WorldWideScience

Sample records for dubnium 256

  1. Extraction systems for the study of dubnium

    International Nuclear Information System (INIS)

    Gates, J.M.; Sudowe, R.; Ali, M.N.; Calvert, M.G.; Dragojevic, I.; Ellison, P.A.; Garcia, M.A.; Gharibyan, N.; Gregorich, K.E.; Nelson, S.L.; Neumann, S.H.; Parsons-Moss, T.; Stavsetra, L.; Nitsche, H.

    2007-01-01

    The chemistry of transactinide elements (Z (ge) 104) is a topic of great interest in current nuclear chemistry research. The chemical systems that can be used in these studies are limited by the short half-lives of the isotopes and the small production rates of atoms per minute or even atoms per week. In the initial investigations, the chemistry used had to be very selective to the periodic group of interest to separate the transactinide atom from all the other unwanted nuclear reaction products, e.g., transfer products. By using the Berkeley Gas-filled Separator (BGS) as a physical pre-separator, we are able concentrate on systems that are selective between the members of the group of interest, because all other interfering products and the beam are being suppressed by the BGS [1]. We are developing suitable extraction systems for the study of element 105, dubnium. For this purpose we have studied the extraction of niobium and tantalum, the lighter homologs of dubnium, from mineral acids with different organophosphorus compounds. All studies were performed online, using short-lived niobium and tantalum produced in the 124 Sn( 51 V,5n) 170 Ta and 74 Se( 18 O,p3n) 88 Nb reactions. This allowed for the study of the lighter homologues at metal concentrations of 10 -16 M. At these low metal concentrations, the formation of polymeric species is largely prohibited. As seen in Fig. 1, by varying the extractant and the hydrochloric acid concentration from 1 to 11 M, we are able to see a difference in extraction behavior between niobium and tantalum. While the system is suitable for determining chemical differences between the lighter homologues, the extraction of tantalum from hydrochloric acid shows slow kinetics. Figure 2 shows that after 90 seconds of mixing, the system is not in equilibrium. However, experiments indicate that equilibrium is reached faster at higher acid concentrations. We have studied the influence of hydrogen ion concentration on the extraction

  2. 15 CFR 256.1 - Introduction.

    Science.gov (United States)

    2010-01-01

    ... 15 Commerce and Foreign Trade 1 2010-01-01 2010-01-01 false Introduction. 256.1 Section 256.1 Commerce and Foreign Trade Regulations Relating to Commerce and Foreign Trade NATIONAL INSTITUTE OF... PROGRAM § 256.1 Introduction. This part states policies and procedures concerning the Research Associate...

  3. Dicty_cDB: SLH256 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SL (Link to library) SLH256 (Link to dictyBase) - - - Contig-U12223-1 SLH256F (Link to Original site) SLH2...56F 399 - - - - - - Show SLH256 Library SL (Link to library) Clone ID SLH256 (Link to...ycdb.biol.tsukuba.ac.jp/CSM/SL/SLH2-C/SLH256Q.Seq.d/ Representative seq. ID SLH25...6F (Link to Original site) Representative DNA sequence >SLH256 (SLH256Q) /CSM/SL/SLH2-C/SLH256Q.Seq.d/ CAGAA...SL/SLJ5-A/SLJ523Q.Seq.d/ 444 e-124 SLH256 (SLH256Q) /CSM/SL/SLH2-C/SLH256Q.Seq.d/ 444 e-124 SSK705 (SSK705Q)

  4. Dicty_cDB: VHK256 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VH (Link to library) VHK256 (Link to dictyBase) - - - Contig-U16260-1 - (Link to Original site) VHK2...56F 620 - - - - - - Show VHK256 Library VH (Link to library) Clone ID VHK256 (Link to dicty...iol.tsukuba.ac.jp/CSM/VH/VHK2-C/VHK256Q.Seq.d/ Representative seq. ID - (Link to ...Original site) Representative DNA sequence >VHK256 (VHK256Q) /CSM/VH/VHK2-C/VHK256Q.Seq.d/ AACTCTCGAGTGCAAAA...27874 ) Dictyostelium discoideum cDNA clone:ddv63k23, 5' ... 1170 0.0 1 ( BJ42787

  5. 30 CFR 256.82 - Environmental studies.

    Science.gov (United States)

    2010-07-01

    ... 30 Mineral Resources 2 2010-07-01 2010-07-01 false Environmental studies. 256.82 Section 256.82... OIL AND GAS IN THE OUTER CONTINENTAL SHELF Studies § 256.82 Environmental studies. (a) The Director... practicable, be designed to predict environmental impacts of pollutants introduced into the environments and...

  6. 30 CFR 256.12 - Supplemental sales.

    Science.gov (United States)

    2010-07-01

    ... 30 Mineral Resources 2 2010-07-01 2010-07-01 false Supplemental sales. 256.12 Section 256.12..., General § 256.12 Supplemental sales. (a) The Secretary may conduct a supplemental sale in accordance with the provisions of this section. (b) Supplemental sales shall be governed by the regulations in this...

  7. 30 CFR 256.44 - Bids disqualified.

    Science.gov (United States)

    2010-07-01

    ... by law, regulation, lease or stipulation to lease shall not disqualify an otherwise qualified bid; or... 30 Mineral Resources 2 2010-07-01 2010-07-01 false Bids disqualified. 256.44 Section 256.44... OIL AND GAS IN THE OUTER CONTINENTAL SHELF Issuance of Leases § 256.44 Bids disqualified. The...

  8. Improved security analysis of Fugue-256

    DEFF Research Database (Denmark)

    Gauravaram, Praveen; Bagheri, Nasour; Knudsen, Lars Ramkilde

    2011-01-01

    Fugue is a cryptographic hash function designed by Halevi, Hall and Jutla and was one of the fourteen hash algorithms of the second round of NIST’s SHA3 hash competition. We consider Fugue-256, the 256-bit instance of Fugue. Fugue-256 updates a state of 960 bits with a round transformation R para...

  9. 40 CFR 256.06 - Definitions.

    Science.gov (United States)

    2010-07-01

    ... AND IMPLEMENTATION OF STATE SOLID WASTE MANAGEMENT PLANS Purpose, General Requirements, Definitions... public (including interstate) solid or hazardous waste management authority, or other public agency below... 40 Protection of Environment 24 2010-07-01 2010-07-01 false Definitions. 256.06 Section 256.06...

  10. 17 CFR 256.301 - Organization.

    Science.gov (United States)

    2010-04-01

    ... 17 Commodity and Securities Exchanges 3 2010-04-01 2010-04-01 false Organization. 256.301 Section... COMPANY ACT OF 1935 Service Company Property Accounts § 256.301 Organization. This account shall include... incident to organizing a corporation or other form of organization and putting it into readiness to do...

  11. 42 CFR 84.256 - Quality control requirements.

    Science.gov (United States)

    2010-10-01

    ... 42 Public Health 1 2010-10-01 2010-10-01 false Quality control requirements. 84.256 Section 84.256... § 84.256 Quality control requirements. (a) In addition to the construction and performance requirements specified in §§ 84.251, 84.252, 84.253, 84.254, and 84.255, the quality control requirements in paragraphs...

  12. 30 CFR 256.50 - Dating of leases.

    Science.gov (United States)

    2010-07-01

    ... 30 Mineral Resources 2 2010-07-01 2010-07-01 false Dating of leases. 256.50 Section 256.50 Mineral Resources MINERALS MANAGEMENT SERVICE, DEPARTMENT OF THE INTERIOR OFFSHORE LEASING OF SULPHUR OR OIL AND GAS IN THE OUTER CONTINENTAL SHELF Issuance of Leases § 256.50 Dating of leases. All leases issued under...

  13. 32 CFR 256.7 - Accident potential zone guidelines.

    Science.gov (United States)

    2010-07-01

    ... 32 National Defense 2 2010-07-01 2010-07-01 false Accident potential zone guidelines. 256.7 Section 256.7 National Defense Department of Defense (Continued) OFFICE OF THE SECRETARY OF DEFENSE (CONTINUED) MISCELLANEOUS AIR INSTALLATIONS COMPATIBLE USE ZONES § 256.7 Accident potential zone guidelines...

  14. 17 CFR 256.426.1 - Donations.

    Science.gov (United States)

    2010-04-01

    ... 17 Commodity and Securities Exchanges 3 2010-04-01 2010-04-01 false Donations. 256.426.1 Section... COMPANY ACT OF 1935 Income and Expense Accounts § 256.426.1 Donations. This account shall include all payments or donations for charitable, social or community welfare purposes. ...

  15. 17 CFR 256.124 - Other investments.

    Science.gov (United States)

    2010-04-01

    ... 17 Commodity and Securities Exchanges 3 2010-04-01 2010-04-01 false Other investments. 256.124... COMPANY ACT OF 1935 2. Investments § 256.124 Other investments. This account shall include the cost or current value of investments, whichever is less, in securities, club memberships, associations, life...

  16. 30 CFR 256.71 - Directional drilling.

    Science.gov (United States)

    2010-07-01

    ... 30 Mineral Resources 2 2010-07-01 2010-07-01 false Directional drilling. 256.71 Section 256.71... drilling. In accordance with an approved exploration plan or development and production plan, a lease may be maintained in force by directional wells drilled under the leased area from surface locations on...

  17. 30 CFR 256.80 - Leases of other minerals.

    Science.gov (United States)

    2010-07-01

    ... 30 Mineral Resources 2 2010-07-01 2010-07-01 false Leases of other minerals. 256.80 Section 256.80 Mineral Resources MINERALS MANAGEMENT SERVICE, DEPARTMENT OF THE INTERIOR OFFSHORE LEASING OF SULPHUR OR OIL AND GAS IN THE OUTER CONTINENTAL SHELF Section 6 Leases § 256.80 Leases of other minerals. The...

  18. 30 CFR 256.25 - Areas near coastal States.

    Science.gov (United States)

    2010-07-01

    ... 30 Mineral Resources 2 2010-07-01 2010-07-01 false Areas near coastal States. 256.25 Section 256... SULPHUR OR OIL AND GAS IN THE OUTER CONTINENTAL SHELF Call for Information and Nominations § 256.25 Areas near coastal States. (a) At the time information is solicited for leasing of areas within 3...

  19. 17 CFR 256.409 - Income taxes.

    Science.gov (United States)

    2010-04-01

    ... 17 Commodity and Securities Exchanges 3 2010-04-01 2010-04-01 false Income taxes. 256.409 Section... COMPANY ACT OF 1935 Income and Expense Accounts § 256.409 Income taxes. (a) This account shall include the amount of local, State and Federal taxes on income properly accruable during the period covered by the...

  20. Nuclear Data Sheets for A=256

    Energy Technology Data Exchange (ETDEWEB)

    Singh, Balraj

    2017-03-15

    Available nuclear structure information for the known A=256 nuclei (Cf, Es, Fm, Md, No, Lr, Rf and Db) is presented together with Adopted properties of levels and gamma rays. This evaluation supersedes data in the previous evaluations of A=256 nuclides by 1999Ak02, 1989Sc26, 1981Sc06 and 1976Sc02.

  1. 17 CFR 256.216 - Unappropriated retained earnings.

    Science.gov (United States)

    2010-04-01

    ... retained earnings. This account shall include the balance, either debit or credit, arising from earnings... 17 Commodity and Securities Exchanges 3 2010-04-01 2010-04-01 false Unappropriated retained earnings. 256.216 Section 256.216 Commodity and Securities Exchanges SECURITIES AND EXCHANGE COMMISSION...

  2. 17 CFR 256.920 - Salaries and wages.

    Science.gov (United States)

    2010-04-01

    ... 17 Commodity and Securities Exchanges 3 2010-04-01 2010-04-01 false Salaries and wages. 256.920... COMPANY ACT OF 1935 2. Expense § 256.920 Salaries and wages. (a) This account shall include salaries, wages, bonuses and other consideration for services, with the exception of director's fees paid directly...

  3. Dicty_cDB: VFJ256 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VF (Link to library) VFJ256 (Link to dictyBase) - - - Contig-U10140-1 VFJ256E (Link...) Clone ID VFJ256 (Link to dictyBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U10140-1 Ori...*nq*fylv*l*vx*KMNKLHLPIKENHHQXIKSIELIKNEFPEILICTDLCLC AYTDHGHCGVLTEEGFIENEKSIIRLG...iiikiih iiyivdmpiqlldhgkvimsf*nln*fiqfllqi*liqklklnpyqdnikfqvi**lnf* dhwlrkd*nq*fylv*l*vx*KMNKLHLPIKENHHQXIKSIELIKNEFPEILICT...pdate 2002.12.18 Homology vs DNA Score E Sequences producing significant alignments: (bits) Value N ( BJ432755 ) Dict

  4. Improved security analysis of Fugue-256 (poster)

    DEFF Research Database (Denmark)

    Gauravaram, Praveen; Knudsen, Lars Ramkilde; Bagheri, Nasoor

    2011-01-01

    We present some improved analytical results as part of the ongoing work on the analysis of Fugue-256 hash function, a second round candidate in the NIST's SHA3 competition. First we improve Aumasson and Phans' integral distinguisher on the 5.5 rounds of the final transformation of Fugue-256 to 16...

  5. 30 CFR 256.65 - Attorney General review.

    Science.gov (United States)

    2010-07-01

    ... 30 Mineral Resources 2 2010-07-01 2010-07-01 false Attorney General review. 256.65 Section 256.65... give due consideration to the views of the Attorney General. The Secretary may act on an assignment or transfer if the Attorney General has not responded to the request for consultation within 30 days of said...

  6. 27 CFR 24.256 - Bottle aging wine.

    Science.gov (United States)

    2010-04-01

    ... 27 Alcohol, Tobacco Products and Firearms 1 2010-04-01 2010-04-01 false Bottle aging wine. 24.256... OF THE TREASURY LIQUORS WINE Storage, Treatment and Finishing of Wine Bottling, Packing, and Labeling of Wine § 24.256 Bottle aging wine. Wine bottled or packed and stored for the purpose of aging need...

  7. 17 CFR 256.01-11 - Methods of allocation.

    Science.gov (United States)

    2010-04-01

    ... applicable and currently effective methods of allocation filed with the Commission. Both direct and allocated... 17 Commodity and Securities Exchanges 3 2010-04-01 2010-04-01 false Methods of allocation. 256.01... HOLDING COMPANY ACT OF 1935 General Instructions § 256.01-11 Methods of allocation. Indirect costs and...

  8. 17 CFR 256.411.5 - Investment tax credit.

    Science.gov (United States)

    2010-04-01

    ... 17 Commodity and Securities Exchanges 3 2010-04-01 2010-04-01 false Investment tax credit. 256.411... HOLDING COMPANY ACT OF 1935 Income and Expense Accounts § 256.411.5 Investment tax credit. (a) This account shall be debited with the amounts of investment tax credits related to service company property...

  9. 40 CFR 265.256 - Special requirements for ignitable or reactive waste.

    Science.gov (United States)

    2010-07-01

    ... TREATMENT, STORAGE, AND DISPOSAL FACILITIES Waste Piles § 265.256 Special requirements for ignitable or... 40 Protection of Environment 25 2010-07-01 2010-07-01 false Special requirements for ignitable or reactive waste. 265.256 Section 265.256 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY...

  10. 40 CFR 264.256 - Special requirements for ignitable or reactive waste.

    Science.gov (United States)

    2010-07-01

    ..., AND DISPOSAL FACILITIES Waste Piles § 264.256 Special requirements for ignitable or reactive waste... 40 Protection of Environment 25 2010-07-01 2010-07-01 false Special requirements for ignitable or reactive waste. 264.256 Section 264.256 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY...

  11. 40 CFR 81.256 - Northeast Iowa Intrastate Air Quality Control Region.

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 17 2010-07-01 2010-07-01 false Northeast Iowa Intrastate Air Quality Control Region. 81.256 Section 81.256 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED... Quality Control Regions § 81.256 Northeast Iowa Intrastate Air Quality Control Region. The Northeast Iowa...

  12. 76 FR 11433 - Federal Transition To Secure Hash Algorithm (SHA)-256

    Science.gov (United States)

    2011-03-02

    ... ADMINISTRATION [FAR-N-2011-01; Docket No. 2011-0083; Sequence 1] Federal Transition To Secure Hash Algorithm (SHA... acquisition community to transition to Secure Hash Algorithm SHA-256. SHA-256 is a cryptographic hash function... persons attending. Please cite ``Federal Transition to Secure Hash Algorithm SHA-256'' in all...

  13. 17 CFR 256.255 - Accumulated deferred investment tax credits.

    Science.gov (United States)

    2010-04-01

    ... investment tax credits. 256.255 Section 256.255 Commodity and Securities Exchanges SECURITIES AND EXCHANGE... investment tax credits. (a) This account shall be credited and account 411.5, Investment tax credit, debited with investment tax credits deferred by companies which do not apply such credits as a reduction of the...

  14. 6 CFR 25.6 - Procedures for designation of qualified anti-terrorism technologies.

    Science.gov (United States)

    2010-01-01

    ...-terrorism technologies. 25.6 Section 25.6 Domestic Security DEPARTMENT OF HOMELAND SECURITY, OFFICE OF THE SECRETARY REGULATIONS TO SUPPORT ANTI-TERRORISM BY FOSTERING EFFECTIVE TECHNOLOGIES § 25.6 Procedures for designation of qualified anti-terrorism technologies. (a) Application Procedure. Any person, firm or other...

  15. 37 CFR 256.1 - General.

    Science.gov (United States)

    2010-07-01

    ... Patents, Trademarks, and Copyrights COPYRIGHT OFFICE, LIBRARY OF CONGRESS COPYRIGHT ARBITRATION ROYALTY PANEL RULES AND PROCEDURES ADJUSTMENT OF ROYALTY FEE FOR CABLE COMPULSORY LICENSE § 256.1 General. This part establishes adjusted terms and rates for royalty payments in accordance with the provisions of 17...

  16. 40 CFR 256.02 - Scope of the State solid waste management plan.

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 24 2010-07-01 2010-07-01 false Scope of the State solid waste management plan. 256.02 Section 256.02 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) SOLID WASTES GUIDELINES FOR DEVELOPMENT AND IMPLEMENTATION OF STATE SOLID WASTE MANAGEMENT PLANS Purpose, General Requirements, Definitions § 256.0...

  17. A 256×256 low-light-level CMOS imaging sensor with digital CDS

    Science.gov (United States)

    Zou, Mei; Chen, Nan; Zhong, Shengyou; Li, Zhengfen; Zhang, Jicun; Yao, Li-bin

    2016-10-01

    In order to achieve high sensitivity for low-light-level CMOS image sensors (CIS), a capacitive transimpedance amplifier (CTIA) pixel circuit with a small integration capacitor is used. As the pixel and the column area are highly constrained, it is difficult to achieve analog correlated double sampling (CDS) to remove the noise for low-light-level CIS. So a digital CDS is adopted, which realizes the subtraction algorithm between the reset signal and pixel signal off-chip. The pixel reset noise and part of the column fixed-pattern noise (FPN) can be greatly reduced. A 256×256 CIS with CTIA array and digital CDS is implemented in the 0.35μm CMOS technology. The chip size is 7.7mm×6.75mm, and the pixel size is 15μm×15μm with a fill factor of 20.6%. The measured pixel noise is 24LSB with digital CDS in RMS value at dark condition, which shows 7.8× reduction compared to the image sensor without digital CDS. Running at 7fps, this low-light-level CIS can capture recognizable images with the illumination down to 0.1lux.

  18. 17 CFR 256.411 - Provision for deferred income taxes-credit.

    Science.gov (United States)

    2010-04-01

    ... taxes-credit. 256.411 Section 256.411 Commodity and Securities Exchanges SECURITIES AND EXCHANGE... deferred income taxes—credit. This account shall be credited and Accumulated Deferred Income Taxes debited with an amount equal to the portion of taxes on income payable for the year which is attributable to a...

  19. 17 CFR 256.01-4 - Construction or service contracts, and centralized procurement accounting.

    Science.gov (United States)

    2010-04-01

    ... contracts, and centralized procurement accounting. 256.01-4 Section 256.01-4 Commodity and Securities... § 256.01-4 Construction or service contracts, and centralized procurement accounting. (a) Specific accounts have not been provided in which to classify expenditures made in the performance of construction...

  20. 17 CFR 256.01-5 - Determination of service cost accounting.

    Science.gov (United States)

    2010-04-01

    ... accounting. Service at cost and fair allocation of costs require, first of all, an accurate accounting for... 17 Commodity and Securities Exchanges 3 2010-04-01 2010-04-01 false Determination of service cost accounting. 256.01-5 Section 256.01-5 Commodity and Securities Exchanges SECURITIES AND EXCHANGE COMMISSION...

  1. 42 CFR 422.256 - Review, negotiation, and approval of bids.

    Science.gov (United States)

    2010-10-01

    ... 42 Public Health 3 2010-10-01 2010-10-01 false Review, negotiation, and approval of bids. 422.256... Information and Plan Approval § 422.256 Review, negotiation, and approval of bids. (a) Authority. Subject to... submitted under § 422.252 and conduct negotiations with MA organizations regarding these bids (including the...

  2. Cold Fusion Production and Decay of Neutron-Deficient Isotopes of Dubnium and Development of Extraction Systems for Group V Elements

    Energy Technology Data Exchange (ETDEWEB)

    Gates, Jacklyn M. [Univ. of California, Berkeley, CA (United States)

    2008-07-31

    Excitation functions for the 1n and 2n exit channels of the 208Pb(51V,xn)259-xDb reaction were measured. A maximum cross section of the 1n exit channel of 2070$+1100\\atop{-760}$ pb was measured at an excitation energy of 16.0 ± 1.8 MeV. For the 2n exit channel, a maximum cross section of 1660$+450\\atop{-370}$ pb was measured at 22.0 ± 1.8 MeV excitation energy. The 1n excitation function for the 209Bi(50Ti,n)258Db reaction was remeasured, resulting in a cross section of 5480$+1730\\atop{-1370}$ pb at an excitation energy of 16.0 ± 1.6 MeV. Differences in cross section maxima are discussed in terms of the fusion probability below the barrier. The extraction of niobium (Nb) and tantalum (Ta) from hydrochloric acid and mixed hydrochloric acid/lithium chloride media by bis(2-ethylhexyl) hydrogen phosphate (HDEHP) and bis(2-ethylhexyl) hydrogen phosphite (BEHP) was studied. The goal of the experiments was to find a system that demonstrates selectivity among the members of group five of the Periodic Table and is also suitable for the study of dubnium (Db, Z = 105). Experiments with niobium and tantalum were performed with carrier (10-6 M), carrier free (10-10 M) and trace (10-16 M) concentrations of metal using hydrochloric acid solution with concentrations ranging from 1 - 11 M. The extraction of niobium and tantalum from mixed hydrochloric acid/lithium chloride media by HDEHP and BEHP as a function of hydrogen ion (H+) concentration was also investigated. The data obtained are used as the basis to discuss the speciation of niobium and tantalum under the conditions studied and to evaluate possible extraction mechanisms. The 74Se(18O,p3n)88gNb excitation function was measured to determine the best energy for producing the 88Nb used in chemistry experiments. A maximum cross section of 495 +- 5 mb was observed at an 18O energy of 74.0 Me

  3. Experimental study on 14 MeV neutron irradiation effects in FLASH ROM28F256 and 29C256

    International Nuclear Information System (INIS)

    He Chaohui; Chen Xiaohua; Li Guozheng; Wang Yanping; Ji Lin; Geng Bin; Yang Hailiang; Liu Enke

    2000-01-01

    Experimental results of neutron irradiation effects are given for FLASH ROM. New phenomena are observed. The 14 MeV neutron irradiation effects in 28F256 and 29C256 devices are different from the single event effects. Errors are only '0'→'1'. There is a neutron flux threshold. Errors occur when neutron flux is above the threshold, no error occurs when below the threshold. The errors go up with the increase of the neutron flux until all '0' change to '1'. Hard errors, that new data cannot be written in memory with programmer, occur in devices which are measured during irradiation and irradiated in power on mode. Errors rise with the increase of reading times. Under same neutron flux, there is no error in devices in power off mode, however, errors occur in all devices in power on mode, moreover, undefined errors occur

  4. 17 CFR 256.190 - Accumulated deferred income taxes.

    Science.gov (United States)

    2010-04-01

    .... proprietary capital ... (CONTINUED) UNIFORM SYSTEM OF ACCOUNTS FOR MUTUAL SERVICE COMPANIES AND SUBSIDIARY SERVICE COMPANIES, PUBLIC UTILITY HOLDING COMPANY ACT OF 1935 4. Deferred Debits § 256.190 Accumulated deferred income taxes. (a...

  5. 17 CFR 256.426.5 - Other deductions.

    Science.gov (United States)

    2010-04-01

    ... deductible before determining total income before interest charges. (b) Records shall be so maintained by...) UNIFORM SYSTEM OF ACCOUNTS FOR MUTUAL SERVICE COMPANIES AND SUBSIDIARY SERVICE COMPANIES, PUBLIC UTILITY HOLDING COMPANY ACT OF 1935 Income and Expense Accounts § 256.426.5 Other deductions. (a) This account...

  6. 47 CFR 25.256 - Special Requirements for operations in the 3.65-3.7 GHz band.

    Science.gov (United States)

    2010-10-01

    ... 47 Telecommunication 2 2010-10-01 2010-10-01 false Special Requirements for operations in the 3.65-3.7 GHz band. 25.256 Section 25.256 Telecommunication FEDERAL COMMUNICATIONS COMMISSION (CONTINUED) COMMON CARRIER SERVICES SATELLITE COMMUNICATIONS Technical Standards § 25.256 Special Requirements for...

  7. 40 CFR 256.27 - Recommendation for schedules leading to compliance with the prohibition of open dumping.

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 24 2010-07-01 2010-07-01 false Recommendation for schedules leading to compliance with the prohibition of open dumping. 256.27 Section 256.27 Protection of Environment... SOLID WASTE MANAGEMENT PLANS Solid Waste Disposal Programs § 256.27 Recommendation for schedules leading...

  8. 17 CFR 256.923 - Outside services employed.

    Science.gov (United States)

    2010-04-01

    ...) UNIFORM SYSTEM OF ACCOUNTS FOR MUTUAL SERVICE COMPANIES AND SUBSIDIARY SERVICE COMPANIES, PUBLIC UTILITY HOLDING COMPANY ACT OF 1935 2. Expense § 256.923 Outside services employed. (a) This account shall include... services. (b) Records shall be so maintained to permit ready analysis showing nature of service, identity...

  9. 17 CFR 256.215 - Appropriated retained earnings.

    Science.gov (United States)

    2010-04-01

    ... 17 Commodity and Securities Exchanges 3 2010-04-01 2010-04-01 false Appropriated retained earnings... UTILITY HOLDING COMPANY ACT OF 1935 Liabilities and Other Credit Accounts § 256.215 Appropriated retained earnings. This account shall include the amount of retained earnings which has been appropriated or set...

  10. 17 CFR 256.136 - Temporary cash investments.

    Science.gov (United States)

    2010-04-01

    ... 17 Commodity and Securities Exchanges 3 2010-04-01 2010-04-01 false Temporary cash investments... UTILITY HOLDING COMPANY ACT OF 1935 3. Current and Accrued Assets § 256.136 Temporary cash investments. This account shall include the cost of investments, such as demand and time loans, bankers' acceptances...

  11. 40 CFR 256.04 - State plan approval, financial assistance.

    Science.gov (United States)

    2010-07-01

    ... WASTES GUIDELINES FOR DEVELOPMENT AND IMPLEMENTATION OF STATE SOLID WASTE MANAGEMENT PLANS Purpose, General Requirements, Definitions § 256.04 State plan approval, financial assistance. (a) The...

  12. 17 CFR 256.926 - Employee pensions and benefits.

    Science.gov (United States)

    2010-04-01

    ..., educational or recreational activities for the benefit of employees. ... 17 Commodity and Securities Exchanges 3 2010-04-01 2010-04-01 false Employee pensions and benefits... UTILITY HOLDING COMPANY ACT OF 1935 2. Expense § 256.926 Employee pensions and benefits. This account...

  13. 25 CFR 256.19 - Who performs the improvements, repairs, or replacement of my dwelling?

    Science.gov (United States)

    2010-04-01

    ... my dwelling? 256.19 Section 256.19 Indians BUREAU OF INDIAN AFFAIRS, DEPARTMENT OF THE INTERIOR... dwelling? Independent or tribal repair or construction trades persons, home building contractors, or construction companies will perform the repairs, renovation, or replacement of your dwelling. [63 FR 10134, Mar...

  14. 17 CFR 256.108 - Accumulated provision for depreciation and amortization of service company property.

    Science.gov (United States)

    2010-04-01

    ..., unless the company maintains costs and related reserves for specific units or types of property. (c... depreciation and amortization of service company property. 256.108 Section 256.108 Commodity and Securities... COMPANIES AND SUBSIDIARY SERVICE COMPANIES, PUBLIC UTILITY HOLDING COMPANY ACT OF 1935 Balance Sheet...

  15. Genetic Fingerprinting of Wheat and Its Progenitors by Mitochondrial Gene orf256

    Directory of Open Access Journals (Sweden)

    Mona M. Elseehy

    2012-04-01

    Full Text Available orf256 is a wheat mitochondrial gene associated with cytoplasmic male sterility (CMS that has different organization in various species. This study exploited the orf256 gene as a mitochondrial DNA marker to study the genetic fingerprint of Triticum and Aegilops species. PCR followed by sequencing of common parts of the orf256 gene were employed to determine the fingerprint and molecular evolution of Triticum and Aegilops species. Although many primer pairs were used, two pairs of orf256 specific primers (5:-94/C: 482, 5:253/C: 482, amplified DNA fragments of 576 bp and 230 bp respectively in all species were tested. A common 500 bp of nine species of Triticum and Aegilops were aligned and showed consistent results with that obtained from other similar chloroplast or nuclear genes. Base alignment showed that there were various numbers of base substitutions in all species compared to S. cereal (Sc (the outgroup species. Phylogenetic relationship revealed similar locations and proximity on phylogenetic trees established using plastid and nuclear genes. The results of this study open a good route to use unknown function genes of mitochondria in studying the molecular relationships and evolution of wheat and complex plant genomes.

  16. 24 CFR 213.256 - Premiums; insurance upon completion.

    Science.gov (United States)

    2010-04-01

    ... 24 Housing and Urban Development 2 2010-04-01 2010-04-01 false Premiums; insurance upon completion... HOUSING AND URBAN DEVELOPMENT MORTGAGE AND LOAN INSURANCE PROGRAMS UNDER NATIONAL HOUSING ACT AND OTHER AUTHORITIES COOPERATIVE HOUSING MORTGAGE INSURANCE Contract Rights and Obligations-Projects § 213.256 Premiums...

  17. The RBE of Fractionated Fast Neutron on Walker 256 Carcinosarcoma with KCCH-Cyclotron

    International Nuclear Information System (INIS)

    Yoo, Seong Yul; Koh, Kyoung Hwan; Cho, Chul Koo; Park, Charn Il; Kang, Wee Saing

    1987-01-01

    For evaluation of biological effect of p+(50.5 MeV) Be neutron beam produced by Korea Cancer Center Hospital(KCCH) cyclotron the RBE had been measured in experimental tumor Walker 256 carcinosarcoma as well as normal tissue, mouse intestine and bone marrow, in single and fractionated irradiation. As pilot study, the RBE had been measured for the mouse jejunal crypt cells in single whole body irradiation of which the result was 2.8. The obtained RBE values of TCD 50 of Walker 256 tumor, bone marrow and intestine in single irradiation were 1.9, 1.9 and 1.5 respectively. In fractionated irradiation, the RBE value of tumor Walker 256 was decreased as increasing of fraction number and increased as increasing of fraction size

  18. 28 CFR 25.6 - Accessing records in the system.

    Science.gov (United States)

    2010-07-01

    ... National Instant Criminal Background Check System § 25.6 Accessing records in the system. (a) FFLs may... through the NCIC communication network. Upon receiving a request for a background check from an FFL, a POC...

  19. 17 CFR 256.930.1 - General advertising expenses.

    Science.gov (United States)

    2010-04-01

    ... 17 Commodity and Securities Exchanges 3 2010-04-01 2010-04-01 false General advertising expenses... UTILITY HOLDING COMPANY ACT OF 1935 2. Expense § 256.930.1 General advertising expenses. This account shall include the cost of materials used and expenses incurred in advertising and related activities...

  20. 17 CFR 256.403 - Depreciation and amortization expense.

    Science.gov (United States)

    2010-04-01

    ... 17 Commodity and Securities Exchanges 3 2010-04-01 2010-04-01 false Depreciation and amortization... UTILITY HOLDING COMPANY ACT OF 1935 Income and Expense Accounts § 256.403 Depreciation and amortization expense. This account shall include the amount of depreciation and amortization for all service plant, and...

  1. 40 CFR 256.03 - State plan submission, adoption, and revision.

    Science.gov (United States)

    2010-07-01

    ... WASTES GUIDELINES FOR DEVELOPMENT AND IMPLEMENTATION OF STATE SOLID WASTE MANAGEMENT PLANS Purpose, General Requirements, Definitions § 256.03 State plan submission, adoption, and revision. (a) To be...

  2. 17 CFR 256.174 - Miscellaneous current and accrued assets.

    Science.gov (United States)

    2010-04-01

    ... COMMISSION (CONTINUED) UNIFORM SYSTEM OF ACCOUNTS FOR MUTUAL SERVICE COMPANIES AND SUBSIDIARY SERVICE COMPANIES, PUBLIC UTILITY HOLDING COMPANY ACT OF 1935 3. Current and Accrued Assets § 256.174 Miscellaneous... nature of each asset included herein. 4. deferred debits ...

  3. 17 CFR 256.107 - Construction work in progress.

    Science.gov (United States)

    2010-04-01

    ... UTILITY HOLDING COMPANY ACT OF 1935 Balance Sheet Accounts: Assets and Other Debit Accounts § 256.107 Construction work in progress. This account shall include the total of the balances of work orders for service company property in process of construction. Work orders shall be cleared from this account as soon as...

  4. 17 CFR 256.242 - Miscellaneous current and accrued liabilities.

    Science.gov (United States)

    2010-04-01

    ... COMMISSION (CONTINUED) UNIFORM SYSTEM OF ACCOUNTS FOR MUTUAL SERVICE COMPANIES AND SUBSIDIARY SERVICE COMPANIES, PUBLIC UTILITY HOLDING COMPANY ACT OF 1935 7. Current and Accrued Liabilities § 256.242... as to show the nature of each liability included herein. 8. deferred credits ...

  5. 50 CFR 216.256 - Applications for Letters of Authorization.

    Science.gov (United States)

    2010-10-01

    ... ATMOSPHERIC ADMINISTRATION, DEPARTMENT OF COMMERCE MARINE MAMMALS REGULATIONS GOVERNING THE TAKING AND IMPORTING OF MARINE MAMMALS Taking Marine Mammals Incidental to Conducting Precision Strike Weapon Missions in the Gulf of Mexico § 216.256 Applications for Letters of Authorization. To incidentally take...

  6. 17 CFR 256.188 - Research, development, or demonstration expenditures.

    Science.gov (United States)

    2010-04-01

    ... 17 Commodity and Securities Exchanges 3 2010-04-01 2010-04-01 false Research, development, or... COMPANIES, PUBLIC UTILITY HOLDING COMPANY ACT OF 1935 4. Deferred Debits § 256.188 Research, development, or... of all expenditures for research, development or demonstration undertaken by or sponsored through the...

  7. Investigation of antioxidative and anticancer potentials of Streptomyces sp. MUM256 isolated from Malaysia mangrove soil

    Directory of Open Access Journals (Sweden)

    Tan Loh eTeng Hern

    2015-11-01

    Full Text Available A Streptomyces strain, MUM256 was isolated from Tanjung Lumpur mangrove soil in Malaysia. Characterization of the strain showed that it has properties consistent with those of the members of the genus Streptomyces. In order to explore the potential bioactivities, extract of the fermented broth culture of MUM256 was prepared with organic solvent extraction method. DPPH and SOD activity were utilized to examine the antioxidant capacity and the results have revealed the potency of MUM256 in superoxide anion scavenging activity in dose-dependent manner. The cytotoxicity of MUM256 extract was determined using cell viability assay against 8 different panels of human cancer cell lines. Among all the tested cancer cells, HCT116 was the most sensitive toward the extract treatment. At the highest concentration of tested extract, the result showed 2.3, 2.0 and 1.8 folds higher inhibitory effect against HCT116, HT29 and Caco-2 respectively when compared to normal cell line. This result has demonstrated that MUM256 extract was selectively cytotoxic towards colon cancer cell lines. In order to determine the constituents responsible for its bioactivities, the extract was then subjected to chemical analysis using GC-MS. The analysis resulted in the identification of chemical constituents including phenolic and pyrrolopyrazine compounds which may responsible for antioxidant and anticancer activities observed. Based on the findings of this study, the presence of bioactive constituents in MUM256 extract could be a potential source for the development of antioxidative and chemopreventive agents.

  8. Demonstration of DFT-spread 256QAM-OFDM signal transmission with cost-effective directly modulated laser.

    Science.gov (United States)

    Li, Fan; Yu, Jianjun; Fang, Yuan; Dong, Ze; Li, Xinying; Chen, Lin

    2014-04-07

    We experimentally demonstrated a 256-ary quadrature amplitude modulation (256QAM) direct-detection optical orthogonal frequency division multiplexing (DDO-OFDM) transmission system utilizing a cost-effective directly modulated laser (DML). Intra-symbol frequency-domain averaging (ISFA) is applied to suppress in-band noise while the channel response estimation and Discrete Fourier Transform-spread (DFT-spread) is used to reduce the peak-to-average power ratio (PAPR) of the transmitted OFDM signal. The bit-error ratio (BER) of 15-Gbit/s 256QAM-OFDM signal has been measured after 20-km SSMF transmission that is less than 7% forward-error-correction (FEC) threshold of 3.8 × 10(-3) as the launch power into fiber is set at 6dBm. For 11.85-Gbit/s 256QAM-OFDM signal, with the aid of ISFA-based channel estimation and PAPR reduction enabled by DFT-spread, the BER after 20-km SSMF transmission can be improved from 6.4 × 10(-3) to 6.8 × 10(-4) when the received optical power is -6dBm.

  9. 24 CFR 203.256 - Insurance of open-end advance.

    Science.gov (United States)

    2010-04-01

    ... Insurance § 203.256 Insurance of open-end advance. Insurance on an open-end advance will be evidenced by delivery of a certificate stating the amount of the advance, the date of insurance, and the regulations... 24 Housing and Urban Development 2 2010-04-01 2010-04-01 false Insurance of open-end advance. 203...

  10. 25 CFR 256.16 - Who is responsible for identifying what work will be done on my dwelling?

    Science.gov (United States)

    2010-04-01

    ... on my dwelling? 256.16 Section 256.16 Indians BUREAU OF INDIAN AFFAIRS, DEPARTMENT OF THE INTERIOR... my dwelling? The servicing housing office is responsible for identifying what work is to be done on your dwelling or whether your dwelling will be replaced. This includes responsibility to communicate...

  11. 25 CFR 256.25 - Is my Federal government-assisted dwelling eligible for services under the Housing Improvement...

    Science.gov (United States)

    2010-04-01

    ... 25 Indians 1 2010-04-01 2010-04-01 false Is my Federal government-assisted dwelling eligible for services under the Housing Improvement Program? 256.25 Section 256.25 Indians BUREAU OF INDIAN AFFAIRS... dwelling eligible for services under the Housing Improvement Program? Yes. You may receive services under...

  12. Differential Fault Analysis on CLEFIA with 128, 192, and 256-Bit Keys

    Science.gov (United States)

    Takahashi, Junko; Fukunaga, Toshinori

    This paper describes a differential fault analysis (DFA) attack against CLEFIA. The proposed attack can be applied to CLEFIA with all supported keys: 128, 192, and 256-bit keys. DFA is a type of side-channel attack. This attack enables the recovery of secret keys by injecting faults into a secure device during its computation of the cryptographic algorithm and comparing the correct ciphertext with the faulty one. CLEFIA is a 128-bit blockcipher with 128, 192, and 256-bit keys developed by the Sony Corporation in 2007. CLEFIA employs a generalized Feistel structure with four data lines. We developed a new attack method that uses this characteristic structure of the CLEFIA algorithm. On the basis of the proposed attack, only 2 pairs of correct and faulty ciphertexts are needed to retrieve the 128-bit key, and 10.78 pairs on average are needed to retrieve the 192 and 256-bit keys. The proposed attack is more efficient than any previously reported. In order to verify the proposed attack and estimate the calculation time to recover the secret key, we conducted an attack simulation using a PC. The simulation results show that we can obtain each secret key within three minutes on average. This result shows that we can obtain the entire key within a feasible computational time.

  13. 31 CFR 256.52 - How does FMS issue a payment?

    Science.gov (United States)

    2010-07-01

    ... requirement for payment by EFT is appropriate, FMS will issue a payment by check. The Voucher for Payment must... 31 Money and Finance: Treasury 2 2010-07-01 2010-07-01 false How does FMS issue a payment? 256.52... SERVICE, DEPARTMENT OF THE TREASURY FINANCIAL MANAGEMENT SERVICE OBTAINING PAYMENTS FROM THE JUDGMENT FUND...

  14. 25 CFR 256.21 - Will I have to vacate my dwelling while repair work or replacement of my dwelling is being done?

    Science.gov (United States)

    2010-04-01

    ... 25 Indians 1 2010-04-01 2010-04-01 false Will I have to vacate my dwelling while repair work or replacement of my dwelling is being done? 256.21 Section 256.21 Indians BUREAU OF INDIAN AFFAIRS, DEPARTMENT OF THE INTERIOR HOUSING HOUSING IMPROVEMENT PROGRAM § 256.21 Will I have to vacate my dwelling while...

  15. A comparative study of Message Digest 5(MD5) and SHA256 algorithm

    Science.gov (United States)

    Rachmawati, D.; Tarigan, J. T.; Ginting, A. B. C.

    2018-03-01

    The document is a collection of written or printed data containing information. The more rapid advancement of technology, the integrity of a document should be kept. Because of the nature of an open document means the document contents can be read and modified by many parties so that the integrity of the information as a content of the document is not preserved. To maintain the integrity of the data, it needs to create a mechanism which is called a digital signature. A digital signature is a specific code which is generated from the function of producing a digital signature. One of the algorithms that used to create the digital signature is a hash function. There are many hash functions. Two of them are message digest 5 (MD5) and SHA256. Those both algorithms certainly have its advantages and disadvantages of each. The purpose of this research is to determine the algorithm which is better. The parameters which used to compare that two algorithms are the running time and complexity. The research results obtained from the complexity of the Algorithms MD5 and SHA256 is the same, i.e., ⊖ (N), but regarding the speed is obtained that MD5 is better compared to SHA256.

  16. Performance analysis of commercial MOSFET packages in Class E converter operating at 2.56 MHz

    DEFF Research Database (Denmark)

    Nair, Unnikrishnan Raveendran; Munk-Nielsen, Stig; Jørgensen, Asger Bjørn

    2017-01-01

    resistance and high temperature operation over Si devices have aided in the paradigm shift towards wide bandgap devices. The low gate charge requirements of SiC MOSFETs enables use of these devices in radio frequency (RF) converters using resonant topologies operating at MHz frequency range. The RF...... are not commercially available and power modules have to be custom designed for these applications. This work demonstrates performance of various commercial MOSFET packages at frequency of 2.56 MHz. Commercial SiC MOSFETs in TO-247 and D2Pak packs are tested in Class E resonant converter operating at 2.56 MHz...

  17. 25 CFR 256.11 - What are the occupancy and square footage standards for a dwelling provided with Category C...

    Science.gov (United States)

    2010-04-01

    ... dwelling provided with Category C assistance? 256.11 Section 256.11 Indians BUREAU OF INDIAN AFFAIRS... footage standards for a dwelling provided with Category C assistance? A modest dwelling provided with... bedrooms Total dwelling square footage 1 (maximum) 1-3 2 2 900 4-6 2 3 1050 7 or more 2 4 31350 1 Total...

  18. 25 CFR 256.15 - How long will I have to wait for repair, renovation, or replacement of my dwelling?

    Science.gov (United States)

    2010-04-01

    ... replacement of my dwelling? 256.15 Section 256.15 Indians BUREAU OF INDIAN AFFAIRS, DEPARTMENT OF THE INTERIOR... replacement of my dwelling? The length of time that it takes to accomplish the work to be done on your dwelling is dependent on: (a) Whether funds are available; (b) The type of work to be done; (c) The climate...

  19. First prompt in-beam γ-ray spectroscopy of a superheavy element: the 256Rf

    International Nuclear Information System (INIS)

    Rubert, J; Dorvaux, O; Gall, B J P; Asfari, Z; Piot, J; Greenlees, P T; Grahn, T; Herzan, A; Jakobsson, U; Jones, P; Julin, R; Juutinen, S; Andersson, L L; Cox, D M; Herzberg, R-D; Asai, M; Dechery, F; Hauschild, K; Henning, G; Heßberger, F P

    2013-01-01

    Using state-of-the-art γ-ray spectroscopic techniques, the first rotational band of a superheavy element, extending up to a spin of 20 h, was discovered in the nucleus 256 Rf. To perform such an experiment at the limits of the present instrumentation, several developments were needed. The most important of these developments was of an intense isotopically enriched 50 Ti beam using the MIVOC method. The experimental set-up and subsequent analysis allowed the 256 Rf ground-state band to be revealed. The rotational properties of the band are discussed and compared with neighboring transfermium nuclei through the study of their moments of inertia. These data suggest that there is no evidence of a significant deformed shell gap at Z = 104.

  20. METALLOPROTEINS DURING DEVELOPMENT OF WALKER-256 CARCINOSARCOMA RESISTANT PHENOTYPE.

    Science.gov (United States)

    Chekhun, V F; Lozovska, Yu V; Burlaka, A P; Ganusevich, I I; Shvets, Yu V; Lukianova, N Yu; Todor, I M; Demash, D V; Pavlova, A A; Naleskina, L A

    2015-01-01

    The study was focused on the detection of changes in serum and tumor metal-containing proteins in animals during development ofdoxorubicin-resistant phenotype in malignant cells after 12 courses of chemotherapy. We found that on every stage of resistance development there was a significant increase in content of ferritin and transferrin proteins (which take part in iron traffick and storage) in Walker-256 carc'inosarcoma tissue. We observed decreased serumferritin levels at the beginning stage of the resistance development and significant elevation of this protein levels in the cases withfully developed resistance phenotype. Transferrin content showed changes opposite to that offerritin. During the development of resistance phenotype the tumor tissue also exhibited increased 'free iron' concentration that putatively correlate with elevation of ROS generation and levels of MMP-2 and MMP-9 active forms. The tumor non-protein thiol content increases gradually as well. The serum of animals with early stages of resistance phenotype development showed high ceruloplasmin activity and its significant reduction after loss of tumor sensitivity to doxorubicin. Therefore, the development of resistance phenotype in Walker-256 carcinosarcoma is accompanied by both the deregulation of metal-containing proteins in serum and tumor tissue and by the changes in activity of antioxidant defense system. Thus, the results of this study allow us to determine the spectrum of metal-containing proteins that are involved in the development of resistant tumor phenotype and that may be targeted for methods for doxorubicin sensitivity correction therapy.

  1. 25 CFR 256.23 - How will I be advised that the repair, renovation or replacement of my dwelling has been completed?

    Science.gov (United States)

    2010-04-01

    ... replacement of my dwelling has been completed? 256.23 Section 256.23 Indians BUREAU OF INDIAN AFFAIRS..., renovation or replacement of my dwelling has been completed? The servicing housing office will advise you, in... final walk-through of the dwelling with your servicing housing office representative. You will be...

  2. Assessment of Myocardial Bridge and Mural Coronary Artery Using ECG-Gated 256-Slice CT Angiography: A Retrospective Study

    Directory of Open Access Journals (Sweden)

    En-sen Ma

    2013-01-01

    Full Text Available Recent clinical reports have indicated that myocardial bridge and mural coronary artery complex (MB-MCA might cause major adverse cardiac events. 256-slice CT angiography (256-slice CTA is a newly developed CT system with faster scanning and lower radiation dose compared with other CT systems. The objective of this study is to evaluate the morphological features of MB-MCA and determine its changes from diastole to systole phase using 256-slice CTA. The imaging data of 2462 patients were collected retrospectively. Two independent radiologists reviewed the collected images and the diagnosis of MB-MCA was confirmed when consistency was obtained. The length, diameter, and thickness of MB-MCA in diastole and systole phases were recorded, and changes of MB-MCA were calculated. Our results showed that among the 2462 patients examined, 336 have one or multiple MB-MCA (13.6%. Out of 389 MB-MCA segments, 235 sites were located in LAD2 (60.41%. The average diameter change of MCA in LAD2 from systole phase to diastole phase was  mm, and 34.9% of MCA have more than 50% diameter stenosis in systole phase. This study suggested that 256-slice CTA multiple-phase reconstruction technique is a reliable method to determine the changes of MB-MCA from diastole to systole phase.

  3. Dissemination of Walker 256 carcinoma cells to rat skeletal muscle

    International Nuclear Information System (INIS)

    Ueoka, H.; Hayashi, K.; Namba, T.; Grob, D.

    1986-01-01

    After injection of 10 6 Walker 256 carcinoma cells labelled with 125 I-5-iodo-2'-deoxyuridine into the tail vein, peak concentration in skeletal muscle was 46 cells/g at 60 minutes, which was lower than 169202, 1665, 555, 198 and 133 cells/g, respectively, at 30 or 60 minutes in lung, liver, spleen, kidney and heart. Because skeletal muscle constitutes 37.4% of body weight, the total number of tumor cells was 2323 cells, which was much greater than in spleen, kidney and heart with 238, 271, and 85 cells, respectively, and only less than in lung and liver, at 222857 and 11700 cells, respectively. The total number in skeletal muscle became greater than in liver at 4 hours and than in lung at 24 hours. Ten minutes after injection of 7.5 x 10 6 Walker 256 carcinoma cells into the abdominal aorta of rats, a mean of 31 colony-forming cells were recovered from the gastrocnemius, while 106 cells were recovered from the lung after injection into the tail vein. These results indicate that a large number of viable tumor cells can be arrested in skeletal muscle through circulation. The rare remote metastasis of malignancies into skeletal muscle despite constantly circulating tumor cells does not appear to be due to poor dissemination of tumor cells into muscle but due to unhospitable environment of skeletal muscle

  4. Metalloproteins during development of Walker-256 carcinosarcoma resistant phenotype

    Directory of Open Access Journals (Sweden)

    V. F. Chekhun

    2015-04-01

    Full Text Available The study was focused on the detection of changes in serum and tumor metal-containing proteins in animals during development of doxorubicin-resistant phenotype in malignant cells after 12 courses of chemotherapy. We found that on every stage of resistance development there was a significant increase in content of ferritin and transferrin proteins (which take part in iron traffick and storage in Walker-256 carcinosarcoma tissue. We observed decreased serum ferritin levels at the beginning stage of the resistance development and significant elevation of this protein levels in the cases with fully developed resistance phenotype. Transferrin content showed changes opposite to that of ferritin. During the development of resistance phenotype the tumor tissue also exhibited increased ‘free iron’ concentration that putatively correlate with elevation of ROS generation and levels of MMP-2 and MMP-9 active forms. The tumor non-protein thiol content increases gradually as well. The serum of animals with early stages of resistance phenotype development showed high ceruloplasmin activity and its significant reduction after loss of tumor sensitivity to doxorubicin. Therefore, the development of resistance phenotype in Walker-256 carcinosarcoma is accompanied by both the deregulation of metal-containing proteins in serum and tumor tissue and by the changes in activity of antioxidant defense system. Thus, the results of this study allow us to determine the spectrum of metal-containing proteins that are involved in the development of resistant tumor phenotype and that may be targeted for methods for doxorubicin sensitivity correction therapy.

  5. 25 CFR 256.14 - What are the steps that must be taken to process my application for the Housing Improvement Program?

    Science.gov (United States)

    2010-04-01

    ... to process my application for the Housing Improvement Program? (a) The servicing housing office must... 25 Indians 1 2010-04-01 2010-04-01 false What are the steps that must be taken to process my application for the Housing Improvement Program? 256.14 Section 256.14 Indians BUREAU OF INDIAN AFFAIRS...

  6. Radiation characterization of a C256 EEPROM

    International Nuclear Information System (INIS)

    Wrobel, T.F.

    1989-01-01

    Total dose, dose-rate and high dose-rate memory retention results are presented for the SEEQ Technologies Inc., 28C256 floating gate electrically erasable programmable read only memory (EEPROM). Total dose failure levels are mode dependent, i.e. ∼33 krad(Si) for reading and ∼9.5 krad(Si) for writing. The write-mode failure level is dose-rated dependent, increasing from ∼10 krad(Si) at ∼11 rad(Si)/s to ∼ 28 krad(Si) at dose rates ∼0,1 rad(Si)/s Average upset and latch-up thresholds are 3.8 x 10 8 rad(Si)/s and 7.7 x 10 8 rad(Si)/s respectively. No latch-up windows were observed. Memory contents were retained following exposure up to 108 krad (Si) and following 1 x 10 12 rad(Si)/s

  7. Binary fragmentation based studies for the near super-heavy compound nucleus {sup 256}Rf

    Energy Technology Data Exchange (ETDEWEB)

    Thakur, Meenu; Behera, B.R.; Mahajan, Ruchi; Kaur, Gurpreet; Sharma, Priya; Kapoor, Kushal; Rani, Kavita [Panjab University, Department of Physics, Chandigarh (India); Saneesh, N.; Dubey, R.; Yadav, A.; Sugathan, P.; Jhingan, A.; Chatterjee, A.; Chatterjee, M.B. [Inter University Accelerator Centre, New Delhi (India); Kumar, Neeraj; Mandal, S. [University of Delhi, Department of Physics and Astrophysics, Delhi (India); Kumar, S. [Andhra University, Department of Nuclear Physics, Visakhapatnam (India); Saxena, A.; Kailas, S. [Bhabha Atomic Research Centre, Nuclear Physics Division, Mumbai (India); Pal, Santanu [CS, Kolkata (India); Nasirov, Avazbek [JINR, Bogoliubov Laboratory of Theoretical Physics, Dubna (Russian Federation); National University, Department of Physics, Tashkent (Uzbekistan); Kayumov, Bakhodir [National University, Department of Physics, Tashkent (Uzbekistan)

    2017-06-15

    Binary fragmentation of the near super-heavy compound nucleus {sup 256}Rf has been studied through the reaction {sup 48}Ti + {sup 208}Pb at a bombarding energy well above the Coulomb barrier. For a better understanding of its reaction dynamics, the mass distribution, mass-energy distribution and mass-angle distribution of the fission fragments produced from {sup 256}Rf have been investigated thoroughly. The masses and kinetic energies of the fission fragments were reconstructed event-by-event from their measured velocities and emission angles. From the mass-energy analysis, a sizeable contribution from the asymmetric fission was observed on the edges of symmetric mass distribution. Evidence of asymmetric fission was also clued from the observed correlation between the masses and emission angles of the fission fragments. Contribution of the quasi-fission products has also been estimated by performing the theoretical dinuclear system calculations. (orig.)

  8. Characterization of Group V Dubnium Homologs on DGA Extraction Chromatography Resin from Nitric and Hydrofluoric Acid Matrices

    Energy Technology Data Exchange (ETDEWEB)

    Despotopulos, J D; Sudowe, R

    2012-02-21

    Studies of the chemical properties of superheavy elements (SHE) pose interesting challenges due to their short half-lives and low production rates. Chemical systems must have extremely fast kinetics, fast enough kinetics to be able to examine the chemical properties of interest before the SHE decays to another nuclide. To achieve chemistry on such time scales, the chemical system must also be easily automated. Most importantly however, a chemical system must be developed which provides suitable separation and kinetics before an on-line study of a SHE can be performed. Relativistic effects make studying the chemical properties of SHEs interesting due to the impact these effects could have on the SHEs chemical properties. Relativistic effects arise when the velocity of the s orbital electrons approach the speed of light. As this velocity increases, the Bohr radius of the inner electron orbitals decreases and there is an increase in the particles mass. This contraction results in a destabilization of the energy of the outer d and f electron orbitals (5f and 6d in the case of SHE), which can cause these to expand due to their increased shielding from the nuclear charge. Another relativistic effect is the spin-orbit splitting for p, d, and f orbitals into j = 1 {+-} 1/2 states. This can lead most interestingly to a possible increased stability of element 114, which due to large spin-orbit splitting of the 7p orbital and the relativistically stabilized 7p{sub 1/2} and 7s orbital gives rise to a closed shell ground state of 7s{sup 2}7p{sub 1/2}{sup 2}. The homologs of element 105, dubnium (Db), Ta and Nb and the pseudo-homolog Pa, are well known to hydrolyze and form both neutral and non-neutral monoatomic and polyatomic species that may cause issues with extraction from a given chemical system. Early ion-exchange and solvent-extraction studies show mixed results for the behavior of Db. Some studies show Db behaving most similar to Ta, while others show it behaving

  9. Discovery of a 7.6-hour high-spin isomer of einsteinium-256

    International Nuclear Information System (INIS)

    Hoffman, D.C.; Daniels, W.R.; Wilhelmy, J.B.; Bunker, M.E.; Starner, J.W.; Jackson, S.V.; Lougheed, R.W.; Landrum, J.H.

    1976-01-01

    A 7.6-hour, beta-emitting isomer of 256 Es has been produced via the (t,p) reaction by bombarding /sup 254g/Es with 16-MeV tritons. No evidence for an alpha branch was found. A number of gamma rays were observed, on the basis of which a partial decay scheme is proposed. It is concluded that the isomer has spin 7 or 8

  10. 25 CFR 256.22 - How can I be sure that the work that is being done on my dwelling meets minimum construction...

    Science.gov (United States)

    2010-04-01

    ... 25 Indians 1 2010-04-01 2010-04-01 false How can I be sure that the work that is being done on my dwelling meets minimum construction standards? 256.22 Section 256.22 Indians BUREAU OF INDIAN AFFAIRS... is being done on my dwelling meets minimum construction standards? (a) At various stages of...

  11. 25 CFR 256.17 - What will the servicing housing office do to identify what work is to be done on my dwelling?

    Science.gov (United States)

    2010-04-01

    ... what work is to be done on my dwelling? 256.17 Section 256.17 Indians BUREAU OF INDIAN AFFAIRS... office do to identify what work is to be done on my dwelling? (a) First, a trained and qualified representative of your servicing housing office must visit your dwelling to identify what repairs or renovation...

  12. A preliminary study of murine walker-256 tumor hypoxia detected by blood oxygen level dependent-MR

    International Nuclear Information System (INIS)

    Zhang Shengjian; Mao Jian; Wu Bin; Peng Weijun

    2013-01-01

    Objective: To establish Walker-256 transplantation tumor model in SD Rats. To study of R_2"* signal changes on murine Walker-256 tumor after inhaling Carbogen by blood oxygen level dependent (BOLD)-MR, and to explore the feasibility of BOLD-MRI on detecting tumor hypoxia. Methods: Walker-256 tumor cell implanted subcutaneously in right lower abdomen of 95 female SD rats. MR was performed on the tumor-forming rats when the maximum diameter of tumor reached 1-3 cm, using a 3.0 T MR scanner equipped with a 3 inch animal surface coil. BOLD-MRI was done by using a multiecho SPGR sequence during inhaling air and at 10 minute after inhaling Carbogen, respectively. All images were transferred to GE ADW 4.3 workstation, then a baseline R_2"* (R_2"* a) and R_2"* (R_2"* b) after inhaling Carbogen of tumor was calculated using R_2 Star analysis software and ΔR_2"* was calculated through ΔR_2"* = R_2"* b -R_2"* a", meanwhile the volume of tumor were calculated as well. The difference of R_2"* signal pre and post-inhaling of Carbogen was compared with a paired t test, Pearson correlation was calculated between R_2"* a, ΔR_2"* and the volume of tumor, respectively. The correlation between ΔR_2"* and R_2"* a was also assessed by Pearson correlation. Results: Sixty-eight of ninety-five female SD rats formed the tumor (71.6%). The volume of tumor was from 352 to 13 173 mm"3. Mean ΔR_2"* decreased significantly (-2.26 ± 3.90) s"-"1 from (41.18 ± 22.29) s"-"1 during breathing air to (38.91 ± 21.35) s"-"1 10 min after inhaling Carbogen (t = 4.01, P 0.05). Conclusions: BOLD-MRI can detect the R_2"* signal change of murine Walker-256 tumor pre-and post-inhaling of Carbogen. The R_2"* signal showed significant decrease after inhaling Carbogen, however, the individual variation was remarkable. (authors)

  13. 42 CFR 447.256 - Procedures for CMS action on assurances and State plan amendments.

    Science.gov (United States)

    2010-10-01

    ... 42 Public Health 4 2010-10-01 2010-10-01 false Procedures for CMS action on assurances and State... for Inpatient Hospital and Long-Term Care Facility Services Payment Rates § 447.256 Procedures for CMS action on assurances and State plan amendments. (a) Criteria for approval. (1) CMS approval action on...

  14. Metabolic changes during development of Walker-256 carcinosarcoma resistance to doxorubicin.

    Science.gov (United States)

    Todor, I N; Lukyanova, N Yu; Shvets, Yu V; Lozovska, Yu V; Chekhun, V F

    2015-03-01

    To study indices of energy metabolism, content of K(+) and Mg(++) both in peripheral blood and in Walker-256 carcinosarcoma during development of resistance to doxorubicin. Resistance of Walker-256 carcinosarcoma to doxorubicin has been developed through 12 subsequent transplantations of tumor after the chemotherapy. Parental strain was inhibited by drug by 65%, while transitional resistant substrains - by 30% and 2%, respectively. Determination of biochemical indices in blood serum and homogenates of tumor tissue, level of potassium, magnesium, lactate, glucose, activities of lactate dehydrogenase and glucose-6-phosphate dehydrogenase was performed with the help of biochemical and immune-enzyme analyzer GBG ChemWell 2990 (USA) using standard kits. Polarography was used to determine indices of mitochondrial oxidative phosphorylation. Study of mitochondrial membrane potential was carried out on flow cytometer Beckman Coulter Epics XL using dye JC-1. It has been determined that development of drug resistance causes the decrease of K(+), Mg(++), glucose content in blood serum and increase of these indices in tumor tissue. At the same time, gradual tumor's loss of sensitivity is characterized by decrease of glycolysis activity in it and activation of mitochondrial oxidative phosphorylation and pentose phosphate pathway of glucose degradation, which causes more intensive formation of NADPH. Development of drug resistance of tumor causes certain metabolic changes in organism and tumor. Further study of such changes will make possible to determine tumor and extratumor markers of resistance.

  15. Creatine supplementation prevents hyperhomocysteinemia, oxidative stress and cancer-induced cachexia progression in Walker-256 tumor-bearing rats.

    Science.gov (United States)

    Deminice, Rafael; Cella, Paola Sanches; Padilha, Camila S; Borges, Fernando H; da Silva, Lilian Eslaine Costa Mendes; Campos-Ferraz, Patrícia L; Jordao, Alceu Afonso; Robinson, Jason Lorne; Bertolo, Robert F; Cecchini, Rubens; Guarnier, Flávia Alessandra

    2016-08-01

    The purpose of this study was to investigate (1) the impact of tumor growth on homocysteine (Hcy) metabolism, liver oxidative stress and cancer cachexia and, (2) the potential benefits of creatine supplementation in Walker-256 tumor-bearing rats. Three experiments were conducted. First, rats were killed on days 5 (D5), 10 (D10) and 14 (D14) after tumor implantation. In experiment 2, rats were randomly assigned to three groups designated as control (C), tumor-bearing (T) and tumor-bearing supplemented with creatine (TCr). A life span experiment was conducted as the third experiment. Creatine was supplied in drinking water for 21 days (8 g/L) in all cases. Tumor implantation consisted of a suspension of Walker-256 cells (8.0 × 10(7) cells in 0.5 mL of PBS). The progressive increase (P creatine supplementation promoted a 28 % reduction of tumor weight (P Creatine supplementation was unable to decrease Hcy concentration and to increase SAM/SAH ratio in tumor tissue. These data suggest that creatine effects on hepatic impaired Hcy metabolism promoted by tumor cell inoculation are responsible to decrease plasma Hcy in tumor-bearing rats. In conclusion, Walker-256 tumor growth is associated with progressive hyperhomocysteinemia, body weight loss and liver oxidative stress in rats. Creatine supplementation, however, prevented these tumor-associated perturbations.

  16. Diagnostic accuracy of prospective ECG gated coronary computed tomography on a 256 slices scanner: Daily practice experience

    Directory of Open Access Journals (Sweden)

    Ahmed M. Fareed

    2014-03-01

    Conclusions: In a highly prevalence diseased population, prospective ECG-gated CTCA using 256-slice scanner is highly accurate for detection and quantification of the degree of coronary luminal stenosis in comparison to ICA.

  17. Cardiac imaging using 256-detector row four-dimensional CT. Preliminary clinical report

    International Nuclear Information System (INIS)

    Kido, Teruhito; Kurata, Akira; Higashino, Hiroshi

    2007-01-01

    Along with the increase of detector rows on the z-axis and a faster gantry rotation speed, the spatial and temporal resolutions of the multislice computed tomography (CT) have been improved for noninvasive coronary artery imaging. We investigated the feasibility of the second specification prototype 256-detector row four-dimensional CT for assessing coronary artery and cardiac function. The subjects were five patients with coronary artery disease. Contrast medium (40-60 ml) was intravenously administered at the rate of 3-4 ml/s. The patient's whole heart was scanned for 1.5 s to cover at least one cardiac cycle during breathholding without electrocardiographic gating. Parameters used were 0.5 mm slice thickness, 0.5 s/rotation, 120 Kv, and 350 mA, with a half-scan reconstruction algorithm (temporal resolution 250 ms). Twenty-six transaxial datasets were reconstructed at intervals of 50 ms. The assessability of the coronary arteries in American Heart Association (AHA) segments 1, 2, 3, 5, 6, 7, 9, and 11 was visually evaluated, resulting in 29 of 32 (90.9%) segments being assessable. Functional assessment was also performed using animated movies without banding artifacts in all cases. The 256-detector row four-dimensional CT can assess the coronary artery and cardiac function using data during 1.5 s without banding artifacts. (author)

  18. Decay properties of {sup 256-339}Ds superheavy nuclei

    Energy Technology Data Exchange (ETDEWEB)

    Santhosh, K.P.; Nithya, C. [Kannur University, School of Pure and Applied Physics, Payyanur, Kerala (India)

    2017-09-15

    The decay properties of 84 isotopes of darmstadtium superheavy nuclei (Z = 110) have been studied using various theoretical models. The proton emission half-lives, the alpha decay half-lives, the spontaneous fission half-lives and the cluster decay half-lives of all the isotopes are evaluated. The one-proton emission half-lives and the alpha decay half-lives are predicted using the Coulomb and proximity potential model for deformed nuclei (CPPMDN). The calculated alpha half-lives are compared with the available experimental results as well as with the predictions of other theoretical models. The predicted half-lives matches well with the experimental results. The one-proton half-lives are also compared with the predictions using other formalisms. The shell-effect-dependent formula of Santhosh et al. has been employed for calculating the spontaneous fission half-lives. A theoretical comparison of spontaneous fission half-lives with four different formalisms is performed. By comparing the one-proton emission half-lives, the alpha decay half-lives and the spontaneous fission half-lives decay modes are predicted for all the isotopes of Ds. It is seen that the isotopes within the range 256 ≤ A ≤ 263 and 279 ≤ A ≤ 339 decay through spontaneous fission and the isotopes 264 ≤ A ≤ 278 exhibit alpha decay. Cluster decay half-lives are calculated using different models including the Coulomb and proximity potential (CPPM), for determining the magicities in the superheavy region. The effect of magicity at N = 184 and N = 202 were confirmed from the plot of log{sub 10}T{sub 1/2} versus neutron number of the daughter nuclei for the emission of different clusters. We hope that the systematic and detailed study of all the possible decay modes of {sup 256-339}Ds using various theoretical models will be helpful in the experimental identification of the isotopes of the element in the future. (orig.)

  19. Celecoxib and Ibuprofen Restore the ATP Content and the Gluconeogenesis Activity in the Liver of Walker-256 Tumor-Bearing Rats

    Directory of Open Access Journals (Sweden)

    Camila Oliveira de Souza

    2015-07-01

    Full Text Available Background/Aims: The main purpose of this study was to investigate the effects of celecoxib and ibuprofen, both non-steroidal anti-inflammatory drugs (NSAIDs, on the decreased gluconeogenesis observed in liver of Walker-256 tumor-bearing rats. Methods: Celecoxib and ibuprofen (both at 25 mg/Kg were orally administered for 12 days, beginning on the same day when the rats were inoculated with Walker-256 tumor cells. Results: Celecoxib and ibuprofen treatment reversed the reduced production of glucose, pyruvate, lactate and urea from alanine as well as the reduced production of glucose from pyruvate and lactate in perfused liver from tumor-bearing rats. Besides, celecoxib and ibuprofen treatment restored the decreased ATP content, increased triacylglycerol levels and reduced mRNA expression of carnitine palmitoyl transferase 1 (CPT1, while ibuprofen treatment restored the reduced mRNA expression of peroxisome proliferator-activated receptor alpha (PPARα in the liver of tumor-bearing rats. Both treatments tended to decrease TNFα, IL6 and IL10 in the liver of tumor-bearing rats. Finally, the treatment with celecoxib, but not with ibuprofen, reduced the growth of Walker-256 tumor. Conclusion: Celecoxib and ibuprofen restored the decreased gluconeogenesis in the liver of Walker-256 tumor-bearing rats. These effects did not involve changes in tumor growth and probably occurred by anti-inflammatory properties of these NSAIDs, which increased expression of genes associated with fatty acid oxidation (PPARα and CPT1 and consequently the ATP production, normalizing the energy status in the liver of tumor-bearing rats.

  20. Simultaneous transmission of 256-QAM WIMAX at 5.7GHz and optically generated impulse radio UWB over fiber for indoor wireless multi-services

    DEFF Research Database (Denmark)

    Yu, Xianbin; Yin, Xiaoli; Gibbon, Timothy Braidwood

    2010-01-01

    Fiber transmission of simultaneous optically generated FCC compliant 625Mbps impulse radio UWB and 80Mbps 256-QAM IEEE 802.16 WIMAX signals is experimentally demonstrated by using a single directly modulated light source.......Fiber transmission of simultaneous optically generated FCC compliant 625Mbps impulse radio UWB and 80Mbps 256-QAM IEEE 802.16 WIMAX signals is experimentally demonstrated by using a single directly modulated light source....

  1. The influence of septal lesions on sodium and water retention induced by Walker 256 tumor

    Directory of Open Access Journals (Sweden)

    F. Guimarães

    1999-03-01

    Full Text Available In the course of studies on the effects of septal area lesions on neuroimmunomodulation and Walker 256 tumor development, it was observed that tumor-induced sodium and water retention was less marked in lesioned than in non-lesioned rats. In the present study possible mechanisms involved in this phenomenon were investigated. The experiments were performed in septal-lesioned (LW; N = 15 and sham-operated (SW; N = 7 8-week-old male Wistar rats, which received multifocal simultaneous subcutaneous (sc inoculations of Walker 256 tumor cells about 30 days after the stereotaxic surgery. Control groups (no tumor, sham-operated food-restricted (SFR, N = 7 and lesioned food-restricted (LFR, N = 10 were subjected to a feeding pattern similar to that observed in tumor-bearing animals. Multifocal inoculation of Walker 256 tumor rapidly induces anorexia, which is paradoxically accompanied by an increase in body weight, as a result of renal Na+ and fluid retention. These effects of the tumor were also seen in LW rats, although the rise in fractional sodium balance during the early clinical period was significantly smaller than in SW rats (day 4: SW = 47.6 ± 6.4% and LW = 13.8 ± 5.2%; day 5: SW = 57.5 ± 3.5% and LW = 25.7 ± 4.8%; day 6: SW = 54.4 ± 3.8% and LW = 32.1 ± 4.4%; P<0.05, suggesting a temporary reduction in tumor-induced sodium retention. In contrast, urine output was significantly reduced in SW rats and increased in LW rats (LW up to -0.85 and SW up to 4.5 ml/100 g body weight, with no change in osmolar excretion. These temporary changes in the tumor's effects on LW rats may reflect a "reversal" of the secondary central antidiuretic response induced by the tumor (from antidiuretic to diuretic.

  2. In vitro evaluation of 56 coronary artery stents by 256-slice multi-detector coronary CT

    International Nuclear Information System (INIS)

    Steen, Henning; Andre, Florian; Korosoglou, Grigorios; Mueller, Dirk; Hosch, Waldemar; Kauczor, Hans-Ulrich; Giannitsis, Evangelos; Katus, Hugo A.

    2011-01-01

    Objective: We sought to investigate stent lumen visibility of 56 coronary stents with the newest 256-multi-slice-CT (256-MDCT) technology for different reconstruction algorithms in an in vitro model. Background: Early identification of in-stent restenosis (ISR) is important to avoid recurrent ischemia and prevent acute myocardial infarction (AMI). Since angiography has the disadvantage of high costs and its invasiveness, MDCT could be a convenient and safe non-invasive alternative for detection of ISR. Material and methods: Percentages of in-stent lumen diameter and in-stent signal attenuation (measured as contrast-to-noise ratio (CNR)) of 56 coronary stents (group A ≤2.5 mm; group B = 2.75-3.0 mm; group C = 3.5-4.0 mm) were evaluated in a coronary vessel in vitro phantom (iodine-filled plastic tubes) employing four different reconstruction algorithms (XCD, CC, CD, XCB) on a novel 256-MDCT (Philips-iCT, collimation = 128 mm x 0.625 mm; rotation time = 270 ms; tube current = 800 mA s with 120 kV). Analysis was conducted with the semi-automatical full-width-at-half-maximum (FWHM) method. P-values 60% for group C stents was significantly larger and CNR was significantly lower (both p 3.0 mm when analysed with cardio-dedicated sharp kernels, although clinical studies corroborating this claim should be performed. However, stents ≤3.0 mm reconstructed by soft kernels revealed insufficient in-stent lumen visualisation and should not be used in clinical practice. Further improvements in spatial and temporal image resolution as well as reductions of radiation exposure and image noise have to be accomplished for the ambitious goal of characterising both CT coronary artery anatomy and in-stent lumen.

  3. Lamellipodia and Membrane Blebs Drive Efficient Electrotactic Migration of Rat Walker Carcinosarcoma Cells WC 256.

    Science.gov (United States)

    Sroka, Jolanta; Krecioch, Izabela; Zimolag, Eliza; Lasota, Slawomir; Rak, Monika; Kedracka-Krok, Sylwia; Borowicz, Pawel; Gajek, Marta; Madeja, Zbigniew

    2016-01-01

    The endogenous electric field (EF) may provide an important signal for directional cell migration during wound healing, embryonic development and cancer metastasis but the mechanism of cell electrotaxis is poorly understood. Additionally, there is no research addressing the question on the difference in electrotactic motility of cells representing various strategies of cell movement-specifically blebbing vs. lamellipodial migration. In the current study we constructed a unique experimental model which allowed for the investigation of electrotactic movement of cells of the same origin but representing different modes of cell migration: weakly adherent, spontaneously blebbing (BC) and lamellipodia forming (LC) WC256 cells. We report that both BC and LC sublines show robust cathodal migration in a physiological EF (1-3 V/cm). The directionality of cell movement was completely reversible upon reversing the field polarity. However, the full reversal of cell direction after the change of EF polarity was much faster in the case of BC (10 minutes) than LC cells (30 minutes). We also investigated the distinct requirements for Rac, Cdc42 and Rho pathways and intracellular Ca2+ in electrotaxis of WC256 sublines forming different types of cell protrusions. It was found that Rac1 is required for directional movement of LC to a much greater extent than for BC, but Cdc42 and RhoA are more crucial for BC than for LC cells. The inhibition of ROCK did not affect electrotaxis of LC in contrast to BC cells. The results also showed that intracellular Ca2+ is essential only for the electrotactic reaction of BC cells. Moreover, inhibition of MLCK and myosin II did not affect the electrotaxis of LC in contrast to BC cells. In conclusion, our results revealed that both lamellipodia and membrane blebs can efficiently drive electrotactic migration of WC 256 carcinosarcoma cells, however directional migration is mediated by different signalling pathways.

  4. 37 CFR 256.2 - Royalty fee for compulsory license for secondary transmission by cable systems.

    Science.gov (United States)

    2010-07-01

    ... 37 Patents, Trademarks, and Copyrights 1 2010-07-01 2010-07-01 false Royalty fee for compulsory... ADJUSTMENT OF ROYALTY FEE FOR CABLE COMPULSORY LICENSE § 256.2 Royalty fee for compulsory license for... receipts be reduced to less than $10,400. The royalty fee payable under this paragraph shall be 0.5 of 1...

  5. A 256-channel measuring and recording system; Un systeme de mesure et d'enregistrement a 256 canaux; Sistema izmerenij i registratsii na 256 kanalov; Sistema de medicion y registro de 256 canales

    Energy Technology Data Exchange (ETDEWEB)

    Krasheninnikov, I S; Kuronkin, S S; Pasechnikova, I P; Safonovi, O A; Tuchina, A S

    1962-04-15

    The paper discusses a system of measuring and recording units intended for use in a wide range of physical experiments. The basis of the system is a 256-channel register unit with a channel capacity of 2{sup 16} and a control unit. The system is executed on ferrite cores and transistors. The arithmetic element of the register unit makes it possible to perform adding and subtracting operations. The time of a complete cycle up t o the memory is 20 {mu}s. In the control unit, the basic controls, such as the settings for registering, counting and recording, can be combined in any order, which gives a much wider range of application as compared with normal equipment. The frequency of the control unit is taken from a 4-Mc/s quartz generator. As measuring units the system employs a pulse-amplitude-to-cipher code converter with a conversion time of 0.25 {mu}s per channel, integral non-linearity better than 0.1%, differential non-linearity less than 4%, zero drift less than 0.2 V and channel-width instability less than 0,4%, for lengthy periods. The converter system employs tubes. The time selector, which employs transistors, has a channel width from 1 to 64 {mu}s; the channel-width instability is less than 10{sup -4}. The logic of the circuit is such as to permit registration of incomplete pulses into the channel for channel widths of more than 8 {mu}s. The unit used to convert small time-intervals (10{sup -9} - 10{sup -7} s.) into a unitary cipher code has a time resolution of about 2 x 10{sup -5} s and a channel width stability better than 10{sup -2}. From the memory unit the information can be passed either in an analogue form to an oscillograph tube or in the form of cipher code to a printer and indicator lamps. (author) [French] Le memoire etudie un systeme de circuits de mesure et d'enregistrement, destine a des experiences de physique extremement variees. Le systeme comporte comme elements principaux un circuit enregistreur a 256 canaux, avec une capacite d

  6. An SEU resistant 256K SOI SRAM

    Science.gov (United States)

    Hite, L. R.; Lu, H.; Houston, T. W.; Hurta, D. S.; Bailey, W. E.

    1992-12-01

    A novel SEU (single event upset) resistant SRAM (static random access memory) cell has been implemented in a 256K SOI (silicon on insulator) SRAM that has attractive performance characteristics over the military temperature range of -55 to +125 C. These include worst-case access time of 40 ns with an active power of only 150 mW at 25 MHz, and a worst-case minimum WRITE pulse width of 20 ns. Measured SEU performance gives an Adams 10 percent worst-case error rate of 3.4 x 10 exp -11 errors/bit-day using the CRUP code with a conservative first-upset LET threshold. Modeling does show that higher bipolar gain than that measured on a sample from the SRAM lot would produce a lower error rate. Measurements show the worst-case supply voltage for SEU to be 5.5 V. Analysis has shown this to be primarily caused by the drain voltage dependence of the beta of the SOI parasitic bipolar transistor. Based on this, SEU experiments with SOI devices should include measurements as a function of supply voltage, rather than the traditional 4.5 V, to determine the worst-case condition.

  7. 40 CFR 256.26 - Requirement for schedules leading to compliance with the prohibition of open dumping.

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 24 2010-07-01 2010-07-01 false Requirement for schedules leading to... SOLID WASTE MANAGEMENT PLANS Solid Waste Disposal Programs § 256.26 Requirement for schedules leading to... schedule of remedial measures, and an enforceable sequence of actions, leading to compliance within a...

  8. Respiratory-gated segment reconstruction for radiation treatment planning using 256-slice CT-scanner during free breathing

    Science.gov (United States)

    Mori, Shinichiro; Endo, Masahiro; Kohno, Ryosuke; Minohara, Shinichi; Kohno, Kazutoshi; Asakura, Hiroshi; Fujiwara, Hideaki; Murase, Kenya

    2005-04-01

    The conventional respiratory-gated CT scan technique includes anatomic motion induced artifacts due to the low temporal resolution. They are a significant source of error in radiotherapy treatment planning for the thorax and upper abdomen. Temporal resolution and image quality are important factors to minimize planning target volume margin due to the respiratory motion. To achieve high temporal resolution and high signal-to-noise ratio, we developed a respiratory gated segment reconstruction algorithm and adapted it to Feldkamp-Davis-Kress algorithm (FDK) with a 256-detector row CT. The 256-detector row CT could scan approximately 100 mm in the cranio-caudal direction with 0.5 mm slice thickness in one rotation. Data acquisition for the RS-FDK relies on the assistance of the respiratory sensing system by a cine scan mode (table remains stationary). We evaluated RS-FDK in phantom study with the 256-detector row CT and compared it with full scan (FS-FDK) and HS-FDK results with regard to volume accuracy and image noise, and finally adapted the RS-FDK to an animal study. The RS-FDK gave a more accurate volume than the others and it had the same signal-to-noise ratio as the FS-FDK. In the animal study, the RS-FDK visualized the clearest edges of the liver and pulmonary vessels of all the algorithms. In conclusion, the RS-FDK algorithm has a capability of high temporal resolution and high signal-to-noise ratio. Therefore it will be useful when combined with new radiotherapy techniques including image guided radiation therapy (IGRT) and 4D radiation therapy.

  9. Decorin is one of the proteoglycans expressed in Walker 256 rat mammary carcinoma

    Directory of Open Access Journals (Sweden)

    S.M. Oba-Shinjo

    2003-08-01

    Full Text Available Proteoglycan and glycosaminoglycan content was analyzed in a model of rat mammary carcinoma to study the roles of these compounds in tumorigenesis. Hyaluronic acid and proteoglycans bearing chondroitin and/or dermatan sulfate chains were detected in solid tumors obtained after subcutaneous inoculation of Walker 256 rat carcinoma cells. About 10% of sulfated glycosaminoglycan chains corresponded to heparan sulfate. The small leucine-rich proteoglycan, decorin, was identified as one of the proteoglycans, in addition to others of higher molecular weight, by cross-reaction with an antiserum raised against pig laryngeal decorin and by N-terminal amino acid sequencing. Decorin was separated from other proteoglycans by hydrophobic chromatography and its complete structure was determined. It has a molecular weight of about 85 kDa and a dermatan chain of 45 kDa with 4-sulfated disaccharides. After degradation of the glycosaminoglycan chain, three core proteins of different molecular weight (36, 46 and 56 kDa were identified. The presence of hyaluronic acid and decorin has been reported in a variety of tumors and tumor cells. In the Walker 256 mammary carcinoma model, hyaluronic acid may play an important role in tumor progression, since it provides a more hydrated extracellular matrix. On the other hand, decorin, which is expressed by stromal cells, represents a host defense response to tumor growth.

  10. Effects Of Walker 256 Carcinoma On Metabolic Alterations During The Evolution Of Pregnancy.

    OpenAIRE

    Cintra-Gomes M.C.; Cury L.; Parreira M.R.; Elias C.F.; Areas M.A.

    1990-01-01

    The control of pregnant cancer patients is difficult because it involves both mother and fetus, and the metabolic alterations in the cancer host induce a massive mobilization of nutrients diverted to the neoplastic cells. The purpose of the present study was to determine the evolution of the Walker 256 carcinoma in pregnant rats and its consequences on fetal development. The results showed that the tumors displayed a very rapid rate of growth and induced a reduction in fetal weights in the pr...

  11. Fission of 255,256Es, 255-257Fm, and 258Md at moderate excitation energies

    NARCIS (Netherlands)

    Britt, H.C.; Hoffman, D.C.; Plicht, J. van der; Wilhelmy, J.; Cheifetz, E.; Dupzyk, R.J.; Lougheed, R.W.

    1984-01-01

    The fission of 255,256Es, 255-257Fm, and 258Md has been studied in the excitation energy range from threshold to 25 MeV. A target of 254Es was used in the direct reaction studies; (d,pf), (t,pf), (3He,df), (3He,pf), and in the compound induced fission reactions formed with p, d, t, and α particle

  12. Extraction and radioimmunological detection of parathormone from the hypercalcaemic Walker carcinosarcoma 256 of the rat

    International Nuclear Information System (INIS)

    Schieber, P.

    1978-01-01

    Out of 1.5 kg solid Walker carcionosarcoma 256, 1682 mg extract were obtained by a specific parathormone extraction technique. This extract was analyzed radioimmunologically with a bovine parathormone standard for comparison. The radioimmunological analysis showed a comparable immunoreactivity in tumour extract and bovine parathormone. This can be seen in the small difference in the rise of regression lines. (orig.) [de

  13. Experimental demonstration of multi-pilot aided carrier phase estimation for DP-64QAM and DP-256QAM

    NARCIS (Netherlands)

    Pajovic, M.; Millar, D.S.; Koike-Akino, T.; Maher, R.; Lavery, D.; Alvarado, A.; Paskov, M.; Kojima, K.; Parsons, K.; Thomsen, B.C.; Savory, S.J.; Bayvel, P.

    2015-01-01

    We present a statistical inference based multi-pilot aided CPE algorithm and analyze its performance via simulations. We experimentally verify LDPC coded back-to-back performance using 10 GBd DP-64QAM and DP-256QAM modulation, with transmitter and receiver linewidths of 100 kHz.

  14. Lamellipodia and Membrane Blebs Drive Efficient Electrotactic Migration of Rat Walker Carcinosarcoma Cells WC 256

    Science.gov (United States)

    Sroka, Jolanta; Krecioch, Izabela; Zimolag, Eliza; Lasota, Slawomir; Rak, Monika; Kedracka-Krok, Sylwia; Borowicz, Pawel; Gajek, Marta; Madeja, Zbigniew

    2016-01-01

    The endogenous electric field (EF) may provide an important signal for directional cell migration during wound healing, embryonic development and cancer metastasis but the mechanism of cell electrotaxis is poorly understood. Additionally, there is no research addressing the question on the difference in electrotactic motility of cells representing various strategies of cell movement—specifically blebbing vs. lamellipodial migration. In the current study we constructed a unique experimental model which allowed for the investigation of electrotactic movement of cells of the same origin but representing different modes of cell migration: weakly adherent, spontaneously blebbing (BC) and lamellipodia forming (LC) WC256 cells. We report that both BC and LC sublines show robust cathodal migration in a physiological EF (1–3 V/cm). The directionality of cell movement was completely reversible upon reversing the field polarity. However, the full reversal of cell direction after the change of EF polarity was much faster in the case of BC (10 minutes) than LC cells (30 minutes). We also investigated the distinct requirements for Rac, Cdc42 and Rho pathways and intracellular Ca2+ in electrotaxis of WC256 sublines forming different types of cell protrusions. It was found that Rac1 is required for directional movement of LC to a much greater extent than for BC, but Cdc42 and RhoA are more crucial for BC than for LC cells. The inhibition of ROCK did not affect electrotaxis of LC in contrast to BC cells. The results also showed that intracellular Ca2+ is essential only for the electrotactic reaction of BC cells. Moreover, inhibition of MLCK and myosin II did not affect the electrotaxis of LC in contrast to BC cells. In conclusion, our results revealed that both lamellipodia and membrane blebs can efficiently drive electrotactic migration of WC 256 carcinosarcoma cells, however directional migration is mediated by different signalling pathways. PMID:26863616

  15. Lamellipodia and Membrane Blebs Drive Efficient Electrotactic Migration of Rat Walker Carcinosarcoma Cells WC 256.

    Directory of Open Access Journals (Sweden)

    Jolanta Sroka

    Full Text Available The endogenous electric field (EF may provide an important signal for directional cell migration during wound healing, embryonic development and cancer metastasis but the mechanism of cell electrotaxis is poorly understood. Additionally, there is no research addressing the question on the difference in electrotactic motility of cells representing various strategies of cell movement-specifically blebbing vs. lamellipodial migration. In the current study we constructed a unique experimental model which allowed for the investigation of electrotactic movement of cells of the same origin but representing different modes of cell migration: weakly adherent, spontaneously blebbing (BC and lamellipodia forming (LC WC256 cells. We report that both BC and LC sublines show robust cathodal migration in a physiological EF (1-3 V/cm. The directionality of cell movement was completely reversible upon reversing the field polarity. However, the full reversal of cell direction after the change of EF polarity was much faster in the case of BC (10 minutes than LC cells (30 minutes. We also investigated the distinct requirements for Rac, Cdc42 and Rho pathways and intracellular Ca2+ in electrotaxis of WC256 sublines forming different types of cell protrusions. It was found that Rac1 is required for directional movement of LC to a much greater extent than for BC, but Cdc42 and RhoA are more crucial for BC than for LC cells. The inhibition of ROCK did not affect electrotaxis of LC in contrast to BC cells. The results also showed that intracellular Ca2+ is essential only for the electrotactic reaction of BC cells. Moreover, inhibition of MLCK and myosin II did not affect the electrotaxis of LC in contrast to BC cells. In conclusion, our results revealed that both lamellipodia and membrane blebs can efficiently drive electrotactic migration of WC 256 carcinosarcoma cells, however directional migration is mediated by different signalling pathways.

  16. ULA-OP 256: A 256-Channel Open Scanner for Development and Real-Time Implementation of New Ultrasound Methods.

    Science.gov (United States)

    Boni, Enrico; Bassi, Luca; Dallai, Alessandro; Guidi, Francesco; Meacci, Valentino; Ramalli, Alessandro; Ricci, Stefano; Tortoli, Piero

    2016-10-01

    Open scanners offer an increasing support to the ultrasound researchers who are involved in the experimental test of novel methods. Each system presents specific performance in terms of number of channels, flexibility, processing power, data storage capability, and overall dimensions. This paper reports the design criteria and hardware/software implementation details of a new 256-channel ultrasound advanced open platform. This system is organized in a modular architecture, including multiple front-end boards, interconnected by a high-speed (80 Gb/s) ring, capable of finely controlling all transmit (TX) and receive (RX) signals. High flexibility and processing power (equivalent to 2500 GFLOP) are guaranteed by the possibility of individually programming multiple digital signal processors and field programmable gate arrays. Eighty GB of on-board memory are available for the storage of prebeamforming, postbeamforming, and baseband data. The use of latest generation devices allowed to integrate all needed electronics in a small size ( 34 cm ×30 cm ×26 cm). The system implements a multiline beamformer that allows obtaining images of 96 lines by 2048 depths at a frame rate of 720 Hz (expandable to 3000 Hz). The multiline beamforming capability is also exploited to implement a real-time vector Doppler scheme in which a single TX and two independent RX apertures are simultaneously used to maintain the analysis over a full pulse repetition frequency range.

  17. Peculiar morphology of the high-redshift radio galaxies 3C 13 and 3C 256 in subarcsecond seeing

    International Nuclear Information System (INIS)

    Le Fevre, O.; Hammer, F.; Nottale, L.; Mazure, A.; Christian, C.

    1988-01-01

    High-spatial-resolution imaging is presented for two radio galaxies from the 3C catalog, 3C 13 and 3C 256 with redshifts of 1.351 and 1.819, respectively. The excellent image quality obtained at CFHT, 0.6-arcsec FWHM for 3C 13 and 0.7-arcsec FWHM for 3C 256 in the R band, over long integration times, made it possible to resolve these distant galaxies into complex structures. As suggested by Le Fevre et al. (1987) for another source (the gravitational lens candidate 3C 324) an interpretation in terms of gravitational amplification by foreground galaxies or clusters of galaxies is proposed. 3C 13 appears to be the most serious candidate, since a foreground galaxy, with an absolute luminosity M(R) = 23.3 and a redshift z = 0.477, is only 3.9 in from the extended radio galaxy. 18 references

  18. Anti-Inflammatory and Cytoprotective Effects of TMC-256C1 from Marine-Derived Fungus Aspergillus sp. SF-6354 via up-Regulation of Heme Oxygenase-1 in Murine Hippocampal and Microglial Cell Lines

    Directory of Open Access Journals (Sweden)

    Dong-Cheol Kim

    2016-04-01

    Full Text Available In the course of searching for bioactive secondary metabolites from marine fungi, TMC-256C1 was isolated from an ethyl acetate extract of the marine-derived fungus Aspergillus sp. SF6354. TMC-256C1 displayed anti-neuroinflammatory effect in BV2 microglial cells induced by lipopolysaccharides (LPS as well as neuroprotective effect against glutamate-stimulated neurotoxicity in mouse hippocampal HT22 cells. TMC-256C1 was shown to develop a cellular resistance to oxidative damage caused by glutamate-induced cytotoxicity and reactive oxygen species (ROS generation in HT22 cells, and suppress the inflammation process in LPS-stimulated BV2 cells. Furthermore, the neuroprotective and anti-neuroinflammatory activities of TMC-256C1 were associated with upregulated expression of heme oxygenase (HO-1 and nuclear translocation of nuclear factor-E2-related factor 2 (Nrf2 in HT22 and BV2 cells. We also found that TMC-256C1 activated p38 mitogen-activated protein kinases (MAPK and phosphatidylinositol 3-kinase (PI3K/Akt signaling pathways in HT22 and BV2 cells. These results demonstrated that TMC-256C1 activates HO-1 protein expression, probably by increasing nuclear Nrf2 levels via the activation of the p38 MAPK and PI3K/Akt pathways.

  19. Reduction of the estimated radiation dose and associated patient risk with prospective ECG-gated 256-slice CT coronary angiography

    International Nuclear Information System (INIS)

    Efstathopoulos, E P; Kelekis, N L; Pantos, I; Brountzos, E; Argentos, S; Grebac, J; Ziaka, D; Seimenis, I; Katritsis, D G

    2009-01-01

    Computed tomography (CT) coronary angiography has been widely used since the introduction of 64-slice scanners and dual-source CT technology, but high radiation doses have been reported. Prospective ECG-gating using a 'step-and-shoot' axial scanning protocol has been shown to reduce radiation exposure effectively while maintaining diagnostic accuracy. 256-slice scanners with 80 mm detector coverage have been currently introduced into practice, but their impact on radiation exposure has not been adequately studied. The aim of this study was to assess radiation doses associated with CT coronary angiography using a 256-slice CT scanner. Radiation doses were estimated for 25 patients scanned with either prospective or retrospective ECG-gating. Image quality was assessed objectively in terms of mean CT attenuation at selected regions of interest on axial coronary images and subjectively by coronary segment quality scoring. It was found that radiation doses associated with prospective ECG-gating were significantly lower than retrospective ECG-gating (3.2 ± 0.6 mSv versus 13.4 ± 2.7 mSv). Consequently, the radiogenic fatal cancer risk for the patient is much lower with prospective gating (0.0176% versus 0.0737%). No statistically significant differences in image quality were observed between the two scanning protocols for both objective and subjective quality assessments. Therefore, prospective ECG-gating using a 'step-and-shoot' protocol that covers the cardiac anatomy in two axial acquisitions effectively reduces radiation doses in 256-slice CT coronary angiography without compromising image quality.

  20. Cervical hip fractures do not occur in arthrotic joints. A clinicoradiographic study of 256 patients.

    Science.gov (United States)

    Dretakis, E K; Steriopoulos, K A; Kontakis, G M; Giaourakis, G; Economakis, G; Dretakis, K E

    1998-08-01

    We studied endogenic factors for the occurrence of cervical hip fractures in 256 patients. 230 underwent hemiarthroplasty, and 26 were treated with internal fixation or without surgery. The condition of the fractured hip and of the ipsilateral knee, as well as the mobility of the patient before the fracture, were studied in all 256 patients. The removed femoral heads were examined, photographed and radiographs were taken with sensitive film. The acetabulum and the femoral head were macroscopically normal in all 230 cases and there was no radiographic evidence of arthrosis. 64% of the patients were fully mobile before the fracture, 34% were mobile with the aid of a cane and 2% were dependent. In 88%, the ipsilateral knee was normal both clinically and radiographically, and in 12%, there was moderate arthrosis. When comparing the mobility before the fracture and the condition of the ipsilateral hip and knee in 100 patients having a cervical fracture with 100 patients having a trochanteric fracture matched for age and sex, we found that a normal hip joint was sine qua non while a normal ipsilateral knee and a fully mobile individual were important additional conditions for the occurrence of a cervical hip fracture, instead of a trochanteric one, after a fall in an elderly person.

  1. 31 CFR 256.12 - What supporting documentation must agencies submit to FMS when requesting a payment from the...

    Science.gov (United States)

    2010-07-01

    ... 31 Money and Finance: Treasury 2 2010-07-01 2010-07-01 false What supporting documentation must... BILLS Requesting Payments § 256.12 What supporting documentation must agencies submit to FMS when... guardian. Agencies must list the appropriate controlling state law citation on the payment request forms...

  2. 17 bit 4.35 mW 1 kHz Delta Sigma ADC and 256-to-1 multiplexer for remote handling instrumentation equipment

    Energy Technology Data Exchange (ETDEWEB)

    Verbeeck, Jens, E-mail: jens.verbeeck@esat.kuleuven.be [KU Leuven, Department ESAT-MICAS, Kasteelpark Arenberg 10, 3001 Heverlee (Belgium); KH Kempen University College, IBW-RELIC, Kleinhoefstraat 4, 2440 Geel (Belgium); Van Uffelen, Marco [Fusion for Energy, c/Josep, n° 2, Torres Diagonal Litoral, Ed. B3, 08019 Barcelona (Spain); Steyaert, Michiel [KU Leuven, Department ESAT-MICAS, Kasteelpark Arenberg 10, 3001 Heverlee (Belgium); Leroux, Paul [KU Leuven, Department ESAT-MICAS, Kasteelpark Arenberg 10, 3001 Heverlee (Belgium); KH Kempen University College, IBW-RELIC, Kleinhoefstraat 4, 2440 Geel (Belgium)

    2013-10-15

    Highlights: ► We present a radiation hard 17 bit-1 kHz 4.35 mW Delta Sigma ADC. ► A radiation tolerant 256-to-1 multiplexer is shown. ► We propose a generic radiation tolerant ASIC for use in an instrumentation link. ► The ASIC can interface more than hundred pressure or resistive sensors. ► All building blocks have a simulated radiation tolerance of more than 1 MGy. -- Abstract: A radiation tolerant Delta-Sigma Analog-to-Digital Converter (ADC) and multiplexer is presented. The design features a 1.5 V, 17 bit ADC consuming 4.35 mW at a sample frequency of 1 MHz. The ADC features a bandwidth of 1 kHz and utilizes a Correlated Double Sampling technique (CDS) to remove offset and 1/f noise. The circuit maintains its 17 bit resolution upon a simulated radiation dose exceeding 1 MGy and varying temperatures between 0 °C and 85 °C. Next a multiplexer is presented. It can multiplex 256 channels at a clock frequency of 128 MHz or has a data throughput of 256 MSample/s. In addition the bit period of the multiplexer varies less then 1.5% due to the influence of temperature or radiation, which proves the temperature and radiation tolerance.

  3. One-stop shop assessment for atrial septal defect closure using 256-slice coronary CT angiography

    Energy Technology Data Exchange (ETDEWEB)

    Yamasaki, Yuzo; Kamitani, Takeshi; Sagiyama, Koji; Yamanouchi, Torahiko; Honda, Hiroshi [Kyushu University, Department of Clinical Radiology, Graduate School of Medical Sciences, 3-1-1 Maidashi, Higashi-ku, Fukuoka (Japan); Nagao, Michinobu; Kawanami, Satoshi [Kyushu University, Department of Molecular Imaging and Diagnosis, Graduate School of Medical Sciences, Fukuoka (Japan); Sakamoto, Ichiro [Kyushu University, Department of Cardiovascular Medicine, Graduate School of Medical Sciences, Fukuoka (Japan); Yamamura, Kenichiro [Kyushu University, Department of Pediatrics, Graduate School of Medical Sciences, Fukuoka (Japan); Yabuuchi, Hidetake [Kyushu University, Department of Health Sciences, Graduate School of Medical Sciences, Fukuoka (Japan)

    2017-02-15

    To investigate the feasibility and accuracy of measurement of the pulmonary to systemic blood flow ratio (Qp/Qs) and defect and rim sizes in secundum atrial septal defects (ASDs) using 256-slice CT, compared to the reference transoesophageal echocardiography (TEE) and right heart catheterization (RHC) measurements. Twenty-three consecutive adult patients with secundum ASDs who underwent retrospective ECG-gated coronary CT angiography (CCTA), TEE and RHC were enrolled in this study. Right ventricular (RV) and left ventricular (LV) stroke volumes (SV) were calculated by biventricular volumetry of CCTA. Qp/Qs-CT was defined as RVSV/LVSV. The sizes of the defect and rim were measured by multi-planar reconstruction CT images. Correlations between Qp/Qs-CT and Qp/Qs-RHC and between the defect diameter obtained by CT and TEE were analyzed by Pearson's coefficient analysis. Rim sizes by CT and TEE were compared by paired t-test. Qp/Qs-CT was significantly correlated with Qp/Qs-RHC (r = 0.83, p < 0.0001), and the defect diameter by CT was significantly correlated with that by TEE (r = 0.95, p < 0.0001). There was no significant difference between CT and TEE in measurements of rim size. 256-slice CCTA allows measuring Qp/Qs and size of defects and rims in patients with secundum ASDs, accomplishing pretreatment evaluation non-invasively and comprehensively. (orig.)

  4. One-stop shop assessment for atrial septal defect closure using 256-slice coronary CT angiography

    International Nuclear Information System (INIS)

    Yamasaki, Yuzo; Kamitani, Takeshi; Sagiyama, Koji; Yamanouchi, Torahiko; Honda, Hiroshi; Nagao, Michinobu; Kawanami, Satoshi; Sakamoto, Ichiro; Yamamura, Kenichiro; Yabuuchi, Hidetake

    2017-01-01

    To investigate the feasibility and accuracy of measurement of the pulmonary to systemic blood flow ratio (Qp/Qs) and defect and rim sizes in secundum atrial septal defects (ASDs) using 256-slice CT, compared to the reference transoesophageal echocardiography (TEE) and right heart catheterization (RHC) measurements. Twenty-three consecutive adult patients with secundum ASDs who underwent retrospective ECG-gated coronary CT angiography (CCTA), TEE and RHC were enrolled in this study. Right ventricular (RV) and left ventricular (LV) stroke volumes (SV) were calculated by biventricular volumetry of CCTA. Qp/Qs-CT was defined as RVSV/LVSV. The sizes of the defect and rim were measured by multi-planar reconstruction CT images. Correlations between Qp/Qs-CT and Qp/Qs-RHC and between the defect diameter obtained by CT and TEE were analyzed by Pearson's coefficient analysis. Rim sizes by CT and TEE were compared by paired t-test. Qp/Qs-CT was significantly correlated with Qp/Qs-RHC (r = 0.83, p < 0.0001), and the defect diameter by CT was significantly correlated with that by TEE (r = 0.95, p < 0.0001). There was no significant difference between CT and TEE in measurements of rim size. 256-slice CCTA allows measuring Qp/Qs and size of defects and rims in patients with secundum ASDs, accomplishing pretreatment evaluation non-invasively and comprehensively. (orig.)

  5. Power fading mitigation of 40-Gbit/s 256-QAM OFDM carried by colorless laser diode under injection-locking.

    Science.gov (United States)

    Tsai, Cheng-Ting; Chi, Yu-Chieh; Lin, Gong-Ru

    2015-11-02

    The pre-compensation on power fading effect of a colorless laser diode (CLD) carried 40-Gbit/s 256-QAM OFDM transmission during 25-km is demonstrated. By offsetting the DC bias to thrice the threshold (I(th)) and increasing the injection to 0 dBm, the CLD not only enhances its coherence but also suppresses modulation throughput declination and reduces the relative intensity related noise floor to -50 dBm. Modeling the receiving power of the delivered 256-QAM OFDM subcarriers is established, indicating that raising the bias to 3I(th) down-shifts the power fading induced notch to 8.8 GHz. This further degrades the OFDM subcarrier peak power by -2.9 dB after 25-km transmission, and the corresponded signal-to-noise ratio (SNR), error vector magnitude (EVM) and bit-error-rate (BER) are 26.1 dB, 4.9% and 6.5 × 10(-3), respectively. Pre-leveling the OFDM subcarrier as well as the modulation throughput effectively compromises the over-bias enlarged power fading to promote transmission. With a pre-leveled power slope of 1.5 dB/GHz for 256-QAM OFDM data, the modulation throughput declination of the high biased CLD significantly mitigates under BtB transmission, enabling the receiving sensitivity at -7.2 dBm with SNR, EVM and BER of 29.9 dB, 3.1% and 1.5 × 10(-4), respectively. Increasing the pre-leveling slope to 3.2 dB/GHz minimizes the fiber dispersion induced power fading, which improves the receiving SNR, EVM and BER to 27.4 dB, 4.2% and 2.6 × 10(-3), respectively, with receiving sensitivity of -3 dBm and power penalty of 4.2 dB after 25-km SMF transmission.

  6. Alterations caused by physical training in pulmonary edema and loss of muscle mass in rats with Walker-256 tumor Alterações promovidas pelo treinamento físico no edema pulmonar e perda de massa muscular em ratos portadores de tumor Walker-256

    Directory of Open Access Journals (Sweden)

    Rubens Cecchini

    2008-10-01

    Full Text Available Walker-256 tumor is a fast-growing tumor and has been studied under several metabolic aspects associated or not to cachexia. It was observed in our laboratory that animals with Walker-256 tumor, after spontaneous death (usually around the fifteenth day, showed significant pulmonary edema with fluid in the pleural cavity. Some studies have suggested that physical training improves the survival of animals with tumor and minimizes the effects of cachexia. The purpose of our work was to assess the pulmonary edema index as well as the cardiac and skeletal muscle mass, besides the survival of rats with Walker-256 tumor submitted previously to physical training through swimming (N. For this study male Wistar rats (200 to 220 g were used, submitted to physical training through swimming (1 hour; 5 days a week, four weeks. One day after the training, sedentary rats (C or trained ones (N were submitted to inoculation on the right flank of 8 x 107 Walker-256 tumor cells (T. Immediately after spontaneous death of these animals, the pulmonary edema index (PEI, cardiac and skeletal muscle mass (gastrocnemius and soleus were evaluated. Pulmonary edema was evaluated through the index calculated by the relation between lung and body weights of each animal, and multiplied by 100 (PP/PC x 100 (LEE et al., 2001. Muscle mass (MM index was calculated similarly. In normal animals the PEI is equal to 0,53±0,02 (n=20. In tumor-bearing rats after spontaneous death the PEI was significantly higher (2,62±0,31, n=18. After the physical training in rats without tumor, the PEI was 0,55±0,03 (n=5. Whereas in tumor-bearing rats previously trained, it was obtained a pulmonary edema index lower than that of the control group with tumor (1,46±0,16, n=5; pO tumor Walker-256 é um carcinoma de crescimento rápido e tem sido estudado sob vários aspectos metabólicos, associados ou não, à caquexia. Foi observado, em nosso laboratório, que em animais portadores de tumor Walker

  7. Implementation of RSA 2048-bit and AES 256-bit with Digital Signature for Secure Electronic Health Record Application

    Directory of Open Access Journals (Sweden)

    Mohamad Ali Sadikin

    2016-10-01

    Full Text Available This research addresses the implementation of encryption and digital signature technique for electronic health record to prevent cybercrime such as robbery, modification and unauthorised access. In this research, RSA 2048-bit algorithm, AES 256-bit and SHA 256 will be implemented in Java programming language. Secure Electronic Health Record Information (SEHR application design is intended to combine given services, such as confidentiality, integrity, authentication, and nonrepudiation. Cryptography is used to ensure the file records and electronic documents for detailed information on the medical past, present and future forecasts that have been given only to the intended patients. The document will be encrypted using an encryption algorithm based on NIST Standard. In the application, there are two schemes, namely the protection and verification scheme. This research uses black-box testing and whitebox testing to test the software input, output, and code without testing the process and design that occurs in the system.We demonstrated the implementation of cryptography in SEHR. The implementation of encryption and digital signature in this research can prevent archive thievery.

  8. A low-cost multichannel pulse-height analyzer PHA 256 using single-chip microcomputer

    International Nuclear Information System (INIS)

    Koehler, M.; Meiling, W.

    1985-01-01

    The PHA 256 multichannel analyzer on the base of the U8820 single-chip microcomputer applied for radiation measurements, for example in monitoring systems with scintillation detectors, is described. The analyzer contains a power supply unit and 7 boards, namely, the processor board; data and program memory; 8-bit analog-to-digital converter; driver to display device; keyboard with 23 function keys; pulse amplifier and high-voltage supply (up to 2 kV). Software used provides preprocessing of spectra supported by following functions: addition and subtraction of different spectra, spectrum monitoring by use of a 5-point-algorithm, calculation of peak areas with linearly interpolated background

  9. Combined therapy of the Walker-256 carcinosarcoma with X-rays and ICRF-159

    International Nuclear Information System (INIS)

    Schaphaus, A.

    1974-01-01

    The radiosensitivity of the Walker-256 carcinosarcoma of the rat under the influence of the tumour-inhibiting bisdioxopiperazine ICRF-159 was studied in collectives of 11-16 animals with tumours. In the combined radio- and chemotherapy, the animals received a daily i.p. injection of 30 mg/kg K.G. of the bisdioxopiperazine ICRF-159 in 1.0 ml NaCl solution containing carboxyl methyl cellulose. The tumour inhibition was determined by multidimensional measurements of the increase in tumour size with the aid of a slide gange. The combined therapy had a better inhibiting effect on tumour growth than radiotherapy alone. (orig./AK) [de

  10. 256-pixel microcalorimeter array for high-resolution γ-ray spectroscopy of mixed-actinide materials

    Energy Technology Data Exchange (ETDEWEB)

    Winkler, R., E-mail: rwinkler@lanl.gov [Los Alamos National Laboratory, Los Alamos, NM (United States); Hoover, A.S.; Rabin, M.W. [Los Alamos National Laboratory, Los Alamos, NM (United States); Bennett, D.A.; Doriese, W.B.; Fowler, J.W.; Hays-Wehle, J.; Horansky, R.D.; Reintsema, C.D.; Schmidt, D.R.; Vale, L.R.; Ullom, J.N. [National Institute of Standards and Technology, Boulder, CO (United States)

    2015-01-11

    The application of cryogenic microcalorimeter detectors to γ-ray spectroscopy allows for measurements with unprecedented energy resolution. These detectors are ideally suited for γ-ray spectroscopy applications for which the measurement quality is limited by the spectral overlap of many closely spaced transitions using conventional detector technologies. The non-destructive analysis of mixed-isotope Pu materials is one such application where the precision can be potentially improved utilizing microcalorimeter detectors compared to current state-of-the-art high-purity Ge detectors (HPGe). The LANL-NIST γ-ray spectrometer, a 256-pixel microcalorimeter array based on transition-edge sensors (TESs), was recently commissioned and used to collect data on a variety of Pu isotopic standards to characterize the instrument performance. These measurements represent the first time the simultaneous readout of all 256 pixels for measurements of mixed-isotope Pu materials has been achieved. The LANL-NIST γ-ray spectrometer has demonstrated an average pixel resolution of 55 eV full-width-at-half-maximum at 100 keV, nearly an order of magnitude better than HPGe detectors. Some challenges of the analysis of many-channel ultra-high resolution data and the techniques used to produce quality spectra for isotopic analysis will be presented. The LANL-NIST γ-ray spectrometer has also demonstrated stable operation and obtained high resolution measurements at total array event rates beyond 1 kHz. For a total event rate of 1.25 kHz, approximately 5.6 cps/pixel, a 72.2 eV average FWHM for the 103 keV photopeak of {sup 153}Gd was achieved.

  11. Characterization of a Wavelength Converter for 256-QAM Signals Based on an AlGaAs-On-Insulator Nano-waveguide

    DEFF Research Database (Denmark)

    Da Ros, Francesco; Yankov, Metodi Plamenov; Porto da Silva, Edson

    2016-01-01

    High efficiency and broadband wavelength conversion in a 9-mm AlGaAs-On-Insulator waveguide is shown to provide high-quality (OSNR > 30 dB) idler generation over a 28-nm bandwidth enabling error-free conversion of 10-GBd 256-QAM with OSNR penalty below 2.5 dB....

  12. Complete Circular Genome Sequence of Successful ST8/SCCmecIV Community-Associated Methicillin-Resistant Staphylococcus aureus (OC8 in Russia: One-Megabase Genomic Inversion, IS256's Spread, and Evolution of Russia ST8-IV.

    Directory of Open Access Journals (Sweden)

    Tsai-Wen Wan

    Full Text Available ST8/SCCmecIV community-associated methicillin-resistant Staphylococcus aureus (CA-MRSA has been a common threat, with large USA300 epidemics in the United States. The global geographical structure of ST8/SCCmecIV has not yet been fully elucidated. We herein determined the complete circular genome sequence of ST8/SCCmecIVc strain OC8 from Siberian Russia. We found that 36.0% of the genome was inverted relative to USA300. Two IS256, oppositely oriented, at IS256-enriched hot spots were implicated with the one-megabase genomic inversion (MbIN and vSaβ split. The behavior of IS256 was flexible: its insertion site (att sequences on the genome and junction sequences of extrachromosomal circular DNA were all divergent, albeit with fixed sizes. A similar multi-IS256 system was detected, even in prevalent ST239 healthcare-associated MRSA in Russia, suggesting IS256's strong transmission potential and advantage in evolution. Regarding epidemiology, all ST8/SCCmecIVc strains from European, Siberian, and Far Eastern Russia, examined had MbIN, and geographical expansion accompanied divergent spa types and resistance to fluoroquinolones, chloramphenicol, and often rifampicin. Russia ST8/SCCmecIVc has been associated with life-threatening infections such as pneumonia and sepsis in both community and hospital settings. Regarding virulence, the OC8 genome carried a series of toxin and immune evasion genes, a truncated giant surface protein gene, and IS256 insertion adjacent to a pan-regulatory gene. These results suggest that unique single ST8/spa1(t008/SCCmecIVc CA-MRSA (clade, Russia ST8-IVc emerged in Russia, and this was followed by large geographical expansion, with MbIN as an epidemiological marker, and fluoroquinolone resistance, multiple virulence factors, and possibly a multi-IS256 system as selective advantages.

  13. Complete Circular Genome Sequence of Successful ST8/SCCmecIV Community-Associated Methicillin-Resistant Staphylococcus aureus (OC8) in Russia: One-Megabase Genomic Inversion, IS256's Spread, and Evolution of Russia ST8-IV.

    Science.gov (United States)

    Wan, Tsai-Wen; Khokhlova, Olga E; Iwao, Yasuhisa; Higuchi, Wataru; Hung, Wei-Chun; Reva, Ivan V; Singur, Olga A; Gostev, Vladimir V; Sidorenko, Sergey V; Peryanova, Olga V; Salmina, Alla B; Reva, Galina V; Teng, Lee-Jene; Yamamoto, Tatsuo

    2016-01-01

    ST8/SCCmecIV community-associated methicillin-resistant Staphylococcus aureus (CA-MRSA) has been a common threat, with large USA300 epidemics in the United States. The global geographical structure of ST8/SCCmecIV has not yet been fully elucidated. We herein determined the complete circular genome sequence of ST8/SCCmecIVc strain OC8 from Siberian Russia. We found that 36.0% of the genome was inverted relative to USA300. Two IS256, oppositely oriented, at IS256-enriched hot spots were implicated with the one-megabase genomic inversion (MbIN) and vSaβ split. The behavior of IS256 was flexible: its insertion site (att) sequences on the genome and junction sequences of extrachromosomal circular DNA were all divergent, albeit with fixed sizes. A similar multi-IS256 system was detected, even in prevalent ST239 healthcare-associated MRSA in Russia, suggesting IS256's strong transmission potential and advantage in evolution. Regarding epidemiology, all ST8/SCCmecIVc strains from European, Siberian, and Far Eastern Russia, examined had MbIN, and geographical expansion accompanied divergent spa types and resistance to fluoroquinolones, chloramphenicol, and often rifampicin. Russia ST8/SCCmecIVc has been associated with life-threatening infections such as pneumonia and sepsis in both community and hospital settings. Regarding virulence, the OC8 genome carried a series of toxin and immune evasion genes, a truncated giant surface protein gene, and IS256 insertion adjacent to a pan-regulatory gene. These results suggest that unique single ST8/spa1(t008)/SCCmecIVc CA-MRSA (clade, Russia ST8-IVc) emerged in Russia, and this was followed by large geographical expansion, with MbIN as an epidemiological marker, and fluoroquinolone resistance, multiple virulence factors, and possibly a multi-IS256 system as selective advantages.

  14. Optimization of polyhydroxybutyrate production by Bacillus sp. CFR 256 with corn steep liquor as a nitrogen source

    OpenAIRE

    Vijayendra, S. V. N.; Rastogi, N. K.; Shamala, T. R.; Anil Kumar, P. K.; Kshama, L.; Joshi, G. J.

    2007-01-01

    Polyhydroxyalkanotes (PHAs), the eco-friendly biopolymers produced by many bacteria, are gaining importance in curtailing the environmental pollution by replacing the non-biodegradable plastics derived from petroleum. The present study was carried out to economize the polyhydroxybutyrate (PHB) production by optimizing the fermentation medium using corn steep liquor (CSL), a by-product of starch processing industry, as a cheap nitrogen source, by Bacillus sp. CFR 256. Response surface methodol...

  15. Fast readout logic interfacing a 256-pixel matrix of a dual-layer 3D device

    International Nuclear Information System (INIS)

    Gabrielli, A; Giorgi, F; Villa, M; Morsani, F

    2010-01-01

    A prototype of a 3D ASIC built up of a fast readout architecture, with sparsification capabilities, which interfaces with a matrix of a 256-pixel sensor, was recently submitted. The chosen technology is CMOS Chartered 130 nm as it is compatible with the Tezzaron facility to interconnect face-to-face two silicon wafers allowing for a vertical integration structure by means of through-silicon-vias. Particularly, the readout logic uses one layer that will be stacked on a sensor layer at the end of the fabrication process.

  16. Fast readout logic interfacing a 256-pixel matrix of a dual-layer 3D device

    Energy Technology Data Exchange (ETDEWEB)

    Gabrielli, A; Giorgi, F; Villa, M [INFN-Bologna and Physics Department, University of Bologna, Viale Berti Pichat, 6/2, 40127, Bologna (Italy); Morsani, F, E-mail: alessandro.gabrielli@bo.infn.i [INFN-Pisa and University of Pisa, Largo B. Pontecorvo, 3, 56127, Pisa (Italy)

    2010-07-15

    A prototype of a 3D ASIC built up of a fast readout architecture, with sparsification capabilities, which interfaces with a matrix of a 256-pixel sensor, was recently submitted. The chosen technology is CMOS Chartered 130 nm as it is compatible with the Tezzaron facility to interconnect face-to-face two silicon wafers allowing for a vertical integration structure by means of through-silicon-vias. Particularly, the readout logic uses one layer that will be stacked on a sensor layer at the end of the fabrication process.

  17. N-(4-Bromobenzyl-2-(5,6-dimethyl-1H-benzo[d]imid-azol-2-ylbenzeneamine

    Directory of Open Access Journals (Sweden)

    Monika Dziełak

    2018-01-01

    Full Text Available N-(4-Bromobenzyl-2-(5,6-dimethyl-1H-benzo[d]imidazol-2-ylbenzeneamine was obtained by condensation of N-(4-bromobenzyl-3,1-benzoxazine-2,4-dione (N-(4-bromobenzylisatoic anhydride with 4,5-dimethyl-1,2-phenylenediamine in refluxing acetic acid. This is a rare example of condensation of N-substituted 3,1-benzoxazine-2,4-dione with 1,2-phenylenediamine, which resulted in the formation of a benzimidazole derivative with a moderate yield. Crystallographic studies and initial biological screening were performed for the obtained product.

  18. CT Angiography of Peripheral Arterial Disease by 256-Slice Scanner: Accuracy, Advantages and Disadvantages Compared to Digital Subtraction Angiography.

    Science.gov (United States)

    Mishra, Atul; Jain, Narendra; Bhagwat, Anand

    2017-07-01

    Peripheral arterial occlusive disease (PAOD) may cause disabling claudication or critical limb ischemia. Multidetector computed tomography (CT) technology has evolved to the level of 256-slice CT scanners which has significantly improved the spatial and temporal resolution of the images. This has provided the capability of chasing the contrast bolus at a fast speed enabling angiographic imaging of long segments of the body. These images can be reconstructed in various planes and various modes for detailed analysis of the peripheral vascular diseases which helps in making treatment decision. The aim of this retrospective study was to compare the CT angiograms (CTAs) of all cases of PAOD done by 256-slice CT scanner at a tertiary care vascular center and comparing these images with the digital subtraction angiograms (DSAs) of these patients. The retrospective study included 53 patients who underwent both CTA and DSA at our center over a period of 3 years from March 2013 to March 2016. The CTA showed high sensitivity (93%) and specificity (92.7%) for overall assessment of degree of stenosis in a vascular segment in cases of aortic and lower limb occlusive disease. The assessment of lesions of infrapopliteal segment was comparatively inferior (sensitivity 91.6%, accuracy 73.3%, and positive predictive value 78.5%), more so in the presence of significant calcification. The advantages of CTA were its noninvasive nature, ability to image large area of body, almost no adverse effects to the patients, and better assessment of vessel wall disease. However, the CTA assessment of collaterals was inferior with a sensitivity of only 62.7% as compared to DSA. Overall, 256-slice CTA provides fast and accurate imaging of vascular tree which can restrict DSA only in few selected cases as a problem-solving tool where clinico-radiological mismatch is present.

  19. Complete Circular Genome Sequence of Successful ST8/SCCmecIV Community-Associated Methicillin-Resistant Staphylococcus aureus (OC8) in Russia: One-Megabase Genomic Inversion, IS256’s Spread, and Evolution of Russia ST8-IV

    Science.gov (United States)

    Wan, Tsai-Wen; Higuchi, Wataru; Hung, Wei-Chun; Reva, Ivan V.; Singur, Olga A.; Gostev, Vladimir V.; Sidorenko, Sergey V.; Peryanova, Olga V.; Salmina, Alla B.; Reva, Galina V.; Teng, Lee-Jene; Yamamoto, Tatsuo

    2016-01-01

    ST8/SCCmecIV community-associated methicillin-resistant Staphylococcus aureus (CA-MRSA) has been a common threat, with large USA300 epidemics in the United States. The global geographical structure of ST8/SCCmecIV has not yet been fully elucidated. We herein determined the complete circular genome sequence of ST8/SCCmecIVc strain OC8 from Siberian Russia. We found that 36.0% of the genome was inverted relative to USA300. Two IS256, oppositely oriented, at IS256-enriched hot spots were implicated with the one-megabase genomic inversion (MbIN) and vSaβ split. The behavior of IS256 was flexible: its insertion site (att) sequences on the genome and junction sequences of extrachromosomal circular DNA were all divergent, albeit with fixed sizes. A similar multi-IS256 system was detected, even in prevalent ST239 healthcare-associated MRSA in Russia, suggesting IS256’s strong transmission potential and advantage in evolution. Regarding epidemiology, all ST8/SCCmecIVc strains from European, Siberian, and Far Eastern Russia, examined had MbIN, and geographical expansion accompanied divergent spa types and resistance to fluoroquinolones, chloramphenicol, and often rifampicin. Russia ST8/SCCmecIVc has been associated with life-threatening infections such as pneumonia and sepsis in both community and hospital settings. Regarding virulence, the OC8 genome carried a series of toxin and immune evasion genes, a truncated giant surface protein gene, and IS256 insertion adjacent to a pan-regulatory gene. These results suggest that unique single ST8/spa1(t008)/SCCmecIVc CA-MRSA (clade, Russia ST8-IVc) emerged in Russia, and this was followed by large geographical expansion, with MbIN as an epidemiological marker, and fluoroquinolone resistance, multiple virulence factors, and possibly a multi-IS256 system as selective advantages. PMID:27741255

  20. Leucine-rich diet alters the 1H-NMR based metabolomic profile without changing the Walker-256 tumour mass in rats.

    Science.gov (United States)

    Viana, Laís Rosa; Canevarolo, Rafael; Luiz, Anna Caroline Perina; Soares, Raquel Frias; Lubaczeuski, Camila; Zeri, Ana Carolina de Mattos; Gomes-Marcondes, Maria Cristina Cintra

    2016-10-03

    Cachexia is one of the most important causes of cancer-related death. Supplementation with branched-chain amino acids, particularly leucine, has been used to minimise loss of muscle tissue, although few studies have examined the effect of this type of nutritional supplementation on the metabolism of the tumour-bearing host. Therefore, the present study evaluated whether a leucine-rich diet affects metabolomic derangements in serum and tumour tissues in tumour-bearing Walker-256 rats (providing an experimental model of cachexia). After 21 days feeding Wistar female rats a leucine-rich diet, distributed in L-leucine and LW-leucine Walker-256 tumour-bearing groups, we examined the metabolomic profile of serum and tumour tissue samples and compared them with samples from tumour-bearing rats fed a normal protein diet (C - control; W - tumour-bearing groups). We utilised 1 H-NMR as a means to study the serum and tumour metabolomic profile, tumour proliferation and tumour protein synthesis pathway. Among the 58 serum metabolites examined, we found that 12 were altered in the tumour-bearing group, reflecting an increase in activity of some metabolic pathways related to energy production, which diverted many nutrients toward tumour growth. Despite displaying increased tumour cell activity (i.e., higher Ki-67 and mTOR expression), there were no differences in tumour mass associated with changes in 23 metabolites (resulting from valine, leucine and isoleucine synthesis and degradation, and from the synthesis and degradation of ketone bodies) in the leucine-tumour group. This result suggests that the majority of nutrients were used for host maintenance. A leucine rich-diet, largely used to prevent skeletal muscle loss, did not affect Walker 256 tumour growth and led to metabolomic alterations that may partially explain the positive effects of leucine for the whole tumour-bearing host.

  1. Follow-up of coronary artery bypass graft patency: diagnostic efficiency of high-pitch dual-source 256-slice MDCT findings.

    Science.gov (United States)

    Yuceler, Zeyneb; Kantarci, Mecit; Yuce, Ihsan; Kizrak, Yesim; Bayraktutan, Ummugulsum; Ogul, Hayri; Kiris, Adem; Celik, Omer; Pirimoglu, Berhan; Genc, Berhan; Gundogdu, Fuat

    2014-01-01

    Our aim was to evaluate the diagnostic accuracy of 256-slice, high-pitch mode multidetector computed tomography (MDCT) for coronary artery bypass graft (CABG) patency. Eighty-eight patients underwent 256-slice MDCT angiography to evaluate their graft patency after CABG surgery using a prospectively synchronized electrocardiogram in the high-pitch spiral acquisition mode. Effective radiation doses were calculated. We investigated the diagnostic accuracy of high-pitch, low-dose, prospective, electrocardiogram-triggering, dual-source MDCT for CABG patency compared with catheter coronary angiography imaging findings. A total of 215 grafts and 645 vessel segments were analyzed. All graft segments had diagnostic image quality. The proximal and middle graft segments had significantly (P < 0.05) better mean image quality scores (1.18 ± 0.4) than the distal segments (1.31 ± 0.5). Using catheter coronary angiography as the reference standard, high-pitch MDCT had the following sensitivity, specificity, positive predictive value, and negative predictive value of per-segment analysis for detecting graft patency: 97.1%, 99.6%, 94.4%, and 99.8%, respectively. In conclusion, MDCT can be used noninvasively with a lower radiation dose for the assessment of restenosis in CABG patients.

  2. 31 CFR 256.32 - What documentation must be submitted to the Judgment Fund Branch to preserve the right to seek...

    Science.gov (United States)

    2010-07-01

    ... to the Judgment Fund Branch to preserve the right to seek interest under 31 U.S.C. 1304(b) in a case... Costs § 256.32 What documentation must be submitted to the Judgment Fund Branch to preserve the right to... preserve interest rights under 31 U.S.C. 1304. A copy of the judgment and cover letter must be sent to the...

  3. Automatic assessment of coronary artery calcium score from contrast-enhanced 256-row coronary computed tomography angiography.

    Science.gov (United States)

    Rubinshtein, Ronen; Halon, David A; Gaspar, Tamar; Lewis, Basil S; Peled, Nathan

    2014-01-01

    The coronary artery calcium score (CS), an independent predictor of cardiovascular events, can be obtained from a stand-alone nonenhanced computed tomography (CT) scan (CSCT) or as an additional nonenhanced procedure before contrast-enhanced coronary CT angiography (CCTA). We evaluated the accuracy of a novel fully automatic tool for computing CS from the CCTA examination. One hundred thirty-six consecutive symptomatic patients (aged 59 ± 11 years, 40% female) without known coronary artery disease who underwent both 256-row CSCT and CCTA were studied. Original scan reconstruction (slice thickness) was maintained (3 mm for CSCT and 0.67 mm for CCTA). CS was computed from CCTA by an automatic tool (COR Analyzer, rcadia Medical Imaging, Haifa, Israel) and compared with CS results obtained by standard assessment of nonenhanced CSCT (HeartBeat CS, Philips, Cleveland, Ohio). We also compared both methods for classification into 5 commonly used CS categories (0, 1 to 10, 11 to 100, 101 to 400, >400 Agatston units). All scans were of diagnostic quality. CS obtained by the COR Analyzer from CCTA classified 111 of 136 (82%) of patients into identical categories as CS by CSCT and 24 of remaining 25 into an adjacent category. Overall, CS values from CCTA showed high correlation with CS values from CSCT (Spearman rank correlation = 0.95, p automatically computed from 256-row CCTA correlated highly with standard CS values obtained from nonenhanced CSCT. CS obtained directly from CCTA may obviate the need for an additional scan and attendant radiation. Copyright © 2014 Elsevier Inc. All rights reserved.

  4. Effects of Walker 256 carcinoma on metabolic alterations during the evolution of pregnancy.

    Science.gov (United States)

    Cintra-Gomes, M C; Cury, L; Parreira, M R; Elias, C F; Areas, M A

    1990-01-01

    The control of pregnant cancer patients is difficult because it involves both mother and fetus, and the metabolic alterations in the cancer host induce a massive mobilization of nutrients diverted to the neoplastic cells. The purpose of the present study was to determine the evolution of the Walker 256 carcinoma in pregnant rats and its consequences on fetal development. The results showed that the tumors displayed a very rapid rate of growth and induced a reduction in fetal weights in the pregnant tumor-bearing rats. The tumor-bearing and pregnant tumor-bearing groups showed a decrease in blood glucose and total serum protein, suggesting an increase in energy utilization of these substrates and synthetic activity by the tumoral cells. An imbalance between protein synthesis and catabolism may occur in the tumor-bearing rats which may be related to the degree of nutritional depletion.

  5. Experimental Comparison of Gains in Achievable Information Rates from Probabilistic Shaping and Digital Backpropagation for DP-256QAM/1024QAM WDM Systems

    DEFF Research Database (Denmark)

    Porto da Silva, Edson; Yankov, Metodi Plamenov; Da Ros, Francesco

    2016-01-01

    Gains in achievable information rates from probabilistic shaping and digital backpropagation are compared for WDM transmission of 5 × 10 GBd DP-256QAM/1024QAM up to 1700 km of reach. The combination of both techniques its shown to provide gains of up to ∼0.5 bits/QAM symbol...

  6. Contribution of radiosensitivity study for Walker 256 tumor in rats. Association of early immunization with action of ionized radiation

    International Nuclear Information System (INIS)

    Sakate, A.T.Y.

    1979-01-01

    The suspension of tumoral cells from Walker 256 were irradiated with doses of 2.500, 4.500, 5.000, 5.500 and 7.500 rad for determining the attenuation dose. The suspension of inactives tumoral cells were injected in rats for verifying the immunized effects in relation of active Walker tumor. After be certified the growth of tumor, the rats were irradiated with cobalt 60 and was verified the decrease of tumor. (author)

  7. 73.7 Tb/s (96x3x256-Gb/s) mode-division-multiplexed DP-16QAM transmission with inline MM-EDFA

    NARCIS (Netherlands)

    Sleiffer, V.A.J.M.; Jung, Y.; Veljanovski, V.; Uden, van R.G.H.; Kuschnerov, M.; Kang, Q.; Grüner-Nielsen, L.; Sun, Y.; Richardson, D.J.; Alam, S.U.; Poletti, F.; Sahu, J.K.; Dhar, A.; Chen, H.; Inan, B.; Koonen, A.M.J.; Corbett, B.; Winfield, R.; Ellis, A.D.; Waardt, de H.

    2012-01-01

    We show transmission of a 73.7 Tb/s (96x3x256-Gb/s) DP-16QAM mode-division- multiplexed signal over 119km of few-mode fiber with inline multi-mode EDFA, using 6x6 MIMO digital signal processing. The total demonstrated net capacity is 57.6 Tb/s (SE 12 bits/s/Hz).

  8. The influence of whole-body and local irradiation modified by hyperglycemia on metastatic Walker carcinosarcoma 256 in rats

    International Nuclear Information System (INIS)

    Kutlimuratov, A.B.; Ivashkin, A.V.; Zakirkhodzhaev, U.D.

    1990-01-01

    It has been shown that the local radiation therapy, and also radiation therapy modified by the short-term hyperglycemia really increase the life-span of rats with Walker 256 carcinosarcoma. At the same time the metastatic process also increases, especially after the modified radiation therapy. The total irradiation of experimental animals in a dose of 50 sGy before the modified radiation therapy considerably decreases the frequency of metastatic process. A conclusion is drawn that the total irradiation has a prophylactic influence on metastases under conditions of modified radiation therapy

  9. Combination of advanced encryption standard 256 bits with md5 to secure documents on android smartphone

    Science.gov (United States)

    Pasaribu, Hendra; Sitanggang, Delima; Rizki Damanik, Rudolfo; Rudianto Sitompul, Alex Chandra

    2018-04-01

    File transfer by using a smartphone has some security issues like data theft by irresponsible parties. To improve the quality of data security systems on smartphones, in this research the integration of AES 256 bit algorithm by using MD5 hashing is proposed. The use of MD5 aims to increase the key strength of the encryption and decryption process of document files. The test results show that the proposed method can increase the key strength of the encryption and decryption process in the document file. Encryption and decryption time by using AES and MD5 combination is faster than using AES only on *.txt file type and reverse results for *.docx, *.xlsx, *.pptx and *.pdf file files.

  10. 256 fs, 2 nJ soliton pulse generation from MoS2 mode-locked fiber laser

    Science.gov (United States)

    Jiang, Zike; Chen, Hao; Li, Jiarong; Yin, Jinde; Wang, Jinzhang; Yan, Peiguang

    2017-12-01

    We demonstrate an Er-doped fiber laser (EDFL) mode-locked by a MoS2 saturable absorber (SA), delivering a 256 fs, 2 nJ soliton pulse at 1563.4 nm. The nonlinear property of the SA prepared by magnetron sputtering deposition (MSD) is measured with a modulation depth (MD) of ∼19.48% and a saturable intensity of 4.14 MW/cm2. To the best of our knowledge, the generated soliton pulse has the highest pulse energy of 2 nJ among the reported mode-locked EDFLs based on transition metal dichalcogenides (TMDs). Our results indicate that MSD-grown SAs could offer an exciting platform for high pulse energy and ultrashort pulse generation.

  11. Two novel variants of human medium chain acyl-CoA dehydrogenase (MCAD). K364R, a folding mutation, and R256T, a catalytic-site mutation resulting in a well-folded but totally inactive protein

    DEFF Research Database (Denmark)

    O'Reilly, Linda P; Andresen, Brage S; Engel, Paul C

    2005-01-01

    was again totally inactive. Neither mutant showed marked depletion of FAD. The pure K364R protein was considerably less thermostable than wild-type MCAD. Western blots indicated that, although the R256T mutant protein is less thermostable than normal MCAD, it is much more stable than K364R. Though......Two novel rare mutations, MCAD approximately 842G-->C (R256T) and MCAD approximately 1166A-->G (K364R), have been investigated to assess how far the biochemical properties of the mutant proteins correlate with the clinical phenotype of medium chain acyl-CoA dehydrogenase (MCAD) deficiency. When...... the gene for K364R was overexpressed in Escherichia coli, the synthesized mutant protein only exhibited activity when the gene for chaperonin GroELS was co-overexpressed. Levels of activity correlated with the amounts of native MCAD protein visible in western blots. The R256T mutant, by contrast, displayed...

  12. Low dose coronary CT angiography with 256-slice helical CT

    International Nuclear Information System (INIS)

    Zhang Xiaodong; Tang Binghang; Li Fangyun

    2011-01-01

    Objective: To compare the image quality and patient radiation dose of coronary computed tomography angiography (CCTA) received by prospectively-gated step-and-shoot (SAS) technique with those obtained by retrospectively-gated spiral ( RGS) technique on a 256-slice CT scanner. Methods: A total of 200 patients were enrolled in this study. One hundred patients underwent CCTA with SAS mode were subdivided into two groups: (1) 50 patients with an average heart rate (HR) ≤ 70 bpm were scanned with a data acquisition time window centered at the 75% of the R-R cycle (group A) and (2) 50 patients with HR > 70 bpm were scanned with the data acquisition time window centered at the 45% of the R-R cycle, including a phase tolerance of ± 5% (group B). Other 100 patients underwent CCTA with RGS mode and ECG-based tube current modulation were also subdivided into two groups: (3) 50 patients with HR ≤ 70 bpm were scanned with cardiac dose right set to phase of 75% ( group C) and (4) 50 patients with HR > 70 bpm were scanned with cardiac ose Rdight set to phases of 45% and 75% (group D). All patients were grouped in randomized order. The image quality of CCTA were evaluated using a rank scale from 1 to 4 (1: excellent; 4: non-assessable). Radiation dose of the four groups received was also estimated. The image quality between groups was compared by Mann-Whitney U test. The radiation dose between groups was compared by t test. For the 100 patients received by prospective ECG-gated CCTA, the receiver operating characteristic curve (ROC) was used to analyze the CCTA image quality and average heart rate to determine the uppercutoff of HR for obtaining diagnostic coronary images with SAS mode. A Spearman correlation analysis was also performed to analyze the correlation of HR and image quality in patients underwent CCTA with SAS mode. Results: Of 2338 coronary artery segments, excellent or good image quality (score of 1 or 2) was achieved in 96.5% (585 of 606) in group A, 77.7% (445

  13. Evaluation of image quality and radiation dose at prospective ECG-triggered axial 256-slice multi-detector CT in infants with congenital heart disease

    Energy Technology Data Exchange (ETDEWEB)

    Huang, Mei-ping; Liang, Chang-hong; Zhao, Zhen-jun; Liu, Hui; Li, Jing-lei; Zhang, Jin-e; Cui, Yan-hai; Yang, Lin; Liu, Qi-shun [Guangdong Academy of Medical Sciences, Guangdong General Hospital, Department of Radiology, Guangzhou (China); Ivanc, Thomas B.; Vembar, Mani [Philips Healthcare, CT Clinical Science, Highland Heights, OH (United States)

    2011-07-15

    There are a limited number of reports on the technical and clinical feasibility of prospective electrocardiogram (ECG)-gated multi-detector computed tomography (MDCT) in infants with congenital heart disease (CHD). To evaluate image quality and radiation dose at weight-based low-dose prospectively gated 256-slice MDCT angiography in infants with CHD. From November 2009 to February 2010, 64 consecutive infants with CHD referred for pre-operative or post-operative CT were included. All were scanned on a 256-slice MDCT system utilizing a low-dose protocol (80 kVp and 60-120 mAs depending on weight: 60 mAs for {<=}3 kg, 80 mAs for 3.1-6 kg, 100 mAs for 6.1-10 kg, 120 mAs for 10.1-15 kg). No serious adverse events were recorded. A total of 174 cardiac deformities, confirmed by surgery or heart catheterization, were studied. The sensitivity of MDCT for cardiac deformities was 97.1%; specificity, 99.4%; accuracy, 95.9%. The mean heart rate during scan was 136.7 {+-} 14.9/min (range, 91-160) with a corresponding heart rate variability of 2.8 {+-} 2.2/min (range, 0-8). Mean scan length was 115.3 {+-} 11.7 mm (range, 93.6-143.3). Mean volume CT dose index, mean dose-length product and effective dose were 2.1 {+-} 0.4 mGy (range, 1.5-2.8), 24.7 {+-} 5.9 mGy.cm (range, 14.7-35.8) and 1.6 {+-} 0.3 mSv (range, 1.1-2.5), respectively. Diagnostic-quality images were achieved in all cases. Satisfactory diagnostic quality for visualization of all/proximal/distal coronary artery segments was achieved in 88.4/98.8/80.0% of the scans. Low-dose prospectively gated axial 256-slice CT angiography is a valuable tool in the routine clinical evaluation of infants with CHD, providing a comprehensive three-dimensional evaluation of the cardiac anatomy, including the coronary arteries. (orig.)

  14. 256-slice CT coronary angiography in atrial fibrillation: The impact of mean heart rate and heart rate variability on image quality

    Energy Technology Data Exchange (ETDEWEB)

    Chen, Liang-Kuang [Department of Radiology, Shin Kong Wu Ho-Su Memorial Hospital, Taipei, Taiwan (China); College of Medicine, Fu Jen Catholic University, Taipei, Taiwan (China); Hsu, Shih-Ming [Department of Biomedical Imaging and Radiological Science, China Medical University, Taichung, Taiwan (China); Mok, Greta S.P. [Department of Electrical and Electronics Engineering, Faculty of Science and Technology, University of Macau, Macau (China); Law, Wei-Yip; Lu, Kun-Mu [Department of Radiology, Shin Kong Wu Ho-Su Memorial Hospital, Taipei, Taiwan (China); Yang, Ching-Ching, E-mail: g39220003@yahoo.com.tw [Department of Radiological Technology, Tzu Chi College of Technology, 880, Sec.2, Chien-kuo Rd. Hualien 970, Taiwan (China); Wu, Tung-Hsin, E-mail: tung@ym.edu.tw [Department of Biomedical Imaging and Radiological Sciences, National Yang Ming University, 155 Li-Nong St., Sec. 2, Taipei 112, Taiwan (China)

    2011-08-21

    Objective: The aim of this study was to evaluate the image quality of 256-MDCT in atrial fibrillation and to compare the findings with those among patients in sinus rhythm. Materials: All reconstructed images were evaluated by two independent experienced readers blinded to patient information, heart rate, and ECG results to assess the diagnostic quality of images of the coronary artery segments using axial images, multi-planar reformations, maximum intensity projections, and volume rendering technique. Results: No statistical significance was detected in terms of the overall image quality between patients in sinus rhythm and with atrial fibrillation. Pearson's correlation analysis showed no significant association between image quality and mean heart rate no matter for patients in sinus rhythm or with atrial fibrillation. Similarly, there was no correlation between image quality and heart rate variability for either patients in sinus rhythm or with atrial fibrillation. Our results showed that the optimal reconstruction window depends on patient's HR, and the pattern for patients in atrial fibrillation is similar to that obtained from non-atrial fibrillation patients. Conclusion: This study shows the potential of using 256-MDCT coronary angiography in patients with atrial fibrillation. Our results suggest that when appropriate reconstruction timing window is applied, patients with atrial fibrillation do not have to be excluded from MDCT coronary angiographic examinations.

  15. 256-slice CT coronary angiography in atrial fibrillation: The impact of mean heart rate and heart rate variability on image quality

    International Nuclear Information System (INIS)

    Chen, Liang-Kuang; Hsu, Shih-Ming; Mok, Greta S.P.; Law, Wei-Yip; Lu, Kun-Mu; Yang, Ching-Ching; Wu, Tung-Hsin

    2011-01-01

    Objective: The aim of this study was to evaluate the image quality of 256-MDCT in atrial fibrillation and to compare the findings with those among patients in sinus rhythm. Materials: All reconstructed images were evaluated by two independent experienced readers blinded to patient information, heart rate, and ECG results to assess the diagnostic quality of images of the coronary artery segments using axial images, multi-planar reformations, maximum intensity projections, and volume rendering technique. Results: No statistical significance was detected in terms of the overall image quality between patients in sinus rhythm and with atrial fibrillation. Pearson's correlation analysis showed no significant association between image quality and mean heart rate no matter for patients in sinus rhythm or with atrial fibrillation. Similarly, there was no correlation between image quality and heart rate variability for either patients in sinus rhythm or with atrial fibrillation. Our results showed that the optimal reconstruction window depends on patient's HR, and the pattern for patients in atrial fibrillation is similar to that obtained from non-atrial fibrillation patients. Conclusion: This study shows the potential of using 256-MDCT coronary angiography in patients with atrial fibrillation. Our results suggest that when appropriate reconstruction timing window is applied, patients with atrial fibrillation do not have to be excluded from MDCT coronary angiographic examinations.

  16. Micro Hard-X Ray Camera: From Caliste 64 to Caliste 256

    International Nuclear Information System (INIS)

    Meuris, A.; Limousin, O.; Le Mer, I.; Pinsard, F.; Blondel, C.; Daly, F.; Lugiez, F.; Gevin, O.; Delagnes, E.; Chavassieux, M.; Vassal, M.C.; Bocage, R.; Soufflet, F.

    2009-01-01

    Caliste project aims at hybridizing 1 cm 2 Cd(Zn)Te detectors with low noise front-end electronics, in a single component standing in a 1 * 1 * 2 cm 3 volume. The micro-camera is a spectroscopic imager for X and gamma rays detection, with time-tagging capability. Hybridization consists in stacking full custom ASICs perpendicular to the detection surface. The first prototype Caliste 64 integrates a detector of 8 * 8 pixels of 1 mm pitch. Fabrication and characterizations of nine cameras units validate the design and the hybridization concept. Spectroscopic tests result in a mean energy resolution of ∼0.7 keV FWHM at 14 keV and ∼0.85 keV FWHM at 60 keV using 1 mm-thick Al Schottky CdTe detectors biased at -400 V and cooled down to 15 degrees C. The new prototype called Caliste 256 integrates 16 * 16 pixels of 580 m pitch in the same volume as Caliste 64. Electrical tests with the first sample fabricated without detector result in a mean equivalent noise charge of 64e - rms (9.6 μs, no leakage current). Caliste devices are 4-side buttable and can be used as elementary detection units of a large hard X-ray focal plane, as for the 64 cm 2 high energy detector of the Simbol-X astronomical space mission. (authors)

  17. Morphologic classification of the right auricule on 256-slice computed tomography.

    Science.gov (United States)

    Li, Cai-Ying; Gao, Bu-Lang; Pan, Tong; Xiang, Cheng; Liu, Xiao-Wei; Yang, Hai-Qing; Yi, Lan-Ying; Liao, Qi-Bin

    2017-06-01

    To investigate the shape of right auricule on 256-slice computed tomography (CT). Five hundred people (250 men, age range 16-84 years) who had cardiac multidetector CT angiography were recruited in this study. All patients had normal sinus rhythm with normal blood pressure (right auricule was studied and compared after reconstruction of the raw images. All patients successfully had cardiac CT angiography (100%), and the right auricule morphology was divided into five types and nine subtypes, including Type I of triangular shape (Ia and Ib), Type II of M shape (IIa and IIb), Type III of L shape (IIIa and IIIb), Type IV of reverse L shape (IVa and IVb), and Type V of balanced shape. The most common type of right auricule is Type IV (28.4%) followed by Type II (24.0%), whereas the least common is Type V (11.0%). Type Ia was present significantly (P  0.05) sex difference existed in the constitution ratio of the types. The normal angle was greater in Type Ib than in Ia. The greater the normal angle in Type I, the greater the deviation of the right auricule tip towards the left. A good understanding of the right auricule anatomical morphology can better guide atrial pacing, radiofrequency ablation and other surgical procedures while preventing possible intra-procedural complications.

  18. Bax/Bcl-2 protein expression ratio and leukocyte function are related to reduction of Walker-256 tumor growth after β-hydroxy-β-methylbutyrate (HMB) administration in Wistar rats.

    Science.gov (United States)

    Kuczera, Diogo; Paro de Oliveira, Heloísa Helena; Fonseca Guimarães, Fernando de Souza; de Lima, Carina; Alves, Luciana; Machado, Andressa Franzói; Coelho, Isabela; Yamaguchi, Adriana; Donatti, Lucélia; Naliwaiko, Katya; Fernandes, Luiz Claudio; Nunes, Everson Araújo

    2012-01-01

    This study investigated the mechanisms by which β-hydroxy-β-methylbutyrate (HMB) administration in rats reduces Walker-256 tumor growth. Male Wistar rats were supplemented with HMB (76 mg/kg/day) (HW), or a placebo (W), during 8 wk by gavage. At the 6th wk, rats were inoculated with a suspension of Walker 256 tumor cells (3 × 10(7)/mL). Fifteen days after inoculation, the HW group showed higher glycemia (109.4 ± 5.53 vs. 89.87 ± 7.02 mg/dL, P HMB-treated rats displayed a 36.9% decrement in rates of proliferation ex vivo and a significant increase in the Bax/Bcl-2 protein expression ratio in comparison to those extracted from the placebo-treated rats (P HMB supplementation decreases tumor burden by modifying the inner environment of tumor cells and by interfering with blood leukocyte function.

  19. Exclusive use of arterial grafts in coronary artery bypass operations for three-vessel disease : Use of both thoracic arteries and the gastroepiploic artery in 256 consecutive patients

    NARCIS (Netherlands)

    Grandjean, JG; Voors, AA; Boonstra, PW; denHeyer, P; Ebels, T

    1996-01-01

    Methods: From September 1989 to September 1994 we operated on a consecutive group of 256 patients with three-vessel disease in whom we used the right gastroepiploic artery together with both internal thoracic arteries, Vein grafts were not used in these patients, This population consisted of 233 men

  20. Childhood history of behavioral inhibition and comorbidity status in 256 adults with social phobia.

    Science.gov (United States)

    Rotge, Jean-Yves; Grabot, Denis; Aouizerate, Bruno; Pélissolo, Antoine; Lépine, Jean-Pierre; Tignol, Jean

    2011-03-01

    Behavioral inhibition (BI), a heritable temperament, predisposes one to an increased risk of social phobia. Recent investigations have reported that BI may also be a precursor to anxiety as well as depressive and alcohol-related disorders, which are frequently comorbid with social phobia. In the present study, we explored the relationship between BI and psychiatric disorders in 256 adults with a primary diagnosis of social phobia. BI severity was retrospectively assessed with the Retrospective Self-Report of Inhibition (RSRI). The severity of social phobia and the presence of comorbid diagnoses were evaluated with the Liebowitz Social Anxiety Scale (LSAS) and the Mini-International Neuropsychiatric Interview, respectively. The RSRI score was significantly and positively correlated with both the LSAS score and the occurrence of a major depressive disorder. No significant association was found with other anxiety and substance-related disorders. The assessment of BI was retrospective and self-reported. A childhood history of BI was associated with an increased risk of depressive comorbidity in social phobia. Copyright © 2010 Elsevier B.V. All rights reserved.

  1. Optimal temporal windows and dose-reducing strategy for coronary artery bypass graft imaging with 256-slice CT

    Energy Technology Data Exchange (ETDEWEB)

    Lu, Kun-Mu [Department of Radiology, Shin Kong Wu Ho-Su Memorial Hospital, 95 Wen Chang Road, Shih Lin District, Taipei 111, Taiwan. (China); Lee, Yi-Wei [Department of Radiology, Kaohsiung Chang Gung Memorial Hospital and Chang Gung University College of Medicine, Kaohsiung, Taiwan (China); Department of Biomedical Imaging and Radiological Sciences, National Yang Ming University, Taipei, Taiwan (China); Guan, Yu-Xiang [Department of Biomedical Imaging and Radiological Sciences, National Yang Ming University, Taipei, Taiwan (China); Chen, Liang-Kuang [Department of Radiology, Shin Kong Wu Ho-Su Memorial Hospital, 95 Wen Chang Road, Shih Lin District, Taipei 111, Taiwan. (China); School of Medicine, Fu Jen Catholic University, Taipei, Taiwan (China); Law, Wei-Yip, E-mail: m002325@ms.skh.org.tw [Department of Radiology, Shin Kong Wu Ho-Su Memorial Hospital, 95 Wen Chang Road, Shih Lin District, Taipei 111, Taiwan. (China); Su, Chen-Tau, E-mail: m005531@ms.skh.org.tw [Department of Radiology, Shin Kong Wu Ho-Su Memorial Hospital, 95 Wen Chang Road, Shih Lin District, Taipei 111, Taiwan. (China); School of Medicine, Fu Jen Catholic University, Taipei, Taiwan (China)

    2013-12-11

    Objective: To determine the optimal image reconstruction windows in the assessment of coronary artery bypass grafts (CABGs) with 256-slice computed tomography (CT), and to assess their associated optimal pulsing windows for electrocardiogram-triggered tube current modulation (ETCM). Methods: We recruited 18 patients (three female; mean age 68.9 years) having mean heart rate (HR) of 66.3 beats per minute (bpm) and a heart rate variability of 1.3 bpm for this study. A total of 36 CABGs with 168 segments were evaluated, including 12 internal mammary artery (33.3%) and 24 saphenous vein grafts (66.7%). We reconstructed 20 data sets in 5%-step through 0–95% of the R–R interval. The image quality of CABGs was assessed by a 5-point scale (1=excellent to 5=non-diagnostic) for each segment (proximal anastomosis, proximal, middle, distal course of graft body, and distal anastomosis). Two reviewers discriminated optimal reconstruction intervals for each CABG segment in each temporal window. Optimal windows for ETCM were also evaluated. Results: The determined optimal systolic and diastolic reconstruction intervals could be divided into 2 groups with threshold HR=68. The determined best reconstruction intervals for low heart rate (HR<68) and high heart rate (HR>68) were 76.0±2.5% and 45.0±0% respectively. Average image quality scores were 1.7±0.6 with good inter-observer agreement (Kappa=0.79). Image quality was significantly better for saphenous vein grafts versus arterial grafts (P<0.001). The recommended windows of ETCM for low HR, high HR and all HR groups were 40–50%, 71–81% and 40–96% of R-R interval, respectively. The corresponding dose savings were about 60.8%, 58.7% and 22.7% in that order. Conclusions: We determined optimal reconstruction intervals and ETCM windows representing a good compromise between radiation and image quality for following bypass surgery using a 256-slice CT.

  2. The optimal dose reduction level using iterative reconstruction with prospective ECG-triggered coronary CTA using 256-slice MDCT

    International Nuclear Information System (INIS)

    Hou, Yang; Xu, Shu; Guo, Wenli; Vembar, Mani; Guo, Qiyong

    2012-01-01

    Aim: To assess the image quality (IQ) of an iterative reconstruction (IR) technique (iDose 4 ) from prospective electrocardiography (ECG)-triggered coronary computed tomography angiography (coronary CTA) on a 256-slice multi-detector CT (MDCT) scanner and determine the optimal dose reduction using IR that can provide IQ comparable to filtered back projection (FBP). Method and materials: 110 consecutive patients (69 men, 41 women; age: 54 ± 10 years) underwent coronary CTA on a 256-slice MDCT (Brilliance iCT, Philips Healthcare). The control group (Group A, n = 21) were scanned using the conventional tube output (120 kVp, 210 mAs) and reconstructed using FBP. The other 4 groups were scanned with the same kVp but successively reduced tube output as follows: B[n = 15]: 125 mAs; C[n = 22]: 105 mAs; D[n = 36]: 84 mAs: E[n = 16]: 65 mAs) and reconstructed using IR levels of L3 (Group B), L4 (Group C) and L5 (Groups D and E), to compensate for the noise increase. All images were reconstructed using the same kernel (XCB). Two radiologists graded IQ in a blinded fashion on a 4-point scale (4 – excellent, 3 – good, 2 – fair and 1 – poor). Quantitative measurements of CT values, image noise and contrast-to-noise (CNR) were measured in each group. A receiver-operating characteristic (ROC) analysis was performed to determine a radiation reduction threshold up to which excellent IQ was maintained. Results: There were no significant differences in objective noise, SNR and CNR values among Groups A, B, C, D, and E (P = 0.14, 0.09, 0.17, respectively). There were no significant differences in the scores of the subjective IQ between Group A, and Groups B, C, D, E (P = 0.23–0.97). Significant differences in image sharpness and study acceptability were observed between groups A and E (P < 0.05). Using the criterion of excellent IQ (score 4), the ROC curve of dose levels and IQ acceptability established a reduction of 60% of tube output (Group D) as optimum cutoff point (AUC

  3. Resistance exercise attenuates skeletal muscle oxidative stress, systemic pro-inflammatory state, and cachexia in Walker-256 tumor-bearing rats.

    Science.gov (United States)

    Padilha, Camila Souza; Borges, Fernando Henrique; Costa Mendes da Silva, Lilian Eslaine; Frajacomo, Fernando Tadeu Trevisan; Jordao, Alceu Afonso; Duarte, José Alberto; Cecchini, Rubens; Guarnier, Flávia Alessandra; Deminice, Rafael

    2017-09-01

    The aim of this study was to investigate the effects of resistance exercise training (RET) on oxidative stress, systemic inflammatory markers, and muscle wasting in Walker-256 tumor-bearing rats. Male (Wistar) rats were divided into 4 groups: sedentary controls (n = 9), tumor-bearing (n = 9), exercised (n = 9), and tumor-bearing exercised (n = 10). Exercised and tumor-bearing exercised rats were exposed to resistance exercise of climbing a ladder apparatus with weights tied to their tails for 6 weeks. The physical activity of control and tumor-bearing rats was confined to the space of the cage. After this period, tumor-bearing and tumor-bearing exercised animals were inoculated subcutaneously with Walker-256 tumor cells (11.0 × 10 7 cells in 0.5 mL of phosphate-buffered saline) while control and exercised rats were injected with vehicle. Following inoculation, rats maintained resistance exercise training (exercised and tumor-bearing exercised) or sedentary behavior (control and tumor-bearing) for 12 more days, after which they were euthanized. Results showed muscle wasting in the tumor-bearing group, with body weight loss, increased systemic leukocytes, and inflammatory interleukins as well as muscular oxidative stress and reduced mTOR signaling. In contrast, RET in the tumor-bearing exercised group was able to mitigate the reduced body weight and muscle wasting with the attenuation of muscle oxidative stress and systemic inflammatory markers. RET also prevented loss of muscle strength associated with tumor development. RET, however, did not prevent the muscle proteolysis signaling via FBXO32 gene messenger RNA expression in the tumor-bearing group. In conclusion, RET performed prior tumor implantation prevents cachexia development by attenuating tumor-induced systemic pro-inflammatory condition with muscle oxidative stress and muscle damage.

  4. Characterization and optimization of a high-efficiency AlGaAs-On-Insulator-based wavelength converter for 64- and 256-QAM signals

    DEFF Research Database (Denmark)

    Da Ros, Francesco; Yankov, Metodi Plamenov; Porto da Silva, Edson

    2017-01-01

    of the wavelength converter is reported, including the optimization of the AlGaAsOI nano-waveguide in terms of conversion efficiency and associated bandwidth and the analysis of the impact of the converter pump quality and power as well as the signal input power. The optimized converter enables generating idlers......In this paper, we demonstrate wavelength conversion of advanced modulation formats such as 10-GBd 64-QAM and 256-QAM with high conversion efficiency over a 29-nm spectral window by using four-wave mixing in an AlGaAs-On-Insulator (AlGaAsOI) nano-waveguide. A thorough characterization...

  5. Microwave hyperthermia as an adjuvant to radiation therapy. Summary experience of 256 multifraction treatment cases

    International Nuclear Information System (INIS)

    Bicher, H.I.

    1985-01-01

    Analysis is presented of a series of 256 human tumors treated under multifraction protocol regimes with standard controlled hyperthermia parameters and increasing doses of radiation therapy. Air cooled microwave applicators intracavitary and interstitial antennae operating at 915 or 300 MHz were used in various sites. Temperatures were measured by micro-thermocouples. Minimum tumor temperatures of 42 0 C were maintained at 1 hour, twice weekly. Treatment included a radiation dose of 1600-1700 rads. Tumor response was 94% with 60% or more total response. Frequency and duration of total responses depended mainly on the radiation dose. Skin tumors, melanomas, chest wall recurrences responded better than head and neck or intrapelvic recurrences. Side effects observed were minor burns; proctitis or oesophagitis with intracavitary devices; ulcerations or fistulae due to rapid tumor regression; 4 cases of pleuritis treating chest wall. Overall toxicity was less than 5%. In conclusion: 1) Combination heat-low dose radiation offers good palliation. 2) Response depends on radiation dose. 3) Combination of full dose radiation therapy plus hyperthermia proves to be well tolerated

  6. Cryogenic on-chip multiplexer for the study of quantum transport in 256 split-gate devices

    International Nuclear Information System (INIS)

    Al-Taie, H.; Kelly, M. J.; Smith, L. W.; Xu, B.; Griffiths, J. P.; Beere, H. E.; Jones, G. A. C.; Ritchie, D. A.; Smith, C. G.; See, P.

    2013-01-01

    We present a multiplexing scheme for the measurement of large numbers of mesoscopic devices in cryogenic systems. The multiplexer is used to contact an array of 256 split gates on a GaAs/AlGaAs heterostructure, in which each split gate can be measured individually. The low-temperature conductance of split-gate devices is governed by quantum mechanics, leading to the appearance of conductance plateaux at intervals of 2e 2 /h. A fabrication-limited yield of 94% is achieved for the array, and a “quantum yield” is also defined, to account for disorder affecting the quantum behaviour of the devices. The quantum yield rose from 55% to 86% after illuminating the sample, explained by the corresponding increase in carrier density and mobility of the two-dimensional electron gas. The multiplexer is a scalable architecture, and can be extended to other forms of mesoscopic devices. It overcomes previous limits on the number of devices that can be fabricated on a single chip due to the number of electrical contacts available, without the need to alter existing experimental set ups

  7. Quantitative assessment of right ventricular function and pulmonary regurgitation in surgically repaired tetralogy of Fallot using 256-slice CT: comparison with 3-Tesla MRI

    Energy Technology Data Exchange (ETDEWEB)

    Yamasaki, Yuzo; Yonezawa, Masato; Matsuo, Yoshio; Kamitani, Takeshi; Higuchi, Ko; Honda, Hiroshi [Graduate School of Medical Sciences, Kyushu University, Department of Clinical Radiology, Higashi-ku, Fukuoka (Japan); Nagao, Michinobu; Kawanami, Satoshi [Graduate School of Medical Sciences, Kyushu University, Department of Molecular Imaging and Diagnosis, Higashi-ku, Fukuoka (Japan); Yamamura, Kenichiro [Graduate School of Medical Sciences, Kyushu University, Department of Pediatrics, Higashi-ku, Fukuoka (Japan); Sakamoto, Ichiro [Graduate School of Medical Sciences, Kyushu University, Department of Cardiovascular Medicine, Higashi-ku, Fukuoka (Japan); Shiokawa, Yuichi [Graduate School of Medical Sciences, Kyushu University, Department of Cardiovascular Surgery, Higashi-ku, Fukuoka (Japan); Yabuuchi, Hidetake [Graduate School of Medical Sciences, Kyushu University, Department of Health Sciences, Higashi-ku, Fukuoka (Japan)

    2014-12-15

    To compare 256-slice cardiac computed tomography (CCT) with cardiac magnetic resonance (CMR) imaging to assess right ventricular (RV) function and pulmonary regurgitant fraction (PRF) in patients with repaired tetralogy of Fallot (TOF). Thirty-three consecutive patients with repaired TOF underwent retrospective ECG-gated CCT and 3-Tesla CMR. RV and left ventricular (LV) end-diastolic volume (EDV), end-systolic volume (ESV), stroke volume (SV) and ejection fraction (EF) were measured using CCT and CMR. PRF-CCT (%) was defined as (RVSV - LVSV)/RVSV. PRF-CMR (%) was measured by the phase-contrast method. Repeated measurements were performed to determine intra- and interobserver variability. CCT measurements, including PRF, correlated highly with the CMR reference (r = 0.71-0.96). CCT overestimated RVEDV (mean difference, 17.1 ± 2.9 ml), RVESV (12.9 ± 2.1 ml) and RVSV (4.2 ± 2.0 ml), and underestimated RVEF (-2.6 ± 1.0 %) and PRF (-9.1 ± 2.0 %) compared with CMR. The limits of agreement between CCT and CMR were in a good range for all measurements. The variability in CCT measurements was lower than those in CMR. The estimated effective radiation dose was 7.6 ± 2.6 mSv. 256-slice CCT can assess RV function and PRF with relatively low dose radiation exposure in patients with repaired TOF, but overestimates RV volume and underestimates PRF. (orig.)

  8. Quantitative assessment of right ventricular function and pulmonary regurgitation in surgically repaired tetralogy of Fallot using 256-slice CT: comparison with 3-Tesla MRI

    International Nuclear Information System (INIS)

    Yamasaki, Yuzo; Yonezawa, Masato; Matsuo, Yoshio; Kamitani, Takeshi; Higuchi, Ko; Honda, Hiroshi; Nagao, Michinobu; Kawanami, Satoshi; Yamamura, Kenichiro; Sakamoto, Ichiro; Shiokawa, Yuichi; Yabuuchi, Hidetake

    2014-01-01

    To compare 256-slice cardiac computed tomography (CCT) with cardiac magnetic resonance (CMR) imaging to assess right ventricular (RV) function and pulmonary regurgitant fraction (PRF) in patients with repaired tetralogy of Fallot (TOF). Thirty-three consecutive patients with repaired TOF underwent retrospective ECG-gated CCT and 3-Tesla CMR. RV and left ventricular (LV) end-diastolic volume (EDV), end-systolic volume (ESV), stroke volume (SV) and ejection fraction (EF) were measured using CCT and CMR. PRF-CCT (%) was defined as (RVSV - LVSV)/RVSV. PRF-CMR (%) was measured by the phase-contrast method. Repeated measurements were performed to determine intra- and interobserver variability. CCT measurements, including PRF, correlated highly with the CMR reference (r = 0.71-0.96). CCT overestimated RVEDV (mean difference, 17.1 ± 2.9 ml), RVESV (12.9 ± 2.1 ml) and RVSV (4.2 ± 2.0 ml), and underestimated RVEF (-2.6 ± 1.0 %) and PRF (-9.1 ± 2.0 %) compared with CMR. The limits of agreement between CCT and CMR were in a good range for all measurements. The variability in CCT measurements was lower than those in CMR. The estimated effective radiation dose was 7.6 ± 2.6 mSv. 256-slice CCT can assess RV function and PRF with relatively low dose radiation exposure in patients with repaired TOF, but overestimates RV volume and underestimates PRF. (orig.)

  9. Is there any influence of breastfeeding on the cerebral blood flow? A review of 256 healthy newborns

    Directory of Open Access Journals (Sweden)

    Alexandra Maria Vieira Monteiro

    2012-10-01

    Full Text Available OBJECTIVE: To investigate whether breastfeeding influence the cerebral blood-flow velocity. MATERIALS AND METHODS: The present study included 256 healthy term neonates, all of them with appropriate weight for gestational age, 50.8% being female. Pulsatility index, resistance index and mean velocity were measured during breastfeeding or resting in the anterior cerebral artery, in the left middle cerebral artery, and in the right middle cerebral artery of the neonates between their first 10 and 48 hours of life. The data were analyzed by means of a paired t-test, Brieger's f-test for analysis of variance and linear regression, with p < 0.01 being accepted as statistically significant. RESULTS: Mean resistance index decreased as the mean velocity increased significantly during breastfeeding. Pulsatility index values decreased as much as the resistance index, but in the right middle cerebral artery it was not statistically significant. CONCLUSION: Breastfeeding influences the cerebral blood flow velocities.

  10. Design, synthesis and evaluation of novel 2,5,6-trisubstituted benzimidazoles targeting FtsZ as antitubercular agents.

    Science.gov (United States)

    Park, Bora; Awasthi, Divya; Chowdhury, Soumya R; Melief, Eduard H; Kumar, Kunal; Knudson, Susan E; Slayden, Richard A; Ojima, Iwao

    2014-05-01

    Filamenting temperature-sensitive protein Z (FtsZ), an essential cell division protein, is a promising target for the drug discovery of new-generation antibacterial agents against various bacterial pathogens. As a part of SAR studies on benzimidazoles, we have synthesized a library of 376 novel 2,5,6-trisubstituted benzimidazoles, bearing ether or thioether linkage at the 6-position. In a preliminary HTP screening against Mtb H37Rv, 108 compounds were identified as hits at a cut off concentration of 5 μg/mL. Among those hits, 10 compounds exhibited MIC values in the range of 0.63-12.5 μg/mL. Light scattering assay and TEM analysis with the most potent compound 5a clearly indicate that its molecular target is Mtb-FtsZ. Also, the Kd of 5a with Mtb-FtsZ was determined to be 1.32 μM. Copyright © 2014 Elsevier Ltd. All rights reserved.

  11. Tumor growth reduction is regulated at the gene level in Walker 256 tumor-bearing rats supplemented with fish oil rich in EPA and DHA

    Energy Technology Data Exchange (ETDEWEB)

    Borghetti, G.; Yamazaki, R.K.; Coelho, I.; Pequito, D.C.T.; Schiessel, D.L.; Kryczyk, M.; Mamus, R.; Naliwaiko, K.; Fernandes, L.C. [Departamento de Fisiologia, Setor de Ciências Biológicas, Universidade Federal do Paraná, Curitiba, PR (Brazil)

    2013-08-23

    We investigated the effect of fish oil (FO) supplementation on tumor growth, cyclooxygenase 2 (COX-2), peroxisome proliferator-activated receptor gamma (PPARγ), and RelA gene and protein expression in Walker 256 tumor-bearing rats. Male Wistar rats (70 days old) were fed with regular chow (group W) or chow supplemented with 1 g/kg body weight FO daily (group WFO) until they reached 100 days of age. Both groups were then inoculated with a suspension of Walker 256 ascitic tumor cells (3×10{sup 7} cells/mL). After 14 days the rats were killed, total RNA was isolated from the tumor tissue, and relative mRNA expression was measured using the 2{sup -ΔΔCT} method. FO significantly decreased tumor growth (W=13.18±1.58 vs WFO=5.40±0.88 g, P<0.05). FO supplementation also resulted in a significant decrease in COX-2 (W=100.1±1.62 vs WFO=59.39±5.53, P<0.001) and PPARγ (W=100.4±1.04 vs WFO=88.22±1.46, P<0.05) protein expression. Relative mRNA expression was W=1.06±0.022 vs WFO=0.31±0.04 (P<0.001) for COX-2, W=1.08±0.02 vs WFO=0.52±0.08 (P<0.001) for PPARγ, and W=1.04±0.02 vs WFO=0.82±0.04 (P<0.05) for RelA. FO reduced tumor growth by attenuating inflammatory gene expression associated with carcinogenesis.

  12. Individualized radiation dose control in 256-slice CT coronary angiography (CTCA) in retrospective ECG-triggered helical scans: Using a measure of body size to adjust tube current selection

    Energy Technology Data Exchange (ETDEWEB)

    Li, Jing-Lei, E-mail: lijinglei80@126.com [Department of Radiology, Guangdong Academy of Medical Sciences, Guangdong General Hospital, 106 Zhongshan Er Road, Guangzhou 510080 (China); Huang, Mei-Ping, E-mail: huang_meiping@yahoo.com.cn [Department of Radiology, Guangdong Academy of Medical Sciences, Guangdong General Hospital, 106 Zhongshan Er Road, Guangzhou 510080 (China); Liang, Chang-Hong, E-mail: cjr.lchh@vip.163.com [Department of Radiology, Guangdong Academy of Medical Sciences, Guangdong General Hospital, 106 Zhongshan Er Road, Guangzhou 510080 (China); Zhao, Zhen-Jun, E-mail: junabc2006@hotmail.com [Department of Radiology, Guangdong Academy of Medical Sciences, Guangdong General Hospital, 106 Zhongshan Er Road, Guangzhou 510080 (China); Liu, Hui, E-mail: liuhuijiujiu@gmail.com [Department of Radiology, Guangdong Academy of Medical Sciences, Guangdong General Hospital, 106 Zhongshan Er Road, Guangzhou 510080 (China); Cui, Yan-Hai, E-mail: yanhai_cui@126.com [Department of Radiology, Guangdong Academy of Medical Sciences, Guangdong General Hospital, 106 Zhongshan Er Road, Guangzhou 510080 (China); Liu, Qi-Shun, E-mail: liuqishun@yeah.net [Department of Radiology, Guangdong Academy of Medical Sciences, Guangdong General Hospital, 106 Zhongshan Er Road, Guangzhou 510080 (China); Zhang, Jin-E., E-mail: zhjine@yahoo.com.cn [Department of Radiology, Guangdong Academy of Medical Sciences, Guangdong General Hospital, 106 Zhongshan Er Road, Guangzhou 510080 (China); Yang, Lin, E-mail: yanglin001517@163.com [Department of Radiology, Guangdong Academy of Medical Sciences, Guangdong General Hospital, 106 Zhongshan Er Road, Guangzhou 510080 (China); Ivanc, Thomas B., E-mail: Thomas.ivanc@philips.com [CT Clinical Science, Philips Healthcare, Highland Heights, OH (United States); Yanof, Jeffrey H., E-mail: Jeffrey.yanof@philips.com [CT Clinical Science, Philips Healthcare, Highland Heights, OH (United States)

    2012-11-15

    Purpose: To reduce radiation dose for retrospective ECG-triggered helical 256-slice CTCA by determining an optimal body size index to prospectively adjust tube current. Methods: 102 consecutive patients with suspected CAD underwent retrospective ECG-triggered CTCA using 256-slice CT scanner. Six body size indexes including BMI, nipple level (NL) bust, thoracic anteroposterior diameter at NL, chest circumference (CC) at NL, left main and right coronary artery (RCA) origin level were measured and their correlation with noise was evaluated using linear regression. An equation was developed to use this index to adjust tube current. Additional 102 consecutive patients were scanned with the index-based mA s adjustment. A t-test for independent samples was used to compare radiation dose levels with and without the index-based mA s selection method. Results: Linear regression indicated that CC RCA had the best correlation with noise (R{sup 2} = 0.603). Effective radiation dose was reduced from 16.6 {+-} 0.9 to 9.8 {+-} 2.7 mSv (p < 0.01), i.e. 40.9% lower dose with the CC RCA-adapted tube current method. The image quality scores indicated no significant difference with and without the size-based mA s selection method. Conclusion: An accessible measure of body size, such as CC RCA, can be used to adapt tube current for individualized radiation dose control.

  13. Individualized radiation dose control in 256-slice CT coronary angiography (CTCA) in retrospective ECG-triggered helical scans: Using a measure of body size to adjust tube current selection

    International Nuclear Information System (INIS)

    Li, Jing-Lei; Huang, Mei-Ping; Liang, Chang-Hong; Zhao, Zhen-Jun; Liu, Hui; Cui, Yan-Hai; Liu, Qi-Shun; Zhang, Jin-E.; Yang, Lin; Ivanc, Thomas B.; Yanof, Jeffrey H.

    2012-01-01

    Purpose: To reduce radiation dose for retrospective ECG-triggered helical 256-slice CTCA by determining an optimal body size index to prospectively adjust tube current. Methods: 102 consecutive patients with suspected CAD underwent retrospective ECG-triggered CTCA using 256-slice CT scanner. Six body size indexes including BMI, nipple level (NL) bust, thoracic anteroposterior diameter at NL, chest circumference (CC) at NL, left main and right coronary artery (RCA) origin level were measured and their correlation with noise was evaluated using linear regression. An equation was developed to use this index to adjust tube current. Additional 102 consecutive patients were scanned with the index-based mA s adjustment. A t-test for independent samples was used to compare radiation dose levels with and without the index-based mA s selection method. Results: Linear regression indicated that CC RCA had the best correlation with noise (R 2 = 0.603). Effective radiation dose was reduced from 16.6 ± 0.9 to 9.8 ± 2.7 mSv (p < 0.01), i.e. 40.9% lower dose with the CC RCA-adapted tube current method. The image quality scores indicated no significant difference with and without the size-based mA s selection method. Conclusion: An accessible measure of body size, such as CC RCA, can be used to adapt tube current for individualized radiation dose control.

  14. Synthesis, radiolabeling and baboon SPECT imaging of 2β-carbomethoxy-3β-(3'-[123I]iodophenyl)tropane ([123I]YP256) as a serotonin transporter radiotracer

    International Nuclear Information System (INIS)

    Bois, Frederic; Baldwin, Ronald M.; Amici, Louis; Al-Tikriti, Mohammed S.; Kula, Nora; Baldessarini, Ross; Innis, Robert B.; Staley, Julie K.; Tamagnan, Gilles D.

    2008-01-01

    To develop a potential SPECT probe to evaluate the integrity of the serotoninergic system (5-HTT) whose dysfunction is linked to several disease conditions such as Parkinson's disease, Alzheimer's disease and depression, we report the synthesis, radiolabeling and in vivo baboon imaging of 2β-carbomethoxy-3β-(3'-[ 123 I]iodophenyl) tropane (YP256, ). The radiolabeling was performed by iododestannylation using sodium [ 123 I]iodide and peracetic acid. Although the ligand displayed high selectivity for 5-HTT over dopamine transporter in vitro, SPECT imaging in baboons did not reveal selective 5-HTT accumulation in brain in vivo

  15. Effect of x-irradiation in rats bearing walker-256-carcinosarcoma and normal rats

    International Nuclear Information System (INIS)

    Ehara, Kazuhiko

    1978-01-01

    Serum protein fractions and total proteins were studied with bloods obtained from the rats exposed each to the partial-, whole-bodies and the transplanted tumors (Walker-256-carcinosarcoma transplanted in the right hind leg). The electrophoretic variation induced in the sera of tumor-bearing rats (Group II), and the content of total proteins decreased. Early irradiation to the tumor part of rats less induced the variations of the electrophoretic pattern and the decrease of the amount of serum total proteins. When the distant metastasis appeared during irradiation treatment, the electrophoretic patterns and content of total proteins changed proportionally to the variation in sera of Group II. On the other hand, the γ-globulin (G) fraction increased in the long-term survival rat. The separation of the rat serum β-G into two peaks of β 1 - and β 2 -G was shown only in Group IV (late irradiation to the right hind leg). This finding supposed that some factors involve in the sera of rats with transplanted primary tumor grown up to a fixed size and guessed the appearance of the distant metastasis during x-irradiation. The percentages of the albumin and γ-G decreased slightly and those of the α 1 -, α 2 - and β-G increased slightly in the rats with 300 rad partial-body (the right hind leg) x-irradiation daily for 20 days. The remarkable decrease of the albumin and γ-G, the increase of the α 1 - and β-G, the marked increase of the α 2 -G and the decrease of serum total proteins were demonstrated for the sera of rats with 1,000 rad whole-body x-irradiation at a time. These phenomena seem to be related to the destructive and reticuloendothelial injury by the exposure. (auth.)

  16. A reconfigurable on-line learning spiking neuromorphic processor comprising 256 neurons and 128K synapses.

    Science.gov (United States)

    Qiao, Ning; Mostafa, Hesham; Corradi, Federico; Osswald, Marc; Stefanini, Fabio; Sumislawska, Dora; Indiveri, Giacomo

    2015-01-01

    Implementing compact, low-power artificial neural processing systems with real-time on-line learning abilities is still an open challenge. In this paper we present a full-custom mixed-signal VLSI device with neuromorphic learning circuits that emulate the biophysics of real spiking neurons and dynamic synapses for exploring the properties of computational neuroscience models and for building brain-inspired computing systems. The proposed architecture allows the on-chip configuration of a wide range of network connectivities, including recurrent and deep networks, with short-term and long-term plasticity. The device comprises 128 K analog synapse and 256 neuron circuits with biologically plausible dynamics and bi-stable spike-based plasticity mechanisms that endow it with on-line learning abilities. In addition to the analog circuits, the device comprises also asynchronous digital logic circuits for setting different synapse and neuron properties as well as different network configurations. This prototype device, fabricated using a 180 nm 1P6M CMOS process, occupies an area of 51.4 mm(2), and consumes approximately 4 mW for typical experiments, for example involving attractor networks. Here we describe the details of the overall architecture and of the individual circuits and present experimental results that showcase its potential. By supporting a wide range of cortical-like computational modules comprising plasticity mechanisms, this device will enable the realization of intelligent autonomous systems with on-line learning capabilities.

  17. Digital electronics for 256 anode Hamamatsu H9500 PSPMT arrays in full-volume Compton imagers

    International Nuclear Information System (INIS)

    Harris, J T; Grudberg, P M; Warburton, W K

    2014-01-01

    Ziock et al.'s [1] recent Monte Carlo study of a proposed ''full-volume'' Compton Imaging Camera concluded that simultaneously locating a Compton scatter event's multiple interaction points within a single large scintillator crystal might be possible at 1 mm spatial resolution using a coded aperture mask sandwiched between two light guides and coupled to a position sensitive photomultiplier (PSPMT) to record the output light pattern. The method promises high efficiency at a relatively low cost. They are currently developing a lower resolution prototype using a large cubic scintillator (25.4 cm/side) whose masked face will be tiled with 25 Hamamatsu H9500 PSPMTs (6,400 outputs). XIA has contracted to develop and produce the readout electronics, which present several significant design challenges, including capturing all 6,400 anode outputs individually, with single photon sensitivity, in a compact format that will fit behind the tiled PSPMTs. 10,000 event/sec operation is desired, as is a cost of less than about $50/channel. In our approach, each PSPMT front end integrates the 256 anode signals and 8-1 multiplexes them to 32 differential outputs that are digitized in a PXI card using 4 octal 50 MHz ADCs. The multiplexers run at 8 MHz, sampling each anode at 1 MHz, which becomes the image frame rate. The ADC signals are demultiplexed and digitally filtered to extract the number of photons in each pixel in the full 2-D image. The design has been completed and built and is undergoing evaluation tests at the single PSPMT level

  18. Clinical application of ECG-gated 256-slice CT angiography for diagnosis of congenital heart disease

    International Nuclear Information System (INIS)

    Tian Xinhua; Liu Jianhua; Gong Tingting; Geng Lili; Sun Yong

    2011-01-01

    Objective: To investigate the clinical application of ECG-gated 256-slice CT angiography for diagnosis of congenital heart disease, and to evaluate the relationship of the image quality and radiation dose between prospective ECG-gated and retrospective ECG-gated cardiac CT angiography (CTA). Methods: Sixty patients who doubt congenital heart disease underwent cardiac CTA, and they were randomly divided into two groups. Thirty patients in group A underwent prospective ECG-gated cardiac CTA, and thirty patients in group B underwent retrospective ECG-gated cardiac CTA. Then the homogeneous enhancement of vascular structures, stair-step artifact, overall image quality and radiation dose were evaluated. Results: The homogeneous enhancement of vascular structures were 2.8±0.3 and 2.7±0.6, respectively, in two groups; and there was no statistical significance (P>0.05). The stair-step artifact were 3.0±0.9 and 3.1±0.9, respectively, in two groups; and there was also no statistical significance (P>0.05). The overall image quality were 3.0±0.8 and 3.1±0.9, respectively, in two group; and there was statistical significance (P>0.05). However, the effective dose were (5.24±0.52) mSv and (16.68±1.49) mSv, respectively, in two groups; and there was statistical significance (P<0.001). Conclusion: Compared with retrospective ECG-gated cardiac CTA, prospective ECG-gated cardiac CTA can reduce radiation dose about 68.6% , while maintaining the image quality which could be made diagnosis. (authors)

  19. Necroptosis mediates the antineoplastic effects of the soluble fraction of polysaccharide from red wine in Walker-256 tumor-bearing rats.

    Science.gov (United States)

    Stipp, Maria Carolina; Bezerra, Iglesias de Lacerda; Corso, Claudia Rita; Dos Reis Livero, Francislaine A; Lomba, Luiz Alexandre; Caillot, Adriana Rute Cordeiro; Zampronio, Aleksander Roberto; Queiroz-Telles, José Ederaldo; Klassen, Giseli; Ramos, Edneia A S; Sassaki, Guilherme Lanzi; Acco, Alexandra

    2017-03-15

    Polysaccharides are substances that modify the biological response to several stressors. The present study investigated the antitumor activity of the soluble fraction of polysaccharides (SFP), extracted from cabernet franc red wine, in Walker-256 tumor-bearing rats. The monosaccharide composition had a complex mixture, suggesting the presence of arabinoglactans, mannans, and pectins. Treatment with SFP (30 and 60mg/kg, oral) for 14days significantly reduced the tumor weight and volume compared with controls. Treatment with 60mg/kg SFP reduced blood monocytes and neutrophils, reduced the tumor activity of N-acetylglucosaminidase, myeloperoxidase, and nitric oxide, increased blood lymphocytes, and increased the levels of tumor necrosis factor α (TNF-α) in tumor tissue. Treatment with SFP also induced the expression of the cell necroptosis-related genes Rip1 and Rip3. The antineoplastic effect of SFP appears to be attributable to its action on the immune system by controlling the tumor microenvironment and stimulating TNF-α production, which may trigger the necroptosis pathway. Copyright © 2016 Elsevier Ltd. All rights reserved.

  20. A Re-configurable On-line Learning Spiking Neuromorphic Processor comprising 256 neurons and 128K synapses

    Directory of Open Access Journals (Sweden)

    Ning eQiao

    2015-04-01

    Full Text Available Implementing compact, low-power artificial neural processing systems with real-time on-line learning abilities is still an open challenge. In this paper we present a full-custom mixed-signal VLSI device with neuromorphic learning circuits that emulate the biophysics of real spiking neurons and dynamic synapses for exploring the properties of computational neuroscience models and for building brain-inspired computing systems. The proposed architecture allows the on-chip configuration of a wide range of network connectivities, including recurrent and deep networks with short-term and long-term plasticity. The device comprises 128 K analog synapse and 256 neuron circuits with biologically plausible dynamics and bi-stable spike-based plasticity mechanisms that endow it with on-line learning abilities. In addition to the analog circuits, the device comprises also asynchronous digital logic circuits for setting different synapse and neuron properties as well as different network configurations. This prototype device, fabricated using a 180 nm 1P6M CMOS process, occupies an area of 51.4 mm 2 , and consumes approximately 4 mW for typical experiments, for example involving attractor networks. Here we describe the details of the overall architecture and of the individual circuits and present experimental results that showcase its potential. By supporting a wide range of cortical-like computational modules comprising plasticity mechanisms, this device will enable the realization of intelligent autonomous systems with on-line learning capabilities.

  1. On-chip gradient generation in 256 microfluidic cell cultures: simulation and experimental validation.

    Science.gov (United States)

    Somaweera, Himali; Haputhanthri, Shehan O; Ibraguimov, Akif; Pappas, Dimitri

    2015-08-07

    A microfluidic diffusion diluter was used to create a stable concentration gradient for dose response studies. The microfluidic diffusion diluter used in this study consisted of 128 culture chambers on each side of the main fluidic channel. A calibration method was used to find unknown concentrations with 12% error. Flow rate dependent studies showed that changing the flow rates generated different gradient patterns. Mathematical simulations using COMSOL Multi-physics were performed to validate the experimental data. The experimental data obtained for the flow rate studies agreed with the simulation results. Cells could be loaded into culture chambers using vacuum actuation and cultured for long times under low shear stress. Decreasing the size of the culture chambers resulted in faster gradient formation (20 min). Mass transport into the side channels of the microfluidic diffusion diluter used in this study is an important factor in creating the gradient using diffusional mixing as a function of the distance. To demonstrate the device's utility, an H2O2 gradient was generated while culturing Ramos cells. Cell viability was assayed in the 256 culture chambers, each at a discrete H2O2 concentration. As expected, the cell viability for the high concentration side channels increased (by injecting H2O2) whereas the cell viability in the low concentration side channels decreased along the chip due to diffusional mixing as a function of distance. COMSOL simulations were used to identify the effective concentration of H2O2 for cell viability in each side chamber at 45 min. The gradient effects were confirmed using traditional H2O2 culture experiments. Viability of cells in the microfluidic device under gradient conditions showed a linear relationship with the viability of the traditional culture experiment. Development of the microfluidic device used in this study could be used to study hundreds of concentrations of a compound in a single experiment.

  2. Four-dimensional measurement of intrafractional respiratory motion of pancreatic tumors using a 256 multi-slice CT scanner

    International Nuclear Information System (INIS)

    Mori, Shinichiro; Hara, Ryusuke; Yanagi, Takeshi; Sharp, Gregory C.; Kumagai, Motoki; Asakura, Hiroshi; Kishimoto, Riwa; Yamada, Shigeru; Kandatsu, Susumu; Kamada, Tadashi

    2009-01-01

    Purpose: To quantify pancreas and pancreatic tumor movement due to respiratory motion using volumetric cine CT images. Materials and methods: Six patients with pancreatic tumors were scanned in cine mode with a 256 multi-slice CT scanner under free breathing conditions. Gross tumor volume (GTV) and pancreas were manually contoured on the CT data set by a radiation oncologist. Intrafractional respiratory movement of the GTV and pancreas was calculated, and the results were compared between the respiratory ungated and gated phases, which is a 30% duty cycle around exhalation. Results: Respiratory-induced organ motion was observed mainly in the anterior abdominal side than the posterior side. Average GTV displacement (ungated/gated phases) was 0.7 mm/0.2 mm in both the left and right directions, and 2.5 mm/0.9 mm in the anterior, 0.1 mm/0 mm in the posterior, and 8.9 mm/2.6 mm in the inferior directions. Average pancreas center of mass displacement relative to that at peak exhalation was mainly in the inferior direction, at 9.6 mm in the ungated phase and 2.3 mm in the gated phase. Conclusions: By allowing accurate determination of the margin, quantitative analysis of tumor and pancreas displacement provides useful information in treatment planning in all radiation approaches for pancreatic tumors.

  3. Optimization of polyhydroxybutyrate production by Bacillus sp. CFR 256 with corn steep liquor as a nitrogen source.

    Science.gov (United States)

    Vijayendra, S V N; Rastogi, N K; Shamala, T R; Anil Kumar, P K; Kshama, L; Joshi, G J

    2007-06-01

    Polyhydroxyalkanotes (PHAs), the eco-friendly biopolymers produced by many bacteria, are gaining importance in curtailing the environmental pollution by replacing the non-biodegradable plastics derived from petroleum. The present study was carried out to economize the polyhydroxybutyrate (PHB) production by optimizing the fermentation medium using corn steep liquor (CSL), a by-product of starch processing industry, as a cheap nitrogen source, by Bacillus sp. CFR 256. Response surface methodology (RSM) was used to optimize the fermentation medium using the variables such as corn steep liquor (5-25 g l(-1)), Na(2)HPO(4) 2H(2)O (2.2-6.2 g l(-1)), KH(2)PO(4) (0.5-2.5 g l(-1)), sucrose (5-55 g l(-1)) and inoculum concentration (1-25 ml l(-1)). Central composite rotatable design (CCRD) experiments were carried out to study the complex interactions of the variables.The optimum conditions for maximum PHB production were (g l(-1)): CSL-25, Na(2)HPO(4) 2H(2)O-2.2, KH(2)PO(4) - 0.5, sucrose - 55 and inoculum - 10 (ml l(-1)). After 72 h of fermentation, the amount of PHA produced was 8.20 g l(-1) (51.20% of dry cell biomass). It is the first report on optimization of fermentation medium using CSL as a nitrogen source, for PHB production by Bacillus sp.

  4. Synthesis, radiolabeling and baboon SPECT imaging of 2{beta}-carbomethoxy-3{beta}-(3'-[{sup 123}I]iodophenyl)tropane ([{sup 123}I]YP256) as a serotonin transporter radiotracer

    Energy Technology Data Exchange (ETDEWEB)

    Bois, Frederic; Baldwin, Ronald M.; Amici, Louis; Al-Tikriti, Mohammed S. [Yale University, School of Medicine, VA Connecticut HCS (116A2), West Haven, CT 06516 (United States); Kula, Nora; Baldessarini, Ross [Department of Psychiatry and Neuroscience Program, Harvard Medical School, Mailman Research Center McLean Division of Massachusetts General Hospital, Belmont, MA 02478 (United States); Innis, Robert B.; Staley, Julie K. [Yale University, School of Medicine, VA Connecticut HCS (116A2), West Haven, CT 06516 (United States); Tamagnan, Gilles D. [Yale University, School of Medicine, VA Connecticut HCS (116A2), West Haven, CT 06516 (United States); Institute for Neurodegenerative Disorders, New Haven, CT 06510 (United States)], E-mail: gtamagnan@indd.org

    2008-01-15

    To develop a potential SPECT probe to evaluate the integrity of the serotoninergic system (5-HTT) whose dysfunction is linked to several disease conditions such as Parkinson's disease, Alzheimer's disease and depression, we report the synthesis, radiolabeling and in vivo baboon imaging of 2{beta}-carbomethoxy-3{beta}-(3'-[{sup 123}I]iodophenyl) tropane (YP256, ). The radiolabeling was performed by iododestannylation using sodium [{sup 123}I]iodide and peracetic acid. Although the ligand displayed high selectivity for 5-HTT over dopamine transporter in vitro, SPECT imaging in baboons did not reveal selective 5-HTT accumulation in brain in vivo.

  5. Towards the island of superheavy stability - Prompt spectroscopy of 246Fm and 256Rf nuclei

    International Nuclear Information System (INIS)

    Piot, J.

    2010-10-01

    The region of trans-fermium nuclei (Z = 100 to 104) is the last region of the nuclides chart to be accessible to spectroscopic measurements. It therefore provides the ultimate anchor points for nuclear models. This region also lies on the path of the alpha-decay chains of the super-heavy elements. This region represents the limit of today's spectroscopic capabilities. It therefore requires technological developments in order to overcome these limits. My thesis focuses on various aspects of the spectroscopy of trans-fermium nuclei. I took part in the development of the TNT2D digital acquisition cards for germanium detectors. I validated their use on the gamma-ray spectrometer JUROGAM during an in-beam experiment and demonstrated the gain compared to an analogue acquisition system. These tests were part of the developments needed to secure a study of the prompt spectroscopy of 256 Rf. The preparation of this experiment also lead me to work on the development of a 50 Ti beam. For that purpose, I studied and tested the use of titanium organo-metallic compounds compatible with the MIVOC technique. In parallel, I studied the use of metallic and oxide titanium pellets with an inductive oven newly developed at the University of Jyvaeskylae. In addition to these developments, I had the opportunity to study the in-beam prompt spectroscopy of 246 Fm at the University of Jyvaeskylae. The measurements yielded a rotational band built on the ground state of 246 Fm. This band has been observed up to the level 16 + and shows a behaviour quite similar to the neighbouring even-even isotopes, except for the top of the band for which a wider statistics is necessary in order to conclude. (author)

  6. Infections During Induction Therapy of Protocol CCLG-2008 in Childhood Acute Lymphoblastic Leukemia: A Single-center Experience with 256 Cases in China

    Directory of Open Access Journals (Sweden)

    Si-Dan Li

    2015-01-01

    Full Text Available Background: Infections remain a major cause of therapy-associated morbidity and mortality in children with acute lymphoblastic leukemia (ALL. Methods: We retrospectively analyzed the medical charts of 256 children treated for ALL under the CCLG-2008 protocol in Beijing Children′s Hospital. Results: There were 65 infectious complications in 50 patients during vincristine, daunorubicin, L-asparaginase and dexamethasone induction therapy, including microbiologically documented infections (n = 12; 18.5%, clinically documented infections (n = 23; 35.3% and fever of unknown origin (n = 30; 46.2%. Neutropenia was present in 83.1% of the infectious episodes. In all, most infections occurred around the 15 th day of induction treatment (n = 28, and no patients died of infection-associated complications. Conclusions: The infections in this study was independent of treatment response, minimal residual diseases at the end of induction therapy, gender, immunophenotype, infection at first visit, risk stratification at diagnosis, unfavorable karyotypes at diagnosis and morphologic type. The infection rate of CCLG-2008 induction therapy is low, and the outcome of patients is favorable.

  7. Bilateral downregulation of Nav1.8 in dorsal root ganglia of rats with bone cancer pain induced by inoculation with Walker 256 breast tumor cells

    International Nuclear Information System (INIS)

    Miao, Xue-Rong; Gao, Xiao-Fei; Wu, Jing-Xiang; Lu, Zhi-Jie; Huang, Zhang-Xiang; Li, Xiao-Qing; He, Cheng; Yu, Wei-Feng

    2010-01-01

    Rapid and effective treatment of cancer-induced bone pain remains a clinical challenge and patients with bone metastasis are more likely to experience severe pain. The voltage-gated sodium channel Nav1.8 plays a critical role in many aspects of nociceptor function. Therefore, we characterized a rat model of cancer pain and investigated the potential role of Nav1.8. Adult female Wistar rats were used for the study. Cancer pain was induced by inoculation of Walker 256 breast carcinosarcoma cells into the tibia. After surgery, mechanical and thermal hyperalgesia and ambulation scores were evaluated to identify pain-related behavior. We used real-time RT-PCR to determine Nav1.8 mRNA expression in bilateral L4/L5 dorsal root ganglia (DRG) at 16-19 days after surgery. Western blotting and immunofluorescence were used to compare the expression and distribution of Nav1.8 in L4/L5 DRG between tumor-bearing and sham rats. Antisense oligodeoxynucleotides (ODNs) against Nav1.8 were administered intrathecally at 14-16 days after surgery to knock down Nav1.8 protein expression and changes in pain-related behavior were observed. Tumor-bearing rats exhibited mechanical hyperalgesia and ambulatory-evoked pain from day 7 after inoculation of Walker 256 cells. In the advanced stage of cancer pain (days 16-19 after surgery), normalized Nav1.8 mRNA levels assessed by real-time RT-PCR were significantly lower in ipsilateral L4/L5 DRG of tumor-bearing rats compared with the sham group. Western-blot showed that the total expression of Nav1.8 protein significantly decreased bilaterally in DRG of tumor-bearing rats. Furthermore, as revealed by immunofluorescence, only the expression of Nav1.8 protein in small neurons down regulated significantly in bilateral DRG of cancer pain rats. After administration of antisense ODNs against Nav1.8, Nav1.8 protein expression decreased significantly and tumor-bearing rats showed alleviated mechanical hyperalgesia and ambulatory-evoked pain. These

  8. The effect of head size/shape, miscentering, and bowtie filter on peak patient tissue doses from modern brain perfusion 256-slice CT: How can we minimize the risk for deterministic effects?

    International Nuclear Information System (INIS)

    Perisinakis, Kostas; Seimenis, Ioannis; Tzedakis, Antonis; Papadakis, Antonios E.; Damilakis, John

    2013-01-01

    Purpose: To determine patient-specific absorbed peak doses to skin, eye lens, brain parenchyma, and cranial red bone marrow (RBM) of adult individuals subjected to low-dose brain perfusion CT studies on a 256-slice CT scanner, and investigate the effect of patient head size/shape, head position during the examination and bowtie filter used on peak tissue doses. Methods: The peak doses to eye lens, skin, brain, and RBM were measured in 106 individual-specific adult head phantoms subjected to the standard low-dose brain perfusion CT on a 256-slice CT scanner using a novel Monte Carlo simulation software dedicated for patient CT dosimetry. Peak tissue doses were compared to corresponding thresholds for induction of cataract, erythema, cerebrovascular disease, and depression of hematopoiesis, respectively. The effects of patient head size/shape, head position during acquisition and bowtie filter used on resulting peak patient tissue doses were investigated. The effect of eye-lens position in the scanned head region was also investigated. The effect of miscentering and use of narrow bowtie filter on image quality was assessed. Results: The mean peak doses to eye lens, skin, brain, and RBM were found to be 124, 120, 95, and 163 mGy, respectively. The effect of patient head size and shape on peak tissue doses was found to be minimal since maximum differences were less than 7%. Patient head miscentering and bowtie filter selection were found to have a considerable effect on peak tissue doses. The peak eye-lens dose saving achieved by elevating head by 4 cm with respect to isocenter and using a narrow wedge filter was found to approach 50%. When the eye lies outside of the primarily irradiated head region, the dose to eye lens was found to drop to less than 20% of the corresponding dose measured when the eye lens was located in the middle of the x-ray beam. Positioning head phantom off-isocenter by 4 cm and employing a narrow wedge filter results in a moderate reduction of

  9. Extraction of niobium and tantalum isotopes using organophosphorus compounds. Pt. 1. Extraction of 'carrier-free' metal concentrations from HCl solutions

    International Nuclear Information System (INIS)

    Gates, J.M.; California Univ., Berkeley, CA; Sudowe, R.; Stavsetra, L.

    2009-01-01

    The extraction of niobium (Nb) and tantalum (Ta) from hydrochloric acid media by bis(2-ethylhexyl) hydrogen phosphate (HDEHP) and bis(2-ethylhexyl) hydrogen phosphite (BEHP) was studied. The goal of the experiments is to find a system that demonstrates selectivity between the members of group five of the Periodic Table and is also suitable for the study of dubnium (Db, Z=105). Experiments were performed at the trace level (10 -16 M Nb or Ta) using hydrochloric acid with concentrations ranging from 1-11 M and short-lived isotopes of Nb and Ta produced in nuclear reactions. When HDEHP was used as the extractant, the Nb extraction yield decreased with increasing acid concentrations above 6 M, while the amount of Ta extracted remained over 75% for all acid concentrations studied. Tantalum was found to be extracted by BEHP at acid concentrations above 6 M, while niobium was not significantly extracted. The data obtained are used as the basis to discuss the speciation of Nb and Ta under the conditions studied and to evaluate possible extraction mechanisms. (orig.)

  10. Chemistry of superheavy elements

    International Nuclear Information System (INIS)

    Schaedel, M.

    2012-01-01

    The chemistry of superheavy elements - or transactinides from their position in the Periodic Table - is summarized. After giving an overview over historical developments, nuclear aspects about synthesis of neutron-rich isotopes of these elements, produced in hot-fusion reactions, and their nuclear decay properties are briefly mentioned. Specific requirements to cope with the one-atom-at-a-time situation in automated chemical separations and recent developments in aqueous-phase and gas-phase chemistry are presented. Exciting, current developments, first applications, and future prospects of chemical separations behind physical recoil separators ('pre-separator') are discussed in detail. The status of our current knowledge about the chemistry of rutherfordium (Rf, element 104), dubnium (Db, element 105), seaborgium (Sg, element 106), bohrium (Bh, element 107), hassium (Hs, element 108), copernicium (Cn, element 112), and element 114 is discussed from an experimental point of view. Recent results are emphasized and compared with empirical extrapolations and with fully-relativistic theoretical calculations, especially also under the aspect of the architecture of the Periodic Table. (orig.)

  11. Low-threshold stimulated emission at 249 nm and 256 nm from AlGaN-based multiple-quantum-well lasers grown on sapphire substrates

    Energy Technology Data Exchange (ETDEWEB)

    Li, Xiao-Hang; Detchprohm, Theeradetch; Kao, Tsung-Ting; Satter, Md. Mahbub; Shen, Shyh-Chiang; Douglas Yoder, P.; Dupuis, Russell D., E-mail: dupuis@gatech.edu [Center for Compound Semiconductors and School of Electrical and Computer Engineering, Georgia Institute of Technology, Atlanta, Georgia 30332-0250 (United States); Wang, Shuo; Wei, Yong O.; Xie, Hongen; Fischer, Alec M.; Ponce, Fernando A. [Department of Physics, Arizona State University, Tempe, Arizona 85287-1504 (United States); Wernicke, Tim; Reich, Christoph; Martens, Martin; Kneissl, Michael [Technical University of Berlin, Institute for Solid State Physics, Berlin D-10623 (Germany)

    2014-10-06

    Optically pumped deep-ultraviolet (DUV) lasing with low threshold was demonstrated from AlGaN-based multiple-quantum-well (MQW) heterostructures grown on sapphire substrates. The epitaxial layers were grown pseudomorphically by metalorganic chemical vapor deposition on (0001) sapphire substrates. Stimulated emission was observed at wavelengths of 256 nm and 249 nm with thresholds of 61 kW/cm{sup 2} and 95 kW/cm{sup 2} at room temperature, respectively. The thresholds are comparable to the reported state-of-the-art AlGaN-based MQW DUV lasers grown on bulk AlN substrates emitting at 266 nm. These low thresholds are attributed to the optimization of active region and waveguide layer as well as the use of high-quality AlN/sapphire templates. The stimulated emission above threshold was dominated by transverse-electric polarization. This work demonstrates the potential candidacy of sapphire substrates for DUV diode lasers.

  12. Coronary Plaque Characteristics Assessed by 256-Slice Coronary CT Angiography and Association with High-Sensitivity C-Reactive Protein in Symptomatic Patients with Type 2 Diabetes

    Directory of Open Access Journals (Sweden)

    Jinling Zhang

    2016-01-01

    Full Text Available Little is known regarding plaque distribution, composition, and the association with inflammation in type 2 diabetes mellitus (DM2. This study aimed to assess the relationship between coronary plaque subtypes and high-sensitivity C-reactive protein levels. Coronary CTA were performed in 98 symptomatic DM2 patients and 107 non-DM2 patients using a 256-slice CT. The extent and types of plaque as well as luminal narrowing were evaluated. Patients with DM2 were more likely to have significant stenosis (>50% with calcified plaques in at least one coronary segment (p<0.01; the prevalence rates of diffuse calcified plaques in the DM2 and non-DM2 groups were 31.6% and 4.7%, respectively (p<0.01. Plasma hs-CRP levels in DM2 with calcified plaques were higher compared with values obtained for the non-DM2 group (p<0.01. In conclusion, combination of coronary CTA and hs-CRP might improve risk stratification in symptomatic DM2 patients.

  13. Low-threshold stimulated emission at 249 nm and 256 nm from AlGaN-based multiple-quantum-well lasers grown on sapphire substrates

    International Nuclear Information System (INIS)

    Li, Xiao-Hang; Detchprohm, Theeradetch; Kao, Tsung-Ting; Satter, Md. Mahbub; Shen, Shyh-Chiang; Douglas Yoder, P.; Dupuis, Russell D.; Wang, Shuo; Wei, Yong O.; Xie, Hongen; Fischer, Alec M.; Ponce, Fernando A.; Wernicke, Tim; Reich, Christoph; Martens, Martin; Kneissl, Michael

    2014-01-01

    Optically pumped deep-ultraviolet (DUV) lasing with low threshold was demonstrated from AlGaN-based multiple-quantum-well (MQW) heterostructures grown on sapphire substrates. The epitaxial layers were grown pseudomorphically by metalorganic chemical vapor deposition on (0001) sapphire substrates. Stimulated emission was observed at wavelengths of 256 nm and 249 nm with thresholds of 61 kW/cm 2 and 95 kW/cm 2 at room temperature, respectively. The thresholds are comparable to the reported state-of-the-art AlGaN-based MQW DUV lasers grown on bulk AlN substrates emitting at 266 nm. These low thresholds are attributed to the optimization of active region and waveguide layer as well as the use of high-quality AlN/sapphire templates. The stimulated emission above threshold was dominated by transverse-electric polarization. This work demonstrates the potential candidacy of sapphire substrates for DUV diode lasers.

  14. The parallel processing of EGS4 code on distributed memory scalar parallel computer:Intel Paragon XP/S15-256

    Energy Technology Data Exchange (ETDEWEB)

    Takemiya, Hiroshi; Ohta, Hirofumi; Honma, Ichirou

    1996-03-01

    The parallelization of Electro-Magnetic Cascade Monte Carlo Simulation Code, EGS4 on distributed memory scalar parallel computer: Intel Paragon XP/S15-256 is described. EGS4 has the feature that calculation time for one incident particle is quite different from each other because of the dynamic generation of secondary particles and different behavior of each particle. Granularity for parallel processing, parallel programming model and the algorithm of parallel random number generation are discussed and two kinds of method, each of which allocates particles dynamically or statically, are used for the purpose of realizing high speed parallel processing of this code. Among four problems chosen for performance evaluation, the speedup factors for three problems have been attained to nearly 100 times with 128 processor. It has been found that when both the calculation time for each incident particles and its dispersion are large, it is preferable to use dynamic particle allocation method which can average the load for each processor. And it has also been found that when they are small, it is preferable to use static particle allocation method which reduces the communication overhead. Moreover, it is pointed out that to get the result accurately, it is necessary to use double precision variables in EGS4 code. Finally, the workflow of program parallelization is analyzed and tools for program parallelization through the experience of the EGS4 parallelization are discussed. (author).

  15. Coronary Stent Artifact Reduction with an Edge-Enhancing Reconstruction Kernel - A Prospective Cross-Sectional Study with 256-Slice CT.

    Science.gov (United States)

    Tan, Stéphanie; Soulez, Gilles; Diez Martinez, Patricia; Larrivée, Sandra; Stevens, Louis-Mathieu; Goussard, Yves; Mansour, Samer; Chartrand-Lefebvre, Carl

    2016-01-01

    Metallic artifacts can result in an artificial thickening of the coronary stent wall which can significantly impair computed tomography (CT) imaging in patients with coronary stents. The objective of this study is to assess in vivo visualization of coronary stent wall and lumen with an edge-enhancing CT reconstruction kernel, as compared to a standard kernel. This is a prospective cross-sectional study involving the assessment of 71 coronary stents (24 patients), with blinded observers. After 256-slice CT angiography, image reconstruction was done with medium-smooth and edge-enhancing kernels. Stent wall thickness was measured with both orthogonal and circumference methods, averaging thickness from diameter and circumference measurements, respectively. Image quality was assessed quantitatively using objective parameters (noise, signal to noise (SNR) and contrast to noise (CNR) ratios), as well as visually using a 5-point Likert scale. Stent wall thickness was decreased with the edge-enhancing kernel in comparison to the standard kernel, either with the orthogonal (0.97 ± 0.02 versus 1.09 ± 0.03 mm, respectively; pkernel generated less overestimation from nominal thickness compared to the standard kernel, both with the orthogonal (0.89 ± 0.19 versus 1.00 ± 0.26 mm, respectively; pkernel was associated with lower SNR and CNR, as well as higher background noise (all p kernel. Stent visual scores were higher with the edge-enhancing kernel (pkernel generates thinner stent walls, less overestimation from nominal thickness, and better image quality scores than the standard kernel.

  16. Mortality and Epidemiology in 256 Cases of Pediatric Traumatic Brain Injury: Korean Neuro-Trauma Data Bank System (KNTDBS) 2010-2014.

    Science.gov (United States)

    Jeong, Hee-Won; Choi, Seung-Won; Youm, Jin-Young; Lim, Jeong-Wook; Kwon, Hyon-Jo; Song, Shi-Hun

    2017-11-01

    Among pediatric injury, brain injury is a leading cause of death and disability. To improve outcomes, many developed countries built neurotrauma databank (NTDB) system but there was not established nationwide coverage NTDB until 2009 and there have been few studies on pediatric traumatic head injury (THI) patients in Korea. Therefore, we analyzed epidemiology and outcome from the big data of pediatric THI. We collected data on pediatric patients from 23 university hospitals including 9 regional trauma centers from 2010 to 2014 and analyzed their clinical factors (sex, age, initial Glasgow coma scale, cause and mechanism of head injury, presence of surgery). Among all the 2617 THI patients, total number of pediatric patients was 256. The average age of the subjects was 9.07 (standard deviation±6.3) years old. The male-to female ratio was 1.87 to 1 and male dominance increases with age. The most common cause for trauma were falls and traffic accidents. Age ( p =0.007), surgery ( p <0.001), mechanism of trauma ( p =0.016), subdural hemorrhage (SDH) ( p <0.001), diffuse axonal injury (DAI) ( p <0.001) were statistically significant associated with severe brain injury. Falls were the most common cause of trauma, and age, surgery, mechanism of trauma, SDH, DAI increased with injury severity. There is a critical need for effective fall and traffic accidents prevention strategies for children, and we should give attention to these predicting factors for more effective care.

  17. 256 ORIGINAL ARTICLE

    African Journals Online (AJOL)

    boaz

    This highlights Bcc as an emerging nosocomial pathogen in ICUs of ZUHs. Continuous monitoring of the occurrence of Bcc in ICU as well as in other hospital ...... amplified polymorphic DNA (RAPD) analysis of microbial community diversity in soil affected by industrial pollutants: reference to Mandideep industrial area.

  18. Effect of hybrid iterative reconstruction technique on quantitative and qualitative image analysis at 256-slice prospective gating cardiac CT

    International Nuclear Information System (INIS)

    Utsunomiya, Daisuke; Weigold, W. Guy; Weissman, Gaby; Taylor, Allen J.

    2012-01-01

    To evaluate the effect of hybrid iterative reconstruction on qualitative and quantitative parameters at 256-slice cardiac CT. Prospective cardiac CT images from 20 patients were analysed. Paired image sets were created using 3 reconstructions, i.e. filtered back projection (FBP) and moderate- and high-level iterative reconstructions. Quantitative parameters including CT-attenuation, noise, and contrast-to-noise ratio (CNR) were determined in both proximal- and distal coronary segments. Image quality was graded on a 4-point scale. Coronary CT attenuation values were similar for FBP, moderate- and high-level iterative reconstruction at 293 ± 74-, 290 ± 75-, and 283 ± 78 Hounsfield units (HU), respectively. CNR was significantly higher with moderate- and high-level iterative reconstructions (10.9 ± 3.5 and 18.4 ± 6.2, respectively) than FBP (8.2 ± 2.5) as was the visual grading of proximal vessels. Visualisation of distal vessels was better with high-level iterative reconstruction than FBP. The mean number of assessable segments among 289 segments was 245, 260, and 267 for FBP, moderate- and high-level iterative reconstruction, respectively; the difference between FBP and high-level iterative reconstruction was significant. Interobserver agreement was significantly higher for moderate- and high-level iterative reconstruction than FBP. Cardiac CT using hybrid iterative reconstruction yields higher CNR and better image quality than FBP. circle Cardiac CT helps clinicians to assess patients with coronary artery disease circle Hybrid iterative reconstruction provides improved cardiac CT image quality circle Hybrid iterative reconstruction improves the number of assessable coronary segments circle Hybrid iterative reconstruction improves interobserver agreement on cardiac CT. (orig.)

  19. Action of tacrolimus on Wistar rat kidneys implanted with Walker 256 carcinosarcoma Estudo da ação do tacrolimus em rins de ratos Wistar implantados com carcinossarcoma de Walker

    Directory of Open Access Journals (Sweden)

    Cristiano Machado Inácio

    2010-02-01

    Full Text Available PURPOSE: To evaluate the development of Walker 256 tumor in male Wistar rats treated with tacrolimus using an experimental kidney tumor model. METHODS: 40 male Wistar rats were divided into four groups: Tumor group (TU (n=10, Tacrolimus-Tumor group (TT (n=10, Tacrolimus group (TC (n=10 and Control group (C (n=10. Treatment with tacrolimus was performed in groups TT and TC. Under anesthesia, the right kidney of each animal of TU and TT was accessed through a supraumbilical incision and inoculated with a 0.1mL solution containing 2x10(6 tumor cells (Walker 256 carcinosarcoma tumor cells. Group TC was treated with a saline solution. All the animals of groups TC and TT were treated with tacrolimus (5mg/kg/day by gavage for 15 days. TU group animals received saline by gavage for 15 days. On the 15th postoperative day, all animals were submitted to euthanasia and blood sampling for analysis of serum creatinine (Cr and blood urea nitrogen (BUN. Abdominal gross examination was performed, the right kidney removed and prepared for histological analysis by hematoxylin-eosin staining. The resulting data were submitted to statistical analysis by ANOVA. RESULTS: Statistical significance was found when comparing creatinine level between groups TU, TT and TC -TT group culminated with a marked increased in creatinine levels (Cr=1.013 ± 0.3028 mg/mL, TU group (Cr=0.5670 ± 0.03536 mg/dL P=0.00256, TC group (Cr =0.711 ± 0.1653 mg/mL P= 0.02832. Statistical significance was found when comparing BUN levels in TT group (71.32 ± 17.14 mg/mL, compared with TU group (45.83 ± 5.046 mg/dL, P=0.000318. There were no statistically significant differences between groups TT and TC (61.23 ± 9.503 mg/mL P=0.7242. Histological analysis showed a poor evolution in TT group with multiple foci of hemorrhage and cortical invasion by the Walker tumor. CONCLUSION: The Tacrolimus-treated group developed a more aggressive tumor and a drug-related nephrotoxic effect.OBJETIVO: Avaliar

  20. Aqueous chemistry of transactinides

    International Nuclear Information System (INIS)

    Schaedel, M.

    2001-01-01

    The aqueous chemistry of the first three transactinide elements is briefly reviewed with special emphasis given to recent experimental results. Short introductory remarks are discussing the atom-at-a-time situation of transactinide chemistry as a result of low production cross-sections and short half-lives. In general, on-line experimental techniques and, more specifically, the automated rapid chemistry apparatus, ARCA, are presented. Present and future developments of experimental techniques and resulting perspectives are outlined at the end. The central part is mainly focussing on hydrolysis and complex formation aspects of the superheavy group 4, 5, and 6 transition metals with F - and Cl - anions. Experimental results are compared with the behaviour of lighter homologous elements and with relativistic calculations. It will be shown that the chemical behaviour of the first superheavy elements is already strongly influenced by relativistic effects. While it is justified to place rutherfordium, dubnium and seaborgium in the Periodic Table of the Elements into group 4, 5 and 6, respectively, it is no more possible to deduce from this position in detail the chemical properties of these transactinide or superheavy elements. (orig.)

  1. Uncaria tomentosa exerts extensive anti-neoplastic effects against the Walker-256 tumour by modulating oxidative stress and not by alkaloid activity.

    Directory of Open Access Journals (Sweden)

    Arturo Alejandro Dreifuss

    Full Text Available This study aimed to compare the anti-neoplastic effects of an Uncaria tomentosa (UT brute hydroethanolic (BHE extract with those of two fractions derived from it. These fractions are choroformic (CHCl3 and n-butanolic (BuOH, rich in pentacyclic oxindole alkaloids (POA and antioxidant substances, respectively. The cancer model was the subcutaneous inoculation of Walker-256 tumour cells in the pelvic limb of male Wistar rat. Subsequently to the inoculation, gavage with BHE extract (50 mg.kg(-1 or its fractions (as per the yield of the fractioning process or vehicle (Control was performed during 14 days. Baseline values, corresponding to individuals without tumour or treatment with UT, were also included. After treatment, tumour volume and mass, plasma biochemistry, oxidative stress in liver and tumour, TNF-α level in liver and tumour homogenates, and survival rates were analysed. Both the BHE extract and its BuOH fraction successfully reduced tumour weight and volume, and modulated anti-oxidant systems. The hepatic TNF-α level indicated a greater effect from the BHE extract as compared to its BuOH fraction. Importantly, both the BHE extract and its BuOH fraction increased the survival time of the tumour-bearing animals. Inversely, the CHCl3 fraction was ineffective. These data represent an in vivo demonstration of the importance of the modulation of oxidative stress as part of the anti-neoplastic activity of UT, as well as constitute evidence of the lack of activity of isolated POAs in the primary tumour of this tumour lineage. These effects are possibly resulting from a synergic combination of substances, most of them with antioxidant properties.

  2. Diagnostic accuracy of low-dose 256-slice multi-detector coronary CT angiography using iterative reconstruction in patients with suspected coronary artery disease

    Energy Technology Data Exchange (ETDEWEB)

    Hou, Yang; Ma, Yue; Wang, Yuke; Yu, Mei; Guo, Qiyong [Shengjing Hospital of China Medical University, Department of Radiology, Shenyang (China); Fan, Weipeng [Central Hospital of Anshan, Department of Radiology, Anshan (China); Vembar, Mani [CT Clinical Science Philips Healthcare, Cleveland, OH (United States)

    2014-01-15

    To evaluate the accuracy of low-dose coronary CTA with iterative reconstruction (IR) in the diagnosis of coronary artery disease (CAD) in patients with suspected CAD. Ninety-six patients with suspected CAD underwent low-dose prospective electrocardiogram-gated coronary CTA, with images reconstructed using IR. Image quality (IQ) of coronary segments were graded on a 4-point scale (4, excellent; 1, non-diagnostic). With invasive coronary angiography (ICA) considered the ''gold standard'', the sensitivity, specificity, positive predictive value (PPV), negative predictive value (NPV) and accuracy of coronary CTA were calculated on segment-, vessel- and patient-based levels. The patient data were divided into two groups (Agatston scores of ≥ 400 and <400). The differences in diagnostic performance between the two groups were tested. Diagnostic image quality was found in 98.1 % (1,232/1,256) of segments. The sensitivity, specificity, PPV, NPV and accuracy were 90.8 %, 95.3 %, 81.8 %, 97.8 % and 94.3 % (segment-based) and 97.2 %, 83.3 %, 94.6 %, 90.9 % and 93.8 % (patient-based). Significant differences between the two groups were seen in specificity, PPV and accuracy (92.1 % vs. 97.9 %, 76.0 % vs. 86.7 %, 91.7 % vs. 96.6 %, P < 0.05; segment-based). The average effective dose was 1.30 ± 0.15 mSv. Low-dose prospective coronary CTA with IR can acquire satisfactory image quality and show high diagnostic accuracy in patients with suspected CAD; however, blooming continues to pose a challenge in severely calcified segments. (orig.)

  3. Interpretations of systematic errors in the NCEP Climate Forecast System at lead times of 2, 4, 8, ..., 256 days

    Directory of Open Access Journals (Sweden)

    Siwon Song

    2012-09-01

    Full Text Available The climatology of mean bias errors (relative to 1-day forecasts was examined in a 20-year hindcast set from version 1 of the Climate Forecast System (CFS, for forecast lead times of 2, 4, 8, 16, ... 256 days, verifying in different seasons. Results mostly confirm the simple expectation that atmospheric model biases should be evident at short lead (2–4 days, while soil moisture errors develop over days-weeks and ocean errors emerge over months. A further simplification is also evident: surface temperature bias patterns have nearly fixed geographical structure, growing with different time scales over land and ocean. The geographical pattern has mostly warm and dry biases over land and cool bias over the oceans, with two main exceptions: (1 deficient stratocumulus clouds cause warm biases in eastern subtropical oceans, and (2 high latitude land is too cold in boreal winter. Further study of the east Pacific cold tongue-Intertropical Convergence Zone (ITCZ complex shows a possible interaction between a rapidly-expressed atmospheric model bias (poleward shift of deep convection beginning at day 2 and slow ocean dynamics (erroneously cold upwelling along the equator in leads > 1 month. Further study of the high latitude land cold bias shows that it is a thermal wind balance aspect of the deep polar vortex, not just a near-surface temperature error under the wintertime inversion, suggesting that its development time scale of weeks to months may involve long timescale processes in the atmosphere, not necessarily in the land model. Winter zonal wind errors are small in magnitude, but a refractive index map shows that this can cause modest errors in Rossby wave ducting. Finally, as a counterpoint to our initial expectations about error growth, a case of non-monotonic error growth is shown: velocity potential bias grows with lead on a time scale of weeks, then decays over months. It is hypothesized that compensations between land and ocean errors may

  4. Functional imaging of larynx via 256-Slice Multi-Detector Computed Tomography in patients with laryngeal tumors: A faster, better and more reliable pre-therapeutic evaluation

    International Nuclear Information System (INIS)

    Celebi, Irfan; Basak, Muzaffer; Ucgul, Ayhan; Yildirim, Hakan; Oz, Aysel; Vural, Cetin

    2012-01-01

    Objective: To determine the clinical utility of using dynamic maneuvers during imaging of larynx via 256-Slice Multi-Detector Computed Tomography in the pre-therapeutic evaluation of laryngeal tumors. Materials and methods: A total of 27 patients (7 women, 20 men; aged 53–76 years) diagnosed with laryngeal squamous cell carcinoma were evaluated pre-therapeutically via contrast enhanced axial CT scans during consecutive phases of phonation (PP), inspiration (IP) and Valsalva maneuver (VP). Results: In 2 of 5 patients diagnosed with T1a glottic tumor, scans obtained during VP and PP were normal while the CT scans obtained during IP clearly showed a mass. In all patients (27/27) PP provided visualization of the ventricle, on coronal plane images and the pyriform sinus apices, on axial plane images. Involvement of the anterior commissure was best assessable on axial plane IP images (sensitivity 93%, specificity 92%). In cases of stage T1–T3 tumors use of dynamic maneuvers during laryngeal CT imaging showed the location and extension of the tumor better than the single phase CT scans did. We did not find a significant improvement in the pre-therapeutic evaluation in stage T4 tumors. Conclusion: Providing markedly clearer and more detailed evaluation of mucosal surfaces and deep structures of the larynx and mobility of the cords than do conventional scans, use of dynamic laryngeal maneuvers during laryngeal CT imaging seems to be an useful alternative in the pre-therapeutic assessment of laryngeal tumors.

  5. Influence of relativistic effects on hydration and hydrolysis of rutherfordium, dubnium and some 6-th row element cations

    International Nuclear Information System (INIS)

    Bilewicz, A.; Siekierski, S.

    1999-01-01

    New evidence for the influence of relativistic effect on coordination number, (CN), and hydrolysis of Rf 4+ and Db 5+ aqua ions has been presented. It has been argued that very strong hydrolysis of the heaviest members of Groups 12, 13 is caused by the low CN of Hg 2+ and Tl 3+ in their aqua ions. Low CN is the result of relativistic effects which stabilize the 6s orbital, increasing thereby the respective promotion energy. That supports our previous view that strong hydrolysis of Rf aq 4+ much greater than that of Hf aq 4+ and Zr aq 4+ , is also a result of lower CN. Since the promotion energy for sp 3 d 4 hybridization (CN 8) seems to be close to that od sp 3 d 2 hybridization (CN 6), and since hybridization energies of Zr 4+ , Hf 4+ and Rf 4+ do not differ very much for hexa- and octahydrates the two aqua ions i.e., M(H 2 O) 6 4+ and M(H 2 O) 8 4+ may coexist in aqueous acid solutions. However, due to relativistic stabilization of 7s and destabilization of 6s orbitals, which increases promotion energy, the Rf 4+ aqua cation should show coordination number 6 rather than 8. A shift of equilibrium toward a lower hydrate increases the tendency to hydrolyse. (author)

  6. Iterative model reconstruction: Improved image quality of low-tube-voltage prospective ECG-gated coronary CT angiography images at 256-slice CT

    Energy Technology Data Exchange (ETDEWEB)

    Oda, Seitaro, E-mail: seisei0430@nifty.com [Department of Cardiology, MedStar Washington Hospital Center, 110 Irving Street, NW, Washington, DC 20010 (United States); Department of Diagnostic Radiology, Faculty of Life Sciences, Kumamoto University, 1-1-1 Honjyo, Chuo-ku, Kumamoto, 860-8556 (Japan); Weissman, Gaby, E-mail: Gaby.Weissman@medstar.net [Department of Cardiology, MedStar Washington Hospital Center, 110 Irving Street, NW, Washington, DC 20010 (United States); Vembar, Mani, E-mail: mani.vembar@philips.com [CT Clinical Science, Philips Healthcare, c595 Miner Road, Cleveland, OH 44143 (United States); Weigold, Wm. Guy, E-mail: Guy.Weigold@MedStar.net [Department of Cardiology, MedStar Washington Hospital Center, 110 Irving Street, NW, Washington, DC 20010 (United States)

    2014-08-15

    Objectives: To investigate the effects of a new model-based type of iterative reconstruction (M-IR) technique, the iterative model reconstruction, on image quality of prospectively gated coronary CT angiography (CTA) acquired at low-tube-voltage. Methods: Thirty patients (16 men, 14 women; mean age 52.2 ± 13.2 years) underwent coronary CTA at 100-kVp on a 256-slice CT. Paired image sets were created using 3 types of reconstruction, i.e. filtered back projection (FBP), a hybrid type of iterative reconstruction (H-IR), and M-IR. Quantitative parameters including CT-attenuation, image noise, and contrast-to-noise ratio (CNR) were measured. The visual image quality, i.e. graininess, beam-hardening, vessel sharpness, and overall image quality, was scored on a 5-point scale. Lastly, coronary artery segments were evaluated using a 4-point scale to investigate the assessability of each segment. Results: There was no significant difference in coronary arterial CT attenuation among the 3 reconstruction methods. The mean image noise of FBP, H-IR, and M-IR images was 29.3 ± 9.6, 19.3 ± 6.9, and 12.9 ± 3.3 HU, respectively, there were significant differences for all comparison combinations among the 3 methods (p < 0.01). The CNR of M-IR was significantly better than of FBP and H-IR images (13.5 ± 5.0 [FBP], 20.9 ± 8.9 [H-IR] and 39.3 ± 13.9 [M-IR]; p < 0.01). The visual scores were significantly higher for M-IR than the other images (p < 0.01), and 95.3% of the coronary segments imaged with M-IR were of assessable quality compared with 76.7% of FBP- and 86.9% of H-IR images. Conclusions: M-IR can provide significantly improved qualitative and quantitative image quality in prospectively gated coronary CTA using a low-tube-voltage.

  7. MT3250BA: a 320×256-50µm snapshot microbolometer ROIC for high-resistance detector arrays

    Science.gov (United States)

    Eminoglu, Selim; Akin, Tayfun

    2013-06-01

    This paper reports the development of a new microbolometer readout integrated circuit (MT3250BA) designed for high-resistance detector arrays. MT3250BA is the first microbolometer readout integrated circuit (ROIC) product from Mikro-Tasarim Ltd., which is a fabless IC design house specialized in the development of monolithic CMOS imaging sensors and ROICs for hybrid photonic imaging sensors and microbolometers. MT3250BA has a format of 320 × 256 and a pixel pitch of 50 µm, developed with a system-on-chip architecture in mind, where all the timing and biasing for this ROIC are generated on-chip without requiring any external inputs. MT3250BA is a highly configurable ROIC, where many of its features can be programmed through a 3-wire serial interface allowing on-the-fly configuration of many ROIC features. MT3250BA has 2 analog video outputs and 1 analog reference output for pseudo-differential operation, and the ROIC can be programmed to operate in the 1 or 2-output modes. A unique feature of MT3250BA is that it performs snapshot readout operation; therefore, the image quality will only be limited by the thermal time constant of the detector pixels, but not by the scanning speed of the ROIC, as commonly found in the conventional microbolometer ROICs performing line-by-line (rolling-line) readout operation. The signal integration is performed at the pixel level in parallel for the whole array, and signal integration time can be programmed from 0.1 µs up to 100 ms in steps of 0.1 µs. The ROIC is designed to work with high-resistance detector arrays with pixel resistance values higher than 250 kΩ. The detector bias voltage can be programmed on-chip over a 2 V range with a resolution of 1 mV. The ROIC has a measured input referred noise of 260 µV rms at 300 K. The ROIC can be used to build a microbolometer infrared sensor with an NETD value below 100 mK using a microbolometer detector array fabrication technology with a high detector resistance value (≥ 250 K

  8. Chemistry of the superheavy elements.

    Science.gov (United States)

    Schädel, Matthias

    2015-03-13

    The quest for superheavy elements (SHEs) is driven by the desire to find and explore one of the extreme limits of existence of matter. These elements exist solely due to their nuclear shell stabilization. All 15 presently 'known' SHEs (11 are officially 'discovered' and named) up to element 118 are short-lived and are man-made atom-at-a-time in heavy ion induced nuclear reactions. They are identical to the transactinide elements located in the seventh period of the periodic table beginning with rutherfordium (element 104), dubnium (element 105) and seaborgium (element 106) in groups 4, 5 and 6, respectively. Their chemical properties are often surprising and unexpected from simple extrapolations. After hassium (element 108), chemistry has now reached copernicium (element 112) and flerovium (element 114). For the later ones, the focus is on questions of their metallic or possibly noble gas-like character originating from interplay of most pronounced relativistic effects and electron-shell effects. SHEs provide unique opportunities to get insights into the influence of strong relativistic effects on the atomic electrons and to probe 'relativistically' influenced chemical properties and the architecture of the periodic table at its farthest reach. In addition, they establish a test bench to challenge the validity and predictive power of modern fully relativistic quantum chemical models. © 2015 The Author(s) Published by the Royal Society. All rights reserved.

  9. 30 CFR 256.5 - Definitions.

    Science.gov (United States)

    2010-07-01

    ... gas from vessels, pipelines, or other transshipment facilities; (h) Marine environment means the... zone and on the Outer Continental Shelf; (i) Coastal environment means the physical, atmospheric, and... coastal zone; (j) Human environment means the physical, social, and economic components, conditions, and...

  10. 49 CFR 256.3 - Definitions.

    Science.gov (United States)

    2010-10-01

    ... and others, and other public activities supported in whole or in part under Federal law. (g) Council...: Intercity bus, commuter rail, intra-city rail transit and bus transportation, airport limousine service and... Railroad Revitalization and Regulatory Reform Act of 1976, as amended, Public Law 94-210, 90 Stat. 125, 49...

  11. 25 CFR 256.2 - Definitions.

    Science.gov (United States)

    2010-04-01

    ... standards for the region; (ii) The heating system must have the capacity to maintain a minimum temperature... economical access to utilities and must be easy to enter and leave; and (ix) Aesthetics and access to school...

  12. 40 CFR 256.10 - Requirements.

    Science.gov (United States)

    2010-07-01

    ... subpart D of this part. (e) State, substate and private sector responsibilities shall be identified for the planning and implementation of solid and hazardous waste management facilities and services. (f) Financial assistance under sections 4008(a) (1) and (2) shall be allocated by the State to State and...

  13. 30 CFR 256.22 - General.

    Science.gov (United States)

    2010-07-01

    ... area. [51 FR 6107, Feb. 20, 1986] ... Director shall prepare a report describing the general geology and potential mineral resources of the area... describing, to the extent known, any other valuable resources contained within the general area and the...

  14. 30 CFR 256.40 - Definitions.

    Science.gov (United States)

    2010-07-01

    ... means: (1) With respect to crude oil—having either an economic interest in or a power of disposition... Resources MINERALS MANAGEMENT SERVICE, DEPARTMENT OF THE INTERIOR OFFSHORE LEASING OF SULPHUR OR OIL AND GAS... an oil and gas lease under section 8(a) of the Act. (b) Joint bid means a bid submitted by two or...

  15. 49 CFR 256.5 - Eligibility.

    Science.gov (United States)

    2010-10-01

    ... reasonable opportunity to review and comment upon the project as it affects property listed or eligible for... passenger terminal, features which appear reasonably likely to attract private investors willing to finance...

  16. 49 CFR 256.11 - Applications.

    Science.gov (United States)

    2010-10-01

    ..., implementation, or operation of each project, along with a discussion of the role of each organization; (2) A...); (20) An opinion of the applicant's legal counsel advising that— (i) Counsel is familiar with— (A) The... organization's role; (4) A full discussion of the desirability and feasibility of the project and a summary of...

  17. 40 CFR 256.50 - Requirements.

    Science.gov (United States)

    2010-07-01

    ... supply, waste water treatment, pesticides, ocean protection, toxic substances control, noise control, and... sludge in reclamation), (iii) U.S. Geological Survey (wetlands, floodplains, ground water); (2..., including Soil Conservation Service (land spreading solid waste on food chain croplands); (5) Federal...

  18. 32 CFR 256.4 - Policy.

    Science.gov (United States)

    2010-07-01

    ... each Clear Zone, Accident Potential Zone, Noise Zone and combination of these as appropriate. (iii) The... practicable. (B) Outside the clear zone, program for the acquisition of interests, first in Accident Potential... assure that a decision to change or relocate a mission is fully justified and that all aspects of the...

  19. 42_256 - 261_Rafukka paper

    African Journals Online (AJOL)

    user pc

    2017-12-02

    Dec 2, 2017 ... around the world with aim of ensuring safety for ... work is aimed at assessing the difference between the anthropome female adults from three ..... on obesity and blood pressure in developing countries: A ... Malaysian Journal of Public Health Medicine, ... Anthropometry Survey of Nigerian Occupational.

  20. Image Filtering with Boolean and Statistical Operators.

    Science.gov (United States)

    1983-12-01

    S3(2) COMPLEX AMAT(256, 4). BMAT (256. 4). CMAT(256. 4) CALL IOF(3. MAIN. AFLNM. DFLNI, CFLNM. MS., 82, S3) CALL OPEN(1.AFLNM* 1.IER) CALL CHECKC!ER...RDBLK(2. 6164. MAT. 16, IER) CALL CHECK(IER) DO I K-1. 4 DO I J-1.256 CMAT(J. K)-AMAT(J. K)’. BMAT (J. K) I CONTINUE S CALL WRBLK(3. 164!. CMAT. 16. IER

  1. DOD Product Support Business Case Analysis Guidebook

    Science.gov (United States)

    2011-04-01

    Cargo Aircraft; Mike Tesi , 256-313-3745 10 Automatic Requirements Computation System Initial Provisioning (ARCSIP) CECOM; Ken Steinberg, LEO...Block III 256-313- 4988 PM Aviation Systems, PD Joint Cargo Aircraft Mike Tesi , 256- 313-3745 16 Computerized Optimization Model for

  2. Improved coronary in-stent visualization using a combined high-resolution kernel and a hybrid iterative reconstruction technique at 256-slice cardiac CT—Pilot study

    International Nuclear Information System (INIS)

    Oda, Seitaro; Utsunomiya, Daisuke; Funama, Yoshinori; Takaoka, Hiroko; Katahira, Kazuhiro; Honda, Keiichi; Noda, Katsuo; Oshima, Shuichi; Yamashita, Yasuyuki

    2013-01-01

    Objectives: To investigate the diagnostic performance of 256-slice cardiac CT for the evaluation of the in-stent lumen by using a hybrid iterative reconstruction (HIR) algorithm combined with a high-resolution kernel. Methods: This study included 28 patients with 28 stents who underwent cardiac CT. Three different reconstruction images were obtained with: (1) a standard filtered back projection (FBP) algorithm with a standard cardiac kernel (CB), (2) an FBP algorithm with a high-resolution cardiac kernel (CD), and (3) an HIR algorithm with the CD kernel. We measured image noise and kurtosis and used receiver operating characteristics analysis to evaluate observer performance in the detection of in-stent stenosis. Results: Image noise with FBP plus the CD kernel (80.2 ± 15.5 HU) was significantly higher than with FBP plus the CB kernel (28.8 ± 4.6 HU) and HIR plus the CD kernel (36.1 ± 6.4 HU). There was no significant difference in the image noise between FBP plus the CB kernel and HIR plus the CD kernel. Kurtosis was significantly better with the CD- than the CB kernel. The kurtosis values obtained with the CD kernel were not significantly different between the FBP- and HIR reconstruction algorithms. The areas under the receiver operating characteristics curves with HIR plus the CD kernel were significantly higher than with FBP plus the CB- or the CD kernel. The difference between FBP plus the CB- or the CD kernel was not significant. The average sensitivity, specificity, and positive and negative predictive value for the detection of in-stent stenosis were 83.3, 50.0, 33.3, and 91.6% for FBP plus the CB kernel, 100, 29.6, 40.0, and 100% for FBP plus the CD kernel, and 100, 54.5, 40.0, and 100% for HIR plus the CD kernel. Conclusions: The HIR algorithm combined with the high-resolution kernel significantly improved diagnostic performance in the detection of in-stent stenosis

  3. Assessment of consistency of the whole tumor and single section perfusion imaging with 256-slice spiral CT: a preliminary study

    International Nuclear Information System (INIS)

    Sun Hongliang; Xu Yanyan; Hu Yingying; Tian Yuanjiang; Wang Wu

    2014-01-01

    Objective: To determine the consistency between quantitative CT perfusion measurements of colorectal cancer obtained from single section with maximal tumor dimension and from average of whole tumor, and compare intra- and inter-observer consistency of the two analysis methods. Methods: Twenty-two patients with histologically proven colorectal cancer were examined prospectively with 256-slice CT and the whole tumor perfusion images were obtained. Perfusion parameters were obtained from region of interest (ROI) inserted in single section showing maximal tumor dimension, then from ROI inserted in all tumor-containing sections by two radiologists. Consistency between values of blood flow (BF), blood volume (BV) and time to peak (TTP) calculated by two methods was assessed. Intra-observer consistency was evaluated by comparing repeated measurements done by the same radiologist using both methods after 3 months. Perfusion measurements were done by another radiologist independently to assess inter-observer consistency of both methods. The results from different methods were compared using paired t test and Bland-Altman plot. Results: Twenty-two patients were examined successfully. The perfusion parameters BF, BV and TTP obtained by whole tumor perfusion and single-section analysis were (35.59 ± 14.59) ml · min -1 · 100 g -1 , (17.55 ±4.21) ml · 100 g -1 , (21.30 ±7.57) s and (34.64 ± 13.29)ml · min -1 · 100 g -1 , (17.61 ±6.39)ml · 100 g -1 , (19.82 ±9.01) s, respectively. No significant differences were observed between the means of the perfusion parameters (BF, BV, TTP) calculated by the two methods (t=0.218, -0.033, -0.668, P>0.05, respectively). The intra-observer 95% limits of consistency of perfusion parameters were BF -5.3% to 10.0%, BV -13.8% to 10.8%, TTP -15.0% to 12.6% with whole tumor analysis, respectively; BF -14.3% to 16.5%, BV -24.2% to 22.2%, TTP -19.0% to 16.1% with single section analysis, respectively. The inter-observer 95% limits of

  4. Some aspects of adaptive transform coding of multispectral data

    Science.gov (United States)

    Ahmed, N.; Natarajan, T.

    1977-01-01

    This paper concerns a data compression study pertaining to multi-spectral scanner (MSS) data. The motivation for this undertaking is the need for securing data compression of images obtained in connection with the Landsat Follow-On Mission, where a compression of at least 6:1 is required. The MSS data used in this study consisted of four scenes: Tristate, consisting of 256 pels per row and a total of 512 rows - i.e., (256x512), (2) Sacramento (256x512), (3) Portland (256x512), and (4) Bald Knob (200x256). All these scenes were on digital tape at 6 bits/pel. The corresponding reconstructed scenes of 1 bit/pel (i.e., a 6:1 compression) are included.

  5. Chemical behaviour of a few atoms of rutherfordium (Rf, Z= 104) and of dubnium (Db, Z= 105) produced at Orsay

    International Nuclear Information System (INIS)

    Trubert, D.; Hussonnois, M.; Le Naour, C.; Brillard, L.; Monroy Guzman, F.; Le Du, J.F.; Servajean, V.

    1998-01-01

    The isotopes 261 Rf and 262 Db were produced by irradiation of a 248 Cm target with respectively 18 O and 19 F ions, at the MP Tandem accelerator of Orsay (France). These isotopes were isolated in HF medium, using he RACHEL setup. Moreover, the radioisotope 262 DB was produced by a nuclear reaction. (authors)

  6. Chemical Identification of Dubnium as a Decay Product of Element 115 Produced in the Reaction $\\rm {^{48}Ca}+{^{243}Am}$

    CERN Document Server

    Dmitriev, S N; Utyonkov, V K; Shishkin, S V; Eremin, A V; Lobanov, Yu V; Chepigin, V I; Sokol, E A; Tsyganov, Yu S; Vostokin, G K; Aksenov, N V; Hussonnois, M; Itkis, M G; Aggeler, H W; Schumann, D; Bruchertseifer, H; Eichler, R; Shaughnessy, D A; Wilk, P A; Kenneally, J M; Stoyer, M A; Wild, J F

    2004-01-01

    The results of an experiment designed to identify $^{268}$Db as the terminal isotope in the $\\alpha $-decay chain of element 115 produced via the ${\\rm {^{243}Am}}({\\rm {^{48}Ca}},3n){\\rm {^{288}115}}$ reaction are presented. The $^{243}$Am target was bombarded with a beam dose of $3.4\\cdot 10^{18}$ $^{48}$Ca projectiles at an energy of 247 MeV at the center of the target. The reaction products were collected in the surface layer of a copper catcher block, which was removed with a lathe and then dissolved in concentrated HNO$_{3}$. The group-5 elements were separated by sorption onto Dowex $50{\\times} 8$ cation-exchange resin with subsequent desorption using 1 M HF, which forms anionic fluoride complexes of group-5 elements. The eluent was evaporated onto a 0.4 $\\mu$m thick polyethylene foil that was placed between a pair of semiconductor detectors surrounded by $^{3}$He neutron counters for measurement of $\\alpha$ particles, fission fragments, and neutrons. In the course of the experiment, we observed 15 spo...

  7. 17 CFR 256.236 - Taxes accrued.

    Science.gov (United States)

    2010-04-01

    ... credited with the amount of taxes accrued during the accounting period, corresponding debits being made to... be kept so as to show for each class of taxes the amount accrued, the basis for the accrual, the...

  8. Publications | Page 256 | IDRC - International Development ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    We share the results of our funded research, and offer free training materials to ... linkages of oil and gas industry in the Nigerian economy (restricted access) ... on access to sexual and reproductive health services and information of women ...

  9. Publications | Page 256 | IDRC - International Development ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    IDRC works with developing-country researchers and institutions to build local capacity through funding, knowledge sharing, and training. Through books, articles, research publications, and studies, we aim to widen the impact of our investment and advance development research. We share the results of our funded ...

  10. (256-IJBCS-Article-H Yédomonhan)

    African Journals Online (AJOL)

    RHUMSIKI

    Apicultura, 22(3): 156-158. Nacoulma O, Millogo-Rasolodimby J. 1995. Les produits de la ruche et leurs utilisations au Burkina Faso. Revue de. Médecines et Pharmacopées Africaines,. 9(2): 63-70. Nombré I. 2003. Etudes des potentialités mellifères de deux zones du Burkina. Faso : Garango (Province du Bouglou) et.

  11. Publications | Page 256 | IDRC - International Development ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Managing Natural Resources for Development in Africa: A Resource Book ... Globalization, the information age, and the rise of the knowledge-based economy are ... This paper uses development theory to examine the embedding of relations ...

  12. 256 253 Profitability Analysis of Groundnut

    African Journals Online (AJOL)

    2008-12-02

    Dec 2, 2008 ... Metropolitan Council of Borno State, Nigeria. * A. Iliyasu, I. ... processing and determine the return on investment in groundnut processing in the study area. Structured ... It was recommended that large scale groundnut production should be encouraged .... increasing rate, increases at decreasing rate and.

  13. 17 CFR 256.01-7 - Records.

    Science.gov (United States)

    2010-04-01

    ... accounts and financial statements shall be maintained in accordance with Regulation S-X and Accounting... company. The service company is authorized to make such subdivisions, reclassification, or consolidations...

  14. 49 CFR 256.7 - Financial assistance.

    Science.gov (United States)

    2010-10-01

    ... project implementation; (2) Final architectural and engineering construction documentation, including all..., (B) intercity bus terminal and docking facilities, (C) adequate facilities for local mass transit... architectural and engineering design documents for the project, including: (i) Plans, sections, and sketches...

  15. 76 FR 256 - Informed Consent Elements

    Science.gov (United States)

    2011-01-04

    ....ClinicalTrials.gov Web site in order to enhance the system of checks and balances for the research... registry databank maintained by the National Institutes of Health/National Library of Medicine (NIH/ NLM... students, and others. To make it easier to identify comments and our responses, the word ``Comment,'' in...

  16. 17 CFR 256.924 - Property insurance.

    Science.gov (United States)

    2010-04-01

    ... insurance premiums to protect the service company against losses and damages to owned or leased property... covered, and the applicable premiums. Any dividends distributed by mutual insurance companies shall be credited to the accounts to which the insurance premiums were charged. ...

  17. Malignant neoplasms of the nasal cavity and paranasal sinuses: a series of 256 patients in Mexico City and Monterrey. Is air pollution the missing link?

    Science.gov (United States)

    Calderón-Garcidueñas, L; Delgado, R; Calderón-Garcidueñas, A; Meneses, A; Ruiz, L M; De La Garza, J; Acuna, H; Villarreal-Calderón, A; Raab-Traub, N; Devlin, R

    2000-04-01

    Air pollution is a serious health problem in major cities in Mexico. The concentrations of monitored criteria pollutants have been above the US National Ambient Air Quality Standards for the last decade. To determine whether the number of primary malignant nasal and paranasal neoplasms has increased, we surveyed 256 such cases admitted to a major adult oncology hospital located in metropolitan Mexico City (MMC) for the period from 1976-1997 and to a tertiary hospital in Monterrey, an industrial city, for the period from 1993-1998. The clinical histories and histopathologic material were reviewed, and a brief clinical summary was written for each case. In the MMC hospital the number of newly diagnosed nasal and paranasal neoplasms per year for the period from 1976-1986 averaged 5.1, whereas for the next 11 years it increased to 12.5. The maximal increase was observed in 1995-1997, with an average of 20.3 new cases per year (P = 0.0006). The predominant neoplasms in these series were non-Hodgkin's lymphoma, squamous cell carcinoma, melanoma, adenocarcinoma, Schneiderian carcinoma, and nasopharyngeal carcinoma. In the Monterrey hospital a 2-fold increase in the numbers of newly diagnosed nasal and paranasal neoplasms was recorded between 1993 and 1998. The predominant MMC neoplasm in this series, namely nasal T-cell/natural killer cell non-Hodgkin's lymphoma, is potentially Epstein-Barr virus related. Nasal and paranasal malignant neoplasms are generally rare. Environmental causative factors include exposure in industries such as nickel refining, leather, and wood furniture manufacturing. Although epidemiologic studies have not addressed the relationship between outdoor air pollution and sinonasal malignant neoplasms, there is strong evidence for the nasal and paranasal carcinogenic effect of occupational aerosol complex chemical mixtures. General practitioners and ear, nose, and throat physicians working in highly polluted cities should be aware of the clinical

  18. Imaging thrombus with radiolabelled monoclonal antibody to platelets

    Energy Technology Data Exchange (ETDEWEB)

    Peters, A.M.; Lavender, J.P.; Needham, S.G.; Loutfi, I.; Snook, D.; Epenetos, A.A.; Lumley, P.; Keery, R.J.; Hogg, N.

    1986-12-13

    A study was conducted evaluating a method of imaging thrombus with platelets radiolabelled with a /sup 111/In labelled monoclonal antibody, P256, directed to the platelet surface glycoprotein complex IIb/IIIa. when the number of receptors occupied by P256 was less than 3% of the total available on the platelet surface, platelet function was undisturbed. P256 was radiolabelled with /sup 111/In using diethylenetriaminepenta-acetic acid, which achieved a specific activity of 185 MBq (5 mCi)/mg. No impairment of immunoreactivity was detected at this specific activity. Platelets were labelled with radiolabelled monoclonal antibody in vitro in two patients at a receptor occupancy of 6% and in vivo in six patients at a receptor occupancy of 1%. In vivo recovery and biodistribution kinetics suggested that after in vitro labelling platelets were minimally activated. The /sup 111/In kinetics recorded after intravenous P256 suggested rapid and efficient radiolabelling of platelets and gave no indication of platelet activation. Of the six patients who received intravenous P256, three had documented thrombus, two of whom gave positive results on P256 platelet scintigraphy. The third had chronic deep venous thrombosis and was scintigraphically negative.

  19. Role of multiple phosphorylation sites in the COOH-terminal tail of aquaporin-2 for water transport: evidence against channel gating

    DEFF Research Database (Denmark)

    Moeller, Hanne B; Macaulay, Nanna; Knepper, Mark A

    2009-01-01

    demonstrated that lack of phosphorylation at S256, S261, S264, or S269 had no effect on AQP2 unit water transport. Similarly, no effect on AQP2 unit water transport was observed for the 264D and 269D forms, indicating that phosphorylation of the COOH-terminal tail of AQP2 is not involved in gating......Arginine vasopressin (AVP)-regulated phosphorylation of the water channel aquaporin-2 (AQP2) at serine 256 (S256) is essential for its accumulation in the apical plasma membrane of collecting duct principal cells. In this study, we examined the role of additional AVP-regulated phosphorylation sites...... in the COOH-terminal tail of AQP2 on protein function. When expressed in Xenopus laevis oocytes, prevention of AQP2 phosphorylation at S256A (S256A-AQP2) reduced osmotic water permeability threefold compared with wild-type (WT) AQP2-injected oocytes. In contrast, prevention of AQP2 single phosphorylation at S...

  20. Structure-guided modification of Rhizomucor miehei lipase for production of structured lipids.

    Directory of Open Access Journals (Sweden)

    Jun-Hui Zhang

    Full Text Available To improve the performance of yeast surface-displayed Rhizomucor miehei lipase (RML in the production of human milk fat substitute (HMFS, we mutated amino acids in the lipase substrate-binding pocket based on protein hydrophobicity, to improve esterification activity. Five mutants: Asn87Ile, Asn87Ile/Asp91Val, His108Leu/Lys109Ile, Asp256Ile/His257Leu, and His108Leu/Lys109Ile/Asp256Ile/His257Leu were obtained and their hydrolytic and esterification activities were assayed. Using Discovery Studio 3.1 to build models and calculate the binding energy between lipase and substrates, compared to wild-type, the mutant Asp256Ile/His257Leu was found to have significantly lower energy when oleic acid (3.97 KJ/mol decrease and tripalmitin (7.55 KJ/mol decrease were substrates. This result was in accordance with the esterification activity of Asp256Ile/His257Leu (2.37-fold of wild-type. The four mutants were also evaluated for the production of HMFS in organic solvent and in a solvent-free system. Asp256Ile/His257Leu had an oleic acid incorporation of 28.27% for catalyzing tripalmitin and oleic acid, and 53.18% for the reaction of palm oil with oleic acid. The efficiency of Asp256Ile/His257Leu was 1.82-fold and 1.65-fold that of the wild-type enzyme for the two reactions. The oleic acid incorporation of Asp256Ile/His257Leu was similar to commercial Lipozyme RM IM for palm oil acidolysis with oleic acid. Yeast surface-displayed RML mutant Asp256Ile/His257Leu is a potential, economically feasible catalyst for the production of structured lipids.

  1. Structure-guided modification of Rhizomucor miehei lipase for production of structured lipids.

    Science.gov (United States)

    Zhang, Jun-Hui; Jiang, Yu-Yan; Lin, Ying; Sun, Yu-Fei; Zheng, Sui-Ping; Han, Shuang-Yan

    2013-01-01

    To improve the performance of yeast surface-displayed Rhizomucor miehei lipase (RML) in the production of human milk fat substitute (HMFS), we mutated amino acids in the lipase substrate-binding pocket based on protein hydrophobicity, to improve esterification activity. Five mutants: Asn87Ile, Asn87Ile/Asp91Val, His108Leu/Lys109Ile, Asp256Ile/His257Leu, and His108Leu/Lys109Ile/Asp256Ile/His257Leu were obtained and their hydrolytic and esterification activities were assayed. Using Discovery Studio 3.1 to build models and calculate the binding energy between lipase and substrates, compared to wild-type, the mutant Asp256Ile/His257Leu was found to have significantly lower energy when oleic acid (3.97 KJ/mol decrease) and tripalmitin (7.55 KJ/mol decrease) were substrates. This result was in accordance with the esterification activity of Asp256Ile/His257Leu (2.37-fold of wild-type). The four mutants were also evaluated for the production of HMFS in organic solvent and in a solvent-free system. Asp256Ile/His257Leu had an oleic acid incorporation of 28.27% for catalyzing tripalmitin and oleic acid, and 53.18% for the reaction of palm oil with oleic acid. The efficiency of Asp256Ile/His257Leu was 1.82-fold and 1.65-fold that of the wild-type enzyme for the two reactions. The oleic acid incorporation of Asp256Ile/His257Leu was similar to commercial Lipozyme RM IM for palm oil acidolysis with oleic acid. Yeast surface-displayed RML mutant Asp256Ile/His257Leu is a potential, economically feasible catalyst for the production of structured lipids.

  2. Processing of A New Digital Orthoimage Map of The Martian Western Hemisphere Using Data Obtained From The Mars Orbiter Camera At A Resolution of 256 Pixel/deg

    Science.gov (United States)

    Wählisch, M.; Niedermaier, G.; van Gasselt, S.; Scholten, F.; Wewel, F.; Roatsch, T.; Matz, K.-D.; Jaumann, R.

    We present a new digital orthoimage map of Mars using data obtained from the CCD line scanner Mars Orbiter Camera (MOC) of the Mars Global Surveyor Mis- sion (MGS) [1,2]. The map covers the Mars surface from 0 to 180 West and from 60 South to 60 North with the MDIM2 resolution of 256 pixel/degree and size. Image data processing has been performed using multiple programs, developed by DLR, Technical University of Berlin [3], JPL, and the USGS. 4,339 Context and 183 Geodesy images [2] were included. After radiometric corrections, the images were Mars referenced [4], geometrically corrected [5] and orthoprojected using a global Martian Digital Terrain Model (DTM) with a resolution of 64 pixel/degree, developed at DLR and based on MGS Mars Orbiter Laser Altimeter (MOLA) data [6]. To elim- inate major differences in brightness between the individual images of the mosaics, high- and low-pass filter processing techniques were applied for each image. After filtering, the images were mosaicked without registering or using block adjustment techniques in order to improve the geometric quality. It turns out that the accuracy of the navigation data has such a good quality that the orthoimages fit very well to each other. When merging the MOC mosaic with the MOLA data using IHS- trans- formation, we recognized very good correspondence between these two datasets. We create a topographic image map of the Coprates region (MC­18) adding contour lines derived from the global DTM to the mosaic. These maps are used for geological and morphological interpretations in order to review and improve our current Viking-based knowledge about the Martian surface. References: [1] www.mssss.com, [2] Caplinger, M. and M. Malin, "The Mars Or- biter Camera Geodesy Campaign, JGR, in press, [3] Scholten, F., Vol XXXI, Part B2, Wien 1996, p.351-356, [4] naïf.jpl.nasa.gov, [5] R.L.Kirk. et al. (2001), "Geometric Calibration of the Mars Orbiter Cameras and Coalignment with Mars Orbiter Laser Altimeter

  3. 40 CFR 256.05 - Annual work program.

    Science.gov (United States)

    2010-07-01

    ... FOR DEVELOPMENT AND IMPLEMENTATION OF STATE SOLID WASTE MANAGEMENT PLANS Purpose, General Requirements... included by reference in the annual work program: (1) Substate solid waste management plans, (2) Plans for the development of facilities and services, including hazardous waste management facilities and...

  4. 40 CFR 98.256 - Data reporting requirements.

    Science.gov (United States)

    2010-07-01

    ... you use Equation Y-12 of this subpart, the annual volumetric flow to the sulfur recovery plant (in scf..., the typical gauge pressure of the coking drum when first vented to the atmosphere, typical void.../kg-mole gas, wet basis). (5) The basis for the volumetric void fraction of the coke vessel prior to...

  5. 40 CFR 60.256 - Continuous monitoring requirements.

    Science.gov (United States)

    2010-07-01

    ... facilities that use wet scrubber emission control equipment: (A) A monitoring device for the continuous measurement of the pressure loss through the venturi constriction of the control equipment. The monitoring... paragraph (c) of this section. (2) For mechanical vents with wet scrubbers, monitoring devices according to...

  6. 38 CFR 3.256 - Eligibility reporting requirements.

    Science.gov (United States)

    2010-07-01

    ...) Income; (2) Net worth or corpus of estate; (3) Marital status; (4) Nursing home patient status; (5... circumstances: (i) If the Social Security Administration has not verified the beneficiary's Social Security number and, if the beneficiary is married, his or her spouse's Social Security number. (ii) If there is...

  7. 17 CFR 256.01-10 - Billing procedures.

    Science.gov (United States)

    2010-04-01

    ... accounts prescribed by the regulatory authorities to which it is subject. Each month a statement shall be rendered to the associate company containing a summary of the accounts by work order by which the charges...) UNIFORM SYSTEM OF ACCOUNTS FOR MUTUAL SERVICE COMPANIES AND SUBSIDIARY SERVICE COMPANIES, PUBLIC UTILITY...

  8. 43 CFR 2.56 - Disclosure of records.

    Science.gov (United States)

    2010-10-01

    ... transferred in a form that is not individually identifiable; (4) To the National Archives and Records... instrumentality of any governmental jurisdiction within or under the control of the United States for a civil or... instrumentality has made a written request to the Department specifying the particular portion desired and the law...

  9. 30 CFR 256.32 - Notice of sale.

    Science.gov (United States)

    2010-07-01

    ... bids shall be filed, and the place, date and hour at which bids shall be opened. The notice shall... conditions of the sale. (b) Tracts shall be offered for lease by competitive sealed bidding under conditions specified in the notice of lease sale and in accordance with all applicable laws and regulations. A...

  10. Technical Note: Evaluation of a 160-mm/256-row CT scanner for whole-heart quantitative myocardial perfusion imaging

    Energy Technology Data Exchange (ETDEWEB)

    So, Aaron, E-mail: aso@robarts.ca [Imaging Program, Lawson Health Research Institute, London, Ontario N6A 4V2 (Canada); Imai, Yasuhiro; Nett, Brian; Jackson, John; Nett, Liz; Hsieh, Jiang [CT Engineering, GE Healthcare, Waukesha, Wisconsin 53188 (United States); Wisenberg, Gerald; Teefy, Patrick; Yadegari, Andrew [Cardiology, University Hospital, London Health Sciences Centre, London, Ontario N6A 5A5 (Canada); Islam, Ali [Radiology, St. Joseph’s Hospital London, Ontario N6A 4V2 (Canada); Lee, Ting-Yim [Imaging Program, Lawson Health Research Institute, London, Ontario N6A 4V2, Canada and Imaging Research Laboratories, Robarts Research Institute, London, Ontario N6A 5K8 (Canada)

    2016-08-15

    Purpose: The authors investigated the performance of a recently introduced 160-mm/256-row CT system for low dose quantitative myocardial perfusion (MP) imaging of the whole heart. This platform is equipped with a gantry capable of rotating at 280 ms per full cycle, a second generation of adaptive statistical iterative reconstruction (ASiR-V) to correct for image noise arising from low tube voltage potential/tube current dynamic scanning, and image reconstruction algorithms to tackle beam-hardening, cone-beam, and partial-scan effects. Methods: Phantom studies were performed to investigate the effectiveness of image noise and artifact reduction with a GE Healthcare Revolution CT system for three acquisition protocols used in quantitative CT MP imaging: 100, 120, and 140 kVp/25 mAs. The heart chambers of an anthropomorphic chest phantom were filled with iodinated contrast solution at different concentrations (contrast levels) to simulate the circulation of contrast through the heart in quantitative CT MP imaging. To evaluate beam-hardening correction, the phantom was scanned at each contrast level to measure the changes in CT number (in Hounsfield unit or HU) in the water-filled region surrounding the heart chambers with respect to baseline. To evaluate cone-beam artifact correction, differences in mean water HU between the central and peripheral slices were compared. Partial-scan artifact correction was evaluated from the fluctuation of mean water HU in successive partial scans. To evaluate image noise reduction, a small hollow region adjacent to the heart chambers was filled with diluted contrast, and contrast-to-noise ratio in the region before and after noise correction with ASiR-V was compared. The quality of MP maps acquired with the CT system was also evaluated in porcine CT MP studies. Myocardial infarct was induced in a farm pig from a transient occlusion of the distal left anterior descending (LAD) artery with a catheter-based interventional procedure. MP

  11. Technical Note: Evaluation of a 160-mm/256-row CT scanner for whole-heart quantitative myocardial perfusion imaging

    International Nuclear Information System (INIS)

    So, Aaron; Imai, Yasuhiro; Nett, Brian; Jackson, John; Nett, Liz; Hsieh, Jiang; Wisenberg, Gerald; Teefy, Patrick; Yadegari, Andrew; Islam, Ali; Lee, Ting-Yim

    2016-01-01

    Purpose: The authors investigated the performance of a recently introduced 160-mm/256-row CT system for low dose quantitative myocardial perfusion (MP) imaging of the whole heart. This platform is equipped with a gantry capable of rotating at 280 ms per full cycle, a second generation of adaptive statistical iterative reconstruction (ASiR-V) to correct for image noise arising from low tube voltage potential/tube current dynamic scanning, and image reconstruction algorithms to tackle beam-hardening, cone-beam, and partial-scan effects. Methods: Phantom studies were performed to investigate the effectiveness of image noise and artifact reduction with a GE Healthcare Revolution CT system for three acquisition protocols used in quantitative CT MP imaging: 100, 120, and 140 kVp/25 mAs. The heart chambers of an anthropomorphic chest phantom were filled with iodinated contrast solution at different concentrations (contrast levels) to simulate the circulation of contrast through the heart in quantitative CT MP imaging. To evaluate beam-hardening correction, the phantom was scanned at each contrast level to measure the changes in CT number (in Hounsfield unit or HU) in the water-filled region surrounding the heart chambers with respect to baseline. To evaluate cone-beam artifact correction, differences in mean water HU between the central and peripheral slices were compared. Partial-scan artifact correction was evaluated from the fluctuation of mean water HU in successive partial scans. To evaluate image noise reduction, a small hollow region adjacent to the heart chambers was filled with diluted contrast, and contrast-to-noise ratio in the region before and after noise correction with ASiR-V was compared. The quality of MP maps acquired with the CT system was also evaluated in porcine CT MP studies. Myocardial infarct was induced in a farm pig from a transient occlusion of the distal left anterior descending (LAD) artery with a catheter-based interventional procedure. MP

  12. Technical Note: Evaluation of a 160-mm/256-row CT scanner for whole-heart quantitative myocardial perfusion imaging.

    Science.gov (United States)

    So, Aaron; Imai, Yasuhiro; Nett, Brian; Jackson, John; Nett, Liz; Hsieh, Jiang; Wisenberg, Gerald; Teefy, Patrick; Yadegari, Andrew; Islam, Ali; Lee, Ting-Yim

    2016-08-01

    The authors investigated the performance of a recently introduced 160-mm/256-row CT system for low dose quantitative myocardial perfusion (MP) imaging of the whole heart. This platform is equipped with a gantry capable of rotating at 280 ms per full cycle, a second generation of adaptive statistical iterative reconstruction (ASiR-V) to correct for image noise arising from low tube voltage potential/tube current dynamic scanning, and image reconstruction algorithms to tackle beam-hardening, cone-beam, and partial-scan effects. Phantom studies were performed to investigate the effectiveness of image noise and artifact reduction with a GE Healthcare Revolution CT system for three acquisition protocols used in quantitative CT MP imaging: 100, 120, and 140 kVp/25 mAs. The heart chambers of an anthropomorphic chest phantom were filled with iodinated contrast solution at different concentrations (contrast levels) to simulate the circulation of contrast through the heart in quantitative CT MP imaging. To evaluate beam-hardening correction, the phantom was scanned at each contrast level to measure the changes in CT number (in Hounsfield unit or HU) in the water-filled region surrounding the heart chambers with respect to baseline. To evaluate cone-beam artifact correction, differences in mean water HU between the central and peripheral slices were compared. Partial-scan artifact correction was evaluated from the fluctuation of mean water HU in successive partial scans. To evaluate image noise reduction, a small hollow region adjacent to the heart chambers was filled with diluted contrast, and contrast-to-noise ratio in the region before and after noise correction with ASiR-V was compared. The quality of MP maps acquired with the CT system was also evaluated in porcine CT MP studies. Myocardial infarct was induced in a farm pig from a transient occlusion of the distal left anterior descending (LAD) artery with a catheter-based interventional procedure. MP maps were generated

  13. Screening of in vitro antimicrobial activity of plants used in traditional Indonesian medicine.

    Science.gov (United States)

    Romulo, Andreas; Zuhud, Ervizal A M; Rondevaldova, Johana; Kokoska, Ladislav

    2018-12-01

    In many regions of Indonesia, there are numerous traditional herbal preparations for treatment of infectious diseases. However, their antimicrobial potential has been poorly studied by modern laboratory methods. This study investigates in vitro antimicrobial activity of 49 ethanol extracts from 37 plant species used in Indonesian traditional medicine for treatment against Candida albicans, Enterococcus faecalis, Escherichia coli, Pseudomonas aeruginosa and Staphylococcus aureus. The plants were collected from the Biopharmaca collection garden, Bogor, Indonesia. The plant material was dried, finely grounded, extracted using ethanol, concentrated, and the dried residue was dissolved in 100% DMSO. Antimicrobial activity was determined in terms of a minimum inhibitory concentration (MIC) using a broth microdilution method in 96-well microplates. The extract of Orthosiphon aristatus (Blume) Miq. (Lamiaceae) leaf produced the strongest antimicrobial effect, inhibiting the growth of C. albicans (MIC 128 μg/mL), S. aureus (MIC 256 μg/mL), E. faecalis (MIC 256 μg/mL) and P. aeruginosa (MIC 256 μg/mL). The leaf extract of Woodfordia floribunda Salisb. (Lythraceae) also exhibited significant effect against C. albicans (MIC 128 μg/mL), S. aureus (MIC 256 μg/mL) and E. faecalis (MIC 256 μg/mL). Rotheca serrata (L.) Steane & Mabb. (Lamiaceae) leaf extract inhibited the growth of S. aureus (MIC 256 µg/mL) and C. albicans (MIC 256 µg/mL). The leaf extract of O. aristatus and W. floribunda exhibited a significant anti-candidal effect. Therefore, both of these plants can serve as prospective source materials for the development of new anti-candidal agents.

  14. Imaging thrombus with radiolabelled monoclonal antibody to platelets

    International Nuclear Information System (INIS)

    Loutfi, I.; Peters, A.M.; Lavender, J.P.; Epenetos, A.A.

    1988-01-01

    Indium-111-hydroxyquinoline labelled platelets, though useful in the detection of thrombus, have not gained widespread use owing to the time and technical skill required for their preparation. A study was therefore conducted evaluating a new method of imaging thrombus with platelets radiolabelled with a 111 In labelled monoclonal antibody, P 256 , directed to the platelet surface glycoprotein complex IIb/IIIa. When the number of receptors occupied by P 256 was less than 3% of the total available on the platelet surface platelet function, as assessed by platelet aggregometry, was undisturbed. P 256 was radiolabelled with 111 In using diethylenetriaminepenta-acetic acid, which achieved a specific activity of 185 MBq (5 mCi)/mg. No impairment of immunoreactivity was detected at this specific activity. Platelets were labelled with radiolabelled monoclonal antibody in vitro in two patients at a receptor occupancy of 6% and in vivo - that is, by direct intravenous injection of P 256 - in six patients at a receptor occupancy of 1%. In vivo recovery and biodistribution kinetics suggested that after in vitro labelling platelets were minimally activated. The 111 In kinetics recorded after intravenous P 256 suggested rapid and efficient radiolabelling of platelets and gave no indication of platelet activation. Of the six patients who received intravenous P 256 , three had documented thrombus, tow of whom gave positive results on P 256 platelet scintigraphy. The third subject had chromic deep venous thrombosis and was scintigraphically negative. Imaging thrombus using a radiolabelled monoclonal antibody directed to platelets appears to offer great potential as a simple, non-invasive approach to the diagnosis of thrombosis. 3 refs. (Author)

  15. Statistical Inference on Memory Structure of Processes and Its Applications to Information Theory

    Science.gov (United States)

    2016-05-12

    8217x’!will!correspond!with!the!stringoid! matrices! ! E4=C4*log(P4)! Ea4=matrix(E4[1:256])! Es4=matrix(E4[257:496])! ! EL4 =matrix(cbind(A4,E4),length...E4))! ELa4=matrix( EL4 [1:256,1:5],length(Ea4))! ELs4=matrix( EL4 [257:496,1:5],length(Es4))! ! Ea4a=matrix(rep(0,60))! for(i!in!1:256)! for(j!in!1:60

  16. Enhanced broadband (11-15 µm) QWIP FPAs for space applications

    Science.gov (United States)

    Nedelcu, Alexandru; de l'Isle, Nadia B.; Truffer, Jean-Patrick; Belhaire, Eric; Costard, Eric; Bois, Philippe; Merken, Patrick; Saint-Pé, Olivier

    2017-11-01

    A thirty months ESA project started in March 2008, whose purpose is to expand and assess the performance of broadband (11-15μm) quantum detectors for spectro-imaging applications: Fourier Transform Spectrometers and Dispersive Spectrometers. We present here the technical requirements, the development approach chosen as well as preliminary signal to noise ratio (SNR) calculations. Our approach is fully compatible with the final array format (1024x256, pitch 50-60μm). We expect the requested uniformity, operability and SNR levels to be achieved at the goal temperatures (60K for FTS applications and 50K for DS applications). The performance level will be demonstrated on 256x256, 50μm pitch arrays. Also, operability and uniformity issues will be addressed on large mechanical 1024x256 hybrid arrays.

  17. A Medipix2-based imaging system for digital mammography with silicon pixel detectors

    CERN Document Server

    Bisogni, M G; Fantacci, M E; Mettivier, G; Montesi, M C; Novelli, M; Quattrocchi, M; Rosso, V; Russo, P; Stefanini, A

    2004-01-01

    In this paper we present the first tests of a digital imaging system based on a silicon pixel detector bump-bonded to an integrated circuit operating in single photon counting mode. The X-rays sensor is a 300 mu m thick silicon, 14 by 14 mm/sup 2/, upon which a matrix of 256 * 256 pixels has been built. The read-out chip, named MEDIPIX2, has been developed at CERN within the MEDIPIX2 Collaboration and it is composed by a matrix of 256 * 256 cells, 55 * 55 mu m/sup 2/. The spatial resolution properties of the system have been assessed by measuring the square wave resolution function (SWRF) and first images of a standard mammographic phantom were acquired using a radiographic tube in the clinical irradiation condition. (5 refs).

  18. Productivity, Physicochemical Changes, and Antioxidant Activity of Shiitake Culinary-Medicinal Mushroom Lentinus edodes (Agaricomycetes) Cultivated on Lignocellulosic Residues.

    Science.gov (United States)

    Gaitán-Hernández, Rigoberto; Zavaleta, Marco Antonio Barradas; Aquino-Bolaños, Elia Nora

    2017-01-01

    The effects of substrate and strain on productivity, physicochemical characteristics, and compounds with antioxidant activity were evaluated in basidiomes of the shiitake mushroom, Lentinus edodes. Strains IE-245 and IE-256 and the substrates oak wood shavings (OW), sorghum stubble (SS), and sugar cane bagasse (SC) were used. Productivity was evaluated by measuring biological efficiency (BE), production rate (PR), and yield. Total sugars, total soluble solids, pH, titratable acidity, color parameters, total phenolics, flavonoids, ascorbic acid, and antioxidant activity of the basidiomes were measured. BE, PR and yield were higher with the combination IE-256/SS, at 103.71%, 1.32%, and 34.57%, respectively. The largest amount of total sugars (17.61 mg glucose · g-1 dry weight) was found with combination IE-256/SS. Variation was observed in basidiome color; the lowest luminosity (L*) value (darkest color) was found in the IE-256 strain on the OW substrate (L* = 30.45), whereas that of the IE-245 strain on the SC substrate was the lightest in color (L* = 57.00). The largest amounts of total phenolics were recorded in the IE-256 strain on the OW (6.50 mg gallic acid equivalents [GAE] · g-1 dry weight) and the SS substrates (5.85 mg GAE · g-1 dry weight). The best antioxidant activity was obtained with IE-256-0.80, 0.65, and 0.59 μmol Trolox equivalents · g dry weight-1-on the OW, SC, and SS substrates, respectively. Based on the values of BE, PR, and yield, IE-256/SS was the most productive. Substrate and strain, and their interactions, influenced the physicochemical characteristics of the basidiomes and the amounts of compounds with antioxidant activity they contained.

  19. Attosecond nanotechnology: NEMS of energy storage and nanostructural transformations in materials

    Energy Technology Data Exchange (ETDEWEB)

    Beznosyuk, Sergey A., E-mail: bsa1953@mail.ru; Maslova, Olga A., E-mail: maslova-o.a@mail.ru [Altai State University, Barnaul, 656049 (Russian Federation); Zhukovsky, Mark S., E-mail: zhukovsky@list.ru [Altai State Technical University, Barnaul, 656038 (Russian Federation)

    2015-10-27

    The attosecond technology of the nanoelectromechanical system (NEMS) energy storage as active center fast transformation of nanostructures in materials is considered. The self-organizing relaxation of the NEMS active center containing nanocube of 256-atoms limited by planes (100) in the FCC lattice matrix of 4d-transition metals (Ru, Rh, Pd) is described by the quantum NEMS-kinetics (NK) method. Typical for these metals change of the NEMS active center physicochemical characteristics during the time of relaxation is presented. There are three types of intermediate quasistationary states of the NEMS active center. Their forms are plainly distinguishable. The full relaxed NEMS active centers (Ru{sub 256}, Rh{sub 256}, Pd{sub 256}) accumulate next storage energies: E{sub Ru} = 2.27 eV/at, E{sub Rh} = 1.67 eV/at, E{sub Pd} = 3.02 eV/at.

  20. Das, Dr Amitava

    Indian Academy of Sciences (India)

    Date of birth: 24 December 1959. Specialization: Molecular Reactions, Supramolecular Chemistry, Assembly Photo-included Processes Address: Director, Central Salt & Marine Chemicals Research Institute, GB Marg, Bhavnagar 364 002, Gujarat Contact: Office: (0278) 256 9496. Residence: (0278) 256 2610. Mobile: ...

  1. Pati, Prof. Arun Kumar

    Indian Academy of Sciences (India)

    Specialization: Quantum Information Theory, Quantum Computing, Foundations of Quantum Theory Address: QIC Group, Physics Division, Harish Chandra Research Institute, Chhatnag Road, Jhusi, Allahabad 211 019, U.P.. Contact: Office: (0532) 227 4391. Mobile: 87566 12314. Fax: (0532) 256 9576, (0532) 256 7444

  2. Ornithinibacillus salinisoli sp. nov., a moderately halophilic bacterium isolated from a saline-alkali soil.

    Science.gov (United States)

    Gan, Longzhan; Zhang, Heming; Long, Xiufeng; Tian, Jiewei; Wang, Zhikuan; Zhang, Yuqin; Dai, Yumei; Tian, Yongqiang

    2018-03-01

    A taxonomic study was performed on strain LCB256 T , which was isolated from a saline-alkali soil sample taken from northwestern China. Cells of strain LCB256 T were Gram-stain-positive, aerobic, rod-shaped and grew at 3-17 % (w/v) NaCl (optimum 10-15 %), 10-52 °C (optimum 25-30 °C) and pH 7.0-9.0 (optimum 8.0). Phylogenetic analysis based on 16S rRNA gene sequences indicated that strain LCB256 T was most closely related to the two genera of Ornithinibacillus and Oceanobacillus, showing highest sequence similarity to Oceanobacillus limi KCTC 13823 T (97.8 %) and Ornithinibacillus bavariensis WSBC 24001 T (97.2 %). The peptidoglycan amino acid type was found to be A4β and the major respiratory quinone was determined to be MK-7. The polar lipid profile of strain LCB256 T contained diphosphatidylglycerol, phosphatidylglycerol, one unidentified phospholipid and two unidentified aminolipids. The dominant cellular fatty acids were anteiso-C15 : 0 and iso-C15 : 0. The G+C content of genomic DNA was 39.3 mol%. DNA-DNA relatedness values between strain LCB256 T and Ornithinibacillus halophilus KCTC 13822 T and Oceanobacillus limi KCTC 13823 T were 46.2 and 34.8 %, respectively. Based on this polyphasic taxonomic study, a novel species of the genus Ornithinibacillus, Ornithinibacillussalinisoli sp. nov. is proposed. The type strain is LCB256 T (=CGMCC 1.15809 T =KCTC 33862 T ).

  3. Facultative Sterol Uptake in an Ergosterol-Deficient Clinical Isolate of Candida glabrata Harboring a Missense Mutation in ERG11 and Exhibiting Cross-Resistance to Azoles and Amphotericin B

    NARCIS (Netherlands)

    Hull, Claire M.; Parker, Josie E.; Bader, Oliver; Weig, Michael; Gross, Uwe; Warrilow, Andrew G. S.; Kelly, Diane E.; Kelly, Steven L.

    We identified a clinical isolate of Candida glabrata (CG156) exhibiting flocculent growth and cross-resistance to fluconazole (FLC), voriconazole (VRC), and amphotericin B (AMB), with MICs of >256, >256, and 32 mu g ml(-1), respectively. Sterol analysis using gas chromatography-mass spectrometry

  4. The Grindahl Hash Functions

    DEFF Research Database (Denmark)

    Knudsen, Lars Ramkilde; Rechberger, Christian; Thomsen, Søren Steffen

    2007-01-01

    to the state. We propose two concrete hash functions, Grindahl-256 and Grindahl-512 with claimed security levels with respect to collision, preimage and second preimage attacks of 2^128 and 2^256, respectively. Both proposals have lower memory requirements than other hash functions at comparable speeds...

  5. Building a castle on sand: effects of mass privatization on capital market creation in transition economies

    Czech Academy of Sciences Publication Activity Database

    Fungáčová, Zuzana

    -, č. 256 (2005), s. 1-51 ISSN 1211-3298 R&D Projects: GA ČR GA402/05/1014 Institutional research plan: CEZ:AV0Z70850503 Keywords : mass privatization * emerging capital markets Subject RIV: AH - Economics http://www.cerge-ei.cz/pdf/wp/Wp256.pdf

  6. Highly sensitive and area-efficient CMOS image sensor using a PMOSFET-type photodetector with a built-in transfer gate

    Science.gov (United States)

    Seo, Sang-Ho; Kim, Kyoung-Do; Kong, Jae-Sung; Shin, Jang-Kyoo; Choi, Pyung

    2007-02-01

    In this paper, a new CMOS image sensor is presented, which uses a PMOSFET-type photodetector with a transfer gate that has a high and variable sensitivity. The proposed CMOS image sensor has been fabricated using a 0.35 μm 2-poly 4- metal standard CMOS technology and is composed of a 256 × 256 array of 7.05 × 7.10 μm pixels. The unit pixel has a configuration of a pseudo 3-transistor active pixel sensor (APS) with the PMOSFET-type photodetector with a transfer gate, which has a function of conventional 4-transistor APS. The generated photocurrent is controlled by the transfer gate of the PMOSFET-type photodetector. The maximum responsivity of the photodetector is larger than 1.0 × 10 3 A/W without any optical lens. Fabricated 256 × 256 CMOS image sensor exhibits a good response to low-level illumination as low as 5 lux.

  7. Functional and Structural Characterization of Purine Nucleoside Phosphorylase from Kluyveromyces lactis and Its Potential Applications in Reducing Purine Content in Food.

    Science.gov (United States)

    Mahor, Durga; Priyanka, Anu; Prasad, Gandham S; Thakur, Krishan Gopal

    2016-01-01

    Consumption of foods and beverages with high purine content increases the risk of hyperuricemia, which causes gout and can lead to cardiovascular, renal, and other metabolic disorders. As patients often find dietary restrictions challenging, enzymatically lowering purine content in popular foods and beverages offers a safe and attractive strategy to control hyperuricemia. Here, we report structurally and functionally characterized purine nucleoside phosphorylase (PNP) from Kluyveromyces lactis (KlacPNP), a key enzyme involved in the purine degradation pathway. We report a 1.97 Å resolution crystal structure of homotrimeric KlacPNP with an intrinsically bound hypoxanthine in the active site. KlacPNP belongs to the nucleoside phosphorylase-I (NP-I) family, and it specifically utilizes 6-oxopurine substrates in the following order: inosine > guanosine > xanthosine, but is inactive towards adenosine. To engineer enzymes with broad substrate specificity, we created two point variants, KlacPNPN256D and KlacPNPN256E, by replacing the catalytically active Asn256 with Asp and Glu, respectively, based on structural and comparative sequence analysis. KlacPNPN256D not only displayed broad substrate specificity by utilizing both 6-oxopurines and 6-aminopurines in the order adenosine > inosine > xanthosine > guanosine, but also displayed reversal of substrate specificity. In contrast, KlacPNPN256E was highly specific to inosine and could not utilize other tested substrates. Beer consumption is associated with increased risk of developing gout, owing to its high purine content. Here, we demonstrate that KlacPNP and KlacPNPN256D could be used to catalyze a key reaction involved in lowering beer purine content. Biochemical properties of these enzymes such as activity across a wide pH range, optimum activity at about 25°C, and stability for months at about 8°C, make them suitable candidates for food and beverage industries. Since KlacPNPN256D has broad substrate specificity, a

  8. Critical Review of the Heats of Formation of HNO and Some Related Species

    National Research Council Canada - National Science Library

    Anderson, William

    1997-01-01

    .... It was found that predissociation experiments, which have gone largely unnoticed for over 15 yr, lead to a significant revision in the recommended value. The new value, 25.6 + 0.6 kcal/mol and 25.6 - 0.1 kcal/mol (298 K; 26.3 kcal/mol at 0 K...

  9. 17 CFR 256.01-13 - Submission of questions.

    Science.gov (United States)

    2010-04-01

    ... and maintain uniformity in accounting, the service companies shall submit all questions of doubtful interpretation of the prescribed accounting to the Division of Corporate Regulation or its successor for...

  10. 42 CFR 403.256 - Loss ratio supporting data.

    Science.gov (United States)

    2010-10-01

    ... individual or a group policy. (2) The earliest age at which policyholders can purchase the policy. (3) The... service. (vi) Interest. (vii) Expected distribution, by age and sex, of persons who will purchase the...) The past loss ratio experience for the policy, including the experience of all riders and endorsements...

  11. 30 CFR 256.8 - Leasing maps and diagrams.

    Science.gov (United States)

    2010-07-01

    ... OIL AND GAS IN THE OUTER CONTINENTAL SHELF Outer Continental Shelf Oil, Gas, and Sulphur Management... any lease is offered or issued an area may be (1) withdrawn from disposition pursuant to section 12(a...

  12. Dicty_cDB: SSE256 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available vtnsll elfdldkdgklsvnevktallvdyiieaetclkkfvdsifkadsnkdnkitwdearqffv tsgsneaqakvfans...lsvnevktallvdyiieaetclkkfvdsifkadsnkdnkitwdearqffv tsgsneaqakvfansmfedvdsdddkcitreelreyaieyyeiypte*lfp*k*SQF

  13. 17 CFR 256.152 - Fuel stock expenses undistributed.

    Science.gov (United States)

    2010-04-01

    ... (CONTINUED) UNIFORM SYSTEM OF ACCOUNTS FOR MUTUAL SERVICE COMPANIES AND SUBSIDIARY SERVICE COMPANIES, PUBLIC... undistributed. The service company shall utilize this account, where appropriate, to include the cost of service... its interpretation, the logistics and handling of fuel, and other related support functions, as a...

  14. Testing 144- and 256-crystal BGO block detectors

    International Nuclear Information System (INIS)

    Rogers, J.G.; Nutt, R.; Andreaco, M.; Williams, C.W.

    1994-01-01

    New block detectors have been fabricated incorporating large numbers of small crystals. The authors evaluate and compare the performance of the new detectors with a standard 64-crystal block detector from Siemens-CTI. The new detectors demonstrate greatly improved imaging capability for 511 keV gamma rays. Future PET tomographs incorporating such detectors should produce substantially better volume images with little increase in tomograph manufacturing costs. The detectors will require a new type of automatic calibration procedure. Various such procedures have been tested and are discussed. A technique using higher energy gamma rays has shown special promise

  15. High speed display algorithm for 3D medical images using Multi Layer Range Image

    International Nuclear Information System (INIS)

    Ban, Hideyuki; Suzuki, Ryuuichi

    1993-01-01

    We propose high speed algorithm that display 3D voxel images obtained from medical imaging systems such as MRI. This algorithm convert voxel image data to 6 Multi Layer Range Image (MLRI) data, which is an augmentation of the range image data. To avoid the calculation for invisible voxels, the algorithm selects at most 3 MLRI data from 6 in accordance with the view direction. The proposed algorithm displays 256 x 256 x 256 voxel data within 0.6 seconds using 22 MIPS Workstation without a special hardware such as Graphics Engine. Real-time display will be possible on 100 MIPS class Workstation by our algorithm. (author)

  16. 77 FR 57596 - Government-Owned Inventions, Available for Licensing

    Science.gov (United States)

    2012-09-18

    ...; NASA Case No.: MFS-32865-4: Airfoil-Shaped Fluid Flow Tool for Use in Making Differential; NASA Case No...-32865-3: Star-Shaped Fluid Flow Tool for Use in Making Differential Measurements; NASA Case No.: MFS... 35812; telephone (256) 544-0013; fax (256) 544-0258. SUPPLEMENTARY INFORMATION: NASA Case No.: MFS-32757...

  17. 75 FR 32857 - Adjustment of Royalty Fee for Cable Compulsory License

    Science.gov (United States)

    2010-06-10

    ... LIBRARY OF CONGRESS Copyright Office 37 CFR Part 256 Adjustment of Royalty Fee for Cable Compulsory License CFR Correction In Title 37 of the Code of Federal Regulations, revised as of July 1, 2009, on page 666, in Sec. 256.2, make the following changes: a. In paragraph (b)(2)(i), remove ``$189,800...

  18. Bioapatite made from chicken femur bone

    Czech Academy of Sciences Publication Activity Database

    Šupová, Monika; Martynková, G.S.; Sucharda, Zbyněk

    2011-01-01

    Roč. 55, č. 3 (2011), s. 256-260 ISSN 0862-5468 R&D Projects: GA ČR(CZ) GA106/09/1000 Institutional research plan: CEZ:AV0Z30460519 Keywords : bioapatite * biocomposite * hydroxyapatite Subject RIV: BO - Biophysics Impact factor: 0.382, year: 2011 http://www.ceramics-silikaty.cz/2011/2011_03_256.htm

  19. Body dimensions and coloration of the winter pelage of a Moravian population of sika deer, Cervus nippon

    Czech Academy of Sciences Publication Activity Database

    Heroldová, Marta; Zejda, J.

    2002-01-01

    Roč. 51, č. 3 (2002), s. 253-256 ISSN 0139-7893 R&D Projects: GA AV ČR IBS6093003 Institutional research plan: CEZ:AV0Z6093917 Keywords : sika deer * body dimensions * coloration Subject RIV: EG - Zoology Impact factor: 0.234, year: 2002 http://www.ivb.cz/folia/51/3/253-256.pdf

  20. Parallelization of a numerical simulation code for isotropic turbulence

    International Nuclear Information System (INIS)

    Sato, Shigeru; Yokokawa, Mitsuo; Watanabe, Tadashi; Kaburaki, Hideo.

    1996-03-01

    A parallel pseudospectral code which solves the three-dimensional Navier-Stokes equation by direct numerical simulation is developed and execution time, parallelization efficiency, load balance and scalability are evaluated. A vector parallel supercomputer, Fujitsu VPP500 with up to 16 processors is used for this calculation for Fourier modes up to 256x256x256 using 16 processors. Good scalability for number of processors is achieved when number of Fourier mode is fixed. For small Fourier modes, calculation time of the program is proportional to NlogN which is ideal complexity of calculation for 3D-FFT on vector parallel processors. It is found that the calculation performance decreases as the increase of the Fourier modes. (author)

  1. Review: Josiah Brownell, The Collapse of Rhodesia: Population Demographics and the Politics of Race (2011) Buchbesprechung: Josiah Brownell, The Collapse of Rhodesia: Population Demographics and the Politics of Race (2011)

    OpenAIRE

    Tinashe Nyamunda

    2013-01-01

    Review of the monograph: Josiah Brownell, The Collapse of Rhodesia: Population Demographics and the Politics of Race, London: I.B. Tauris, 2011, ISBN 978-1-84885-475-8, 256 pagesBesprechung der Monographie: Josiah Brownell, The Collapse of Rhodesia: Population Demographics and the Politics of Race, London: I.B. Tauris, 2011, ISBN 978-1-84885-475-8, 256 Seiten

  2. Review: Josiah Brownell, The Collapse of Rhodesia: Population Demographics and the Politics of Race (2011)

    OpenAIRE

    Tinashe Nyamunda; Centre for Africa Studies, University of the Free State

    2013-01-01

    Review of the monograph: Josiah Brownell, The Collapse of Rhodesia: Population Demographics and the Politics of Race, London: I.B. Tauris, 2011, ISBN 978-1-84885-475-8, 256 pages Besprechung der Monographie: Josiah Brownell, The Collapse of Rhodesia: Population Demographics and the Politics of Race, London: I.B. Tauris, 2011, ISBN 978-1-84885-475-8, 256 Seiten

  3. Pan-African phylogeny of Mus (subgenus Nannomys) reveals one of the most successful mammal radiations in Africa

    Czech Academy of Sciences Publication Activity Database

    Bryja, Josef; Mikula, Ondřej; Šumbera, R.; Meheretu, Y.; Aghová, Tatiana; Lavrenchenko, L. A.; Mazoch, Vladimír; Oguge, N.; Mbau, J. S.; Welegerima, K.; Amundala, N.; Colyn, M.; Leirs, H.; Verheyen, E.

    2014-01-01

    Roč. 14, č. 256 (2014), s. 256 ISSN 1471-2148 R&D Projects: GA ČR GAP506/10/0983 Institutional support: RVO:68081766 Keywords : Biogeography * Tropical Africa * Molecular phylogeny * Pygmy mice * Plio-Pleistocene climatic fluctuations * Divergence timing * Muridae (Murinae) * Mus minutoides * Phylogeography * DNA barcoding Subject RIV: EG - Zoology Impact factor: 3.368, year: 2014

  4. Phosphorylation of human aquaporin 2 (AQP2) allosterically controls its interaction with the lysosomal trafficking protein LIP5.

    Science.gov (United States)

    Roche, Jennifer Virginia; Survery, Sabeen; Kreida, Stefan; Nesverova, Veronika; Ampah-Korsah, Henry; Gourdon, Maria; Deen, Peter M T; Törnroth-Horsefield, Susanna

    2017-09-01

    The interaction between the renal water channel aquaporin-2 (AQP2) and the lysosomal trafficking regulator-interacting protein LIP5 targets AQP2 to multivesicular bodies and facilitates lysosomal degradation. This interaction is part of a process that controls AQP2 apical membrane abundance in a vasopressin-dependent manner, allowing for urine volume adjustment. Vasopressin regulates phosphorylation at four sites within the AQP2 C terminus (Ser 256 , Ser 261 , Ser 264 , and Thr 269 ), of which Ser 256 is crucial and sufficient for AQP2 translocation from storage vesicles to the apical membrane. However, whether AQP2 phosphorylation modulates AQP2-LIP5 complex affinity is unknown. Here we used far-Western blot analysis and microscale thermophoresis to show that the AQP2 binds LIP5 in a phosphorylation-dependent manner. We constructed five phospho-mimicking mutants (S256E, S261E, S264E, T269E, and S256E/T269E) and a C-terminal truncation mutant (ΔP242) that lacked all phosphorylation sites but retained a previously suggested LIP5-binding site. CD spectroscopy indicated that wild-type AQP2 and the phospho-mimicking mutants had similar overall structure but displayed differences in melting temperatures possibly arising from C-terminal conformational changes. Non-phosphorylated AQP2 bound LIP5 with the highest affinity, whereas AQP2-ΔP242 had 20-fold lower affinity as determined by microscale thermophoresis. AQP2-S256E, S261E, T269E, and S256E/T269E all had reduced affinity. This effect was most prominent for AQP2-S256E, which fits well with its role in apical membrane targeting. AQP2-S264E had affinity similar to non-phosphorylated AQP2, possibly indicating a role in exosome excretion. Our data suggest that AQP2 phosphorylation allosterically controls its interaction with LIP5, illustrating how altered affinities to interacting proteins form the basis for regulation of AQP2 trafficking by post-translational modifications. © 2017 by The American Society for

  5. Evaluation of iron colloid-enhanced T{sub 2}-weighted fast MR imaging of hepatocellular carcinoma. Comparison of SE, TSE and TGSE sequences

    Energy Technology Data Exchange (ETDEWEB)

    Sugihara, Shuji; Suto, Yuji; Kamba, Masayuki; Yoshida, Kotarou; Ohta, Yoshio [Tottori Univ., Yonago (Japan). Faculty of Medicine

    1996-06-01

    We have applied chondroitin sulfate iron colloid (CSIC) as a contrast agent for MRI in detecting hepatocellular carcinoma (HCC) on conventional spin-echo sequences (SE). In this report, we evaluated CSIC-enhanced T{sub 2}-weighted fast MR imaging of HCC. MR imaging were performed before and after i.v. administration of CSIC in 15 patients with 46 HCCs. T{sub 2}-weighted SE (1800/80/2, 210 x 256 matrix), T{sub 2}-weighted turbo spin-echo (TSE1800) (1800/90/5, echo train length=7, 252 x 256 matrix), TSE (3500/90/5, echo train length=7, 252 x 256 matrix) (TSE7), TSE (3500/99/5, echo train length=11, 242 x 256 matrix) (TSE11) and T{sub 2}-weighted turbo-gradient spine-echo (TGSE) (4500/108/4, echo train length=33, 252 x 256 matrix) images were compared quantitatively and qualitatively. In all sequences, liver signal-to-noise ratio (SNR) was significantly decreased and lesion-to-liver contrast-to-noise ratio (CNR) was significantly increased after CSIC administration. Although decreased ratio in liver and tumor SNR caused by CSIC was smaller on TSE sequences compared with SE and TGSE, increased ratio in lesion-to-liver CNR was largest on TSE7. Either before or after i.v. administration of CSIC, the number of detectable lesions was largest on TSE7. TSE with used longer TR, TE and decreased echo factor was useful method for CSIC-enhanced abdominal MR imaging. (author)

  6. Review: Josiah Brownell, The Collapse of Rhodesia: Population Demographics and the Politics of Race (2011 Buchbesprechung: Josiah Brownell, The Collapse of Rhodesia: Population Demographics and the Politics of Race (2011

    Directory of Open Access Journals (Sweden)

    Tinashe Nyamunda

    2013-01-01

    Full Text Available Review of the monograph: Josiah Brownell, The Collapse of Rhodesia: Population Demographics and the Politics of Race, London: I.B. Tauris, 2011, ISBN 978-1-84885-475-8, 256 pagesBesprechung der Monographie: Josiah Brownell, The Collapse of Rhodesia: Population Demographics and the Politics of Race, London: I.B. Tauris, 2011, ISBN 978-1-84885-475-8, 256 Seiten

  7. Application of digital image processing to a β-gauge for determining mass concentration of suspending particulate matter in atmosphere

    International Nuclear Information System (INIS)

    Gotoh, Takao

    1992-01-01

    A two-dimensional image of the mass concentration of suspending particulate matter (SPM) collected on Millipore filter paper was photographed with Ultrofilm- 3 H. The printed paper image was transformed into a digital image (256 x 256 pixels) with 256 gray levels. Two results were obtained. The averaged values of gray level over all pixels of the digital image was found to correlate with the mass value measured by a β-gauge. The characteristic range of the digital image which was transformed to frequency by two-dimensional fast fourier transformation was found in the low frequency. It was presumed to relate to SPM from anthropogenic sources because the SPMs usually show higher density and smaller particle size than SPMs from natural sources. (author)

  8. A 16-detector alpha spectrometer using 1 multichannel analyzer

    International Nuclear Information System (INIS)

    Phillips, W.G.

    1978-01-01

    An alpha spectrometer containing 16 independent detectors and utilizing one 4096-channel multichannel analyzer (MCA) was constructed from commerically available modules. The spectrometer was designed specifically for the counting of low levels of radioactivity in environmental samples. Gated analog routing allows spectral data acquisition into 256 channel regions of the MCA memory as if each region were an independent 256-channel MCA. External live-time clocks and 50-Mhz analog-to-digital converters control timing and acquisition on each unit of eight detectors. Spectral data output is to magnetic tape in units of 256 channels each with a unique tagword. These tapes are then read and processed, and final reports are generated, by a large Control Data 6000 series computer

  9. Antioxidant and Antimicrobial Potential of the Bifurcaria bifurcata Epiphytic Bacteria

    Directory of Open Access Journals (Sweden)

    André Horta

    2014-03-01

    Full Text Available Surface-associated marine bacteria are an interesting source of new secondary metabolites. The aim of this study was the isolation and identification of epiphytic bacteria from the marine brown alga, Bifurcaria bifurcata, and the evaluation of the antioxidant and antimicrobial activity of bacteria extracts. The identification of epiphytic bacteria was determined by 16S rRNA gene sequencing. Bacteria extracts were obtained with methanol and dichloromethane (1:1 extraction. The antioxidant activity of extracts was performed by quantification of total phenolic content (TPC, 2,2-diphenyl-1-picrylhydrazyl (DPPH radical scavenging activity and oxygen radical absorbance capacity (ORAC. Antimicrobial activities were evaluated against Escherichia coli, Pseudomonas aeruginosa, Bacillus subtilis, Salmonella enteritidis, Staphylococcus aureus, Saccharomyces cerevisiae and Candida albicans. A total of 39 Bifurcaria bifurcata-associated bacteria were isolated and 33 were identified as Vibrio sp. (48.72%, Alteromonas sp. (12.82%, Shewanella sp. (12.26%, Serratia sp. (2.56%, Citricoccus sp. (2.56%, Cellulophaga sp. (2.56%, Ruegeria sp. (2.56% and Staphylococcus sp. (2.56%. Six (15.38% of the 39 bacteria Bifurcaria bifurcata-associated bacteria presented less than a 90% Basic Local Alignment Search Tool (BLAST match, and some of those could be new. The highest antioxidant activity and antimicrobial activity (against B. subtilis was exhibited by strain 16 (Shewanella sp.. Several strains also presented high antimicrobial activity against S. aureus, mainly belonging to Alteromonas sp. and Vibrio sp. There were no positive results against fungi and Gram-negative bacteria. Bifurcaria bifurcata epiphytic bacteria were revealed to be excellent sources of natural antioxidant and antimicrobial compounds.

  10. Antioxidant and antimicrobial potential of the Bifurcaria bifurcata epiphytic bacteria.

    Science.gov (United States)

    Horta, André; Pinteus, Susete; Alves, Celso; Fino, Nádia; Silva, Joana; Fernandez, Sara; Rodrigues, Américo; Pedrosa, Rui

    2014-03-24

    Surface-associated marine bacteria are an interesting source of new secondary metabolites. The aim of this study was the isolation and identification of epiphytic bacteria from the marine brown alga, Bifurcaria bifurcata, and the evaluation of the antioxidant and antimicrobial activity of bacteria extracts. The identification of epiphytic bacteria was determined by 16S rRNA gene sequencing. Bacteria extracts were obtained with methanol and dichloromethane (1:1) extraction. The antioxidant activity of extracts was performed by quantification of total phenolic content (TPC), 2,2-diphenyl-1-picrylhydrazyl (DPPH) radical scavenging activity and oxygen radical absorbance capacity (ORAC). Antimicrobial activities were evaluated against Escherichia coli, Pseudomonas aeruginosa, Bacillus subtilis, Salmonella enteritidis, Staphylococcus aureus, Saccharomyces cerevisiae and Candida albicans. A total of 39 Bifurcaria bifurcata-associated bacteria were isolated and 33 were identified as Vibrio sp. (48.72%), Alteromonas sp. (12.82%), Shewanella sp. (12.26%), Serratia sp. (2.56%), Citricoccus sp. (2.56%), Cellulophaga sp. (2.56%), Ruegeria sp. (2.56%) and Staphylococcus sp. (2.56%). Six (15.38%) of the 39 bacteria Bifurcaria bifurcata-associated bacteria presented less than a 90% Basic Local Alignment Search Tool (BLAST) match, and some of those could be new. The highest antioxidant activity and antimicrobial activity (against B. subtilis) was exhibited by strain 16 (Shewanella sp.). Several strains also presented high antimicrobial activity against S. aureus, mainly belonging to Alteromonas sp. and Vibrio sp. There were no positive results against fungi and Gram-negative bacteria. Bifurcaria bifurcata epiphytic bacteria were revealed to be excellent sources of natural antioxidant and antimicrobial compounds.

  11. Automated synthesis and verification of configurable DRAM blocks for ASIC's

    Science.gov (United States)

    Pakkurti, M.; Eldin, A. G.; Kwatra, S. C.; Jamali, M.

    1993-01-01

    A highly flexible embedded DRAM compiler is developed which can generate DRAM blocks in the range of 256 bits to 256 Kbits. The compiler is capable of automatically verifying the functionality of the generated DRAM modules. The fully automated verification capability is a key feature that ensures the reliability of the generated blocks. The compiler's architecture, algorithms, verification techniques and the implementation methodology are presented.

  12. 1024-65536 channel nuclear spectrum data acquisition and processing system

    Energy Technology Data Exchange (ETDEWEB)

    Songjiang, Xia

    1987-09-01

    A multiscale data acquisition and processing system based on IBM PC/XT microcomputer is described. In this system, not only 1024,2048,4096 single parameter spectrum, but also 128 x 128, 256 x 256 dual parameter spectrum can be acquisited. The interface logic is designed to work at sequential recording DMA mode, the total avergage time for recording each descriptor is 7.5 ..mu..s.

  13. Dicty_cDB: Contig-U14029-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 256 7e-67 AF542024_1( AF542024 |pid:none) Griffithsia japonica GTP-binding p... 256 9e-67 AB241242_1( AB241242 |pid:none) Symbiotic... protist of Reticuliterme... 249 7e-65 AB241241_1( AB241241 |pid:none) Symbiotic pro... |pid:none) Plasmodium knowlesi strain H chr... 239 9e-62 AB241243_1( AB241243 |pid:none) Symbiotic

  14. The Prognostic Significance of Metastasis to Lymph Nodes in Aortopulmonary Zone (Stations 5 and 6) in Completely Resected Left Upper Lobe Tumors.

    Science.gov (United States)

    Citak, Necati; Sayar, Adnan; Metin, Muzaffer; Büyükkale, Songül; Kök, Abdulaziz; Solak, Okan; Yurt, Sibel; Gürses, Atilla

    2015-10-01

    We investigated the prognostic effect of lymph nodes metastasis in aortopulmonary (AP) zone in resected non-small cell lung cancer of the left upper lobe (LUL). Between 1998 and 2010, 181 patients with LUL carcinoma underwent complete resection and were retrospectively analyzed. The patients were divided into four groups according to N status: N0 (n = 68, 37.6%), N1 (n = 64, 35.3%), N2(5,6+) (only metastasized to stations 5 and/or 6, n = 36, 19.9%), and N2(7+) (only metastasized to stations 7, n = 13, 7.2%). N1 were divided according to single and multiple (N1(single) n = 49, N1(multiple) n = 15) or peripheral and hilar (N1(peripheral) n = 39, N1(hilar) n = 25). Overall 5-year survival rate was 55.1%. Five-year survivals were 76.1% for N0, 54.3% for N1, and 20.7% for N2. N1(peripheral) had a better survival than N1(hilar) (60.3 vs. 29.4%, p = 0.09). Five-year survival of N1(single) was 60.1%, whereas it was 36.6% for N1(multiple) (p = 0.02). Five-year survival rate was 24.6% for N2(5,6+). Skip metastasis for lymph nodes in AP zone (n = 13) was a factor of better prognosis as compared to nonskip metastasis (n = 23) (29.9 vs. 19.2%). There was no statistically significant difference between the N2(5,6+) and N1(hilar) (p = 0.772), although N1(peripheral) had a significantly better survival than N2(5,6+) (p = 0.02). AP zone metastases alone had a significantly worse survival than N1(single) (p = 0.008), whereas there was no statistically significant difference between the N1(multiple) and N2(5,6+) (p = 0.248). N2(7+) was not expected to survive 3 years after operation. They had a significantly worse prognosis than N2(5,6+) (p = 0.02). LUL tumors with metastasis in the AP zone lymph nodes, especially skip metastasis, were associated with a more favorable prognosis than other mediastinal lymph nodes. However, the therapy of choice for lung cancer with N2(5,6+) has not been clarified yet. Georg Thieme

  15. Improved Impossible Differential Attacks on Large-Block Rijndael

    DEFF Research Database (Denmark)

    Wang, Qingju; Gu, Dawu; Rijmen, Vincent

    2012-01-01

    . The improvement can lead to 10-round attack on Rijndael-256 as well. With 2198.1 chosen plaintexts, an attack is demonstrated on 9-round Rijndael-224 with 2 195.2 encryptions and 2140.4 bytes memory. Increasing the data complexity to 2216 plaintexts, the time complexity can be reduced to 2130 encryptions...... and the memory requirements to 2 93.6 bytes. For 9-round Rijndael-256, we provide an attack requiring 2229.3 chosen plaintexts, 2194 encryptions, and 2 139.6 bytes memory. Alternatively, with 2245.3 plaintexts, an attack with a reduced time of 2127.1 encryptions and a memory complexity of 290.9 bytes can...... be mounted. With 2244.2 chosen plaintexts, we can attack 10-round Rijndael-256 with 2253.9 encryptions and 2186.8 bytes of memory....

  16. 40 CFR 256.42 - Recommendations for assuring facility development.

    Science.gov (United States)

    2010-07-01

    ... facilities and practices to be developed by responsible State and substate agencies or by the private sector... sector initiatives in order to meet the identified facility needs. (e) In any area having fewer than 2... establish procedures for choosing which facilities will get priority for technical or financial assistance...

  17. 256 Preservation and Conservation of Yoruba Cultural Artifacts: The ...

    African Journals Online (AJOL)

    User

    2012-01-24

    Jan 24, 2012 ... Indexed African Journals Online: www.ajol.info. An International .... symbols representing wars, worship or business dealings. In Asia Minor and ... ensure that the information or the object of cultural importance survives and .... (ii) fire fighting equipment, as part of the security measures, should be procured ...

  18. The automatic radiation monitor distributed System SRM-256C

    International Nuclear Information System (INIS)

    Stetsenko, G.N.; Rastsvetalov, Y.N.; Yanovich, A.A.

    1996-01-01

    The Controlled and Supervised Areas (CSA) of UNK proton accelerator built in Protvino (IHEP, Russia), borrows the significant area (more than 15 sq.km). Submitted in work results of accounts show, that by major factors, influencing to a radioecological conditions in region at the expense of work UNK are: 1) the output of pulsing radiation on day-time surface; 2) the radionuclides receipts with drinking water; 3) the pollution of radioactive air from system of ventilation. At normal mode of UNK operation the equivalent dose rates on daytime surface of pulsing radiation will changes in limits from 0.5 mcSv/hours near overmines buildings up to 0.1 mcSv / hour on the CSA border. The average equivalent dose rates per year due to internal irradiation at use (intakes) of drinking water will not exceed 5 - 50 mcSv/years. The Maximum equivalent dose rates on day-time surface, caused by pollution of radioactive air does not exceed 0.01... 0.03 mcSv/hour in limits of CSA, and the average equivalent dose per year caused by internal irradiation does not exceed 0.05 mcSv/years. At emergency-free operation the maximum degree of the UNK influence in limits of CSA is estimated in terms of average equivalent dose per year at levels, not exceeding 0.05... 0.10 mSv/year. For maintenance of integral environmental monitoring of total external radiation levels in limits of CSA network of passive monitor stations will be developed

  19. 17 CFR 256.408 - Taxes other than income taxes.

    Science.gov (United States)

    2010-04-01

    ... (CONTINUED) UNIFORM SYSTEM OF ACCOUNTS FOR MUTUAL SERVICE COMPANIES AND SUBSIDIARY SERVICE COMPANIES, PUBLIC.... (a) This account shall include the amount of state unemployment insurance, franchise taxes, federal...

  20. 40 CFR 421.256 - Pretreatment standards for new sources.

    Science.gov (United States)

    2010-07-01

    ... Maximum for monthly average mg/troy ounce of gold and silver smelted Lead 0.364 0.169 Mercury 0.195 0.078... Maximum for monthly average mg/troy ounce of silver reduced in solution Lead 0.112 0.052 Mercury 0.060 0... for any 1 day Maximum for monthly average mg/troy ounce of gold refined electrolytically Lead 5.544 2...

  1. All projects related to | Page 256 | IDRC - International Development ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Gender and Governance in Conflict Zones: A South Asian Perspective. Project. Women face many barriers to political participation in conflict zones across South ... ADAPTATION TO CHANGE, COASTAL FISHERY, FISHERY MANAGEMENT.

  2. 15 CFR 25.6 - Prerequisites for issuing a complaint.

    Science.gov (United States)

    2010-01-01

    ... this section), the amount of money, or the value of property or services, demanded or requested in... simultaneously, regardless of the amount of money, or the value of property or services, demanded or requested. ..., demand, or submission. (c) Nothing in this section shall be construed to limit the reviewing official's...

  3. 28 CFR 2.56 - Disclosure of Parole Commission file.

    Science.gov (United States)

    2010-07-01

    ... Chairman's decision on appeal. (i) Expedited processing of Requests. (1) The Commission will provide... permissible under the Freedom of Information Act or the Privacy Act of 1974. (b) Scope of disclosure. Disclosure under this section shall extend to Commission documents concerning the prisoner or parolee making...

  4. Third Supplement to ’A Catalog of the Mosquitoes of the World’ (Diptera: Culicidae)

    Science.gov (United States)

    1992-11-01

    and Green 1987:256). maculosa James and Liston. 19I 1. Rattanarithikul and Green 1987:256 (lectotype 9 desig.- BM). Subgenus Nyssorhynchus Blanchard...1990:39 (2 syntypes, BM). campiorhynchus (Thomson) annulipes Taylor, 1914. Townsend 1990:42 (?3 syntypes; BM). detritus (Haliday) maculosa Theobald, 1905...Skuse, 195 misionensis Duret. 199 macu/at us Theobald. 181 moenensis Iyengar, 2 10 maculosa James and Liston, 183 mojuensis Duret and Damasceno. 200

  5. Hexafluorobenzene under Extreme Conditions.

    Science.gov (United States)

    Pravica, Michael; Sneed, Daniel; Wang, Yonggang; Smith, Quinlan; White, Melanie

    2016-03-17

    We report the results from three high pressure experiments on hexafluorobenzene (C6F6). In the first experiment, Raman spectra were recorded up to 34.4 GPa. A phase transition from I → II was observed near 2 GPa. Near 8.8 GPa, a phase transition to an unreported phase (III) commenced. Above 20.6 GPa, yet another phase was observed (IV). Pressure cycling was employed to determine that, below 25.6 GPa, all pressure-induced alterations were reversible. However, at pressures above 20 GPa, dramatic spectral changes and broadening were observed at 25.6 and 34.4 GPa. The sample irreversibly changed into a soft solid with waxlike consistency when pressure was reduced to ambient and was recoverable. In the second experiment, IR spectra were collected up to 14.6 GPa. The phase transition (II → III) near 8.8 GPa was confirmed. An angular dispersive X-ray diffraction experiment was conducted to 25.6 GPa. Phase transitions above 1.4 GPa (I → II), above 5.5 GPa (II → III), above 10 GPa (III → IV), and above 15.5 GPa (IV → V) were observed. Near 25.6 GPa, long-range crystalline order was lost as the X-ray diffraction spectrum presented evidence of an amorphous solid.

  6. Particle simulation on a distributed memory highly parallel processor

    International Nuclear Information System (INIS)

    Sato, Hiroyuki; Ikesaka, Morio

    1990-01-01

    This paper describes parallel molecular dynamics simulation of atoms governed by local force interaction. The space in the model is divided into cubic subspaces and mapped to the processor array of the CAP-256, a distributed memory, highly parallel processor developed at Fujitsu Labs. We developed a new technique to avoid redundant calculation of forces between atoms in different processors. Experiments showed the communication overhead was less than 5%, and the idle time due to load imbalance was less than 11% for two model problems which contain 11,532 and 46,128 argon atoms. From the software simulation, the CAP-II which is under development is estimated to be about 45 times faster than CAP-256 and will be able to run the same problem about 40 times faster than Fujitsu's M-380 mainframe when 256 processors are used. (author)

  7. Heterogeneously Catalyzed Endothermic Fuel Cracking

    Science.gov (United States)

    2016-08-28

    reactor was circumferentially delivered from a 4.2 kW array consisting of 4 independently PID controlled fiber insulated heaters (Zircar ceramics, FIH...the H-ZSM- 5 lattice and Brønsted acid site characteristics” Micropor . Mesopor. Mater., 222 (2016) 256−270. DISTRIBUTION A: Distribution...distribution on the H-ZSM-5 lattice and Brønsted acid site characteristics" Micropor . Mesopor. Mater., 222 (2016) 256-270. S. M. Opalka, H. Huang

  8. Setting research priorities for maternal, newborn, child health and nutrition in India by engaging experts from 256 indigenous institutions contributing over 4000 research ideas: a CHNRI exercise by ICMR and INCLEN.

    Science.gov (United States)

    Arora, Narendra K; Mohapatra, Archisman; Gopalan, Hema S; Wazny, Kerri; Thavaraj, Vasantha; Rasaily, Reeta; Das, Manoj K; Maheshwari, Meenu; Bahl, Rajiv; Qazi, Shamim A; Black, Robert E; Rudan, Igor

    2017-06-01

    Health research in low- and middle- income countries (LMICs) is often driven by donor priorities rather than by the needs of the countries where the research takes place. This lack of alignment of donor's priorities with local research need may be one of the reasons why countries fail to achieve set goals for population health and nutrition. India has a high burden of morbidity and mortality in women, children and infants. In order to look forward toward the Sustainable Development Goals, the Indian Council of Medical Research (ICMR) and the INCLEN Trust International (INCLEN) employed the Child Health and Nutrition Research Initiative's (CHNRI) research priority setting method for maternal, neonatal, child health and nutrition with the timeline of 2016-2025. The exercise was the largest to-date use of the CHNRI methodology, both in terms of participants and ideas generated and also expanded on the methodology. CHNRI is a crowdsourcing-based exercise that involves using the collective intelligence of a group of stakeholders, usually researchers, to generate and score research options against a set of criteria. This paper reports on a large umbrella CHNRI that was divided into four theme-specific CHNRIs (maternal, newborn, child health and nutrition). A National Steering Group oversaw the exercise and four theme-specific Research Sub-Committees technically supported finalizing the scoring criteria and refinement of research ideas for the respective thematic areas. The exercise engaged participants from 256 institutions across India - 4003 research ideas were generated from 498 experts which were consolidated into 373 research options (maternal health: 122; newborn health: 56; child health: 101; nutrition: 94); 893 experts scored these against five criteria (answerability, relevance, equity, innovation and out-of-box thinking, investment on research). Relative weights to the criteria were assigned by 79 members from the Larger Reference Group. Given India's diversity

  9. Systemic inflammatory markers and sources of social support among older adults in the Memory Research Unit cohort.

    Science.gov (United States)

    McHugh Power, Joanna; Carney, Sile; Hannigan, Caoimhe; Brennan, Sabina; Wolfe, Hannah; Lynch, Marina; Kee, Frank; Lawlor, Brian

    2016-11-01

    Potential associations between systemic inflammation and social support received by a sample of 120 older adults were examined here. Inflammatory markers, cognitive function, social support and psychosocial wellbeing were evaluated. A structural equation modelling approach was used to analyse the data. The model was a good fit [Formula: see text], p social support from friends ( β = -0.256) and body mass index ( β = -0.256). Results are discussed in relation to social signal transduction theory.

  10. High-frequency signal paths in the TMR-86.1 experimental tomography apparatus

    International Nuclear Information System (INIS)

    Obrcian, J.; Jellus, V.; Weis, J.; Frollo, I.

    1990-01-01

    The NMR-based TMR-86.1 tomography apparatus, developed at the Institute of Measurement and Measuring Instrumentation, Slovak Academy of Sciences in Bratislava, Czechoslovakia, enables imaging of the inner structure of biological samples and human limbs no more than 110 mm in diameter, using a measuring matrix containing at most 128x128 elements. The imaged matrix can possess a maximum of 256x256 image elements with 256 brightness steps. The signal paths of the high-frequency excitation-imaging complex of the apparatus are described. Some functional blocks of the apparatus can be used without substantial modifications for the imaging of larger objects such as the human body. From the point of view of the high-frequency pulses for nonselective excitation (so-called 180deg-pulses), the excitation pulse power will have to be increased to at least 1 kW. (author). 5 figs, 7 refs

  11. Concentração inibitória mínima (CIM de oito antimicrobianos frente isolados de Streptococcus suis

    Directory of Open Access Journals (Sweden)

    Felipe Masiero Salvarani

    2008-02-01

    Full Text Available The minimun inhibitory concentration (MIC was determined toward amoxicilin, ampicilin, penicillin, ceftiofur, florfenicol, lincomycin, trimethoprim-sulfadiazine and tetracycline for 75 strains of Streptococcus suis. The MIC was performed on sheep blood agar plates containing concentrations varying from 0,25 to 256 µg/ml of the antibiotic described above. The amoxicilin in the concentrations of 1 and 2 µg/ml, florfenicol in the concentration of 1 µg/ml and trimethoprim-sulfadiazine in the concentrations of 2 e 8 µg/ml, were the antibiotics that presented minor resistance. In contrast, the ampicilin, tetracycline, ceftiofur and lincomycin, presented MIC of 64 and 128 µg/ml, 64 and 128 µg/ml, 128 and 256 µg/ml and >;256 µg/ml, respectively. The results of this study show that the amoxicilin and florfenicol are the antibiotics of choice for the treatment of diseases by S. suis in swine.

  12. Anatomy of the fingers in MR imaging using a high resolution surface coil; Die Anatomie der Finger in der MRT unter Anwendung einer Hochaufloesungsspule

    Energy Technology Data Exchange (ETDEWEB)

    Maeurer, J. [Strahlenklinik und Poliklinik, Klinikum Rudolf Virchow, Standort Wedding, Freie Univ. Berlin (Germany); Mueller, H.F. [Strahlenklinik und Poliklinik, Klinikum Rudolf Virchow, Standort Wedding, Freie Univ. Berlin (Germany); Lemke, A.J. [Strahlenklinik und Poliklinik, Klinikum Rudolf Virchow, Standort Wedding, Freie Univ. Berlin (Germany); Requardt, R. [Siemens AG, Erlangen (Germany); Stein, I. [Strahlenklinik und Poliklinik, Klinikum Rudolf Virchow, Standort Wedding, Freie Univ. Berlin (Germany); Schedel, H. [Strahlenklinik und Poliklinik, Klinikum Rudolf Virchow, Standort Wedding, Freie Univ. Berlin (Germany); Langer, R. [Strahlenklinik und Poliklinik, Klinikum Rudolf Virchow, Standort Wedding, Freie Univ. Berlin (Germany); Felix, R. [Strahlenklinik und Poliklinik, Klinikum Rudolf Virchow, Standort Wedding, Freie Univ. Berlin (Germany)

    1994-12-31

    MR-images of the fingers of twenty healthy volunteers were obtained at a 1,5-T whole-body system with a high resolution coil. Additionally, the fingers of two formalin-fixed anatomical specismen were imaged, fronzen and then subsequently sectioned for anatomic correlation. Measurements were recorded with a slice thickness of 2 mm. A 256x256 matrix and a 2,5 cam fiel of view (FOV) were used resulting in a pixel size of 0,01 mm{sup 2}. Based on the excellent depiction of anatomic detail and contrast resolution high resolution MRI of the fingers enabled identification of osseous and cartilaginous structures, as well as delineation of tendons, ligaments blood-vessels and dermal layers. (orig.) [Deutsch] An einem 1,5-T-Ganzkoerpertomographen wurden die Finger von 20 gesunden Probanden mit einer Hochaufloesungsspule zur Darstellung der Anatomie untersucht. Zum Vergleich erfolgte die Abbildung der anatomischen Strukturen an zwei formol- und alkoholfixierten Leichepraeparaten der Hand mittels MRT. Im Anschluss wurden die untersuchten Regionen am tiefgefrorenen Praeparat mit einer Bandsaege nachgeschnitten. Die MR-Messungen wurden mit einer Schichtdicke von 3 mm, einem Field of View (FOV) von 25 mm und einer Matrix von 256x256 Pixel durchgefuehrt. Die daraus resultierende Pixelgroesse betrug 0,01 mm{sup 2}. Der Weichteilkontrast und die hohe Ortsaufloesung ermoeglichten die Identifikation von Knochen- und Knorpelstrukturen sowie die Abgrenzung von Sehnen, Baendern, Blutgefaessen und Hautschichten. (orig.)

  13. Effect of spatial noise of medical grade Liquid Crystal Displays (LCD) on the detection of micro-calcification

    Science.gov (United States)

    Roehrig, Hans; Fan, Jiahua; Dallas, William J.; Krupinski, Elizabeth A.; Johnson, Jeffrey

    2009-08-01

    This presentation describes work in progress that is the result of an NIH SBIR Phase 1 project that addresses the wide- spread concern for the large number of breast-cancers and cancer victims [1,2]. The primary goal of the project is to increase the detection rate of microcalcifications as a result of the decrease of spatial noise of the LCDs used to display the mammograms [3,4]. Noise reduction is to be accomplished with the aid of a high performance CCD camera and subsequent application of local-mean equalization and error diffusion [5,6]. A second goal of the project is the actual detection of breast cancer. Contrary to the approach to mammography, where the mammograms typically have a pixel matrix of approximately 1900 x 2300 pixels, otherwise known as FFDM or Full-Field Digital Mammograms, we will only use sections of mammograms with a pixel matrix of 256 x 256 pixels. This is because at this time, reduction of spatial noise on an LCD can only be done on relatively small areas like 256 x 256 pixels. In addition, judging the efficacy for detection of breast cancer will be done using two methods: One is a conventional ROC study [7], the other is a vision model developed over several years starting at the Sarnoff Research Center and continuing at the Siemens Corporate Research in Princeton NJ [8].

  14. Development of a portable x-ray tv camera set

    International Nuclear Information System (INIS)

    Panityotai, J.

    1990-01-01

    A portable X-ray T V camera set was developed using a 24 V battery as a power supply unit. The development aims at a non-film X-radiographic technique with low exposure radiation. The machine is able to catch one X-radiographic frame at a time with a resolution of 256 X 256 pixels under 64 gray scales. The investigation shows a horizontal resolution of 0.6 lines per millimeter and a vertical resolution of 0.7 lines per mi/limiter

  15. A Parallel Algorithm for Connected Component Labelling of Gray-scale Images on Homogeneous Multicore Architectures

    International Nuclear Information System (INIS)

    Niknam, Mehdi; Thulasiraman, Parimala; Camorlinga, Sergio

    2010-01-01

    Connected component labelling is an essential step in image processing. We provide a parallel version of Suzuki's sequential connected component algorithm in order to speed up the labelling process. Also, we modify the algorithm to enable labelling gray-scale images. Due to the data dependencies in the algorithm we used a method similar to pipeline to exploit parallelism. The parallel algorithm method achieved a speedup of 2.5 for image size of 256 x 256 pixels using 4 processing threads.

  16. Metabolomics on integrated circuit

    OpenAIRE

    Cheah, Boon Chong; MacDonald, Alasdair I.; Barrett, Michael P.; Cumming, David R.S.

    2017-01-01

    We have demonstrated a chip-based diagnostics tool for the quantification of metabolites, using specific enzymes, to study enzyme kinetics and calculate the Michaelis-Menten constant. An array of 256×256 ion-sensitive field effect transistors (ISFETs) fabricated in a complementary metal oxide semiconductor (CMOS) process is used for this prototype. We have used hexokinase enzyme reaction on the ISFET CMOS chip with glucose concentration in the physiological range of 0.05 mM – 231 mM and succe...

  17. ARNICA, the Arcetri near-infrared camera: Astronomical performance assessment.

    Science.gov (United States)

    Hunt, L. K.; Lisi, F.; Testi, L.; Baffa, C.; Borelli, S.; Maiolino, R.; Moriondo, G.; Stanga, R. M.

    1996-01-01

    The Arcetri near-infrared camera ARNICA was built as a users' instrument for the Infrared Telescope at Gornergrat (TIRGO), and is based on a 256x256 NICMOS 3 detector. In this paper, we discuss ARNICA's optical and astronomical performance at the TIRGO and at the William Herschel Telescope on La Palma. Optical performance is evaluated in terms of plate scale, distortion, point spread function, and ghosting. Astronomical performance is characterized by camera efficiency, sensitivity, and spatial uniformity of the photometry.

  18. High Resolution Optical Imaging through the Atmosphere

    Science.gov (United States)

    1989-12-28

    S A DETECTION OF A VERY BRIGHT SOURCE CLOSE TO THE LMC SUPERNOVA SN 1987A P. NISENSON, C.PAPALIOLIOS, M. KAROVSKA , AND R. NOYES Harvard-Smatsonan...with 256 x 256 pixel sampling separated from it by approximately 60 mas ( Karovska et al. This gives a 7 mas per resel which is more than adequate for...correlation time. This C. PaSAloois, M. Karovska *, L Koachilbi, approach allows framing of the data for maximization of the P. Nimnson*, C. Standkiy* A S

  19. The Decision to Produce Altcoins: Miners' Arbitrage in Cryptocurrency Markets

    OpenAIRE

    Adam Hayes

    2015-01-01

    Bitcoin has become the de facto 'gold' standard among cryptocurrencies as it is the most widely accepted in commerce, has the largest mining network, and greatest volume of transactions. Because of this, miners of other SHA-256 cryptocurrencies will tend to convert those altcoins into bitcoin in order to transact in a meaningful way with the real economy. The result is that bitcoin mining regulates that of all other SHA-256 blockchains. Specifically, what matters is the expected number of bit...

  20. Simulation tests of plastic-packaged commercial SRAM

    International Nuclear Information System (INIS)

    Kalashnikov, O.A.; Nikiforov, A.Y.

    1999-01-01

    Laser and X-ray simulation test technique is developed adopted to plastic-packaged ICs. Dose rate and total dose test results are presented for two types of commercial RAMS. Dose rate and total dose test results were obtained for two types of commercial RAMS: AS7C256-20 256 K (32 K x 8) and MT5C1008W - 1 M (128 K x 8). The latch-up of AS7C256-20 was detected at dose rate 1.510 9 rad(Si)/s and of MT5C1008W - at dose rate 5.7-10 8 rad(Si)/s. The total dose failure thresholds were in the ranges of 55 to 90 krad(Si) for AS7C25620 and 40 to 328 krad for MT5C1008W depending on RAM operational mode under irradiation. The obtained simulation test results are in a good agreement with previously published for radiation installations. (authors)

  1. Car-borne multichannel gamma-ray spectrometric system model CZD-6

    International Nuclear Information System (INIS)

    Lu Shili; Zhai Yugui; Ma Yanfang; Jiao Cangwen; Zhang Biao

    1998-01-01

    The car-borne multichannel gamma-ray spectrometric system Mode CZD-6 is composed of a HDY-256 of portable multichannel gamma-ray spectrometer developed by the Beijing Research Institute of Uranium Geology and a large volume scintillation detector. the position for each measurement point is determined by the GPS instrument. Its latitude and longitude, as well as measured 256 channels of γ-spectrometric data are collected by a notebook computer, which can show the 256 channels of spectra for each point during measuring processes. The complete system can be loaded in a field car. This system has been used to environmental radioactive monitoring after calibration by airborne radiometric models in Shijiazhuang, Hebei province. A lot of data confirm that the system works stably and reliably, and is a fast and advanced approach for environmental γ-spectrometric monitoring. It can be used not only to determination of contents of natural radioactive elements in environments, but also to monitoring nuclear pollution and emergency treatment in nuclear accidents significantly

  2. The Sydney University PAPA camera

    Science.gov (United States)

    Lawson, Peter R.

    1994-04-01

    The Precision Analog Photon Address (PAPA) camera is a photon-counting array detector that uses optical encoding to locate photon events on the output of a microchannel plate image intensifier. The Sydney University camera is a 256x256 pixel detector which can operate at speeds greater than 1 million photons per second and produce individual photon coordinates with a deadtime of only 300 ns. It uses a new Gray coded mask-plate which permits a simplified optical alignment and successfully guards against vignetting artifacts.

  3. Support Equipment Selection Analysis (SESA) for the Navy Standard Airborne Computer Set (AN/AYK-14(V)).

    Science.gov (United States)

    1980-11-17

    111 - rb’" /JI- D.1 F. 1A.’ E I IJ~Ei]JF J I -126- HAEC-92-138 0 cz-: 00 CA a +. 9 11 11 118 0 rA. a , +, +.~ ’ q y 1 wI ~ 3- An~ii .03 -. VDI . 𔃾’ -127...32 - 2048 10 MHz +5 v - - 32 1024 10 MUz +5 v - lb - 1024 25 MHz +.76 v 224 - - 256 500 kHz +5 v (TTL) - 32 32 256 250 kHz +28 v - 32 32 286 250

  4. 40 CFR 256.01 - Purpose and scope of the guidelines.

    Science.gov (United States)

    2010-07-01

    ... WASTES GUIDELINES FOR DEVELOPMENT AND IMPLEMENTATION OF STATE SOLID WASTE MANAGEMENT PLANS Purpose... guidelines is to assist in the development and implementation of State solid waste management plans, in... objectives of environmentally sound management and disposal of solid and hazardous waste, resource...

  5. 2-(5,6-Diphenyl-1,2,4-triazin-3-ylaniline

    Directory of Open Access Journals (Sweden)

    Mariusz Mojzych

    2012-12-01

    Full Text Available The title compound, C21H16N4, obtained under standard Suzuki cross-coupling conditions, is a model compound in the synthesis and biological activity evaluation of new aza-analogues of sildenafil containing a pyrazolo[4,3-e][1,2,4]triazine system. An N—H...N intramolecular hydrogen bond involving the aminobenzene system and the 1,2,4-triazine moiety helps to establish a near coplanar orientation of the rings with a dihedral angle of 12.04 (4°, which is believed to be necessary for the biological activity of sildenafil analogues. The 1,2,4-triazine ring is slightly distorted from planarity [r.m.s deviation = 0.0299 (11 Å] and forms dihedral angles of 58.60 (4 and 36.35 (3° with the pendant phenyl rings. The crystal packing features bifurcated N—H...(N,N hydrogen bonds linking screw-axis-related molecules into chains parallel to the [010] direction< and π–π interactions, with a centroid–centroid separation of 3.8722 (7 Å and a slippage of 1.412 (3 Å. The crystal studied was a nonmerohedral twin with a ratio of 0.707 (2:0293 (2.

  6. 30 CFR 256.20 - Consideration of coastal zone management program.

    Science.gov (United States)

    2010-07-01

    ... 30 Mineral Resources 2 2010-07-01 2010-07-01 false Consideration of coastal zone management....20 Consideration of coastal zone management program. In the development of the leasing program, consideration shall be given to the coastal zone management program being developed or administered by an...

  7. 24 CFR 25.6 - Violations creating grounds for administrative action.

    Science.gov (United States)

    2010-04-01

    ... the applicable net worth, liquidity or warehouse line of credit requirements of 24 CFR part 202... written rule or instruction; (k) Submission of false information to HUD in connection with any HUD/FHA...

  8. 256 An International Multi-Disciplinary Journal, Ethiopia Vol. 4 (1 ...

    African Journals Online (AJOL)

    FIRST LADY

    Spatial and Temporal Perspective on Road Traffic Accident. Variations in .... relationship between the number of collisions (e.g. by type, severity, etc) and the amount of ..... established the need for adequate accident monitoring and control.

  9. 32 CFR 256.5 - The air installation compatible use program.

    Science.gov (United States)

    2010-07-01

    ... due to noise characteristics and safety of flight; (2) Identification of present incompatible land...) Indication of types of desirable development for various land tracts; (5) Land value estimates for the zones... planning, acquisition and siting of noise generating items, such as engine test stands, full advantage is...

  10. 17 CFR 256.01-3 - General structure of accounting system.

    Science.gov (United States)

    2010-04-01

    ... accumulated by direct charges. All employees, including officers, of the service company shall keep, within..., account numbers charged, department work order number and other code designations that facilitate proper... be maintained in a manner permitting ready analysis by prescribed accounts (with direct reference to...

  11. Brain MR image segmentation based on an improved active contour model.

    Directory of Open Access Journals (Sweden)

    Xiangrui Meng

    Full Text Available It is often a difficult task to accurately segment brain magnetic resonance (MR images with intensity in-homogeneity and noise. This paper introduces a novel level set method for simultaneous brain MR image segmentation and intensity inhomogeneity correction. To reduce the effect of noise, novel anisotropic spatial information, which can preserve more details of edges and corners, is proposed by incorporating the inner relationships among the neighbor pixels. Then the proposed energy function uses the multivariate Student's t-distribution to fit the distribution of the intensities of each tissue. Furthermore, the proposed model utilizes Hidden Markov random fields to model the spatial correlation between neigh-boring pixels/voxels. The means of the multivariate Student's t-distribution can be adaptively estimated by multiplying a bias field to reduce the effect of intensity inhomogeneity. In the end, we reconstructed the energy function to be convex and calculated it by using the Split Bregman method, which allows our framework for random initialization, thereby allowing fully automated applications. Our method can obtain the final result in less than 1 second for 2D image with size 256 × 256 and less than 300 seconds for 3D image with size 256 × 256 × 171. The proposed method was compared to other state-of-the-art segmentation methods using both synthetic and clinical brain MR images and increased the accuracies of the results more than 3%.

  12. Adaptive optics system for the IRSOL solar observatory

    Science.gov (United States)

    Ramelli, Renzo; Bucher, Roberto; Rossini, Leopoldo; Bianda, Michele; Balemi, Silvano

    2010-07-01

    We present a low cost adaptive optics system developed for the solar observatory at Istituto Ricerche Solari Locarno (IRSOL), Switzerland. The Shack-Hartmann Wavefront Sensor is based on a Dalsa CCD camera with 256 pixels × 256 pixels working at 1kHz. The wavefront compensation is obtained by a deformable mirror with 37 actuators and a Tip-Tilt mirror. A real time control software has been developed on a RTAI-Linux PC. Scicos/Scilab based software has been realized for an online analysis of the system behavior. The software is completely open source.

  13. Retroreflector field tracker. [noncontact optical position sensor for space application

    Science.gov (United States)

    Wargocki, F. E.; Ray, A. J.; Hall, G. E.

    1984-01-01

    An electrooptical position-measuring instrument, the Retroreflector Field Tracker or RFT, is described. It is part of the Dynamic Augmentation Experiment - a part of the payload of Space Shuttle flight 41-D in Summer 1984. The tracker measures and outputs the position of 23 reflective targets placed on a 32-m solar array to provide data for determination of the dynamics of the lightweight structure. The sensor uses a 256 x 256 pixel CID detector; the processor electronics include three Z-80 microprocessors. A pulsed laser diode illuminator is used.

  14. Low-complexity Joint Sub-carrier Phase Noise Compensation for Digital Multi-carrier Systems

    DEFF Research Database (Denmark)

    Yankov, Metodi Plamenov; Barletta, Luca; Zibar, Darko

    2017-01-01

    Joint sub-carrier phase noise processing is proposed which recovers the SNR penalty related to decreased sub-carrier baudrate w.r.t. single carrier systems. The method enables digital sub-banding to be safely employed for nonlinear mitigation for modulation formats of up to 256-QAM.......Joint sub-carrier phase noise processing is proposed which recovers the SNR penalty related to decreased sub-carrier baudrate w.r.t. single carrier systems. The method enables digital sub-banding to be safely employed for nonlinear mitigation for modulation formats of up to 256-QAM....

  15. A plate reader-based method for cell water permeability measurement

    DEFF Research Database (Denmark)

    Fenton, Robert A.; Moeller, H B; Nielsen, S

    2010-01-01

    Cell volume and water permeability measurements in cultured mammalian cells are typically conducted under a light microscope. Many of the employed approaches are time consuming and not applicable to a study of confluent epithelial cell monolayers. We present here an adaptation of a calcein......: AQP2-S256D > AQP2 wild-type > AQP2-S256A. We propose that the method can be applied to study AQP function and more generally to study cell volume changes in adherent cell lines. Furthermore, it should be adaptable for AQP inhibitor screening in chemical compound libraries....

  16. Effect of quantization and interpolation of projections on the sensitivity of computerized tomography

    International Nuclear Information System (INIS)

    Vajnberg, Eh.I.; Fajngojz, M.L.

    1984-01-01

    The sources and forms of manifestation of errors in quantization and interpolation of projections in case of X-ray computerized tomography are considered and quantitative criteria of their evaluation are formulated. The dominating role of the interaction of two successive quantizations of projections - one-dimensional and two-dimensional ones is revealed. The necessity of joint optimization of the two-dimensional quantization range, expansion and form of interpolation function, quantized convolution nucleus is substantiated. The experimental results at aspect ratio of tomograms 256x256 and 480 projections are presented

  17. AcEST: DK950225 [AcEST

    Lifescience Database Archive (English)

    Full Text Available ... 256 5e-67 tr|A1Y9I8|A1Y9I8_TOBAC Chloroplast post-illumination chlorophyll... 254 3e-66 tr|A9PFG9|A9PFG9...a m... 245 2e-63 tr|A1Y9I7|A1Y9I7_MAIZE Chloroplast post-illumination chlorophyll...YANVD 255 Query: 549 DGSCPYISDESSD 587 DGSCP +S + Sbjct: 256 DGSCPLELSDSDE 268 >tr|A1Y9I8|A1Y9I8_TOBAC Chloroplast post-illuminat

  18. The Temperature Dependence of the Debye-Waller Factor of Magnesium

    DEFF Research Database (Denmark)

    Sledziewska-Blocka, D.; Lebech, Bente

    1976-01-01

    The temperature dependence of the average Debye-Waller factor for magnesium was measured by means of neutron diffraction spectrometry. The experimental results obtained in the temperature range from 5 to 256 K are compared with theoretical calculations, using the harmonic and quasi-harmonic appro......The temperature dependence of the average Debye-Waller factor for magnesium was measured by means of neutron diffraction spectrometry. The experimental results obtained in the temperature range from 5 to 256 K are compared with theoretical calculations, using the harmonic and quasi......-harmonic approximations and results of previous experiments....

  19. The experimental study of VEGF antisense oligodeoxynucleotides with lipiodol in arterial embolization of liver cancer in rats

    International Nuclear Information System (INIS)

    Wu Hanping; Feng Gansheng; Li Xin; Liang Huimin; Zheng Chuansheng

    2003-01-01

    Objective: To study the inhibitory effects of VEGF antisense oligodeoxynucleotides (asODN) on cultured Walker-256 cells' VEGF expression, and to observe the anti-tumor effects of intraarterial infusion of asODN mixed with lipiodol on rat liver cancer. Methods: VEGF asODN and sense ODN were added to the media of non-serum cultured Walker-256 cells, and the VEGF concentrations of the supernatants were detected by using ELISA 48 hours later. Cells of endothelial cell line ECV-304 were cultured in the supernatants. The growth of ECV-304 cells was observed by MTT method. 30 rats with Walker-256 carcinoma cells implanted into left liver lobe were randomly divided into 3 groups. 0.2 ml ultra-fluid lipiodol (UFLP group, n=10), 3OD asODN mixed with 0.2 ml ultra-fluid lipiodol (UFLP + asODN group, n=10), and 0.2 ml normal saline (control group, n=10) were infused into the hepatic artery. The volumes of tumors were measured by using MRI before and 7 days after the treatment. VEGF mRNA in cancerous and peri-cancerous tissues was detected by RT-PCR. The microvessel density (MVD) and VEGF expression were observed by immunohistochemistry. Results: asODN could inhibit Walker-256 cells' VEGF expression. The tumor growth rate was lower in UFLP + asODN group than that in UFLP and control groups [(140.1±33.8)%, (177.9±64.9)%, and (403.9± 69.4)%, respectively, F=60.02, P 0.05). The MVD in UFLP + asODN group (53.1±18.4) was significantly less than that of control group (73.2±20.4) and UFLP group (80.3±18.5) (F=5.44, P<0.05). Conclusion: VEGF asODN could inhibit VEGF expression of Walker-256 cells. It may be an antiangiogenesis therapy drug in malignant tumor. VEGF asODN mixed with UFLP in embolizing liver cancer could decrease liver cancer growth, VEGF expression, and microvessel density better than UFLP alone

  20. Imaging Expression of Cytosine Deaminase-Herpes Virus Thymidine Kinase Fusion Gene (CD/TK Expression with [124I]FIAU and PET

    Directory of Open Access Journals (Sweden)

    Trevor Hackman

    2002-01-01

    Full Text Available Double prodrug activation gene therapy using the Escherichia coli cytosine deaminase (CDherpes simplex virus type 1 thymidine kinase (HSV1-tk fusion gene (CD/TK with 5-fluorocytosine (5FC, ganciclovir (GCV, and radiotherapy is currently under evaluation for treatment of different tumors. We assessed the efficacy of noninvasive imaging with [124I]FIAU (2′-fluoro-2′-deoxy-1-β-d-arabinofuranosyl-5-iodo-uracil and positron emission tomography (PET for monitoring expression of the CD/TK fusion gene. Walker-256 tumor cells were transduced with a retroviral vector bearing the CD/TK gene (W256CD/TK cells. The activity of HSV1-TK and CD subunits of the CD/TK gene product was assessed in different single cell-derived clones of W256CD/TK cells using the FIAU radiotracer accumulation assay in cells and a CD enzyme assay in cell homogenates, respectively. A linear relationship was observed between the levels of CD and HSV1-tk subunit expression in corresponding clones in vitro over a wide range of CD/TK expression levels. Several clones of W256CD/TK cells with significantly different levels of CD/TK expression were selected and used to produce multiple subcutaneous tumors in rats. PET imaging of HSV1-TK subunit activity with [124I]FIAU was performed on these animals and demonstrated that different levels of CD/TK expression in subcutaneous W256CD/TK tumors can be imaged quantitatively. CD expression in subcutaneous tumor sample homogenates was measured using a CD enzyme assay. A comparison of CD and HSV1-TK subunit enzymatic activity of the CD/TK fusion protein in vivo showed a significant correlation. Knowing this relationship, the parametric images of CD subunit activity were generated. Imaging with [124I]FIAU and PET could provide pre- and posttreatment assessments of CD/TK-based double prodrug activation in clinical gene therapy trials.

  1. A high resolution gamma-ray spectrometer based on superconducting microcalorimeters

    Energy Technology Data Exchange (ETDEWEB)

    Bennett, D. A.; Horansky, R. D. [National Institute of Standards and Technology, Boulder, Colorado 80305 (United States); University of Denver, Denver, Colorado 80208 (United States); Schmidt, D. R.; Doriese, W. B.; Fowler, J. W.; Kotsubo, V.; Mates, J. A. B. [National Institute of Standards and Technology, Boulder, Colorado 80305 (United States); University of Colorado, Boulder, Colorado 80309 (United States); Hoover, A. S.; Winkler, R.; Rabin, M. W. [Los Alamos National Laboratory, Los Alamos, New Mexico 87545 (United States); Alpert, B. K.; Beall, J. A.; Fitzgerald, C. P.; Hilton, G. C.; Irwin, K. D.; O' Neil, G. C.; Reintsema, C. D.; Schima, F. J.; Swetz, D. S.; Vale, L. R. [National Institute of Standards and Technology, Boulder, Colorado 80305 (United States); and others

    2012-09-15

    Improvements in superconductor device fabrication, detector hybridization techniques, and superconducting quantum interference device readout have made square-centimeter-sized arrays of gamma-ray microcalorimeters, based on transition-edge sensors (TESs), possible. At these collecting areas, gamma microcalorimeters can utilize their unprecedented energy resolution to perform spectroscopy in a number of applications that are limited by closely-spaced spectral peaks, for example, the nondestructive analysis of nuclear materials. We have built a 256 pixel spectrometer with an average full-width-at-half-maximum energy resolution of 53 eV at 97 keV, a useable dynamic range above 400 keV, and a collecting area of 5 cm{sup 2}. We have demonstrated multiplexed readout of the full 256 pixel array with 236 of the pixels (91%) giving spectroscopic data. This is the largest multiplexed array of TES microcalorimeters to date. This paper will review the spectrometer, highlighting the instrument design, detector fabrication, readout, operation of the instrument, and data processing. Further, we describe the characterization and performance of the newest 256 pixel array.

  2. Interactive navigation and bronchial tube tracking in virtual bronchoscopy.

    Science.gov (United States)

    Heng, P A; Fung, P F; Wong, T T; Siu, Y H; Sun, H

    1999-01-01

    An interactive virtual environment for simulation of bronchoscopy is developed. Medical doctor can safely plan their surgical bronchoscopy using the virtual environment without any invasive diagnosis which may risk the patient's health. The 3D pen input device of the system allows the doctor to navigate and visualize the bronchial tree of the patient naturally and interactively. To navigate the patient's bronchial tree, a vessel tracking process is required. While manual tracking is tedious and labor-intensive, fully automatic tracking may not be reliable. We propose a semi-automatic tracking technique called Intelligent Path Tracker which provides automation and enough user control during the vessel tracking. To support an interactive frame rate, we also introduce a new volume rendering acceleration technique, named as IsoRegion Leaping. The volume rendering is further accelerated by distributed rendering on a TCP/IP-based network of low-cost PCs. With these approaches, a 256 x 256 x 256 volume data of human lung, can be navigated and visualized at a frame rate of over 10 Hz in our virtual bronchoscopy system.

  3. Real-time, vibration-compensated CO2 interferometer operation on the DIII-D tokamak

    International Nuclear Information System (INIS)

    Carlstrom, T.N.; Ahlgren, D.R.; Crosbie, J.

    1988-01-01

    A multichannel, two-color, quadrature heterodyne interferometer is used to measure the line density in the DIII-D tokamak. The unique feature of this real-time vibration-compensated interferometer is the combination of high speed (1 MHz), high resolution (2π/256), and wide range ( +- 8193 fringes). Quadrature phase information from a CO 2 laser (10.6 μm) and a He--Ne laser (0.63 μm) are digitized with high-speed (6 MHz) flash digitizers. Zero crossings of the signals are counted with digital circuitry yielding quarter fringe resolution with a 4-MHz bandwidth. Further fringe resolution of 1/256 is provided at 350 kHz by a PROM which uses the digital signals as input to a look-up table. Analog line density is presently available at 80 kHz with a system noise equivalent phase shift of +- 2/256. Error monitoring is provided for low signal amplitude and exceeding the maximum fringe rate. In addition, a method to prevent coating of in-vessel mirrors due to plasma and vessel wall cleaning discharges has been developed

  4. Cone-beam CT angiography of the thorax. An experimental study

    International Nuclear Information System (INIS)

    Yoshida, Katsuya; Shimada, Kazuhiro; Tadokoro, Hiroyuki

    1999-01-01

    The authors recently developed a cone-beam computed tomography (CT) scanner and this report presents their evaluation of its potential for thoracic vascular imaging. An X-ray tube and a video-fluoroscopic system were rotated around the objects and 360 projected images were collected in a 12-s scan. Each image was digitized and a 3 dimensional (D) image (256 x 256 x 256 voxel volume with a voxel dimension of 0.9 x 0.9 x 0.9 mm) was reconstructed. Two different 3D-CT angiographies were investigated in 2 pigs: right atriography and thoracic aortography. Each pig was anesthetized, mechanically ventilated and positioned within the scanner. Contrast agent was infused through the right atrium or the aortic root at a rate of 3 ml/s during the scan. The right atriography scan clearly delineated the anatomy of the pulmonary artery, heart chambers and thoracic aorta. The thoracic aortography scan also clearly delineated the aortic anatomy including the internal thoracic and intercostal arteries. In conclusion, cone-beam CT angiography is potentially useful for thoracic vascular imaging. (author)

  5. Study of hard X-ray dose enhancement effects for some kinds of semiconductor devices

    CERN Document Server

    Guo Hong Xia; Chen Yu Sheng; Zhou Hui; He Chao Hui; Xie Ya Ning; Huang Yu Ying; He Wei; Hu Tian Dou

    2002-01-01

    Experimental results of X-ray dose enhancement effects are given for CMOS4069 and floating gate ROMs irradiated in Beijing Synchrotron Radiation Facility and in cobalt source. Shift of threshold voltage vs. total dose for CMOS4069 and the errors vs. total dose for 28f256 and 29c256 have been tested on line and the equivalent relation of total dose damage under the same accumulated dose is provided comparing the response of devices irradiated by X-ray and gamma-ray source. These results can be provided for X-ray radiation hardening technology as an effective evaluation data

  6. Positron emission tomographic images and expectation maximization: A VLSI architecture for multiple iterations per second

    International Nuclear Information System (INIS)

    Jones, W.F.; Byars, L.G.; Casey, M.E.

    1988-01-01

    A digital electronic architecture for parallel processing of the expectation maximization (EM) algorithm for Positron Emission tomography (PET) image reconstruction is proposed. Rapid (0.2 second) EM iterations on high resolution (256 x 256) images are supported. Arrays of two very large scale integration (VLSI) chips perform forward and back projection calculations. A description of the architecture is given, including data flow and partitioning relevant to EM and parallel processing. EM images shown are produced with software simulating the proposed hardware reconstruction algorithm. Projected cost of the system is estimated to be small in comparison to the cost of current PET scanners

  7. 1×4 Optical packet switching of variable length 640 Gbit/s data packets using in-band optical notch-filter labeling

    DEFF Research Database (Denmark)

    Medhin, Ashenafi Kiros; Kamchevska, Valerija; Galili, Michael

    2014-01-01

    We experimentally perform 1×4 optical packet switching of variable length 640 Gbit/s OTDM data packets using in-band notch-filter labeling with only 2.7-dB penalty. Up to 8 notches are employed to demonstrate scalability of the labeling scheme to 1×256 switching operation.......We experimentally perform 1×4 optical packet switching of variable length 640 Gbit/s OTDM data packets using in-band notch-filter labeling with only 2.7-dB penalty. Up to 8 notches are employed to demonstrate scalability of the labeling scheme to 1×256 switching operation....

  8. A method for real-time three-dimensional vector velocity imaging

    DEFF Research Database (Denmark)

    Jensen, Jørgen Arendt; Nikolov, Svetoslav

    2003-01-01

    The paper presents an approach for making real-time three-dimensional vector flow imaging. Synthetic aperture data acquisition is used, and the data is beamformed along the flow direction to yield signals usable for flow estimation. The signals are cross-related to determine the shift in position...... are done using 16 × 16 = 256 elements at a time and the received signals from the same elements are sampled. Access to the individual elements is done through 16-to-1 multiplexing, so that only a 256 channels transmitting and receiving system are needed. The method has been investigated using Field II...

  9. Increase of the assistancial productivity of the nuclear magnetic resonance equipment TOMIKON BMT 1100

    International Nuclear Information System (INIS)

    Rodriguez, A.; Carbonell, G.; Hernandez, C.

    1992-01-01

    In the present work a revision of the physical parameters which take part in the obtained of the Nuclear Magnetic Resonance (NMR) is carried put. Image is obtained introducing changes on them given in the disminution of the matrix size from 256 x 256 to 128 pixels with the corresponding disminution of FOV in dependence of the analized region, showing theoretical and practically its great importance of the number of possible examination with the resulting augment of the productivity of the method and the possibility to carried out studies on little cooperative patients mantaining an adequate quality and diagnostic information of the images

  10. The identification of van Hiele level students on the topic of space analytic geometry

    Science.gov (United States)

    Yudianto, E.; Sunardi; Sugiarti, T.; Susanto; Suharto; Trapsilasiwi, D.

    2018-03-01

    Geometry topics are still considered difficult by most students. Therefore, this study focused on the identification of students related to van Hiele levels. The task used from result of the development of questions related to analytical geometry of space. The results of the work involving 78 students who worked on these questions covered 11.54% (nine students) classified on a visual level; 5.13% (four students) on analysis level; 1.28% (one student) on informal deduction level; 2.56% (two students) on deduction and 2.56% (two students) on rigor level, and 76.93% (sixty students) classified on the pre-visualization level.

  11. ORF Alignment: NC_002678 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available m ... loti MAFF303099] ... Length = 59 ... Query: 256 LDKPMPAADLLGWTGPEILAEAERGVLQRALARADGNVSAAAQ...ALGISRATLHRKLNRL 314 ... LDKPMPAADLLGWTGPEILAEAERGVLQRALARADGNVSAAAQALGISR...ATLHRKLNRL Sbjct: 1 ... LDKPMPAADLLGWTGPEILAEAERGVLQRALARADGNVSAAAQALGISRATLHRKLNRL 59

  12. ORF Alignment: NC_004917 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available SIATLKAKKGIEKITAITAYDALMARIFDGEVDVILVGDSLKMSFGGENETLGASMQEM 65 ... MSIATLKAKKGIEKITAITAYDALMARIFD...GEVDVILVGDSLKMSFGGENETLGASMQEM Sbjct: 1 ... MSIATLKAKKGIEKITAITAYDALMARIFDGEVDVILVGDSLK...ydroxymethyltransferase [Helicobacter hepaticus ATCC ... 51449] ... Length = 256 ... Query: 6 ... M

  13. Kuritegevusehirm, sotsiaalkontroll ja kommunitarism : kas kriminaalõiguse suund suuremale ühiskondlikkusele? / Jaan Sootak

    Index Scriptorium Estoniae

    Sootak, Jaan, 1948-

    2000-01-01

    Positiivsest üldpreventsioonist, ubikviteedipreventsioonist, nulltolerantsist ja kommunitaristlikust karistusteooriast. Ilmunud ka: Sootak, Jaan. Kuri karjas : [artiklite kogumik]. Tartu, 2009, lk. 225-256

  14. ORF Alignment: NC_002928 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available ella ... parapertussis] ... Length = 256 ... Query: 5 ... LRHERHGGVLLLTMDRERTRNALSDADAVEALVQACARIGA...DLSVRAVVLTGSHGVFSSG 64 ... LRHERHGGVLLLTMDRERTRNALSDADAVEALVQACARIGADLSVRA...VVLTGSHGVFSSG Sbjct: 1 ... LRHERHGGVLLLTMDRERTRNALSDADAVEALVQACARIGADLSVRAVVLTGSHGVFSSG 60 ... Query: 125 CDIRLAA

  15. People and things. CERN Courier, Jul-Aug 1985, v. 25(6)

    Energy Technology Data Exchange (ETDEWEB)

    Anon.

    1985-06-15

    The article reports on achievements of various people, staff changes and position opportunities within the CERN organization and contains news updates on upcoming or past events. Under the chairmanship of Carlo Rubbia, a 'Working Group on the Scientific and Technological Longterm Future of CERN' has been set up 'to explore various options for the long-term future of CERN. ATLAS, short for Argonne Tandem Linear Accelerator System and the world's first superconducting heavy ion accelerator, was dedicated at the US Argonne National Laboratory on 3 June.

  16. 32 CFR 256.8 - Land use compatibility guidelines for accident potential.

    Science.gov (United States)

    2010-07-01

    ... ......do Yes Yes. Spectator sports including arenas ......do No No. Golf course, 8 riding stables 9... No. Entertainment assembly ......do ......do Do. Other outdoor recreation ......do Yes 7 Yes. Resource production and extraction and open land: Agriculture 10 Yes Yes Do. Livestock farming, animal...

  17. Sud du Sahara | Page 256 | CRDI - Centre de recherches pour le ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    ... Democratic Republic of Congo : Feasibility Study and Advocacy. Langue English. Read more about Citoyens du monde : les répercussions des programmes de travail rémunéré et de travail bénévole à l'étranger. Langue French. Read more about Creating Global Citizens : Impact of Volunteer and Work Abroad Programs.

  18. The effect of ultrasound at 256 KHz on Microcystis aeruginosa, with ...

    African Journals Online (AJOL)

    2012-10-31

    Oct 31, 2012 ... for 5 min inhibits the growth of the cyanobacterium Spirulina platensis for 3 d, while a sonication with 20 kHz showed no constant effect (Hao et al., 2004). Several mechanisms were discovered by which ultrasonic treatment affects the cells, of which the collapsing of gas vacu- oles during cavitation was ...

  19. : tous les projets | Page 256 | CRDI - Centre de recherches pour le ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Sujet: HEALTH SERVICES, HEALTH SYSTEM, OPERATIONS RESEARCH, INFORMATION MANAGEMENT, INFORMATION SYSTEMS. Région: Burkina Faso, Guinea-Bissau, Liberia, Mali, Sierra Leone, North of Sahara, South of Sahara. Programme: Santé des mères et des enfants. Financement total : CA$ 750,000.00.

  20. People and things. CERN Courier, Jul-Aug 1985, v. 25(6)

    International Nuclear Information System (INIS)

    Anon.

    1985-01-01

    The article reports on achievements of various people, staff changes and position opportunities within the CERN organization and contains news updates on upcoming or past events. Under the chairmanship of Carlo Rubbia, a 'Working Group on the Scientific and Technological Longterm Future of CERN' has been set up 'to explore various options for the long-term future of CERN. ATLAS, short for Argonne Tandem Linear Accelerator System and the world's first superconducting heavy ion accelerator, was dedicated at the US Argonne National Laboratory on 3 June

  1. Morphologic alterations in normal and neoplastic tissues following hyperthermia treatment

    International Nuclear Information System (INIS)

    Badylak, S.F.; Babbs, C.F.

    1984-01-01

    The sequential morphologic alterations in normal skeletal muscle in rats, Walker 256 tumors in rats, and transmissible venereal tumors (TVT) in dogs following microwave-induced hyperthermia (43 0 C and 45 0 for 20 minutes) were studied by light and electron microscopy. Normal muscle and Walker 256 tumors showed vascular damage at 5 minutes post-heating (PH), followed by suppuration and thrombosis at 6 and 48 hours PH, and by regeneration and repair at 7 days PH. Endothelial damage and parenchymal degeneration were present 5 minutes PH. Progressive ischemic injury occurred for at least 48 hours PH. Two hyperthermia treatments, separated by a 30 or 60 minute cooling interval, were applied to rats implanted with Walker 256 tumors. Increased selective heating of tumor tissue versus surrounding normal tissue, and increased intratumoral temperatures were found during the second hyperthermia treatment. Canine TVTs were resistant to hyperthermia damage. These results characterized the sequential morphologic alterations following hyperthermia treatment and showed that: 1) vascular damage contributed to the immediate and latent cytotoxic effects of hyperthermia, 2) selective heating occurred in the neoplastic tissue disrupted by prior heat treatment, and 3) not all neoplasms are responsive to hyperthermia treatment

  2. Soft errors in dynamic random access memories - a basis for dosimetry

    International Nuclear Information System (INIS)

    Haque, A.K.M.M.; Yates, J.; Stevens, D.

    1986-01-01

    The soft error rates of a number of 64k and 256k dRAMs from several manufacturers have been measured, employing a MC 68000 microprocessor. For this 'accelerated test' procedure, a 37 kBq (1 μCi) 241 Am alpha emitting source was used. Both 64k and 256k devices exhibited widely differing error rates. It was generally observed that the spread of errors over a particular device/manufacturer was much smaller than the differences between device families and manufacturers. Bit line errors formed a significant part of the total for 64k dRAMs, whereas in 256k dRAMs cell errors dominated; the latter also showed an enhanced sensitivity to integrated dose leading to total failure, and a time-dependent recovery. Although several theoretical models explain soft error mechanisms and predict responses which are compatible with our experimental results, it is considered that microdosimetric and track structure methods should be applied to the problem for its better appreciation. Finally, attention is drawn to the need for further studies of dRAMs, with a view to their use as digital dosemeters. (author)

  3. Application of determination of PRA, Ang II and IGF-1 levels in the study of typing of essential hypertension

    International Nuclear Information System (INIS)

    Lu Yongyi; Chen Qun; Yang Yongqing

    2010-01-01

    Objective: To study the clinical application of determination of plasma renin activity (PRA), Angiotensin II (Ang II ) and insulin-like growth factor-1 (IGF-1) levels in typing of essential hypertension (EH). Methods: Determined the levels of PRA and Aug II in 256 patients with EH and 70 healthy volunteers (as control group) by radioimmunoassay, and measured IGF-1 level by enzyme immunoassay. Research on the typing of EH and the difference between the groups. Results: The PRA and Ang II in control group was (0.432±0.236) μg·L -1 ·h -1 and (31.7±7.4) μg/L respectively. In 256 patients with EH, PRA was increased, normal and decreased in 18.0%, 71.8% and 10.2% respectively, while the level of Ang II was increased, normal and decreased in 12.9%, 76.2% and 10.9% respectively. The IGF-1 levels in 256 patients with EH were increased following the increase of blood pressure. Conclusion: Typing of EH patients with PRA and Ang II as well as the determination of IGF-1 were useful in treating and following up the patients with EH. (authors)

  4. An acceleration system for Laplacian image fusion based on SoC

    Science.gov (United States)

    Gao, Liwen; Zhao, Hongtu; Qu, Xiujie; Wei, Tianbo; Du, Peng

    2018-04-01

    Based on the analysis of Laplacian image fusion algorithm, this paper proposes a partial pipelining and modular processing architecture, and a SoC based acceleration system is implemented accordingly. Full pipelining method is used for the design of each module, and modules in series form the partial pipelining with unified data formation, which is easy for management and reuse. Integrated with ARM processor, DMA and embedded bare-mental program, this system achieves 4 layers of Laplacian pyramid on the Zynq-7000 board. Experiments show that, with small resources consumption, a couple of 256×256 images can be fused within 1ms, maintaining a fine fusion effect at the same time.

  5. WET SOLIDS FLOW ENHANCEMENT; SEMIANNUAL

    International Nuclear Information System (INIS)

    Hugo S. Caram; Natalie Foster

    1997-01-01

    The objective was to visualize the flow of granular materials in flat bottomed silo. This was done by for dry materials introducing mustard seeds and poppy seeds as tracer particles and imaging them using Nuclear Magnetic Resonance. The region sampled was a cylinder 25 mm in diameter and 40 mm in length. Eight slices containing 128*128 to 256*256 pixels were generated for each image. The size of the silo was limited by the size of the high resolution NMR imager available. Cross-sections of 150mm flat bottomed silos, with the tracer layers immobilized by a gel, showed similar qualitative patterns for both dry and wet granular solids

  6. Rainfall-threshold conditions for landslides in a humid-tropical system

    Science.gov (United States)

    Larsen, Matthew C.; Simon, Andrew

    1993-01-01

    Landslides are triggered by factors such as heavy rainfall, seismic activity, and construction on hillslopes. The leading cause of landslides in Puerto Rico is intense and/or prolonged rainfall. A rainfall threshold for rainfall-triggered landsliding is delimited by 256 storms that occurred between 1959 and 1991 in the central mountains of Puerto Rico, where mean annual rainfall is close to or in excess of 2,000 mm. Forty one of the 256 storms produced intense and/or prolonged rainfall that resulted in tens to hundreds of landslides. A threshold fitted to the lower boundary of the field defined by landslide-triggering storms is expressed as

  7. Use of the Frank sequence in pulsed EPR

    DEFF Research Database (Denmark)

    Tseitlin, Mark; Quine, Richard W.; Eaton, Sandra S.

    2011-01-01

    The Frank polyphase sequence has been applied to pulsed EPR of triarylmethyl radicals at 256MHz (9.1mT magnetic field), using 256 phase pulses. In EPR, as in NMR, use of a Frank sequence of phase steps permits pulsed FID signal acquisition with very low power microwave/RF pulses (ca. 1.5m......W in the application reported here) relative to standard pulsed EPR. A 0.2mM aqueous solution of a triarylmethyl radical was studied using a 16mm diameter cross-loop resonator to isolate the EPR signal detection system from the incident pulses. Keyword: Correlation spectroscopy,Multi-pulse EPR,Low power pulses,NMR,EPR...

  8. Antimicrobial and cytotoxic activity of Marrubium alysson and Retama raetam grown in Tunisia.

    Science.gov (United States)

    Hayet, Edziri; Samia, Ammar; Patrick, Groh; Ali, Mahjoub Mohamed; Maha, Mastouri; Laurent, Gutmann; Mighri, Zine; Mahjoub, Laouni

    2007-05-15

    Antibacterial and antifungal activities of extracts obtained from M. alysson, R. raetam were tested using a solid medium technique. We showed that the petroleum ether extract of M. alysson had a Minimum Inhibitory Concentration (MIC) varied from 128 to 2000 microg mL(-1) against different Enterobacteriaceae and antifungal activity against Candida glabrata, Candida albicans, Candida parapsilosis and Candida kreusei with a MIC of 256 microg mL(-1). The ethyl acetate extract of R. raetam showed the best activity against Gram positive organisms with MICs of 128 to 256 microg mL(-1) against methicillin resistant Staphylococcus aureus but low activity against the different Candida species.

  9. Design of a 16 kbit superconducting latching/SFQ hybrid RAM

    International Nuclear Information System (INIS)

    Nagasawa, Shuichi; Hasegawa, Haruhiro; Hashimoto, Tatsunori; Suzuki, Hideo; Miyahara, Kazunori; Enomoto, Youichi

    1999-01-01

    We have designed a 16 kbit superconducting latching/SFQ hybrid (SLASH) RAM, which enables high-frequency clock operation up to 10 GHz. The 16 kbit SLASH RAM consists of four 4x4 matrix arrays of 256 bit RAM blocks, block decoders, latching block drivers, latching block senses, impedance matched lines and the powering circuits. The 256 bit RAM block is composed of a 16x16 matrix array of vortex transitional memory cells, latching drivers, SFQ NOR decoders and latching sense circuits. We have also designed and implemented an SFQ NOR decoder that is composed of magnetically coupled multi-input OR gates and RSFQ inverters. (author)

  10. The Ultraviolet Spectrometer and Polarimeter on the Solar Maximum Mission

    Science.gov (United States)

    Woodgate, B. E.; Brandt, J. C.; Kalet, M. W.; Kenny, P. J.; Tandberg-Hanssen, E. A.; Bruner, E. C.; Beckers, J. M.; Henze, W.; Knox, E. D.; Hyder, C. L.

    1980-01-01

    The Ultraviolet Spectrometer and Polarimeter (UVSP) on the Solar Maximum Mission spacecraft is described, including the experiment objectives, system design, performance, and modes of operation. The instrument operates in the wavelength range 1150-3600 A with better than 2 arcsec spatial resolution, raster range 256 x 256 sq arcsec, and 20 mA spectral resolution in second order. Observations can be made with specific sets of four lines simultaneously, or with both sides of two lines simultaneously for velocity and polarization. A rotatable retarder can be inserted into the spectrometer beam for measurement of Zeeman splitting and linear polarization in the transition region and chromosphere.

  11. The ultraviolet spectrometer and polarimeter on the solar maximum mission

    International Nuclear Information System (INIS)

    Woodgate, B.E.; Brandt, J.C.; Kalet, M.W.; Kenny, P.J.; Beckers, J.M.; Henze, W.; Hyder, C.L.; Knox, E.D.

    1980-01-01

    The Ultraviolet Spectrometer and Polarimeter (UVSP) on the Solar Maximum Mission spacecraft is described, including the experiment objectives, system design. performance, and modes of operation. The instrument operates in the wavelength range 1150-3600 Angstreom with better than 2 arc sec spatial resolution, raster range 256 x 256 arc sec 2 , and 20 m Angstroem spectral resolution in second order. Observations can be made with specific sets of 4 lines simultaneously, or with both sides of 2 lines simultaneously for velocity and polarization. A rotatable retarder can be inserted into the spectrometer beam for measurement of Zeeman splitting and linear polarization in the transition region and chromosphere. (orig.)

  12. Digital column readout architectures for hybrid pixel detector readout chips

    International Nuclear Information System (INIS)

    Poikela, T; Plosila, J; Westerlund, T; Buytaert, J; Campbell, M; Gaspari, M De; Llopart, X; Wyllie, K; Gromov, V; Kluit, R; Beuzekom, M van; Zappon, F; Zivkovic, V; Brezina, C; Desch, K; Fu, Y; Kruth, A

    2014-01-01

    In this paper, two digital column architectures suitable for sparse readout of data from a pixel matrix in trigger-less applications are presented. Each architecture reads out a pixel matrix of 256 x 256 pixels with a pixel pitch of 55 μm. The first architecture has been implemented in the Timepix3 chip, and this is presented together with initial measurements. Simulation results and measured data are compared. The second architecture has been designed for Velopix, a readout chip planned for the LHCb VELO upgrade. Unlike Timepix3, this has to be tolerant to radiation-induced single-event effects. Results from post-layout simulations are shown with the circuit architectures

  13. Performance of an Uncooled Camera Utilizing an SWIR InGaAs 256x256 FPA for Imaging in the 1.0 micrometer - 1.7 micrometer Spectral Band

    National Research Council Canada - National Science Library

    Barton, J

    1998-01-01

    .... The camera spectral sensitivity is established by the material properties of the detector array which is composed of photovoltaic detectors formed in an epitaxial layer of InGaAs with a composition...

  14. ORF Alignment: NC_002929 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available lla ... pertussis Tohama I] ... Length = 256 ... Query: 5 ... LRHERHGGVLLLTMDRERTRNALSDADAVEALVQACA...RIGADLSVRAVVLTGSHGVFSSG 64 ... LRHERHGGVLLLTMDRERTRNALSDADAVEALVQACARIGADL...SVRAVVLTGSHGVFSSG Sbjct: 1 ... LRHERHGGVLLLTMDRERTRNALSDADAVEALVQACARIGADLSVRAVVLTGSHGVFSSG 60 ... Query: 125 CDI

  15. ORF Alignment: NC_002927 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available ella ... bronchiseptica RB50] ... Length = 256 ... Query: 5 ... LRHERHGGVLLLTMDRERTRNALSDADAVEALVQA...CARIGADLSVRAVVLTGSHGVFSSG 64 ... LRHERHGGVLLLTMDRERTRNALSDADAVEALVQACARIGA...DLSVRAVVLTGSHGVFSSG Sbjct: 1 ... LRHERHGGVLLLTMDRERTRNALSDADAVEALVQACARIGADLSVRAVVLTGSHGVFSSG 60 ... Query: 125 C

  16. The 150 ns detector project: progress with small detectors

    International Nuclear Information System (INIS)

    Warburton, W.K.; Russell, S.R.; Kleinfelder, Stuart A.; Segal, Julie

    1994-01-01

    This project's long term goal is to develop a pixel area detector capable of 6 MHz frame rates (150 ns/frame). Our milestones toward this goal are: a single pixel, 1x256 1D and 8x8 2D detectors, 256x256 2D detectors and, finally, 1024x1024 2D detectors. The design strategy is to supply a complete electronics chain (resetting preamp, selectable gain amplifier, analog-to-digital converter (ADC), and memory) for each pixel. In the final detectors these will all be custom integrated circuits. The front end preamplifiers are being integrated first, since their design and performance are both the most unusual and also critical to the project's success. Similarly, our early work is also concentrating on devising and perfecting detector structures which are thick enough (1 mm) to absorb over 99% of the incident X-rays in the energy range of interest. In this paper we discuss our progress toward the 1x256 1D and 8x8 2D detectors. We have fabricated sample detectors at Stanford's Center for Integrated Systems and are preparing both to test them individually and to wirebond them to the preamplifier samples to produce our first working small 1D and 2D detectors. We will describe our solutions to the design problems associated with collecting charge in less than 30 ns from 1 mm thick pixels in high resistivity silicon. We have constructed and tested the front end of our preamplifier design using a commercial 1.2 μm CMOS technology and are moving on to produce a few channels of the complete preamplifier, including a switchable gain stage and output stage. We will discuss both the preamplifier design and our initial test results. ((orig.))

  17. Coagulase-Negative Staphylococci in Human Milk From Mothers of Preterm Compared With Term Neonates.

    Science.gov (United States)

    Soeorg, Hiie; Metsvaht, Tuuli; Eelmäe, Imbi; Metsvaht, Hanna Kadri; Treumuth, Sirli; Merila, Mirjam; Ilmoja, Mari-Liis; Lutsar, Irja

    2017-05-01

    Human milk is the preferred nutrition for neonates and a source of bacteria. Research aim: The authors aimed to characterize the molecular epidemiology and genetic content of staphylococci in the human milk of mothers of preterm and term neonates. Staphylococci were isolated once per week in the 1st month postpartum from the human milk of mothers of 20 healthy term and 49 preterm neonates hospitalized in the neonatal intensive care unit. Multilocus variable-number tandem-repeats analysis and multilocus sequence typing were used. The presence of the mecA gene, icaA gene of the ica-operon, IS 256, and ACME genetic elements was determined by PCR. The human milk of mothers of preterm compared with term neonates had higher counts of staphylococci but lower species diversity. The human milk of mothers of preterm compared with term neonates more often contained Staphylococcus epidermidis mecA (32.7% vs. 2.6%), icaA (18.8% vs. 6%), IS 256 (7.9% vs. 0.9%), and ACME (15.4% vs. 5.1%), as well as Staphylococcus haemolyticus mecA (90.5% vs. 10%) and IS 256 (61.9% vs. 10%). The overall distribution of multilocus variable-number tandem-repeats analysis (MLVA) types and sequence types was similar between the human milk of mothers of preterm and term neonates, but a few mecA-IS 256-positive MLVA types colonized only mothers of preterm neonates. Maternal hospitalization within 1 month postpartum and the use of an arterial catheter or antibacterial treatment in the neonate increased the odds of harboring mecA-positive staphylococci in human milk. Limiting exposure of mothers of preterm neonates to the hospital could prevent human milk colonization with more pathogenic staphylococci.

  18. Technologies of high-performance thermography systems

    Science.gov (United States)

    Breiter, R.; Cabanski, Wolfgang A.; Mauk, K. H.; Kock, R.; Rode, W.

    1997-08-01

    A family of 2 dimensional detection modules based on 256 by 256 and 486 by 640 platinum silicide (PtSi) focal planes, or 128 by 128 and 256 by 256 mercury cadmium telluride (MCT) focal planes for applications in either the 3 - 5 micrometer (MWIR) or 8 - 10 micrometer (LWIR) range was recently developed by AIM. A wide variety of applications is covered by the specific features unique for these two material systems. The PtSi units provide state of the art correctability with long term stable gain and offset coefficients. The MCT units provide extremely fast frame rates like 400 Hz with snapshot integration times as short as 250 microseconds and with a thermal resolution NETD less than 20 mK for e.g. the 128 by 128 LWIR module. The unique design idea general for all of these modules is the exclusively digital interface, using 14 bit analog to digital conversion to provide state of the art correctability, access to highly dynamic scenes without any loss of information and simplified exchangeability of the units. Device specific features like bias voltages etc. are identified during the final test and stored in a memory on the driving electronics. This concept allows an easy exchange of IDCAs of the same type without any need for tuning or e.g. the possibility to upgrade a PtSi based unit to an MCT module by just loading the suitable software. Miniaturized digital signal processor (DSP) based image correction units were developed for testing and operating the units with output data rates of up to 16 Mpixels/s. These boards provide the ability for freely programmable realtime functions like two point correction and various data manipulations in thermography applications.

  19. The 150 ns detector project: progress with small detectors

    Energy Technology Data Exchange (ETDEWEB)

    Warburton, W.K. (X-ray Instrumentation Associates, 2513 Charleston Rd, Ste 207, Mountain View, CA 94043 (United States)); Russell, S.R. (X-ray Instrumentation Associates, 2513 Charleston Rd, Ste 207, Mountain View, CA 94043 (United States)); Kleinfelder, Stuart A. (VLSI Physics, 19 Drury Lane, Berkeley, CA 94705 (United States)); Segal, Julie (Integrated Ckts Lab., Dept. of Electrical Engineering, Stanford University, Stanford, CA 94305 (United States))

    1994-09-01

    This project's long term goal is to develop a pixel area detector capable of 6 MHz frame rates (150 ns/frame). Our milestones toward this goal are: a single pixel, 1x256 1D and 8x8 2D detectors, 256x256 2D detectors and, finally, 1024x1024 2D detectors. The design strategy is to supply a complete electronics chain (resetting preamp, selectable gain amplifier, analog-to-digital converter (ADC), and memory) for each pixel. In the final detectors these will all be custom integrated circuits. The front end preamplifiers are being integrated first, since their design and performance are both the most unusual and also critical to the project's success. Similarly, our early work is also concentrating on devising and perfecting detector structures which are thick enough (1 mm) to absorb over 99% of the incident X-rays in the energy range of interest. In this paper we discuss our progress toward the 1x256 1D and 8x8 2D detectors. We have fabricated sample detectors at Stanford's Center for Integrated Systems and are preparing both to test them individually and to wirebond them to the preamplifier samples to produce our first working small 1D and 2D detectors. We will describe our solutions to the design problems associated with collecting charge in less than 30 ns from 1 mm thick pixels in high resistivity silicon. We have constructed and tested the front end of our preamplifier design using a commercial 1.2 [mu]m CMOS technology and are moving on to produce a few channels of the complete preamplifier, including a switchable gain stage and output stage. We will discuss both the preamplifier design and our initial test results. ((orig.))

  20. Flow analysis of the ophthalmic artery

    Energy Technology Data Exchange (ETDEWEB)

    Harada, Kuniaki; Hashimoto, Masato; Bandoh, Michio; Odawara, Yoshihiro; Kamagata, Masaki; Shirase, Ryuji [Sapporo Medical Univ. (Japan). Hospital

    2003-02-01

    The purpose of this study was to analyze the hemodynamics of ophthalmic artery flow using phase contrast MR angiography (PC-MRA). A total of 14 eyes from 10 normal volunteers and a patient with normal tension glaucoma (NTG) were analyzed. The optimal conditions were time repetition (TR)/echo time (TE)/flip angle (FA)/nex=40 ms/minimum/90 deg/2, field of view (FOV)=6 cm, matrix size=256 x 256. The resistive index (RI) and pulsatillity index (PI) values were significantly raised in the patient with NTG when compared to the control group. We therefore believe that PC-MRA may be a useful clinical tool for the assessment of the mechanism of NTG. (author)

  1. Internal differential collision attacks on the reduced-round Grøstl-0 hash function

    DEFF Research Database (Denmark)

    Ideguchi, Kota; Tischhauser, Elmar Wolfgang; Preneel, Bart

    2014-01-01

    . This results in collision attacks and semi-free-start collision attacks on the Grøstl-0 hash function and compression function with reduced rounds. Specifically, we show collision attacks on the Grøstl-0-256 hash function reduced to 5 and 6 out of 10 rounds with time complexities 248 and 2112 and on the Grøstl......-0-512 hash function reduced to 6 out of 14 rounds with time complexity 2183. Furthermore, we demonstrate semi-free-start collision attacks on the Grøstl-0-256 compression function reduced to 8 rounds and the Grøstl-0-512 compression function reduced to 9 rounds. Finally, we show improved...

  2. Evaluation of cross sections of 56Fe up to 3 GeV and integral benchmark calculation for thick target yield

    International Nuclear Information System (INIS)

    Yoshizawa, Nobuaki; Meigo, Shin-ichiro

    2001-01-01

    The neutron and proton cross sections of 56 Fe were evaluated up to 3 GeV. JENDL High Energy File of 56 Fe were developed for use in transport calculation. For neutrons, the high-energy data are merged with JENDL3.3-file. Integral benchmark calculations for thick target neutron yields (TTY) for 113 MeV and 256 MeV proton bombardment of Fe targets were performed using the evaluated libraries. Calculated TTY neutron spectra were compared with experimental data. For 113 MeV, calculated TTY at 7.5 degree underestimated in the emitted neutron energy range above 10 MeV. For 256 MeV, calculated TTY well agree with experimental data except below 10 MeV. (author)

  3. Preimages for Step-Reduced SHA-2

    DEFF Research Database (Denmark)

    Aoki, Kazumaro; Guo, Jian; Matusiewicz, Krystian

    2009-01-01

    In this paper, we present preimage attacks on up to 43-step SHA-256 (around 67% of the total 64 steps) and 46-step SHA-512 (around 57.5% of the total 80 steps), which significantly increases the number of attacked steps compared to the best previously published preimage attack working for 24 steps....... The time complexities are 2^251.9, 2^509 for finding pseudo-preimages and 2^254.9, 2^511.5 compression function operations for full preimages. The memory requirements are modest, around 2^6 words for 43-step SHA-256 and 46-step SHA-512. The pseudo-preimage attack also applies to 43-step SHA-224 and SHA-384...

  4. A high speed digital signal averager for pulsed NMR

    International Nuclear Information System (INIS)

    Srinivasan, R.; Ramakrishna, J.; Ra agopalan, S.R.

    1978-01-01

    A 256-channel digital signal averager suitable for pulsed nuclear magnetic resonance spectroscopy is described. It implements 'stable averaging' algorithm and hence provides a calibrated display of the average signal at all times during the averaging process on a CRT. It has a maximum sampling rate of 2.5 μ sec and a memory capacity of 256 x 12 bit words. Number of sweeps is selectable through a front panel control in binary steps from 2 3 to 2 12 . The enhanced signal can be displayed either on a CRT or by a 3.5-digit LED display. The maximum S/N improvement that can be achieved with this instrument is 36 dB. (auth.)

  5. Red Light Represses the Photophysiology of the Scleractinian Coral Stylophora pistillata

    Science.gov (United States)

    Wijgerde, Tim; van Melis, Anne; Silva, Catarina I. F.; Leal, Miguel C.; Vogels, Luc; Mutter, Claudia; Osinga, Ronald

    2014-01-01

    Light spectrum plays a key role in the biology of symbiotic corals, with blue light resulting in higher coral growth, zooxanthellae density, chlorophyll a content and photosynthesis rates as compared to red light. However, it is still unclear whether these physiological processes are blue-enhanced or red-repressed. This study investigated the individual and combined effects of blue and red light on the health, zooxanthellae density, photophysiology and colouration of the scleractinian coral Stylophora pistillata over 6 weeks. Coral fragments were exposed to blue, red, and combined 50/50% blue red light, at two irradiance levels (128 and 256 μmol m−2 s−1). Light spectrum affected the health/survival, zooxanthellae density, and NDVI (a proxy for chlorophyll a content) of S. pistillata. Blue light resulted in highest survival rates, whereas red light resulted in low survival at 256 μmol m−2 s−1. Blue light also resulted in higher zooxanthellae densities compared to red light at 256 μmol m−2 s−1, and a higher NDVI compared to red and combined blue red light. Overall, our results suggest that red light negatively affects the health, survival, symbiont density and NDVI of S. pistillata, with a dominance of red over blue light for NDVI. PMID:24658108

  6. Fast parallel algorithm for three-dimensional distance-driven model in iterative computed tomography reconstruction

    International Nuclear Information System (INIS)

    Chen Jian-Lin; Li Lei; Wang Lin-Yuan; Cai Ai-Long; Xi Xiao-Qi; Zhang Han-Ming; Li Jian-Xin; Yan Bin

    2015-01-01

    The projection matrix model is used to describe the physical relationship between reconstructed object and projection. Such a model has a strong influence on projection and backprojection, two vital operations in iterative computed tomographic reconstruction. The distance-driven model (DDM) is a state-of-the-art technology that simulates forward and back projections. This model has a low computational complexity and a relatively high spatial resolution; however, it includes only a few methods in a parallel operation with a matched model scheme. This study introduces a fast and parallelizable algorithm to improve the traditional DDM for computing the parallel projection and backprojection operations. Our proposed model has been implemented on a GPU (graphic processing unit) platform and has achieved satisfactory computational efficiency with no approximation. The runtime for the projection and backprojection operations with our model is approximately 4.5 s and 10.5 s per loop, respectively, with an image size of 256×256×256 and 360 projections with a size of 512×512. We compare several general algorithms that have been proposed for maximizing GPU efficiency by using the unmatched projection/backprojection models in a parallel computation. The imaging resolution is not sacrificed and remains accurate during computed tomographic reconstruction. (paper)

  7. The role of breast milk in the colonization of neonatal gut and skin with coagulase-negative staphylococci.

    Science.gov (United States)

    Soeorg, Hiie; Metsvaht, Tuuli; Eelmäe, Imbi; Merila, Mirjam; Treumuth, Sirli; Huik, Kristi; Jürna-Ellam, Marika; Ilmoja, Mari-Liis; Lutsar, Irja

    2017-11-01

    BackgroundWe aimed to determine the genetic relatedness between Staphylococcus epidermidis colonizing breast milk (BM) and BM-fed neonates during the first month of life.MethodsS. epidermidis was isolated from the stool and skin swabs of 20 healthy term and 49 preterm neonates hospitalized in the neonatal intensive care unit and from the BM of mothers once a week and typed by multilocus variable-number tandem-repeat analysis. Virulence-related genes were determined by PCR.ResultsThe gut (95%) and skin (100%) of term neonates were colonized with strains genetically similar to those in BM and carrying mecA and IS256 at low rate (both skin (34.7%) and in the gut in the first week of life (14.3%), but the prevalence of mecA (>90.6%) and IS256 (>61.7%) was high. By the fourth week, in the gut of preterm neonates the prevalence of mecA (73.8%) and IS256 (18.4%) decreased, but colonization with strains genetically similar to those in BM increased (83.7%).ConclusionDuring early life, the skin and gut of preterm neonates is colonized with S. epidermidis that is distinct from strains found in BM, but gradually the gut is enriched with strains genetically similar to those in BM, as in term neonates.

  8. Hepcidin as a possible marker in determination of malignancy degree and sensitivity of breast cancer cells to cytostatic drugs.

    Science.gov (United States)

    Yalovenko, T M; Todor, I M; Lukianova, N Y; Chekhun, V F

    2016-06-01

    To investigate the role of hepcidin (Hepc) in the formation of cells malignant phenotype in vitro and its expression in the dyna-mics of growth of Walker-256 carcinosarcoma with different sensitivity to doxorubicin (Dox). The cell lines used in the analysis included T47D, MCF-7, MDA-MB-231, MDA-MB-468, MCF/CP, and MCF/Dox. Hepc expression was studied by immunocytochemical method. "Free" iron content was determined by EPR spectroscopy. Determination of Hepc expression in homogenates of tumor tissue and in blood serum of rats with Dox-sensitive and -resistant Walker-256 carcinosarcoma was performed. It was found that Hepc levels in breast cancer (BC) cells with high degree of malignancy (MDA-MB-231, MDA-MB-468) and drug-resistant phenotype (MCF/CP, MCF/Dox) were by 1.5-2 times higher (p < 0.05) in comparison with sensitive and less malignant BC cells. The development of drug-resistant phenotype in Walker-256 carcinosarcoma cells was accompanied by increasing of Hepc and "free" iron content (by 2.4 and 1.2 times, respectively). The data of in vitro and in vivo research evidenced on involvement of Hepc in formation of BC cells malignant phenotype and their resistance to Dox.

  9. Red light represses the photophysiology of the scleractinian coral Stylophora pistillata.

    Science.gov (United States)

    Wijgerde, Tim; van Melis, Anne; Silva, Catarina I F; Leal, Miguel C; Vogels, Luc; Mutter, Claudia; Osinga, Ronald

    2014-01-01

    Light spectrum plays a key role in the biology of symbiotic corals, with blue light resulting in higher coral growth, zooxanthellae density, chlorophyll a content and photosynthesis rates as compared to red light. However, it is still unclear whether these physiological processes are blue-enhanced or red-repressed. This study investigated the individual and combined effects of blue and red light on the health, zooxanthellae density, photophysiology and colouration of the scleractinian coral Stylophora pistillata over 6 weeks. Coral fragments were exposed to blue, red, and combined 50/50% blue red light, at two irradiance levels (128 and 256 μmol m(-2) s(-1)). Light spectrum affected the health/survival, zooxanthellae density, and NDVI (a proxy for chlorophyll a content) of S. pistillata. Blue light resulted in highest survival rates, whereas red light resulted in low survival at 256 μmol m(-2) s(-1). Blue light also resulted in higher zooxanthellae densities compared to red light at 256 μmol m(-2) s(-1), and a higher NDVI compared to red and combined blue red light. Overall, our results suggest that red light negatively affects the health, survival, symbiont density and NDVI of S. pistillata, with a dominance of red over blue light for NDVI.

  10. Red light represses the photophysiology of the scleractinian coral Stylophora pistillata.

    Directory of Open Access Journals (Sweden)

    Tim Wijgerde

    Full Text Available Light spectrum plays a key role in the biology of symbiotic corals, with blue light resulting in higher coral growth, zooxanthellae density, chlorophyll a content and photosynthesis rates as compared to red light. However, it is still unclear whether these physiological processes are blue-enhanced or red-repressed. This study investigated the individual and combined effects of blue and red light on the health, zooxanthellae density, photophysiology and colouration of the scleractinian coral Stylophora pistillata over 6 weeks. Coral fragments were exposed to blue, red, and combined 50/50% blue red light, at two irradiance levels (128 and 256 μmol m(-2 s(-1. Light spectrum affected the health/survival, zooxanthellae density, and NDVI (a proxy for chlorophyll a content of S. pistillata. Blue light resulted in highest survival rates, whereas red light resulted in low survival at 256 μmol m(-2 s(-1. Blue light also resulted in higher zooxanthellae densities compared to red light at 256 μmol m(-2 s(-1, and a higher NDVI compared to red and combined blue red light. Overall, our results suggest that red light negatively affects the health, survival, symbiont density and NDVI of S. pistillata, with a dominance of red over blue light for NDVI.

  11. Analysis and Implementation of Cryptographic Hash Functions in Programmable Logic Devices

    Directory of Open Access Journals (Sweden)

    Tautvydas Brukštus

    2016-06-01

    Full Text Available In this day’s world, more and more focused on data pro-tection. For data protection using cryptographic science. It is also important for the safe storage of passwords for this uses a cryp-tographic hash function. In this article has been selected the SHA-256 cryptographic hash function to implement and explore, based on fact that it is now a popular and safe. SHA-256 cryp-tographic function did not find any theoretical gaps or conflict situations. Also SHA-256 cryptographic hash function used cryptographic currencies. Currently cryptographic currency is popular and their value is high. For the measurements have been chosen programmable logic integrated circuits as they less effi-ciency then ASIC. We chose Altera Corporation produced prog-rammable logic integrated circuits. Counting speed will be inves-tigated by three programmable logic integrated circuit. We will use programmable logic integrated circuits belong to the same family, but different generations. Each programmable logic integ-rated circuit made using different dimension technology. Choo-sing these programmable logic integrated circuits: EP3C16, EP4CE115 and 5CSEMA5F31. To compare calculations perfor-mances parameters are provided in the tables and graphs. Re-search show the calculation speed and stability of different prog-rammable logic circuits.

  12. Solar observations with the prototype of the Brazilian Decimetric Array

    Science.gov (United States)

    Sawant, H. S.; Ramesh, R.; Faria, C.; Cecatto, J. R.; Fernandes, F. C. R.; Madsen, F. H. R.; Subramanian, K. R.; Sundararajan, M. S.

    The prototype of the Brazilian Decimetric Array BDA consists of 5 element alt-az mounted parabolic mesh type dishes of 4-meter diameter having base lines up to 220 meters in the E--W direction The array was put into regular operation at Cachoeira Paulista Brazil longitude 45 r 00 20 W and latitude 22 r 41 19 S This array operates in the frequency range of 1 2 -- 1 7 GHz Solar observations are carried at sim 1 4 GHz in transit and tracking modes Spatial fine structures superimposed on the one dimensional brightness map of the sun associated with active regions and or with solar activity and their time evolution will be presented In the second phase of the project the frequency range will be increased to 1 2 - 1 7 2 8 and 5 6 GHz Central part of the array will consist of 26 antennas with 4-meter diameter laid out randomically in the square of 256 by 256 meter with minimum and maximum base lines of 8 and 256 meters respectively Details of this array with imaging capabilities in snap shot mode for solar observations and procedure of the phase and amplitude calibrations will be presented The development of instrument will be completed by the beginning of 2008

  13. The Conference from the Prague Perspective

    Czech Academy of Sciences Publication Activity Database

    Hrubec, Marek

    2017-01-01

    Roč. 43, č. 3 (2017), s. 256-257 ISSN 0191-4537 Institutional support: RVO:67985955 Keywords : Critical Theory * Conference Philosophy and Social Science * Prague Subject RIV: AA - Philosophy ; Religion

  14. System architecture for high speed reconstruction in time-of-flight positron tomography

    International Nuclear Information System (INIS)

    Campagnolo, R.E.; Bouvier, A.; Chabanas, L.; Robert, C.

    1985-06-01

    A new generation of Time Of Flight (TOF) positron tomograph with high resolution and high count rate capabilities is under development in our group. After a short recall of the data acquisition process and image reconstruction in a TOF PET camera, we present the data acquisition system which achieves a data transfer rate of 0.8 mega events per second or more if necessary in list mode. We describe the reconstruction process based on a five stages pipe line architecture using home made processors. The expected performance with this architecture is a time reconstruction of six seconds per image (256x256 pixels) of one million events. This time could be reduce to 4 seconds. We conclude with the future developments of the system

  15. Preliminary test results from a telescope of Hughes pixel arrays at FNAL

    International Nuclear Information System (INIS)

    Jernigan, J.G.; Arens, J.; Vezie, D.; Collins, T.; Krider, J.; Skubic, P.

    1992-09-01

    In December of 1991 three silicon hybrid pixel detectors each having 2.56 x 2.56 pixels 30 μm square, made by the Hughes Aircraft Company, were placed in a high energy muon beam at the Fermi National Accelerator Laboratory. Straight tracks were recorded in these detectors at angles to the normal to the plane of the silicon ranging from 0 to 45 degrees. In this note, preliminary results are presented on the straight through tracks, i.e., those passing through the telescope at normal incidence. Pulse height data, signal-to-noise data, and preliminary straight line fits to the data resulting in residual distributions are presented. Preliminary calculations show spatial resolution of less than 5 μm in two dimensions

  16. An Improved Recovery Algorithm for Decayed AES Key Schedule Images

    Science.gov (United States)

    Tsow, Alex

    A practical algorithm that recovers AES key schedules from decayed memory images is presented. Halderman et al. [1] established this recovery capability, dubbed the cold-boot attack, as a serious vulnerability for several widespread software-based encryption packages. Our algorithm recovers AES-128 key schedules tens of millions of times faster than the original proof-of-concept release. In practice, it enables reliable recovery of key schedules at 70% decay, well over twice the decay capacity of previous methods. The algorithm is generalized to AES-256 and is empirically shown to recover 256-bit key schedules that have suffered 65% decay. When solutions are unique, the algorithm efficiently validates this property and outputs the solution for memory images decayed up to 60%.

  17. Near-infrared spectrophotometry of eight 3CR radiogalaxies: the first detections of [O III]500.7 and [S III]953.2 emission lines in galaxies with z > 1

    International Nuclear Information System (INIS)

    Rawlings, Steve; Lacy, Mark

    1991-01-01

    We present the results of near-IR spectrophotometry of eight 3CR radiogalaxies with redshifts in the range 0.256≤z≤1.575. The narrow [O III]500.7 emission line was detected in 3C13 (z = 1.351), and the narrow [S III]953.2 emission line in 3C79 (z = 0.256), in the northern near-IR knot of 3C356 (z = 1.079) and marginally in 3C368 (z=1.132). We show that narrow-line emission can sometimes account for a substantial fraction of the broad-band near-IR flux arising from the substructures of high-z radiogalaxies, but that this fraction is strongly dependent on, and therefore a valuable probe of, physical conditions within the substructures. (author)

  18. The High Energy Detector of Simbol-X

    Science.gov (United States)

    Meuris, A.; Limousin, O.; Lugiez, F.; Gevin, O.; Blondel, C.; Le Mer, I.; Pinsard, F.; Cara, C.; Goetschy, A.; Martignac, J.; Tauzin, G.; Hervé, S.; Laurent, P.; Chipaux, R.; Rio, Y.; Fontignie, J.; Horeau, B.; Authier, M.; Ferrando, P.

    2009-05-01

    The High Energy Detector (HED) is one of the three detection units on board the Simbol-X detector spacecraft. It is placed below the Low Energy Detector so as to collect focused photons in the energy range from 8 to 80 keV. It consists of a mosaic of 64 independent cameras, divided in 8 sectors. Each elementary detection unit, called Caliste, is the hybridization of a 256-pixel Cadmium Telluride (CdTe) detector with full custom front-end electronics into a unique component. The status of the HED design will be reported. The promising results obtained from the first micro-camera prototypes called Caliste 64 and Caliste 256 will be presented to illustrate the expected performance of the instrument.

  19. The High Energy Detector of Simbol-X

    International Nuclear Information System (INIS)

    Meuris, A.; Limousin, O.; Blondel, C.; Le Mer, I.; Pinsard, F.; Cara, C.; Goetschy, A.; Martignac, J.; Laurent, P.; Chipaux, R.; Rio, Y.; Fontignie, J.; Horeau, B.; Ferrando, P.; Lugiez, F.; Gevin, O.; Tauzin, G.; Herve, S.; Authier, M.

    2009-01-01

    The High Energy Detector (HED) is one of the three detection units on board the Simbol-X detector spacecraft. It is placed below the Low Energy Detector so as to collect focused photons in the energy range from 8 to 80 keV. It consists of a mosaic of 64 independent cameras, divided in 8 sectors. Each elementary detection unit, called Caliste, is the hybridization of a 256-pixel Cadmium Telluride (CdTe) detector with full custom front-end electronics into a unique component. The status of the HED design will be reported. The promising results obtained from the first micro-camera prototypes called Caliste 64 and Caliste 256 will be presented to illustrate the expected performance of the instrument.

  20. Infrared detectors, focal plane arrays, and imaging sensors; Proceedings of the Meeting, Orlando, FL, Mar. 30, 31, 1989

    Science.gov (United States)

    Dereniak, Eustace L.; Sampson, Robert T.

    1989-10-01

    The present conference on advancements in IR detectors, Schottky-barrier focal plane arrays, CCD image analysis, and HgCdTe materials gives attention to a 256 x 256 PtSi array for IR astronomy, proposals for a second-generation meteosat's advanced optical payload, cryogenic bipolar technology for on-focal-plane signal processing, a parallel cellular processing system for fast generation of perspective plots, and ultrahigh-speed CCD image sensors for scanning applications. Also discussed are MBE GaAs rib waveguide experiments at 10.6 microns, an interferometric thermal detector, the development status of superconducting IR detector research, the absorption coefficients of n-type Hg(1-x)Cd(x)Te samples, and the influence of the surface channel on crosstalk in HgCdTe photovoltaic arrays.

  1. Beam test results for the RAPS03 non-epitaxial CMOS active pixel sensor

    International Nuclear Information System (INIS)

    Biagetti, Daniele; Marras, Alessandro; Meroli, Stefano; Passeri, Daniele; Placidi, Pisana; Servoli, Leonello; Tucceri, Paola

    2011-01-01

    Recently our group has been investigating the possibility of using a standard CMOS technology - featuring no epitaxial layer - to fabricate a sensor for charged particle detection. In this work we present the results obtained exposing sensors with 256x256 pixels (10x10μm pixel size, two different pixel layouts) to 180 GeV protons and positrons at the SuperProtoSynchrotron facility (CERN). We have investigated the different response of the two architectural options in terms of S/N, cluster width, intrinsic spatial resolution, efficiency. The results show a good Landau response, S/N about 22 with an average cluster size of 4.5 pixels, and an intrinsic spatial resolution of 1.5μm (order of 1/7th of the pixel size).

  2. Trial of quantitative analysis of cardiac function by 3D reconstruction of multislice cine MR images

    International Nuclear Information System (INIS)

    Yamamoto, Hideki; Sei, Tetsurou; Nakagawa, Tomio; Hiraki, Yoshio.

    1994-01-01

    Non-invasive techniques for measuring the dynamic behavior of the left ventricle (LV) can be invaluable tool in the diagnosis of the heart disease. In this paper we present methods for quantitative analysis of cardiac function using a compact magnetic resonance image processing system. A 256 x 256 magnetic resonance transaxial image of the left ventricle in a normal case is obtained. After gray level thresholding and region segmentation, the boundary of the left ventricular chamber is extracted. Then, the boundaries of the left ventricular chamber are displayed three-dimensionally by using the Z-buffer algorithm. Thus, LV volume and ejection fraction are calculated. Here, the value of LV ejection fraction is 60%. These results agree reasonably well with the corresponding data obtained by the echocardiography. (author)

  3. 3D finite element model of elastoplastic contact on the double sinus rough surface

    International Nuclear Information System (INIS)

    Hagege, H; Bouvier, S; Mazeran, P-E; Bigerelle, M

    2011-01-01

    One of the objectives in the field of tribology is to solve the mechanical stress-displacement problem involved by rough contacts. In our approach, the surface chosen is a 256-256 μm 2 3D sinusoidal shape (amplitude 4.5μm, wavelength 50μm) with an elastoplastic constitutive behaviour. The constitutive law combines isotropic and kinematic hardening and is experimentally identified from 316L steel sheets. The FEM deformable surface is crushed then uncrushed by a rigid flat surface: stresses, contact pressure and plastic cumulated strain are computed. We investigate the results sensitivity with respect to the level of in-plane refinement. At last, we conclude on some guidelines for 3D finite elements modelling of rough surfaces.

  4. MR imaging of the pulmonary vasculature: Cine and high-resolution techniques

    International Nuclear Information System (INIS)

    Gefter, W.B.; Hatabu, H.; Kressel, H.Y.; Axel, L.; Lenkinski, R.E.; Schiebler, M.L.; Dougherty, L.; Douglas, P.S.; Reichek, N.

    1987-01-01

    Pulmonary vessels were evaluated on 43 cine examinations (12 normals, 31 with cardiopulmonary diseases) at 1.5 T (General Electric). Arteries and veins could be differentiated by characteristic intensity fluctuations in 90%. Abnormal patterns were observed with elevated left atrial pressure, pulmonary hypertension, pulmonic stenosis, and mitral regurgitation. A small arteriovenous malformation was identified. Approaches to high-resolution imaging included surface coils, 24-cm field of view, and 256 x 256 matrix. Spin-echo (SE) sequences gated in systole or diastole, and GRASS with and without breath-holding were evaluated. Surface-coil SE diastolic images (4 NEX) visualized sixth- and seventh-generation vessels. Breath-hold GRASS showed fifth- and sixth-generation vessels without respiratory artifact. These are promising techniques for displaying the pulmonary circulation

  5. [Characteristics of polyamine biosynthesis regulation and tumor growth rate in hormone-dependant grafted breast tumors of mice and rats].

    Science.gov (United States)

    Orlovskiĭ, A A

    2007-01-01

    Effect of the inhibitors of polyamines biosynthesis on completely or partially hormone-dependant breast tumors (mouse Ca755 carcinoma and Walker W-256 carcinosarcoma) is essentially special: in contrary to hormone-dependant tumors, this effect may be not only breaking but stimulating as well. Change-over from one to another mode of reaction is conditioned, most probable, by hormonal status, which is determined by one or another estral cycle phase. Biochemical mechanisms of this change-over are closely connected with polyamines metabolism, namely the degree of polyamines (especially spermine) interconvertion and physiological reactivity level of the system controlling expression of ornithin-decarboxilase. At that, the first of these pathways is predominant for completely hormone-dependant Ca755 and the second one -for partially hormone-dependant W-256.

  6. Status of Radiotherapy around the World: Radiotherapy in China. Chapter 25.6

    International Nuclear Information System (INIS)

    Zhu, Ci; Yin, Wei Bo; Chen, Bo; Zhang, Chun Li; Zhang, Hong Zhi; Li, Ye Xiong

    2017-01-01

    China’s experience of using radiotherapy to treat cancer began with the installation of the first superficial X ray machine at Peking Union Medical College Hospital in early 1920, followed by the first 200 kV deep X ray machine installed at the French Hospital in Shanghai in 1923, and the first Chinese radiotherapy department established at the Affiliated Hospital of Peking University in 1932. However, the field of radiotherapy in China was still in its infancy between the 1930s and 1960s, as all operating machines were imported from foreign countries, making radiotherapy very difficult to access for cancer patients. Progress was slow until the mid-1970s, when the first batch of megavoltage machines (cobalt-60 machines and linacs) was produced by Chinese manufacturers. Owing to the efforts of radiotherapy pioneers such as Wu Huanxing, Gu Xianzhi, Liu Taifu, and Yin Weibo, who brought radiotherapy to China and shaped how Chinese patients would be treated today, radiotherapy was installed as one of the mainstream modalities of cancer treatment. In 1986, the China Society for Radiation Oncology (CSTRO) was founded, indicating that a network advancing radiation oncology practice in China was taking shape. One year later, the first issue of the Chinese Journal of Radiation Oncology was published, offering a platform for the timely exchange and sharing of laboratory and clinical research outcomes among radiation oncology professions across the country. During the past two decades, with the introduction of the gamma knife and stereotactic radiotherapy, 3-D conformal radiotherapy, IMRT, IGRT and other advanced techniques, China experienced not only a big jump in its radiotherapy equipment and facilities, but also a dramatic growth in the excellence of radiation oncology specialist staff nationwide

  7. Jak se laser uplatnil v holografii?

    Czech Academy of Sciences Publication Activity Database

    Miler, Miroslav

    2010-01-01

    Roč. 60, 4-5 (2010), s. 251-256 ISSN 0009-0700 Institutional research plan: CEZ:AV0Z20670512 Keywords : holography * lasers * coherence Subject RIV: JA - Electronics ; Optoelectronics, Electrical Engineering

  8. 77 FR 52336 - National Institute of Mental Health Notice of Meeting

    Science.gov (United States)

    2012-08-29

    ... connection; (D) Minimum of Pentium 400 with 256 MB of RAM (Recommended); (E) Java Virtual Machine enabled... . Dated: August 23, 2012. Carolyn A. Baum, Program Analyst, Office of Federal Advisory Committee Policy...

  9. Krajina jako prostředí k rekreaci - na příkladu Šuamvy

    Czech Academy of Sciences Publication Activity Database

    Kušová, Drahomíra; Těšitel, Jan; Bartoš, Michael

    2001-01-01

    Roč. 35, č. 5 (2001), s. 253-256 ISSN 0044-4863 Institutional research plan: CEZ:AV0Z6087904 Keywords : tourism * leisure time activities * sociological survey Subject RIV: AO - Sociology, Demography

  10. Spatial resolution evaluation with a pair of two four-layer DOI detectors for small animal PET scanner: jPET-RD

    Energy Technology Data Exchange (ETDEWEB)

    Nishikido, Fumihiko [National Institute of Radiological Sciences, Anagawa 4-9-1 Inage-ku, Chiba-shi, Chiba 263-8555 (Japan)], E-mail: funis@nirs.go.jp; Tsuda, Tomoaki [Shimadzu Corporation, Nishinokyo Kuwabaracho 1 Nakagyo-ku, Kyoto-shi, Kyoto 604-8511 (Japan); Yoshida, Eiji; Inadama, Naoko; Shibuya, Kengo; Yamaya, Taiga [National Institute of Radiological Sciences, Anagawa 4-9-1 Inage-ku, Chiba-shi, Chiba 263-8555 (Japan); Kitamura, Keishi [Shimadzu Corporation, Nishinokyo Kuwabaracho 1 Nakagyo-ku, Kyoto-shi, Kyoto 604-8511 (Japan); Takahashi, Kei [National Institute of Radiological Sciences, Anagawa 4-9-1 Inage-ku, Chiba-shi, Chiba 263-8555 (Japan); Graduate School of Science and Technology, Chiba University, Yayoi-cho 1-33, Inage-ku, Chiba-shi, Chiba 263-8522 (Japan); Ohmura, Atsushi [National Institute of Radiological Sciences, Anagawa 4-9-1 Inage-ku, Chiba-shi, Chiba 263-8555 (Japan); Graduate School of Advanced Science and Engineering, Waseda University, Okubo 3-4-1, Shinjuku-ku, Tokyo 169-8555 (Japan); Murayama, Hideo [National Institute of Radiological Sciences, Anagawa 4-9-1 Inage-ku, Chiba-shi, Chiba 263-8555 (Japan)

    2008-01-01

    We are developing a small animal PET scanner, 'jPET-RD' to achieve high sensitivity as well as high spatial resolution by using four-layer depth-of-interaction (DOI) detectors. The jPET-RD is designed with two detector rings. Each detector ring is composed of six DOI detectors arranged hexagonally. The diameter of the field-of-view (FOV) is 8.8 cm, which is smaller than typical small animal PET scanners on the market now. Each detector module consists of a crystal block and a 256-channel flat panel position-sensitive photomultiplier tube. The crystal block, consisting of 32x32x4 crystal (4096 crystals, each 1.46 mmx1.46 mmx4.5 mm) and a reflector, is mounted on the 256ch FP-PMT. In this study, we evaluated the spatial resolution of reconstructed images with the evaluation system of two four-layer DOI detectors which consist of 32x32x4 LYSO (Lu: 98%, Y: 2%) crystals coupled on the 256ch FP-PMT by using RTV rubber. The spatial resolution of 1.5 mm was obtained at the center of the FOV by the filtered back projection. The spatial resolution, better than 2 mm in the whole FOV, was also achieved with DOI while the spatial resolution without DOI was degraded to 3.3 mm.

  11. Spatial resolution evaluation with a pair of two four-layer DOI detectors for small animal PET scanner: jPET-RD

    International Nuclear Information System (INIS)

    Nishikido, Fumihiko; Tsuda, Tomoaki; Yoshida, Eiji; Inadama, Naoko; Shibuya, Kengo; Yamaya, Taiga; Kitamura, Keishi; Takahashi, Kei; Ohmura, Atsushi; Murayama, Hideo

    2008-01-01

    We are developing a small animal PET scanner, 'jPET-RD' to achieve high sensitivity as well as high spatial resolution by using four-layer depth-of-interaction (DOI) detectors. The jPET-RD is designed with two detector rings. Each detector ring is composed of six DOI detectors arranged hexagonally. The diameter of the field-of-view (FOV) is 8.8 cm, which is smaller than typical small animal PET scanners on the market now. Each detector module consists of a crystal block and a 256-channel flat panel position-sensitive photomultiplier tube. The crystal block, consisting of 32x32x4 crystal (4096 crystals, each 1.46 mmx1.46 mmx4.5 mm) and a reflector, is mounted on the 256ch FP-PMT. In this study, we evaluated the spatial resolution of reconstructed images with the evaluation system of two four-layer DOI detectors which consist of 32x32x4 LYSO (Lu: 98%, Y: 2%) crystals coupled on the 256ch FP-PMT by using RTV rubber. The spatial resolution of 1.5 mm was obtained at the center of the FOV by the filtered back projection. The spatial resolution, better than 2 mm in the whole FOV, was also achieved with DOI while the spatial resolution without DOI was degraded to 3.3 mm

  12. Use of an anti-platelet monoclonal antibody F (ab')2 fragment for imaging thrombus

    International Nuclear Information System (INIS)

    Loutfi, I.; Stuttle, A.W.J.; Peters, A.M.; George, P.; Lavender, J.P.; Lumley, P.

    1990-01-01

    Ten patients with suspected thrombus have been studied using 111 In-labelled F (ab')2 fragments of P256, a monoclonal antibody which recognizes an epitope on the platelet membrane glycoprotein IIb/IIIa complex. The F (ab')2 fragment was radiolabelled with 111 In via diethylenetri-aminepentamacetic acid to give a specific activity of up to 190 MBq (5mCi) mg - 1 without impairment of immunoreactivity. In vitro platelet aggregation studies showed that the F (ab')2 fragment caused less platelet aggregation than the whole antibody on a molar ratio and was without significant effect upon the sensitivity of platelets to a range of aggregating agents. Platalets were labelled in ten patients by intravenous injection of approximately 100 μg P256 F (ab')2. Of the ten patients studies, six showed localization of activity consistent with platelet accumulation. Localization was clearly seen when associated with thrombus of the lower limbs (three patients: deep vein thrombosis; one patient: aortofemoral graft), and was apparent although less marked in two other cases, one of aortic aneurysm and one of carotid stenosis. Use of radiolabelled P256 F (ab')2 offers a means of non-invasive detection of thrombus which, from in vitro studies, would appear to have less direct effect of platelet behaviour than the whole antibody. (author). 9 refs. 8 figs. 1 tab

  13. effectiveness of community based seed multiplication in enhancing

    African Journals Online (AJOL)

    ACSS

    driven CBSM and factors influencing farmers' access to improved bean seed. ... increased crop production and productivity. .... extension workers and local leaders. A total sample of 256 respondents from five ... maintenance of genetic purity.

  14. Computational Equipment for Support of Air Force Sponsored Programs for the Design of Advanced and Miniaturized Explosive and Advanced Propellant Systems

    National Research Council Canada - National Science Library

    Stewart, D. S; Buckmaster, John D; Jackson, Thomas L

    2008-01-01

    This grant funded the acquisition of a 128 node/256 processor cluster computer that now supports the computational needs of the combined, Air Force-sponsored research groups of Prof. D. Scott Stewart (PI...

  15. African Journal for the Psychological Study of Social Issues - Vol 9 ...

    African Journals Online (AJOL)

    Product's promotion patterns and their effects on consumers' purchase intentions, brand loyalty and attitude · EMAIL FULL TEXT EMAIL FULL TEXT · DOWNLOAD FULL TEXT DOWNLOAD FULL TEXT. NA Shenge, 249-256 ...

  16. Hinke Piersma en Jeroen Kemperman, Openstaande rekeningen. De gemeente Amsterdam en de gevolgen van roof en rechtsherstel, 1940-1950.

    Directory of Open Access Journals (Sweden)

    Regina Grüter

    2017-05-01

    Full Text Available Hinke Piersma en Jeroen Kemperman, Openstaande rekeningen. De gemeente Amsterdam en de gevolgen van roof en rechtsherstel, 1940-1950 (Amsterdam: Boom, 2015, 256 pp., isbn 978 908 953 661 7.

  17. Phosphorus, nitrogen, and radionuclide retention and leaching from a Joel sand amended with red mud/gypsum

    International Nuclear Information System (INIS)

    McPharlin, L.R.; Jeffery, R.C.; Toussaint, L.F.; Cooper, M.

    1994-01-01

    The leaching of phosphorus (P), nitrogen (N), and radionuclides 232 Th, 226 Ra, 228 Ra, and 40 K from Joel sands amended with red mud/gypsum (RMG) at 9 rates (0, 2, 4, 8, 16, 32, 64, 128, and 256 t/ha) was measured using columns. Intense leaching conditions (34 mm/day for 12 days) and a high rate of applied P (320 kg/ha as superphosphate) and N (680 kg/ha as ammonium nitrate) were used to simulate extremes of irrigated vegetable production on the Swan Coastal Plain. Addition of the highest rate of RMG (256 t/ha) reduced leaching of fertiliser P and ammonium-nitrogen (NH4-N) by 85% and 50%, respectively, compared with 0 t/ha after 12 days. At 64 t RMG/ha P leaching was reduced 50% compared with 0 t/ha. Nitrate-nitrogen (NO3-N) leaching was not affected by addition of RMG. Reduced leaching of NH4-N was attributed to an increase in cation exchange capacity of the soil with the addition of RMG. Bicarbonate-extractable P in the soil increased with rate of RMG to >50 μg P/g soil at 256 t/ha. This indicates that soil testing of residual P could be used to reduce P inputs to vegetable crops after soils were amended with RMG. This would further reduce the impact of vegetable production on the water systems of the Swan Coastal Plain and extend the period of effectiveness of RMG amended soils. The increase in 232 Th specific activity in Joel sand amended with RMG was well below statutory limits even at the highest rate. Neither 40 K nor 226 Ra were detectable in RMG amended sands up to 256 t RMG/ha. There was no evidence of leaching of 226 Ra or 228 Ra at any rate of RMG. These results suggest that the use of RMG amendment on commercial horticultural properties on the Swan Coastal Plain could be feasible. 30 refs., 7 figs., 2 tabs

  18. Miniature infrared hyperspectral imaging sensor for airborne applications

    Science.gov (United States)

    Hinnrichs, Michele; Hinnrichs, Bradford; McCutchen, Earl

    2017-05-01

    Pacific Advanced Technology (PAT) has developed an infrared hyperspectral camera, both MWIR and LWIR, small enough to serve as a payload on a miniature unmanned aerial vehicles. The optical system has been integrated into the cold-shield of the sensor enabling the small size and weight of the sensor. This new and innovative approach to infrared hyperspectral imaging spectrometer uses micro-optics and will be explained in this paper. The micro-optics are made up of an area array of diffractive optical elements where each element is tuned to image a different spectral region on a common focal plane array. The lenslet array is embedded in the cold-shield of the sensor and actuated with a miniature piezo-electric motor. This approach enables rapid infrared spectral imaging with multiple spectral images collected and processed simultaneously each frame of the camera. This paper will present our optical mechanical design approach which results in an infrared hyper-spectral imaging system that is small enough for a payload on a mini-UAV or commercial quadcopter. The diffractive optical elements used in the lenslet array are blazed gratings where each lenslet is tuned for a different spectral bandpass. The lenslets are configured in an area array placed a few millimeters above the focal plane and embedded in the cold-shield to reduce the background signal normally associated with the optics. We have developed various systems using a different number of lenslets in the area array. Depending on the size of the focal plane and the diameter of the lenslet array will determine the spatial resolution. A 2 x 2 lenslet array will image four different spectral images of the scene each frame and when coupled with a 512 x 512 focal plane array will give spatial resolution of 256 x 256 pixel each spectral image. Another system that we developed uses a 4 x 4 lenslet array on a 1024 x 1024 pixel element focal plane array which gives 16 spectral images of 256 x 256 pixel resolution each

  19. SU-E-I-91: Development of a Compact Radiographic Simulator Using Microsoft Kinect.

    Science.gov (United States)

    Ono, M; Kozono, K; Aoki, M; Mizoguchi, A; Kamikawa, Y; Umezu, Y; Arimura, H; Toyofuku, F

    2012-06-01

    Radiographic simulator system is useful for learning radiographic techniques and confirmation of positioning before x-ray irradiation. Conventional x-ray simulators have drawbacks in cost and size, and are only applicable to situations in which position of the object does not change. Therefore, we have developed a new radiographic simulator system using an infrared-ray based three-dimensional shape measurement device (Microsoft Kinect). We made a computer program using OpenCV and OpenNI for processing of depth image data obtained from Kinect, and calculated the exact distance from Kinect to the object by calibration. Theobject was measured from various directions, and positional relationship between the x-ray tube and the object was obtained. X-ray projection images were calculated by projecting x-rays onto the mathematical three-dimensional CT data of a head phantom with almost the same size. The object was rotated from 0 degree (standard position) through 90 degrees in increments of 10 degrees, and the accuracy of the measured rotation angle values was evaluated. In order to improve the computational time, the projection image size was changed (512*512, 256*256, and 128*128). The x-ray simulation images corresponding to the radiographic images produced by using the x-ray tube were obtained. The three-dimensional position of the object was measured with good precision from 0 to 50 degrees, but above 50 degrees, measured position error increased with the increase of the rotation angle. The computational time and image size were 30, 12, and 7 seconds for 512*512, 256*256, and 128*128, respectively. We could measure the three-dimensional position of the object using properly calibrated Kinect sensor, and obtained projection images at relatively high-speed using the three-dimensional CTdata. It was suggested that this system can be used for obtaining simulated projection x-ray images before x-ray exposure by attaching this device onto an x-ray tube. © 2012 American

  20. Signal-to-noise assessment for diffusion tensor imaging with single data set and validation using a difference image method with data from a multicenter study

    Energy Technology Data Exchange (ETDEWEB)

    Wang, Zhiyue J., E-mail: jerry.wang@childrens.com [Department of Radiology, Children' s Medical Center, Dallas, Texas 75235 and Department of Radiology, University of Texas Southwestern Medical Center, Dallas, Texas 75390 (United States); Chia, Jonathan M. [Clinical Science, Philips Healthcare, Cleveland, Ohio 44143 (United States); Ahmed, Shaheen; Rollins, Nancy K. [Department of Radiology, Children' s Medical Center, Dallas, TX 75235 and Department of Radiology, University of Texas Southwestern Medical Center, Dallas, TX 75390 (United States)

    2014-09-15

    Purpose: To describe a quantitative method for determination of SNR that extracts the local noise level using a single diffusion data set. Methods: Brain data sets came from a multicenter study (eight sites; three MR vendors). Data acquisition protocol required b = 0, 700 s/mm{sup 2}, fov = 256 × 256 mm{sup 2}, acquisition matrix size 128 × 128, reconstruction matrix size 256 × 256; 30 gradient encoding directions and voxel size 2 × 2 × 2 mm{sup 3}. Regions-of-interest (ROI) were placed manually on the b = 0 image volume on transverse slices, and signal was recorded as the mean value of the ROI. The noise level from the ROI was evaluated using Fourier Transform based Butterworth high-pass filtering. Patients were divided into two groups, one for filter parameter optimization (N = 17) and one for validation (N = 10). Six white matter areas (the genu and splenium of corpus callosum, right and left centrum semiovale, right and left anterior corona radiata) were analyzed. The Bland–Altman method was used to compare the resulting SNR with that from the difference image method. The filter parameters were optimized for each brain area, and a set of “global” parameters was also obtained, which represent an average of all regions. Results: The Bland–Altman analysis on the validation group using “global” filter parameters revealed that the 95% limits of agreement of percent bias between the SNR obtained with the new and the reference methods were −15.5% (median of the lower limit, range [−24.1%, −8.9%]) and 14.5% (median of the higher limits, range [12.7%, 18.0%]) for the 6 brain areas. Conclusions: An FT-based high-pass filtering method can be used for local area SNR assessment using only one DTI data set. This method could be used to evaluate SNR for patient studies in a multicenter setting.

  1. SU-D-204-07: Comparison of AAPM TG150 Draft Image Receptor Tests with Vendor Automated QC Tests for Five Mobile DR Units

    Energy Technology Data Exchange (ETDEWEB)

    Li, G; Nishino, T [UT MD Anderson Cancer Center, Houston, TX (United States); Greene, T [Radiation Services, Inc., Dover, FL (United States); Willis, C [MD Anderson Cancer Center, Bellaire, TX (United States)

    2015-06-15

    Purpose: To determine the consistency of digital detector (DR) tests recommended by AAPM TG150 and tests provided by commercially available DirectView Total Quality Tool (TQT). Methods: The DR tests recommended by the TG150 Detector Subgroup[1] were performed on 4 new Carestream DRX-Revolution and one Carestream DRX1C retrofit of a GE AMX-4 that had been in service for three years. After detector calibration, flat-field images plus images of two bar patterns oriented parallel and perpendicular to the A-C axis, were acquired at conditions recommended by TG150. Raw images were harvested and then analyzed using a MATLAB software previously validated[2,3,4]. Data were analyzed using ROIs of two different dimensions: 1) 128 x 128 ROIs matching the detector electronics; and 2) 256 x 256 ROIs, each including 4 adjacent smaller ROIs. TG150 metrics from 128 x 128 ROIs were compared to TQT metrics, which are also obtained from 128 x 128 ROIs[5]. Results: The results show that both TG150 and TQT measurements were consistent among these detectors. Differences between TG150 and TQT values appear systematic. Compared with 128 x 128 ROIs, noise and SNR non-uniformity were lower with 256 x 256 ROIs, although signal non-uniformity was similar, indicating detectors were appropriately calibrated for gain and offset. MTF of the retrofit unit remained essentially the same between 2012 and 2015, but was inferior to the new units. The older generator focal spot is smaller (0.75mm vs. 1.2mm), and the SID for acquisition is 182cm as well, so focal spot dimensions cannot explain the difference. The difference in MTF may be secondary to differences in generator X-ray spectrum or by unannounced changes in detector architecture. Further investigation is needed. Conclusion: The study shows that both TG150 and TQT tests are consistent. The numerical value of some metrics are dependent on ROI size.

  2. An Autonomous Sensor Tasking Approach for Large Scale Space Object Cataloging

    Science.gov (United States)

    Linares, R.; Furfaro, R.

    The field of Space Situational Awareness (SSA) has progressed over the last few decades with new sensors coming online, the development of new approaches for making observations, and new algorithms for processing them. Although there has been success in the development of new approaches, a missing piece is the translation of SSA goals to sensors and resource allocation; otherwise known as the Sensor Management Problem (SMP). This work solves the SMP using an artificial intelligence approach called Deep Reinforcement Learning (DRL). Stable methods for training DRL approaches based on neural networks exist, but most of these approaches are not suitable for high dimensional systems. The Asynchronous Advantage Actor-Critic (A3C) method is a recently developed and effective approach for high dimensional systems, and this work leverages these results and applies this approach to decision making in SSA. The decision space for the SSA problems can be high dimensional, even for tasking of a single telescope. Since the number of SOs in space is relatively high, each sensor will have a large number of possible actions at a given time. Therefore, efficient DRL approaches are required when solving the SMP for SSA. This work develops a A3C based method for DRL applied to SSA sensor tasking. One of the key benefits of DRL approaches is the ability to handle high dimensional data. For example DRL methods have been applied to image processing for the autonomous car application. For example, a 256x256 RGB image has 196608 parameters (256*256*3=196608) which is very high dimensional, and deep learning approaches routinely take images like this as inputs. Therefore, when applied to the whole catalog the DRL approach offers the ability to solve this high dimensional problem. This work has the potential to, for the first time, solve the non-myopic sensor tasking problem for the whole SO catalog (over 22,000 objects) providing a truly revolutionary result.

  3. The 150 ns detector project: Prototype preamplifier results

    Science.gov (United States)

    Warburton, W. K.; Russell, S. R.; Kleinfelder, Stuart A.

    1994-08-01

    The long-term goal of the 150 ns detector project is to develop a pixel area detector capable of 6 MHz frame rates (150 ns/frame). Our milestones toward this goal are: a single pixel, 1×256 1D and 8×8 2D detectors, 256×256 2D detectors and, finally, 1024 × 1024 2D detectors. The design strategy is to supply a complete electronics chain (resetting preamp, selectable gain amplifier, analog-to-digital converter (ADC), and memory) for each pixel. In the final detectors these will all be custom integrated circuits. The front-end preamplifiers are integrated first, since their design and performance are the most unusual and also critical to the project's success. Similarly, our early work is concentrated on devising and perfecting detector structures. In this paper we demonstrate the performance of prototypes of our integrated preamplifiers. While the final design will have 64 preamps to a chip, including a switchable gain stage, the prototypes were integrated 8 channels to a "Tiny Chip" and tested in 4 configurations (feedback capacitor Cf equal 2.5 or 4.0 pF, output directly or through a source follower). These devices have been tested thoroughly for reset settling times, gain, linearity, and electronic noise. They generally work as designed, being fast enough to easily integrate detector charge, settle, and reset in 150 ns. Gain and linearity appear to be acceptable. Current values of electronic noise, in double-sampling mode, are about twice the design goal of {2}/{3} of a single photon at 6 keV. We expect this figure to improve with the addition of the onboard amplifier stage and improved packaging. Our next test chip will include these improvements and allow testing with our first detector samples, which will be 1×256 (50 μm wide pixels) and 8×8 (1 mm 2 pixels) element detector on 1 mm thick silicon.

  4. Ghana Journal of Geography: Submissions

    African Journals Online (AJOL)

    PROMOTING ACCESS TO AFRICAN RESEARCH ... The title page should include: The name(s) of the author(s); A concise and informative ... General Guide ... Journal of Database Marketing & Customer Strategy Management, 17, 247 – 256.

  5. Archeologický výzkum zaniklého těžebního areálu u kostela sv. Václava v Pněvicích (okr. Kutná Hora)

    Czech Academy of Sciences Publication Activity Database

    Končelová, Markéta; Velímský, Filip

    2012-01-01

    Roč. 12, prosinec (2012), s. 253-256 ISSN 1801-5972 Institutional research plan: CEZ:AV0Z80020508 Keywords : Kutná Hora * archaeology * Middle Ages * silver mining Subject RIV: AC - Archeology, Anthropology, Ethnology

  6. „Diderot miloval mystifikace“, a co Milan Kundera?

    Czech Academy of Sciences Publication Activity Database

    Jungmannová, Lenka

    2017-01-01

    Roč. 65, č. 2 (2017), s. 235-256 ISSN 0009-0468 Institutional support: RVO:68378068 Keywords : Czech drama * Kundera, Milan * Steigerwald, Karel Subject RIV: AJ - Letters, Mass-media, Audiovision OBOR OECD: Specific literatures

  7. Characterization of 3 to 5 Micron Thermal Imagers and Analysis of Narrow Band Images

    National Research Council Canada - National Science Library

    Quek, Yew S

    2004-01-01

    ...) and the Minimum Resolvable Temperature (MRT). An available thermal imager, the Cincinnati Electronics IRRIS-256LN, and a newly purchased thermal imager, the Indigo Systems Merlin InSb Laboratory Camera, were investigated and compared...

  8. ORF Alignment: NC_003888 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_003888 gi|21219041 >1pv1A 14 282 20 256 6e-05 ... emb|CAE53384.1| hypothetical protein [Actinoplanes... teichomyceticus] emb|CAG15045.1| ... hypothetical protein [Actinoplanes teichomyce

  9. ORF Alignment: NC_003306 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_003306 gi|17938860 >1pv1A 14 282 20 256 6e-05 ... emb|CAE53384.1| hypothetical protein [Actinoplanes... teichomyceticus] emb|CAG15045.1| ... hypothetical protein [Actinoplanes teichomyce

  10. ORF Alignment: NC_003064 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_003064 gi|16119505 >1pv1A 14 282 20 256 6e-05 ... emb|CAE53384.1| hypothetical protein [Actinoplanes... teichomyceticus] emb|CAG15045.1| ... hypothetical protein [Actinoplanes teichomyce

  11. 78 FR 76604 - Grand River Dam Authority; Notice of Application Tendered for Filing With the Commission and...

    Science.gov (United States)

    2013-12-18

    ...(a)-825(r). h. Applicant Contact: Dr. Darrell Townsend, P.O. Box 70, Langley, Oklahoma, 74350-0070; (918) 256-0616; [email protected] . i. FERC Contact: Stephen Bowler, (202) 502-6861, or stephen.bowler...

  12. Sõlmes alumiiniummaja = Aluminium House in a Knot

    Index Scriptorium Estoniae

    2008-01-01

    Alumiiniumplaatidega kaetud sõlmekujulise plaaniga eramu (256 m2). Arhitektid: Peeter Pere, Urmas Muru. Projektbüroo: Muru & Pere. Konsultant Katrin Kaevats. Valmis: 2007. 2 plaani, 4 värv. välisvaadet, sisevaade

  13. O ČEZu, UNESCU a Ikee. Psaní iniciálových zkratkových slov a tendence k jejich skloňování

    Czech Academy of Sciences Publication Activity Database

    Dufek, Ondřej

    2016-01-01

    Roč. 99, č. 5 (2016), s. 256-268 ISSN 0027-8203 R&D Projects: GA MŠk(CZ) LM2010013 Institutional support: RVO:68378092 Keywords : initialism * acronym * declension * orthography Subject RIV: AI - Linguistics

  14. Fast iterative segmentation of high resolution medical images

    International Nuclear Information System (INIS)

    Hebert, T.J.

    1996-01-01

    Various applications in positron emission tomography (PET), single photon emission computed tomography (SPECT) and magnetic resonance imaging (MRI) require segmentation of 20 to 60 high resolution images of size 256x256 pixels in 3-9 seconds per image. This places particular constraints on the design of image segmentation algorithms. This paper examines the trade-offs in segmenting images based on fitting a density function to the pixel intensities using curve-fitting versus the maximum likelihood method. A quantized data representation is proposed and the EM algorithm for fitting a finite mixture density function to the quantized representation for an image is derived. A Monte Carlo evaluation of mean estimation error and classification error showed that the resulting quantized EM algorithm dramatically reduces the required computation time without loss of accuracy

  15. Development of a “Fission-proxy” Method for the Measurement of 14-MeV Neutron Fission Yields at CAMS

    Energy Technology Data Exchange (ETDEWEB)

    Gharibyan, Narek [Lawrence Livermore National Lab. (LLNL), Livermore, CA (United States)

    2016-10-25

    Relative fission yield measurements were made for 50 fission products from 25.6±0.5 MeV alpha-induced fission of Th-232. Quantitative comparison of these experimentally measured fission yields with the evaluated fission yields from 14-MeV neutron-induced fission of U-235 demonstrates the feasibility of the proposed fission-proxy method. This new technique, based on the Bohr-independence hypothesis, permits the measurement of fission yields from an alternate reaction pathway (Th-232 + 25.6 MeV α → U-236* vs. U-235 + 14-MeV n → U-236*) given that the fission process associated with the same compound nucleus is independent of its formation. Other suitable systems that can potentially be investigated in this manner include (but are not limited to) Pu-239 and U-237.

  16. Fast high-resolution MR imaging using the snapshot-FLASH MR sequence

    International Nuclear Information System (INIS)

    Matthaei, D.; Haase, A.; Henrich, D.; Duhmke, E.

    1990-01-01

    Snapshot, fast low-angle short (FLASH) MR imaging using an accelerated FLASH-MR sequence provides MR images with measuring times far below 1 second. The short TE of this sequence prevents susceptibility artifacts in gradient-echo imaging. In this paper variations of the sequence are shown that provide high resolution images with T1-weighted IR, T2-weighted SE, and chemical shift (CHESS) contrast sequences. METHODS AND MATERIALS: A whole-body 2-T system (Bruker-Medizintechnik) were used in combination with a 60-cm gradient system (providing gradient strength of 5 mT/m) to study healthy volunteers. The measuring time for a 256 x 256 image matrix was 800 msec. This sequence has been used in combination with T1-weighted IR, T2-weighted SE, and CHESS variations

  17. Cytochrome P450-dependent N-hydroxylation of an aminoguanidine (amidinohydrazone) and microsomal retroreduction of the N-hydroxylated product.

    Science.gov (United States)

    Clement, B; Schultze-Mosgau, M H; Richter, P H; Besch, A

    1994-07-01

    1. The first example of a P450-dependent N-hydroxylation of an aminoguanidine (amidinohydrazone) is reported for 2-amino-5-chlorobenzophenone amidinohydrazone 1 (G 256) as substrate. 2. The N-hydroxylated metabolite 2 (2-amino-5-chlorobenzophenone N-hydroxyamidinohydrazone NOH-G256) and a further metabolite of 1, the phenol 3, were identified by tlc and ms analysis. 3. The microsomal reduction of an N-hydroxyaminoguanidine (N-hydroxy-amidino-hydrazone) was also demonstrated for the transformation of 2 to 1. 4. Both the N-hydroxylation of the aminoguanidine and the retroreduction of the N-hydroxyaminoguanidine were characterized by quantitative hplc analysis. 5. The conversion of the aminoguanidine 1 to N-hydroxyaminoguanidine 2 may be considered as an analogue of the physiological N-hydroxylation of arginine to N-hydroxyarginine by NO synthases.

  18. Design and implementation of FIR filter based on STM32F103x

    Directory of Open Access Journals (Sweden)

    ZHENG Zhendong

    2013-08-01

    Full Text Available STM32F1 series processors are based on ST's new generation of ARM cortex-M3 processor core to meet the industrial control,medical,consumer and other areas of application requirements. At the same time,ST companies also launched a set of DSP function library for the STM32F10x series,enabling common digital signal processing. In this paper,a set of FIRfilter design and implementation is proposed for the STM32F10x series. Experiments show that the integer filter coefficients can replace the float coefficients in FIRfilter design. When the sampling rate is 256 samples per second,the FIRfilter is of the order of 128 and takes only 1.5ms to finish filtering 256 samples,fully meeting the design requirements for industrial control systems.

  19. Use of personal computer image for processing a magnetic resonance image (MRI)

    International Nuclear Information System (INIS)

    Yamamoto, Tetsuo; Tanaka, Hitoshi

    1988-01-01

    Image processing of MR imaging was attempted by using a popular personal computer as 16-bit model. The computer processed the images on a 256 x 256 matrix and 512 x 512 matrix. The softwer languages for image-processing were those of Macro-Assembler performed by (MS-DOS). The original images, acuired with an 0.5 T superconducting machine (VISTA MR 0.5 T, Picker International) were transfered to the computer by the flexible disket. Image process are the display of image to monitor, other the contrast enhancement, the unsharped mask contrast enhancement, the various filter process, the edge detections or the color histogram was obtained in 1.6 sec to 67 sec, indicating that commercialzed personal computer had ability for routine clinical purpose in MRI-processing. (author)

  20. [Effects of salt stress on germination and in vitro growth of pistachio (Pistacia vera L.)].

    Science.gov (United States)

    Benmahioul, Benamar; Daguin, Florence; Kaid-Harche, Meriem

    2009-08-01

    In order to study the salinity tolerance of pistachio (Pistacia vera L.), embryos developed from mature seeds were isolated and cultured in vitro and subjected to different NaCl concentrations (0, 42.8, 85.5, 171.1 and 256.6 mM) for 30 days. The results showed that in vitro germination of embryonic axes was not affected by the salt concentration. However, the germinated embryo survival rates decreased from 100% for the control to 62.9% for the highest salt concentration (256.6 mM). In addition, the plantlet growth (length of aerial and root parts, number of leaf produced per embryo, as well as the production of total fresh and dry matter for both aerial parts and roots) showed significant differences according the various salt concentrations.

  1. Browse Title Index

    African Journals Online (AJOL)

    Items 151 - 200 of 256 ... Vol 13, No 3 (2015), Molecular epidemiology of contagious bovine pleuropneumonia ... Vol 11, No 2 (2013), Nanotechnology applications in veterinary .... of dermatophytes among domestic horses in Kwara state, Nigeria ...

  2. Studies on supramolecular gel formation using DOSY NMR

    Czech Academy of Sciences Publication Activity Database

    Nonappa, N.; Šaman, David; Kolehmainen, E.

    2015-01-01

    Roč. 53, č. 4 (2015), s. 256-260 ISSN 0749-1581 Institutional support: RVO:61388963 Keywords : DOSY * VT NMR * gel * diffusion coefficients Subject RIV: CF - Physical ; Theoretical Chemistry Impact factor: 1.226, year: 2015

  3. 2003 Reson 8101ER Multibeam Sonar Data from Cruise OES-03-07/AHI-03-07, Data Set Name Saipan.

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — Reson 8101ER multibeam Data were collected between 21 August and 13 September 2003 (JD 233-256) aboard NOAA Survey Launch Acoustic Habitat Investigator (AHI) at...

  4. Particle Flow Modelling in Slurry-Fed Stirred Vessels

    Czech Academy of Sciences Publication Activity Database

    Scargiali, F.; Grisafi, F.; Čermáková, Jiřina; Machoň, V.; Brucato, A.

    2004-01-01

    Roč. 27, č. 3 (2004), s. 249-256 ISSN 0930-7516 Institutional research plan: CEZ:AV0Z4072921 Keywords : solids * dispersion Subject RIV: CF - Physical ; Theoretical Chemistry Impact factor: 0.791, year: 2004

  5. Review of Amanda E. Herbert, Female Alliances: Gender, Identity, and Friendship in Early Modern Britain

    Directory of Open Access Journals (Sweden)

    Angela Rehbein

    2015-03-01

    Full Text Available Review of Amanda E. Herbert, Female Alliances: Gender, Identity, and Friendship in Early Modern Britain. New Haven: Yale UP, 2014. xi, 256 pages: illustrations; 24 cm. ISBN 978-0-300-17740-4.

  6. Optimization of RAPD-PCR reaction system for genetic relationships ...

    African Journals Online (AJOL)

    STORAGESEVER

    2010-02-08

    Feb 8, 2010 ... Camellia features beautiful tree shape, various petal color, .... (Huzhuabai (C. japonica)) was randomly selected for optimization of .... Afr. J. Biotechnol. Figure 1. Agarose gel electrophoresis analysis by primer S256 (left-up), ...

  7. Commentary on the Discovery of the Beautiful Style Michigan Madonna

    Czech Academy of Sciences Publication Activity Database

    Hlobil, Ivo

    2016-01-01

    Roč. 64, 3/4 (2016), s. 256-260 ISSN 0049-5123 Institutional support: RVO:68378033 Keywords : gothic sculpture * Bohemian Beautiful Style * Madonna-torso * Museum Ann Arbor * Michigan ( USA ) Subject RIV: AL - Art, Architecture, Cultural Heritage

  8. Food for Thought: Cross-Classification and Category Organization in a Complex Real-World Domain.

    Science.gov (United States)

    Ross, Brian H.; Murphy, Gregory L.

    1999-01-01

    Seven studies involving 256 undergraduates examined how people represent, access, and make inferences about the real-world category domain, foods. Results give a detailed picture of the use of cross-classification in a complex domain. (SLD)

  9. Thermal Properties of Alkyl-Triethylammonium bis{(Trifluoromethyl)Sulfonyl}Imide Ionic Liquids

    Czech Academy of Sciences Publication Activity Database

    Machanová, Karolina; Wagner, Zdeněk; Andresová, Adéla; Rotrekl, Jan; Boisset, A.; Jacquemin, J.; Bendová, Magdalena

    2015-01-01

    Roč. 44, 3-4 (2015), s. 790-810 ISSN 0095-9782 Institutional support: RVO:67985858 Keywords : ionic liquids * differential scanning calorimetry * mathematical gnostics Subject RIV: CF - Physical ; Theoretical Chemistry Impact factor: 1.256, year: 2015

  10. Weight gain associated with atypical and typical antipsychotics during treatment of adolescent schizophrenic psychoses: A retrospective study

    Czech Academy of Sciences Publication Activity Database

    Hrdlička, M.; Zedková, I.; Blatný, Marek; Urbánek, Tomáš

    2009-01-01

    Roč. 30, č. 2 (2009), s. 256-261 ISSN 0172-780X Institutional research plan: CEZ:AV0Z70250504 Keywords : schizophrenia * antipsychotics * weight gain Subject RIV: AN - Psychology Impact factor: 1.047, year: 2009

  11. Interaction of laser radiation with a low-density structured absorber

    Czech Academy of Sciences Publication Activity Database

    Rozanov, V. B.; Barishpol’tsev, D.V.; Vergunova, G.A.; Demchenko, N. N.; Ivanov, E.M.; Aristova, E.N.; Zmitrenko, N.V.; Limpouch, I.; Ullschmied, Jiří

    2016-01-01

    Roč. 122, č. 2 (2016), s. 256-276 ISSN 1063-7761 Institutional support: RVO:61389021 Keywords : laser radiation interaction * laser with low-density Subject RIV: BH - Optics, Masers, Lasers Impact factor: 1.196, year: 2016

  12. Nigerian Journal of Physics - Vol 20, No 1 (2008)

    African Journals Online (AJOL)

    Unsteady free convection flow past a porous plate under thermal and mass ... the effects of phase noise in 256 quadrature amplitude modulation using scatter plot ... Modelling and analysis of radiative heat transfer mechanism of solar heater ...

  13. Therapeutic hypothermia reduces intestinal ischemia/reperfusion ...

    African Journals Online (AJOL)

    The detached intestinal epithelial cells in hypothermia group showed ... of apoptosis than those in normothermia group at 4 h (17.30 ± 2.56 vs. ... intestinal ischemia/reperfusion (IR) injury, which could be attenuated by therapeutic hypothermia.

  14. Clean Hands Count

    Medline Plus

    Full Text Available ... action today; no cure tomorrow - Duration: 3:10. World Health Organization 78,256 views 3:10 Wash ... handwash? With soap and water - Duration: 1:27. World Health Organization 230,361 views 1:27 Hand ...

  15. Hungarosoma bokori Verhoeff, 1928 (Diplopoda: Chordeumatida): new insights into its taxonomy, systematics, molecular genetics, biogeography and ecology

    Czech Academy of Sciences Publication Activity Database

    Mock, A.; Tajovský, Karel; Žurovcová, Martina; Jarošová, Andrea; Kocourek, P.; Gruber, J.; Angyal, D.; Spelda, J.

    2016-01-01

    Roč. 4178, č. 2 (2016), s. 234-256 ISSN 1175-5326 Institutional support: RVO:60077344 Keywords : Hungarosomatidae * redescription * gonopods * distribution * cytochrome oxidase 1 gene * DNA barcoding Subject RIV: EG - Zoology Impact factor: 0.972, year: 2016

  16. ORF Alignment: NC_005296 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_005296 gi|39933548 >1v7zA 10 254 14 256 2e-44 ... emb|CAE25915.1| putative creatin...e amidohydrolase [Rhodopseudomonas palustris ... CGA009] ref|NP_945824.1| putative creatine ...

  17. ORF Alignment: NC_006576 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_006576 gi|56750058 >1v7zA 4 251 11 256 7e-49 ... ref|YP_170759.1| creatinine amido...hydrolase [Synechococcus elongatus PCC 6301] ... dbj|BAD78239.1| creatinine amidohydrolase [Synechoco

  18. Clean Hands Count

    Medline Plus

    Full Text Available ... no cure tomorrow - Duration: 3:10. World Health Organization 78,256 views 3:10 Wash 'Em - Hand ... message from WHO - Duration: 10:07. World Health Organization 9,045 views 10:07 A very serious ...

  19. Mysids (Crustacea) from the salt pans of Mumbai, India, with a description of a new species

    Digital Repository Service at National Institute of Oceanography (India)

    Biju, A.; Panampunnayil, S.U.

    on Marine Science, University of Tokyo 256–273. Quintero C, de Roa EZ. 1973. Notas bioecologicas sobre Metamysidopsis insularis Brattegard (Crusatacea-Mysidacea) en una laguna litoral de Venezuela. Acta Biologica Venezuelica 8: 245-278. Ramamoorthy K...

  20. MODELKEY - Models for assessing and forecasting the impact of environmental key pollutants on freshwater and marine ecosystems and biodiversity

    Czech Academy of Sciences Publication Activity Database

    Brack, W.; Bakker, J.; de Deckere, E.; Deerenberg, C.; van Gils, J.; Hein, M.; Jurajda, Pavel; Kooijman, B.; Lamoree, M.; Lek, S.; de Alda, M. J. L.; Marcomini, A.; Munoz, I.; Rattei, S.; Segner, H.; Thomas, K.; von der Ohe, P. C.; Westrich, B.; de Zwart, D.; Schmitt-Jansen, M.

    2005-01-01

    Roč. 12, č. 5 (2005), s. 252-256 ISSN 0944-1344 Institutional research plan: CEZ:AV0Z60930519 Keywords : biodiversity * EU- Projects * fish communities Subject RIV: EH - Ecology, Behaviour Impact factor: 1.518, year: 2005

  1. Determination of amphetamine-type stimulants in oral fluid by solid-phase microextraction and gas chromatography-mass spectrometry

    International Nuclear Information System (INIS)

    Souza, Daniele Z.; Boehl, Paula O.; Comiran, Eloisa; Mariotti, Kristiane C.; Pechansky, Flavio; Duarte, Paulina C.A.V.; De Boni, Raquel; Froehlich, Pedro E.; Limberger, Renata P.

    2011-01-01

    Graphical abstract: Highlights: → Propylchloroformate derivatization of amphetamine-type stimulants in oral fluid. → Direct immersion solid-phase microextraction/gas chromatography-mass spectrometry. → Linear range 2(4)-256 ng mL -1 , detection limits 0.5-2 ng mL -1 . → Accuracy 98-112%, precision TM device has been developed and validated. Thereunto, in-matrix propylchloroformate derivatization followed by direct immersion solid-phase microextraction and gas chromatography-mass spectrometry were employed. Deuterium labeled AMP was used as internal standard for all the stimulants and analysis was performed using the selected ion monitoring mode. The detector response was linear for the studied drugs in the concentration range of 2-256 ng mL -1 (neat oral fluid), except for FEN, whereas the linear range was 4-256 ng mL -1 . The detection limits were 0.5 ng mL -1 (MET), 1 ng mL -1 (MPH) and 2 ng mL -1 (DIE, AMP, FEN), respectively. Accuracy of quality control samples remained within 98.2-111.9% of the target concentrations, while precision has not exceeded 15% of the relative standard deviation. Recoveries with Quantisal TM device ranged from 77.2% to 112.1%. Also, the goodness-of-fit concerning the ordinary least squares model in the statistical inference of data has been tested through residual plotting and ANOVA. The validated method can be easily automated and then used for screening and confirmation of amphetamine-type stimulants in drivers' oral fluid.

  2. Association of Xerostomia and Ultrasonographic Features of the Major Salivary Glands After Radioactive Iodine Ablation for Papillary Thyroid Carcinoma.

    Science.gov (United States)

    Soo Roh, Sang; Wook Kim, Dong; Jin Baek, Hye

    2016-11-01

    The objective of this study is to evaluate the association between xerostomia and sonographic features of the major salivary glands after patients undergo radioactive iodine ablation (RIA) for papillary thyroid carcinoma (PTC). The study included 256 consecutive patients who underwent total thyroidectomy, RIA, and neck ultrasound examinations. Changes in the ultrasound features of the parotid and submandibular glands after RIA were evaluated retrospectively by a single radiologist, on the basis of direct comparison of sonograms obtained before and after RIA. Clinical data, including the presence of xerostomia, were investigated retrospectively by the same radiologist via a review of the electronic medical records. For 111 of the 256 patients (43.4%), ultrasound examination revealed changes in the major salivary glands after RIA. The presence of xerostomia was undetermined in 85 of the 256 patients. Among the remaining 171 patients, the frequency of xerostomia was 36.8% (63/171). When patients with xerostomia were compared with those without xerostomia, no statistically significant differences in patient sex and age, the dose of RIA received, or the number of RIA sessions were noted (p > 0.05). Considering the changes in the ultrasound features of the major salivary glands after RIA, no statistically significant association was found between xerostomia and the number of involved major salivary glands or the presence of an involved submandibular gland (p > 0.05). In this study, ultrasound was unhelpful for evaluating xerostomia after RIA in patients with PTC.

  3. Performance of an LPD prototype detector at MHz frame rates under Synchrotron and FEL radiation

    Science.gov (United States)

    Koch, A.; Hart, M.; Nicholls, T.; Angelsen, C.; Coughlan, J.; French, M.; Hauf, S.; Kuster, M.; Sztuk-Dambietz, J.; Turcato, M.; Carini, G. A.; Chollet, M.; Herrmann, S. C.; Lemke, H. T.; Nelson, S.; Song, S.; Weaver, M.; Zhu, D.; Meents, A.; Fischer, P.

    2013-11-01

    A MHz frame rate X-ray area detector (LPD — Large Pixel Detector) is under development by the Rutherford Appleton Laboratory for the European XFEL. The detector will have 1 million pixels and allows analogue storage of 512 images taken at 4.5 MHz in the detector front end. The LPD detector has 500 μm thick silicon sensor tiles that are bump bonded to a readout ASIC. The ASIC's preamplifier provides relatively low noise at high speed which results in a high dynamic range of 105 photons over an energy range of 5-20 keV. Small scale prototypes of 32 × 256 pixels (LPD 2-Tile detector) and 256 × 256 pixels (LPD supermodule detector) are now available for X-ray tests. The performance of prototypes of the detector is reported for first tests under synchrotron radiation (PETRA III at DESY) and Free-Electron-Laser radiation (LCLS at SLAC). The initial performance of the detector in terms of signal range and noise, radiation hardness and spatial and temporal response are reported. The main result is that the 4.5 MHz sampling detection chain is reliably working, including the analogue on-chip memory concept. The detector is at least radiation hard up to 5 MGy at 12 keV. In addition the multiple gain concept has been demonstrated over a dynamic range to 104 at 12 keV with a readout noise equivalent to < 1 photon rms in its most sensitive mode.

  4. standalone general purpose data logger design and implementation

    African Journals Online (AJOL)

    eobe

    volatile EEPROM data memory, four AT24C256 2-wire serial EEPROM chips were used for data storage. wire serial ... analog electrical signal that relays information about .... in-code, ADC, Serial Communication and short term memory ...

  5. ORF Alignment: NC_000853 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_000853 gi|15643179 >1v7zA 3 256 7 270 9e-43 ... ref|NP_228223.1| creatinine amidoh...ydrolase, putative [Thermotoga maritima MSB8] ... gb|AAD35498.1| creatinine amidohydrolase, putative

  6. UV Light Induced Surface Modification of HDPE Films with Bioactive Compounds

    Czech Academy of Sciences Publication Activity Database

    Daniloska, V.; Blazevska-Gilev, J.; Dimova, V.; Fajgar, Radek; Tomovska, R.

    2010-01-01

    Roč. 256, č. 7 (2010), s. 2276-2283 ISSN 0169-4332 Institutional research plan: CEZ:AV0Z40720504 Keywords : surface modification * uv irradiation * benzocaine Subject RIV: CH - Nuclear ; Quantum Chemistry Impact factor: 1.795, year: 2010

  7. Two-dimensional convolution subject to data-spreading algorithm. Report for August 1985-July 1986

    Energy Technology Data Exchange (ETDEWEB)

    Chen, Y C; Wang, H C

    1986-01-01

    An algorithm for two-dimensional convolution is proposed to be highly efficient and suitable for parallel processing, and a hardware of pipeline architecture is implemented to realize the algorithm. The implemented hardware is built on an IBM personal computer and acts as an auxiliary processor of the personal computer. This makes the dream come true that high speed, low-cost image processing is feasible on personal computers. The hardware executes two operations of two-dimensional convolution concurrently on an 256 x 256 image frame in less than 500 miniseconds. Several functions are available to users, and parameters such as weighting coefficients and threshold value are programmable. Various processing results of the image frame can be obtained by changing these parameters. Besides, horizontal and vertical edge detection can also be executed concurrently, with results available at the same time.

  8. Loring AFB, Maine. Revised Uniform Summary of Surface Weather Observations (RUSSWO). Parts A-F.

    Science.gov (United States)

    1983-08-12

    8217rHE ( S.9V1CE/-At "- 7-c L-) T’ AFR ME 73-62 J A’, PERCENTAGE FREQUENCY OF OCCURRENCE 1 , ?-17’ FROM HOURLY OBSERVATIONS) iso S. <A’- ’fVE 1. , 39.1...142976_ 33977 3A.9 5.5 90 S O 22.1 02? 9 ? W.8.b 0P56 3~3~33~7.786 898 41013 go *~O..669019 22619 ZS.21tV.521 69 .51 68.3 : ,-Ni V4 7 L AL CL IMA TOLCu...8217 I f4 64 4/ e .’ .1 .2 1 .3 .2 .21 C 93 93’ S. 4 1 .11 .2 . , .4 . .1 ISO 1513 -f 79 1 .’ .7 .6’ :6 *5 . 7’ *1 I 256 256 ’ 7, / 77 .0 .2 .Q .91 .8 .e

  9. Research Article Special Issue

    African Journals Online (AJOL)

    pc

    2018-02-24

    Feb 24, 2018 ... It is the most vigorous business arrangement and has .... International restaurants identify as franchised restaurants that are of foreign origin. ... satisfaction and service quality is from restaurant H managing a mean of 2.56 as ...

  10. Direct astatination of a tumour-binding protein, human epidermal growth factor, using nido-carborane as a prosthetic group

    Czech Academy of Sciences Publication Activity Database

    Sjostrom, A.; Tolmachev, V.; Lebeda, Ondřej; Koziorowski, J.; Carlsson, J.; Lundqvist, H.

    2003-01-01

    Roč. 256, č. 7 (2003), s. 191-197 ISSN 0236-5731 R&D Projects: GA AV ČR KSK4055109 Keywords : neutron-capture therapy * astatine-211 Subject RIV: CH - Nuclear ; Quantum Chemistry Impact factor: 0.472, year: 2003

  11. Zum keltischen Erbe in der älteren Römischen Kaiserzeit in Böhmen und Mitteleuropa

    Czech Academy of Sciences Publication Activity Database

    Salač, Vladimír

    2011-01-01

    Roč. 63, č. 2 (2011), s. 256-283 ISSN 0323-1267 Institutional research plan: CEZ:AV0Z80020508 Keywords : Late La Tène period * Celts * Germans * culture heritage * Bohemia * Central Europe Subject RIV: AC - Archeology, Anthropology, Ethnology

  12. frequency of ipsilateral femoral neck fractures in patients

    African Journals Online (AJOL)

    Background: Ipsilateral associated femoral neck and shaft fractures are reported to occur in 2.5-6% of all femoral shaft ... nailing of the shaft fracture, which makes treatment of the neck ... chest, spine), while the other had maxillofacial injuries.

  13. Pan-African phylogeny of Mus (subgenus Nannomys) reveals one of the most successful mammal radiations in Africa

    Czech Academy of Sciences Publication Activity Database

    Bryja, J.; Mikula, Ondřej; Šumbera, R.; Meheretu, Y.; Aghová, T.; Lavrenchenko, L. A.; Mazoch, V.; Oguge, N.; Mbau, J. S.; Welegerima, K.; Amundala, N.; Colyn, M.; Leirs, H.; Verheyen, E.

    2014-01-01

    Roč. 14, č. 256 (2014) ISSN 1471-2148 R&D Projects: GA ČR GAP506/10/0983 Institutional support: RVO:67985904 Keywords : biogeography * tropical Africa * molecular phylogeny Subject RIV: EG - Zoology Impact factor: 3.368, year: 2014

  14. Articles about MedlinePlus

    Science.gov (United States)

    ... MedlinePlus → Articles about MedlinePlus URL of this page: https://medlineplus.gov/bibliography.html Articles about MedlinePlus To ... Dec 29]; 3(5):256-60. Available from: http://ecp.acponline.org/sepoct00/nlm.htm . Marill JL, ...

  15. A migration-driven model for the historical spread of leprosy in medieval Eastern and Central Europe

    Czech Academy of Sciences Publication Activity Database

    Donoghue, H. D.; Taylor, G. M.; Marcsik, A.; Molnár, E.; Pálfi, G.; Pap, I.; Teschler-Nicola, M.; Pinhasi, R.; Erdal, Y. S.; Velemínský, P.; Likovský, Jakub; Belcastro, M. G.; Mariotti, V.; Riga, A.; Rubini, M.; Zaio, P.; Besra, G. S.; Lee, O. Y.-C.; Wu, H. H.T.; Minnikin, D. E.; Bull, I. D.; O'Grady, J.; Spigelman, M.

    2015-01-01

    Roč. 31, April (2015), s. 250-256 ISSN 1567-1348 Institutional support: RVO:67985912 Keywords : ancient DNA * genotyping * human migrations * lipid biomarkers * Mycobacterium leprae * Mycobacterium tuberculosis Subject RIV: AC - Archeology, Anthropology, Ethnology Impact factor: 2.591, year: 2015

  16. Design rules for carbazole derivatized n-alkyl methacrylate polymeric memristors

    Czech Academy of Sciences Publication Activity Database

    McFarlane, T. M.; Zdyrko, B.; Bandera, Y.; Worley, D.; Klep, O.; Jurča, M.; Tonkin, C.; Foulger, S. H.; Vilčáková, J.; Sáha, P.; Pfleger, Jiří

    2018-01-01

    Roč. 6, č. 10 (2018), s. 2533-2545 ISSN 2050-7526 Institutional support: RVO:61389013 Keywords : n-alkyl methacrylate polymers * charge transport * composites Subject RIV: CD - Macromolecular Chemistry OBOR OECD: Polymer science Impact factor: 5.256, year: 2016

  17. Towards Primary School Physics Teaching and Learning: Design Research Approach. Research Report 256

    Science.gov (United States)

    Juuti, Kalle

    2005-01-01

    This thesis describes a project to design a primary school physics learning environment which takes into account teachers' needs, design procedures, properties of the learning environment, and pupil learning outcomes. The project's design team has wide experience in research and development work in relation to science education, the use of ICT in…

  18. Experimental demonstration of nonbinary LDPC convolutional codes for DP-64QAM/256QAM

    NARCIS (Netherlands)

    Koike-Akino, T.; Sugihara, K.; Millar, D.S.; Pajovic, M.; Matsumoto, W.; Alvarado, A.; Maher, R.; Lavery, D.; Paskov, M.; Kojima, K.; Parsons, K.; Thomsen, B.C.; Savory, S.J.; Bayvel, P.

    2016-01-01

    We show the great potential of nonbinary LDPC convolutional codes (NB-LDPC-CC) with low-latency windowed decoding. It is experimentally demonstrated that NB-LDPC-CC can offer a performance improvement of up to 5 dB compared with binary coding.

  19. 25 CFR 256.13 - How do I apply for the Housing Improvement Program?

    Science.gov (United States)

    2010-04-01

    ... of your annual trust income statement from your Individual Indian Money (IIM) account, for royalty... membership card. (e) Fifth, you must provide proof of income from all permanent members of your household. (1..., including W-2's and all other attachments. (2) You must provide proof of all other income from all permanent...

  20. 30 CFR 256.57 - Using a third-party guarantee instead of a bond.

    Science.gov (United States)

    2010-07-01

    ... are beyond your guarantor's control and that do not affect your guarantor's likelihood of remaining in... either Moody's Investor Service or Standard and Poor's Corporation; (ii) Your guarantor's net worth...

  1. A 256 channel 8-Bit current digitizer ASIC for the Belle-II PXD

    Science.gov (United States)

    Knopf, J.; Fischer, P.; Kreidl, C.; Peric, I.

    2011-01-01

    The international DEPFET collaboration is developing a silicon pixel vertex detector (PXD), based on monolithic arrays of DEPFET transistors, for the future physics experiment Belle-II at the SuperKEKB particle accelerator in Japan. The matrix elements are read out in a 'rolling shutter mode', i.e. rows are selected consecutively and all columns are read out in each cycle of bond pads is used, allowing for flipping the chip onto the final all-silicon DEPFET sensor module. Several tests have been performed in order to prove the chip's operation and its quality in terms of noise. The results are presented.

  2. Book review Information and Communication Technologies for ...

    African Journals Online (AJOL)

    Book review. Information and Communication Technologies for Development in Africa: Volume 2. The Experience with Community Telecentres By Florence Etta and Sheila Parvyn-Wamahiu (2003). Kibet A Ngetich. Abstract. No Abstract Available Africa Development Vol. XXX (1&2) 2005: 254-256.

  3. 75 FR 35024 - North Carolina Waters Along the Entire Length of Brunswick and Pender Counties and the Saline...

    Science.gov (United States)

    2010-06-21

    ... Marina, 910-458-0575, Flexible-open year round, 4' draft at mean low tide (6) Waterfront Village & Yacht...:30 p.m. Monday-Friday, 13'-18' draft at mean low tide (13) Seapath Yacht Club, 910-256-3747, 7 a.m.-7...

  4. Nové poznatky ke stavebnímu vývoji kostela sv. Jana Křtitele v Kurdějově

    Czech Academy of Sciences Publication Activity Database

    Bláha, Jiří; Dohnalová, P.

    2013-01-01

    Roč. 20, č. 1 (2013), s. 237-256 ISSN 1212-1487 R&D Projects: GA MK(CZ) DF11P01OVV002 Keywords : fortified church * timber roof * dendrochronology Subject RIV: AL - Art, Architecture, Cultural Heritage www.pruzkumypamatek.cz

  5. 76 FR 65061 - Manual for Courts-Martial; Proposed Evidence Amendments

    Science.gov (United States)

    2011-10-19

    ... the evidence, with the false information set aside, that the remaining information presented to the..., including any personal identifiers or contact information. FOR FURTHER INFORMATION CONTACT: Lieutenant...-2200, (571) 256-8136, e-mail [email protected] . SUPPLEMENTARY INFORMATION: The proposed...

  6. Fernando Bouza Álvarez, «Dásele licencia y privilegio». Don Quijote y la aprobación de libros en el Siglo de Oro

    Directory of Open Access Journals (Sweden)

    Gonzalo Pontón

    2013-05-01

    Full Text Available Review of Fernando Bouza Álvarez, «Dásele licencia y privilegio». Don Quijote y la aprobación de libros en el Siglo de Oro, Akal, Madrid, 2012, 256 pp. ISBN: 978-84-460-3228-1.

  7. The effectiveness of narrative versus informational smoking education on beliefs, attitudes, and intentions of low educated adolescents

    NARCIS (Netherlands)

    de Graaf, A.; van den Putte, B.; Nguyen, M.-H.; Zebregs, S.; Lammers, J.; Neijens, P.

    2017-01-01

    Objective: This study tests the effectiveness of narrative versus informational smoking education on smoking beliefs, attitudes and intentions of low-educated adolescents. Design: A field experiment with three waves of data collection was conducted. Participants (N = 256) were students who attend

  8. Zoonotic mosquito-borne flaviviruses: worldwide presence of agents with proven pathogenicity and potential candidates of future emerging diseases

    Czech Academy of Sciences Publication Activity Database

    Weissenböck, H.; Hubálek, Zdeněk; Bakonyi, T.; Nowotny, N.

    2010-01-01

    Roč. 140, 3-4 (2010), s. 271-280 ISSN 0378-1135 Institutional research plan: CEZ:AV0Z60930519 Keywords : Flaviviridae * mosquitoes * Culicidae * zoonoses * arboviruses Subject RIV: FN - Epidemiology, Contagious Diseases ; Clinical Immunology Impact factor: 3.256, year: 2010

  9. Mõõtmise probleem 18. sajandi psühholoogias / Konstantin Ramul ; tõlk. Kenn Konstabel

    Index Scriptorium Estoniae

    Ramul, Konstantin, 1879-1975

    2004-01-01

    Mentaalsete mõõtmiste tähtsusest 18. sajandil teadusliku psühholoogia arengule 19. sajandil. 18. sajandi erinevate autorite arvamustest psühholoogiliste mõõtmiste võimalustest ja meetoditest. Varem ilmunud: American Psychologist, 1960, nr. 15, lk. 256-265

  10. A new species of Bothriocephalus Rudolphi, 1808 (Eucestoda: Bothriocephalidea) from the channel bull blenny Cottoperca gobio (Günther) (Perciformes: Bovichtidae) on the Patagonian shelf off Argentina

    Czech Academy of Sciences Publication Activity Database

    Gil de Pertierra, A.A.; Arredondo, N.J.; Kuchta, Roman; Incorvaia, I.S.

    2015-01-01

    Roč. 90, č. 3 (2015), s. 247-256 ISSN 0165-5752 R&D Projects: GA ČR GBP505/12/G112 Institutional support: RVO:60077344 Keywords : Cestoda * fishes * parasites Subject RIV: EG - Zoology Impact factor: 1.316, year: 2015

  11. Marie Underi luule : mõnest tõlkeprobleemist / Ilse Lehiste ; inglise k. tlk. Ene-Reet Soovik

    Index Scriptorium Estoniae

    Lehiste, Ilse, 1922-2010

    2000-01-01

    Orig.: Marie Under's poetry: some problems of translation. Varem ilmunud: Lituanus, 1983, nr. 3. Kaasautor: Rimvydas Shilbajoris. M. Underi luuletuse "Täiskuu" tekst eesti k., tõlge inglise keelde (tlk. I. Lehiste) ja reaalune tõlge inglise keelde, lk. 256-260

  12. 1 Evaluation of the antioxidant activity of citrus flavedo extracts in ...

    African Journals Online (AJOL)

    2015-07-10

    Jul 10, 2015 ... mayonnaise prepared from unstripped soybean oil and in bulk unstripped soybean oil. .... soybean oil to obtain 0.02% (m/m) BHT or 0.2% (m/m) citrus flavedo extract in ..... Journal of Chromatography A 705, 247-256.

  13. Revised Figures

    Indian Academy of Sciences (India)

    22

    Sample. Porous Area (%). Average pore size. (µm). TGR 0. 18.117. 0.256 ... 2Department of Applied Science, The NorthCap University, Gurgoan 122017, India ..... As the study of PL spectra helps to unveil the performance of charge carrier ...

  14. Genetic study of Dravidian castes of Tamil Nadu

    Indian Academy of Sciences (India)

    of 256 base pairs (bp) of a 285-bp Alu element at the CD4 locus (Edwards and ..... out procedure for extracting DNA from human nucleated cells. Nucleic Acids ... Ota T. 1993 DISPAN: Genetic distance and phylogenetic analysis. Pennsylvania ...

  15. Micro-analytical studies on sugar cane bagasse ash

    Indian Academy of Sciences (India)

    In the present work, SCBA is subjected to ... Thermo Scientifics, USA). The spectral resolution was 4 cm−1 and 256 scans were coded into the mid ..... The week band shows the presence of water molecules bonds. • Incomplete calcination of ...

  16. Animal Certifié Conforme: Déchiffrer nos Relations avec le Vivant

    Directory of Open Access Journals (Sweden)

    Daniel W. Gade

    2014-01-01

    Full Text Available Review of Animal Certifié Conforme: Déchiffrer nos Relations avec le Vivant. Bernadette Lizet and Jacqueline Milliet, eds. 2012. Dunod/Muséum National d’Histoire Naturelle, Paris. Pp 256. €22 (paperback. ISBN 9782100582853.

  17. Ethnic Conflicts and Minority Interests in Nigeria | Badru | Journal of ...

    African Journals Online (AJOL)

    The Journal of Cultural Studies: 2000 2(1): 256-265). Full Text: EMAIL FULL TEXT EMAIL FULL TEXT · DOWNLOAD FULL TEXT DOWNLOAD FULL TEXT · AJOL African Journals Online. HOW TO USE AJOL... for Researchers · for Librarians ...

  18. A randomized controlled trial of the effectiveness of multisystemic therapy in the Netherlands: post-treatment changes and moderator effects

    NARCIS (Netherlands)

    Asscher, J.J.; Dekovic, M.; Manders, W.A.; Prins, P.J.M.; van der Laan, P.H.

    2013-01-01

    Objective: In the present randomized controlled trial, the effectiveness of multisystemic therapy (MST) in The Netherlands was examined. Moderator tests were conducted for ethnicity, age and gender. Methods: The sample consisted of N = 256 adolescents, referred because of conduct problems, and

  19. Decay studies of neutron-deficient lawrencium isotopes

    International Nuclear Information System (INIS)

    Antalic, S.; Saro, S.; Streicher, B.; Venhart, M.; Hessberger, F.P.; Ackermann, D.; Heinz, S.; Kindler, B.; Kojouharov, I.; Lommel, B.; Mann, R.; Hofmann, S.; Kuusiniemi, P.; Leino, M.; Nishio, K.; Sulignano, B.

    2008-01-01

    The radioactive decay of the isotopes 254-256 Lr and their daughter products was investigated by means of α, prompt α-γ and delayed conversion electron-γ coincidence spectroscopy. The isotopes were produced using the reaction 48 Ca+ 209 Bi. (orig.)

  20. Synthesis and luminescence properties of TiO2:Yb-Er mesoporous ...

    Indian Academy of Sciences (India)

    36

    surface areas and volume, making them suitable for applications such as catalysis, separation of ... devices, encapsulation of proteins and diagnosis and treatment of cancer [2,5,6]. .... After this, water (5 ml or 60 ml) is added to the solution.