the future climate change

    Czech Academy of Sciences Publication Activity Database

    Kolanowska, Marta; Kras, M.; Lipińska, M.; Mystkowska, K.; Szlachetko, D. L.; Naczk, A. M.

    2017-01-01

    Roč. 7, č. 1 (2017), č. článku 12704. ISSN 2045-2322 R&D Projects: GA ČR GB14-36098G Institutional support: RVO:86652079 Keywords : global warming * Orchids * climate change Subject RIV: EH - Ecology, Behaviour OBOR OECD: Environmental sciences (social aspects to be 5.7) Impact factor: 4.259, year: 2016

  14. Family Functioning Predictors of Self-Concept and Self-Esteem in Children at Risk for Learning Disabilities in Oman: Exclusion of Parent and Gender Contribution

    Science.gov (United States)

    Emam, Mahmoud Mohamed; Abu-Serei, Usama Saad

    2014-01-01

    The study investigated whether family functioning can predict the self-concept and self-esteem of normally achieving (NA) and at risk for learning disabilities (LD) students in Oman regardless of parent education level and gender status. A total of 259 elementary school students were selected from schools in the main districts of Muscat, the…

  15. Impact of Executive Function Deficits and Attention-Deficit/Hyperactivity Disorder (ADHD) on Academic Outcomes in Children

    Science.gov (United States)

    Biederman, Joseph; Monuteaux, Michael C.; Doyle, Alysa E.; Seidman, Larry J.; Wilens, Timothy E.; Ferrero, Frances; Morgan, Christie L.; Faraone, Stephen V.

    2004-01-01

    The association between executive function deficits (EFDs) and functional outcomes were examined among children and adolescents with attention-deficit/hyperactivity disorder (ADHD). Participants were children and adolescents with (n = 259) and without (n = 222) ADHD, as ascertained from pediatric and psychiatric clinics. The authors defined EFD as…

  16. beta-1,2,3-Triazolyl-Nucleosides as Nicotinamide Riboside Mimics

    Czech Academy of Sciences Publication Activity Database

    Amigues, E.J.; Armstrong, E.; Dvořáková, Marcela; Migaud, M.E.; Huang, M.

    2009-01-01

    Roč. 28, č. 3 (2009), s. 238-259 ISSN 1525-7770 Institutional research plan: CEZ:AV0Z50380511 Keywords : Nucleoside * nucleotide * sirtuin Subject RIV: EB - Genetics ; Molecular Biology Impact factor: 0.768, year: 2009

  17. Nonpyrogenic Molecular Adjuvants Based on norAbu-Muramyldipeptide and norAbu-Glucosaminyl Muramyldipeptide: Synthesis, Molecular Mechanisms of Action, and Biological Activities in Vitro and in Vivo

    Czech Academy of Sciences Publication Activity Database

    Effenberg, R.; Turánek Knötigová, P.; Zyka, D.; Čelechovská, H.; Mašek, J.; Bartheldyová, E.; Hubatka, F.; Koudelka, Š.; Lukáč, R.; Kovalová, Anna; Šaman, David; Křupka, M.; Barkocziova, L.; Kosztyu, P.; Šebela, M.; Drož, L.; Hučko, M.; Kanásová, M.; Miller, A.D.; Raška, M.; Ledvina, M.; Turánek, J.

    2017-01-01

    Roč. 60, č. 18 (2017), s. 7745-7763 ISSN 0022-2623 R&D Projects: GA MŠk(CZ) LO1304 Institutional support: RVO:61388963 Keywords : N-acetylmuramyl peptides * muramyl dipeptide * adamantylamide dipeptide Subject RIV: CC - Organic Chemistry OBOR OECD: Organic chemistry Impact factor: 6.259, year: 2016

  18. Ticks infected via co-feeding transmission can transmit Lyme borreliosis to vertebrate hosts

    Czech Academy of Sciences Publication Activity Database

    Belli, A.; Sarr, A.; Rais, O.; Rego, Ryan O. M.; Voordouw, M.J.

    2017-01-01

    Roč. 7, JUL 10 (2017), č. článku 5006. ISSN 2045-2322 Institutional support: RVO:60077344 Keywords : Ixodes ricinus ticks * disease spirochete * borne pathogens * r-0 model * vector * mice * immunity * persistence Subject RIV: GJ - Animal Vermins ; Diseases, Veterinary Medicine OBOR OECD: Veterinary science Impact factor: 4.259, year: 2016

  19. N-(Pivaloyloxy)alkoxy-carbonyl Prodrugs of the Glutamine Antagonist 6-Diazo-5-oxo-L-norleucine (DON) as a Potential Treatment for HIV Associated Neurocognitive Disorders

    Czech Academy of Sciences Publication Activity Database

    Nedelcovych, M. T.; Tenora, Lukáš; Kim, B. H.; Kelschenbach, J.; Chao, W.; Hadas, E.; Jančařík, Andrej; Prchalová, Eva; Zimmermann, S. C.; Dash, R. P.; Gadiano, A. J.; Garrett, C.; Furtmüller, G.; Oh, B.; Brandacher, G.; Alt, J.; Majer, Pavel; Volsky, D.J.; Rais, R.; Slusher, B. S.

    2017-01-01

    Roč. 60, č. 16 (2017), s. 7186-7198 ISSN 0022-2623 Institutional support: RVO:61388963 Keywords : long-term potentiation * magnetic resonance spectroscopy * virus type 1 encephalitis Subject RIV: CC - Organic Chemistry OBOR OECD: Organic chemistry Impact factor: 6.259, year: 2016

  20. The relation between evil and transcendence: new possibilities ...

    African Journals Online (AJOL)

    In this article I will analyse the concept of evil in terms of the typology of transcendence that was developed by Wessel Stoker. I will argue that there are, within the (post-) modern discourse, and ... This notion of evil may enhance our ethical responsibility towards it. South African Journal of Philosophy 2014, 33(3): 259–269 ...

  1. SLC22A3 polymorphisms do not modify pancreatic cancer risk, but may influence overall patient survival

    Czech Academy of Sciences Publication Activity Database

    Mohelníková-Duchoňová, B.; Strouhal, O.; Hughes, D. J.; Holcatová, I.; Oliverius, M.; Kala, Z.; Campa, D.; Rizzato, C.; Canzian, F.; Pezzilli, R.; Talar-Wojnarowska, R.; Malecka-Panas, E.; Sperti, C.; Federico Zambon, C.; Pedrazzoli, S.; Fogar, P.; Milanetto, A.C.; Capurso, G.; Fave, G.D.; Valente, R.; Gazouli, M.; Malleo, G.; Lawlor, R.T.; Strobel, O.; Hackert, T.; Giese, N.; Vodička, Pavel; Vodičková, Ludmila; Landi, S.; Tavano, F.; Gioffreda, D.; Piepoli, A.; Pazienza, V.; Mambrini, A.; Pedata, M.; Cantore, M.; Bambi, F.; Ermini, S.; Funel, N.; Lemstrová, R.; Souček, P.

    2017-01-01

    Roč. 7, MAR 2017 (2017), s. 43812 ISSN 2045-2322 R&D Projects: GA ČR(CZ) GAP301/12/1734 Institutional support: RVO:68378041 Keywords : genome-wide association * genetic susceptibility * loci * transporters Subject RIV: EB - Genetics ; Molecular Biology OBOR OECD: Biochemistry and molecular biology Impact factor: 4.259, year: 2016

  2. Bond Feasibility Study. Project Identification Committee Report.

    Science.gov (United States)

    Wichita Public Schools, KS.

    A committee, appointed by the Board of Education, was requested to make a comprehensive study of the school building needs of Unified School District No. 259. In an attempt to determine the feasibility of a general bond election to upgrade the public schools, the specific charge to the committee was to evaluate the needs for physical plant…

  3. Prevalence and severity of malnutrition in pre-school children in a rural area of western Kenya

    NARCIS (Netherlands)

    Kwena, Arthur M.; Terlouw, Dianne J.; de Vlas, Sake J.; Phillips-Howard, Penelope A.; Hawley, William A.; Friedman, Jennifer F.; Vulule, John M.; Nahlen, Bernard L.; Sauerwein, Robert W.; ter Kuile, Feiko O.

    2003-01-01

    We determined the nutritional status of children less than five years of age in an area in rural western Kenya with intense malaria transmission, a high prevalence of severe anemia and human immunodeficiency virus, and high infant and under-five mortality (176/1,000 and 259/1,000). No information is

  4. International Uranium Resources Evaluation Project (IUREP) national favourability studies: Niue

    International Nuclear Information System (INIS)

    1977-12-01

    Niue is described as a coral island containing 259 square kilometers, located between Tonga and the Southern Cook Islands in the Central Pacific. Geologically, little is known, or can be deduced from available information, therefore reported occurrences of uranium are the basis for a potential in category 1 (less than 1,000 tonnes U) . (author)

  5. Activation of an anti-bacterial toxin by the biosynthetic enzyme CysK: mechanism of binding, interaction specificity and competition with cysteine synthase

    Czech Academy of Sciences Publication Activity Database

    Benoni, Roberto; Beck, C. M.; Garza-Sánchez, F.; Bettati, S.; Mozzarelli, A.; Hayes, C. S.; Campanini, B.

    2017-01-01

    Roč. 7, Aug 18 (2017), č. článku 8817. ISSN 2045-2322 Institutional support: RVO:61388963 Keywords : O-acetylserine sulfhydrylase * dependent growth inhibition * Salmonella typhimurium LT-2 Subject RIV: CE - Biochemistry OBOR OECD: Biochemistry and molecular biology Impact factor: 4.259, year: 2016 https://www.nature.com/articles/s41598-017-09022-6

  6. Coding accuracy on the psychophysical scale

    Czech Academy of Sciences Publication Activity Database

    Košťál, Lubomír; Lánský, Petr

    2016-01-01

    Roč. 6, Mar 29 (2016), s. 23810 ISSN 2045-2322 R&D Projects: GA ČR(CZ) GA15-08066S Institutional support: RVO:67985823 Keywords : cortex * neural decoding * senzory processing Subject RIV: FH - Neurology Impact factor: 4.259, year: 2016

  7. PTPRD (protein tyrosine phosphatase receptor type delta) is associated with restless legs syndrome

    Czech Academy of Sciences Publication Activity Database

    Schormair, B.; Kemlink, D.; Roeske, D.; Eckstein, G.; Xiong, L.; Lichtner, P.; Ripke, S.; Trenkwalder, C.; Zimprich, A.; Stiasny-Kolster, K.; Oertel, W.; Bachmann, C. G.; Paulus, W.; Högl, B.; Frauscher, B.; Gschliesser, V.; Poewe, W.; Peglau, I.; Vodička, Pavel; Vávrová, J.; Šonka, K.; Nevšímalová, S.; Montplaisir, J.; Turecki, G.; Rouleau, G.; Gieger, Ch.; Illig, T.; Wichmann, H.E.; Holsboer, F.; Müller-Myhsok, B.; Meitinger, T.; Winkelmann, J.

    2008-01-01

    Roč. 40, č. 8 (2008), s. 946-948 ISSN 1061-4036 R&D Projects: GA MZd NR8563 Institutional research plan: CEZ:AV0Z50390703 Keywords : PTPRD * syndrom restless legs Subject RIV: EB - Genetics ; Molecular Biology Impact factor: 30.259, year: 2008

  8. Enhanced functional and structural domain assignments using

    Indian Academy of Sciences (India)

    Unknown

    using remote similarity detection procedures for proteins encoded in the genome of Mycobacterium tuberculosis H37Rv” (J. Biosci. 29 (3) 245–. 259, 2004) by Seema Namboori, Natasha Mhatre, Sentivel Sujatha,. Narayanaswamy Srinivasan and Shashi Bhushan Pandit. The three-dimensional structure and subcellular ...

  9. Philipp Weselsky - profesor chemie vídeňské techniky z Českomoravské vysočiny

    Czech Academy of Sciences Publication Activity Database

    Jindra, Jiří

    2010-01-01

    Roč. 43, č. 4 (2010), s. 255-259 ISSN 0300-4414 Institutional research plan: CEZ:AV0Z80630520 Keywords : Vienna Technical university 1854-1884 * tuition of analytical chemistry * Philipp Weselsky Subject RIV: AB - History

  10. Empirical evidence for large X-effects in animals with undifferentiated sex chromosomes

    Czech Academy of Sciences Publication Activity Database

    Dufresnes, C.; Majtyka, T.; Baird, Stuart J. E.; Gerchen, J. F.; Borzée, A.; Savary, R.; Ogielska, M.; Perrin, N.; Stöck, M.

    2016-01-01

    Roč. 6, č. 21029 (2016), s. 21029 ISSN 2045-2322 Institutional support: RVO:68081766 Keywords : controlled study * genetic marker * hybrid zone * Hyla * introgression * sex chromosome Subject RIV: EB - Genetics ; Molecular Biology Impact factor: 4.259, year: 2016

  11. The Execution of the Miners of Kutná Hora at Poděbrady and in Křivoklát in 1496. On the Veneration of the Miners of Poděbrady in the Sixteenth Century

    Czech Academy of Sciences Publication Activity Database

    Šárovcová, Martina

    Suppl., č. 2 (2015), s. 259-278 ISSN 0015-1831 Institutional support: RVO:68378033 Keywords : music manuscripts * Utraquism * Bohemian Reformation * illuminated fragments * Jan Hus * Fabián Puléř * early modern illuminated manuscripts Subject RIV: AL - Art, Architecture, Cultural Heritage

  12. Variation in annual pollen accumulation rates of Fagus along a N-S transect in Europe based on pollen traps

    Czech Academy of Sciences Publication Activity Database

    Pidek, I. A.; Svitavská-Svobodová, Helena; van der Knaap, W. O.; Noryskiewicz, A. M.; Filbrandt-Czaja, A.; Noryskiewicz, B.; Latalova, M.; Zimny, M.; Swieta-Musznicka, J.; Bozilova, E.; Tonkov, S.; Filipova-Marinova, M.; Poska, A.; Giesecke, T.; Gikov, A.

    2010-01-01

    Roč. 19, č. 4 (2010), s. 259-270 ISSN 0939-6314 R&D Projects: GA AV ČR IAAX00130801; GA AV ČR IAAX00050801 Institutional research plan: CEZ:AV0Z60050516 Keywords : Fagus * Europe * pollen monitoring Subject RIV: EF - Botanics Impact factor: 1.656, year: 2010

  13. Assessment of the nutritional quality of smoked catfish ( Clarias ...

    African Journals Online (AJOL)

    This study examined the nutritional quality of smoked Catfish Clarias gariepinus obtained in three different markets in Lapai, Niger State, Nigeria for a period of three months. Proximate compositions of smoked Clarias gariepinus were determined. The highest protein content (49.27 ± 2.59) was recorded in smoked fish ...

  14. Prevalence of Hemolivia mauritanica (Apicomplexa: Adeleina: Haemogregarinidae) in natural populations of tortoises of the genus Testudo in the east Mediterranean region

    Czech Academy of Sciences Publication Activity Database

    Široký, P.; Kamler, M.; Modrý, David

    2005-01-01

    Roč. 52, č. 4 (2005), s. 259-361 ISSN 0015-5683 R&D Projects: GA ČR GP524/03/D104 Grant - others:IGA VFU(CZ) 2/2004/FVHE Institutional research plan: CEZ:AV0Z60220518 Keywords : Apicomplexa * Hemolivia mauritanica Subject RIV: EG - Zoology Impact factor: 1.138, year: 2005

  15. SAJSM EDITORIAL.indd

    African Journals Online (AJOL)

    Richard played cricket at a high level, with an average of 25.9 runs in rst division cricket. He captained the South. African Country Districts Cricket team for a number of years as a wicketkeeper-batsman. He retired from active cricket in 1982 and after his cricket career he served on the Border Cricket Board, with a three-year ...

  16. The Burden of Pulmonary Hypertension in Patients with ...

    African Journals Online (AJOL)

    Results: A total of 1390 echocardiogram reports done at Conquest Medical Imaging, Enugu, from July 2009 to August 2013 were retrospectively reviewed. Degenerative mitral valve disease was noted in 18.7% of the patients, (259/1390) made up of 149 males and 110 females with a mean age of 68.3 (14.4) years.

  17. The variability of the primeval forest's spatial pattern in the Babia Gora National Park

    International Nuclear Information System (INIS)

    Chrobaczek, U.; Jastrzebski, R.; Ziemniewicz, M.; Kaczor, D.; Widlak, M.; Lesiak, M.

    2011-01-01

    This paper analyzes the spatial variability of stand volume, species composition and regeneration in a primeval stand located in the lower maintain belt in the Babia Gora massif. These characteristics were surveyed on 259 circular plots (of a 7.0 m radius) located in a square grid 20 m · 20 m on the total area 10.36 ha. (authors)

  18. Volume 11 No. 1 February 2011 4538 UTILIZATION OF STOVER ...

    African Journals Online (AJOL)

    user

    2011-02-01

    Feb 1, 2011 ... balance (3.0±0.98 g/d) was similar (P > 0.05) among cultivars, whereas available protein ranged (P ... solar radiation, and 25.9°C. (range: 22.6°C ..... Van Soest PJ Nutritional ecology of the ruminant, O & B Books, Inc. Oregon,.

  19. Can deep seated gravitational slope deformations be activated by regional tectonic strain: First insights from displacement measurements in caves from the Eastern Alps

    Czech Academy of Sciences Publication Activity Database

    Baron, I.; Plan, L.; Grasemann, B.; Mitrovic, I.; Lenhardt, W.; Hausmann, H.; Stemberk, Josef

    2016-01-01

    Roč. 259, APR 15 (2016), 81-89 ISSN 0169-555X Grant - others:Austrian Science Fund(AT) P25884-N29 Institutional support: RVO:67985891 Keywords : tectonic strain * slope failure * earthquake Subject RIV: DB - Geology ; Mineralogy Impact factor: 2.958, year: 2016

  20. The Hardy inequality with boundary or intermediate conditions

    Czech Academy of Sciences Publication Activity Database

    Kufner, Alois

    2017-01-01

    Roč. 8, č. 2 (2017), s. 105-109 ISSN 2077-9879 Institutional support: RVO:67985840 Keywords : Hardy's inequality * boundary conditions Subject RIV: BA - General Mathematics OBOR OECD: Pure mathematics http://www.mathnet.ru/php/archive.phtml?wshow=paper&jrnid=emj&paperid=259&option_lang=eng