Activities on PIRA Researches and its Applications in Korea
International Nuclear Information System (INIS)
Yoo, Kunjoong; Chae, Sungki; Choi, Youngsang; Roh, Myungsub
1986-01-01
Since 1979, activities on the developments of PIRA methodologies and procedures, and its application as well as the safety goal establishment have increased because of the important benefits which may be derived from the uses of PIRA. PIRA is used in many areas including safety evaluation, preparation of basis of standards, siting of nuclear facilities, operator training, energy technology comparison, design, safety improvement(backfitting), operating procedure changes, test and maintenance procedure development, safety goal establishment, and plant availability improvement. Especially, vendor countries are utilizing PIRA methods for parts of the safety demonstration for proposed power plants. In this connection, Korea began to take a interest in PIRA in 1979. Since then, basic methodologies and computer codes of PIRA have been introduced, modified, and applied to Korea nuclear power plants
Eco-friendly synthesis of Graphene using the aqueous extract of Amaranthus dubius
Directory of Open Access Journals (Sweden)
M. Jannathul Firdhouse
2013-06-01
Full Text Available An eco-friendly process of reduction of graphene oxide using aqueous extract of Amaranthus dubius under refluxing method is herein reported. The colour change of the graphene oxide (GO solution from brown to black was noted during the reduction of graphene oxide. UV-Visible spectrophotometer was used to monitor the formation of reduced graphene oxide (AKRGO. The crystallite size of nanographene was confirmed by XRD analysis and Scherrer’s formula. FTIR spectral analysis revealed the reduction of graphene oxide using aqueous extract of Amaranthus dubius. The morphology of the synthesized graphene was examined by SEM analysis.
Directory of Open Access Journals (Sweden)
Edgar Molina
2015-03-01
Full Text Available The effects on performance and digestibility in growing rabbits were studied by comparing 3 diets containing increasing inclusion rates of amaranth (Amaranthus dubius Mart. ex Thell.: 0 (A0, 160 (A16 and 320 g/kg (A32 diet. Diets were formulated isoproteic and isocaloric to meet the nutrient requirements of growing rabbits. One hundred and thirteen weaned New Zealand White rabbits (mean±standard deviation weight: 760±102 g, individually caged, were randomly assigned to one of the 3 experimental diets. Rabbits were fed ad libitum from 35 to 87 d of age, and health status and performance traits were onitored. The coefficients of total tract apparent digestibility of the diets were measured between 42 and 46 d of age in 12 rabbits per treatment. Amaranthus dubius contained 209 g/kg dry matter (DM of crude protein and 398 g/kg DM of neutral detergent fibre. There were no significant differences between treatments in weight gain (mean 21.6 g/d and live weight at the end of the fattening period (mean 1883 g. Daily feed intake was higher (P<0.05 in A0 than in A16 and A32 diets (85.4 vs. 73.7 and 69.9 g/d, respectively, and feed conversion rate improved with increased inclusion of A. dubius in the diet (from 3.84 to 3.28 for A0 and A32 diets, respectively; P<0.05. Health status was not affected by the amaranth inclusion rate. Total tract apparent digestibility showed high values, with no differences among diets except for ether extract. Thus, A. dubius could be considered as an alternative source of protein and fibre for rabbit feeding in tropical and subtropical regions.
Agronomic Biofortification of Amaranthus dubius with Macro Nutrients and Vitamin A
Mala, R.; Celsia, A. S. Ruby; Mahalakshmi, R.; Rajeswari, S.
2017-08-01
Agronomic biofortification of Amaranthus dubius with carbohydrates, proteins and Vitamin A using Spirulina platensis is reported in the present preliminary study. S. platensis was applied basally to field and its influence on germination, concentration of proteins, carbohydrates, chlorophyll, carotenoids and antioxidant activity of leaves were assessed in CO1 variety of A. dubius. Biofortification of the nutrients were evaluated on 5th and 20th day. Germination was optimum at 0.005 % of S. platensis as a fertilizer and the agronomic fortifying agent. Germination in control was 82 % and 95 % in 0.005 % of S. platensis fortification. The concentration of total chlorophyll in control and biofortified leaf on 20th day were 85.6 mg/g and 325 mg/g of dried leaf. The concentration of proteins was 71.93 mg/g and 450 mg/g on 20th day in control and fortified leaves. S. platensis applied field produced leaves fortified with 1.27 % of vitamin A aldehyde. Antioxidant activity of control leaf was 34.85 % and it was significantly increased in fortified leaves to 87 %. Thus the study confirms the fortification of leaf with proteins, carbohydrates and vitamin A.
Aukema, Brian H; Raffa, Kenneth F
2002-12-01
We used a laboratory assay to partition the effects of predation and intraspecific competition on the establishment, mating success, and brood development of an endophytic herbivore. We selected a system in which the same predator feeds both exophytically and endophytically on the same prey, to evaluate the role of herbivore feeding guild on predator numerical and functional responses. The bark beetle, Ips pini (Coleoptera: Scolytidae) reproduces within the stems of conifers. Males establish mating chambers under the bark, produce aggregation pheromones, and are subsequently joined by females that construct ovipositional galleries. Thanasimus dubius (Coleoptera: Cleridae) adults prey on adults alighting on the bark surface. T. dubius females then oviposit at the bark beetles' entrance sites, and their larvae prey on developing bark beetle larvae within the tree. We imposed a controlled 3×3 factorial design of prey and predator adult densities on red pine logs. Both predation and competition decreased I. pini reproduction. However, the per capita effect of predation was greater than competition, with one adult T. dubius reducing herbivore reproduction by an equivalent amount as four to five competing males and their harems. Increased densities of adult T. dubius on the plant surface reduced the number of prey captured per predator. Total predation on adults and larvae was similar. However, adult T. dubius on the plant surface ate approximately 18-35 times more I. pini per day than did their endophytic larvae. Within the plant, cannibalism among T. dubius, low herbivore densities, limited feeding times, and presumably the complex gallery architecture of I. pini reduced the number of predator progeny. The progeny of I. pini showed even sex ratios in the absence of predators, but were female biased when predators were present. We quantified a relatively narrow set of predator and prey densities that can generate replacement rates greater than one for this predator
Moynié, Lucile; Luscher, Alexandre; Rolo, Dora; Pletzer, Daniel; Tortajada, Antoni; Weingart, Helge; Braun, Yvonne; Page, Malcolm G P; Naismith, James H; Köhler, Thilo
2017-04-01
The outer membrane of Gram-negative bacteria presents an efficient barrier to the permeation of antimicrobial molecules. One strategy pursued to circumvent this obstacle is to hijack transport systems for essential nutrients, such as iron. BAL30072 and MC-1 are two monobactams conjugated to a dihydroxypyridone siderophore that are active against Pseudomonas aeruginosa and Acinetobacter baumannii Here, we investigated the mechanism of action of these molecules in A. baumannii We identified two novel TonB-dependent receptors, termed Ab -PiuA and Ab -PirA, that are required for the antimicrobial activity of both agents. Deletion of either piuA or pirA in A. baumannii resulted in 4- to 8-fold-decreased susceptibility, while their overexpression in the heterologous host P. aeruginosa increased susceptibility to the two siderophore-drug conjugates by 4- to 32-fold. The crystal structures of PiuA and PirA from A. baumannii and their orthologues from P. aeruginosa were determined. The structures revealed similar architectures; however, structural differences between PirA and PiuA point to potential differences between their cognate siderophore ligands. Spontaneous mutants, selected upon exposure to BAL30072, harbored frameshift mutations in either the ExbD3 or the TonB3 protein of A. baumannii , forming the cytoplasmic-membrane complex providing the energy for the siderophore translocation process. The results of this study provide insight for the rational design of novel siderophore-drug conjugates against problematic Gram-negative pathogens. Copyright © 2017 American Society for Microbiology.
YI YI YONG
2018-01-01
This thesis examines the ability of betacyanin, a natural red-violet pigment from red pitahaya (Hylocereus polyrhizus) and red spinach (Amaranthus dubius)in inhibiting the growth of bacteria that cause diseases and bacteria attached to surfaces such as glass, polystyrene, polyvinyl chloride, polyethylene, polypropylene, and silicone rubber. Extraction was optimized to produce a betacyanin fraction and various assays were carried out to identify the best betacyanin formulation against a polymi...
Directory of Open Access Journals (Sweden)
Rosemeri Morokawa
2011-12-01
Full Text Available The results of a Bromeliaceae Juss. floristic survey in the Piraí Mountain, Araraquara complex(Guaratuba Municipality, Paraná State are presented. Twenty six species included in nine genera and three subfamilies were registered. Bromelioideae presented the highest genera diversity and Tillandsioideae showed the highest species diversity, including twelve species belonging to the genus Vriesea (46%. It was the first register of Nidularium procerum Lindm., Tillandsia stricta Sol. ex Ker Gawl., Vriesea altodaserrae L. B. Sm., Vriesea erythrodactylon (E. Morren E. Morren ex Mez, Vrieseaflava And.Costa, H. Luther & Wand., Vriesea friburgensis Mez, Vriesea hoehneana L. B. Sm., Vriesea inflata (Wawra Wawra e Wittrockia superba Lindm. at the Guaratuba Municipality. Dyckia leptostachya Baker was collected for the first time at the coastal zone of Paraná State, being this record done after 40 years since its last register in the State. For each species, information on phenology, geographic distribution and vulnerability level are included. Apresentam-se resultados de levantamento florístico das espécies de Bromeliaceae Juss. no Pico Piraí, Complexo do Araraquara (Guaratuba, Paraná. Verificou-se a ocorrência de 26 espécies pertencentes a nove gêneros e três subfamílias. Bromelioideae englobou a maior diversidade de gêneros e Tillandsioideae registrou-se a maior diversidade de espécies, sendo 12 delas incluídas no gênero Vriesea (46%. As seguintes espécies foram registradas pela primeira vez no município de Guaratuba: Nidularium procerum Lindm., Tillandsia stricta Sol. ex Ker Gawl., Vriesea altodaserrae L. B. Sm., Vriesea erythrodactylon (E. Morren E. Morren ex Mez, Vriesea flava And. Costa, H. Luther & Wand.,Vriesea friburgensis Mez, Vriesea hoehneana L. B. Sm., Vriesea inflata (Wawra Wawra e Wittrockia superba Lindm.. Dyckia leptostachya Baker foi registrada pela primeira vez na zona litorânea paranaense e após 40 anos do último
Directory of Open Access Journals (Sweden)
Michio Namikoshi
2012-02-01
Full Text Available Two new tryptamine-derived alkaloids, named as leptoclinidamide (1 and (--leptoclinidamine B (2, were isolated from an Indonesian ascidian Leptoclinides dubius together with C2-α-D-mannosylpyranosyl-L-tryptophan (3. The structure of 1 was assigned on the basis of spectroscopic data for 1 and its N-acetyl derivative (4. Compound 1 was an amide of tryptamine with two β-alanine units. Although the planar structure of 2 is identical to that of the known compound (+-leptoclinidamine B (5, compound 2 was determined to be the enantiomer of 5 based on amino acid analysis using HPLC methods. Compounds 1 to 4 were evaluated for cytotoxicity against two human cancer cell lines, HCT-15 (colon and Jurkat (T-cell lymphoma cells, but none of the compounds showed activity.
Ghysels, Bart; Ochsner, Urs; Möllman, Ute; Heinisch, Lothar; Vasil, Michael; Cornelis, Pierre; Matthijs, Sandra
2005-05-15
Actively secreted iron chelating agents termed siderophores play an important role in the virulence and rhizosphere competence of fluorescent pseudomonads, including Pseudomonas aeruginosa which secretes a high affinity siderophore, pyoverdine, and the low affinity siderophore, pyochelin. Uptake of the iron-siderophore complexes is an active process that requires specific outer membrane located receptors, which are dependent of the inner membrane-associated protein TonB and two other inner membrane proteins, ExbB and ExbC. P. aeruginosa is also capable of using a remarkable variety of heterologous siderophores as sources of iron, apparently by expressing their cognate receptors. Illustrative of this feature are the 32 (of which 28 putative) siderophore receptor genes observed in the P. aeruginosa PAO1 genome. However, except for a few (pyoverdine, pyochelin, enterobactin), the vast majority of P. aeruginosa siderophore receptor genes still remain to be characterized. Ten synthetic iron chelators of catecholate type stimulated growth of a pyoverdine/pyochelin deficient P. aeruginosa PAO1 mutant under condition of severe iron limitation. Null mutants of the 32 putative TonB-dependent siderophore receptor encoding genes engineered in the same genetic background were screened for obvious deficiencies in uptake of the synthetic siderophores, but none showed decreased growth stimulation in the presence of the different siderophores. However, a double knock-out mutant of ferrienterobactin receptor encoding gene pfeA (PA 2688) and pirA (PA0931) failed to be stimulated by 4 of the tested synthetic catecholate siderophores whose chemical structures resemble enterobactin. Ferric-enterobactin also failed to stimulate growth of the double pfeA-pirA mutant although, like its synthetic analogues, it stimulated growth of the corresponding single mutants. Hence, we confirmed that pirA represents a second P. aeruginosa ferric-enterobactin receptor. The example of these two
Fernanda G. Braga; Yoshiko S. Kuniyoshi
2010-01-01
Este estudo foi realizado em duas propriedades particulares, situadas no município de Piraí do Sul, sul do Brasil. Foram realizadas 16 fases de campo mensais, com três dias de duração, no período compreendido entre fevereiro de 2001 e maio de 2002, com o objetivo de obter informações sobre a biologia do veado-campeiro (Ozotoceros bezoarticus Linnaeus, 1758) e identificar os principais fatores de impacto sobre o mesmo. Foram computadas 1.065 observações, estimando-se 71,45 indivíduos na popula...
Singh, O P; Dykes, C L; Sharma, G; Das, M K
2015-01-01
Leucine-to-phenylalanine substitution at residue L1014 in the voltage-gated sodium channel, target site of action for dichlorodiphenyltrichloroethane (DDT) and pyrethroids, is the most common knockdown resistance (kdr) mutation reported in several insects conferring resistance against DDT and pyrethroids. Here, we report presence of two coexisting alternative transversions, A>T and A>C, on the third codon position of L1014 residue in malaria vector Anopheles subpictus Grassi (species A) from Jamshedpur (India), both leading to the same amino acid substitution of Leu-to-Phe with allelic frequencies of 19 and 67%, respectively. A single primer-introduced restriction analysis-polymerase chain reaction (PIRA-PCR) was devised for the identification of L1014F-kdr mutation in An. subpictus resulting from either type of point mutation. Genotyping of samples with PIRA-PCR revealed high frequency (82%) of L1014F-kdr mutation in the study area. © The Authors 2015. Published by Oxford University Press on behalf of Entomological Society of America. All rights reserved. For Permissions, please email: journals.permissions@oup.com.
Montero Quiroga, Keyla Carolina
2014-01-01
El género Amaranthus se caracteriza por su alto contenido de nutrientes comparables a los alimentos de origen animal. Sin embargo, la especie Amaranthus dubius, la cual está diseminada en Venezuela, se considera un arvense de cultivos de subsistencia, como el maíz, sorgo y leguminosas; esto impulso la investigación sobre la posible aplicación del amaranto venezolano para la alimentación humana. El estudio se inició con la evaluación de la composición proximal, el contenid...
Shibuta, K; Abe, M; Suzuki, T
1994-01-01
The K variant of human butyrylcholinesterase is caused by a G/A transition in the butyrylcholinesterase gene, which neither creates nor destroys any restriction site. In an attempt to detect the K variant both simply and rapidly, we developed a two step method of "PCR primer introduced restriction analysis" (PCR-PIRA). The first step was used to introduce a new Fun4HI site into the normal allele for a screening test, while the second step was performed to create a new MaeIII site on the variant allele for a specific test. This method thus enabled us to distinguish clearly the K variant from the normal allele, and also showed that the frequency of the K variant allele is 0.164 in the Japanese population. Images PMID:7966197
Braga,Fernanda G.; Kuniyoshi,Yoshiko S.
2010-01-01
Este estudo foi realizado em duas propriedades particulares, situadas no município de Piraí do Sul, sul do Brasil. Foram realizadas 16 fases de campo mensais, com três dias de duração, no período compreendido entre fevereiro de 2001 e maio de 2002, com o objetivo de obter informações sobre a biologia do veado-campeiro (Ozotoceros bezoarticus Linnaeus, 1758) e identificar os principais fatores de impacto sobre o mesmo. Foram computadas 1.065 observações, estimando-se 71,45 indivíduos na popula...
Evaluación de extractos de fique, coquito, sorgo y ruda como posibles bio-herbicidas
Directory of Open Access Journals (Sweden)
Liliana Osorio Salazar
2009-04-01
Full Text Available En experimentos completamente al azar en condiciones de laboratorio y campo, en Palmira, Valle del Cauca, se evaluó el efecto de extractos de Macrophylla furcraea Baker (fique, Cyperus rotundus L (coquito, Sorghum bicolor L (sorgo, y Ruta graveolens L (ruda sobre la germinación de semillas de las arvenses Bidens pilosa L (papunga y Amaranthus dubius Mart (bledo y del cilantro Coriandrum sativum L. Se obtuvieron los extractos por el método Soxhlet, utilizando agua, etanol y cloroformo como solventes. Los extractos obtenidos se evaluaron en tres diluciones (0, 5 y 10 % en pruebas de germinación de semillas de las arvenses y del cultivo. Se emplearon tres repeticiones de 50 semillas cada una y el testigo se regó con agua destilada. Los extractos etanólicos y clorofórmicos de coquito y fique en las diluciones al 5 y 10 % presentaron el mayor efecto inhibitorio en la germinación a los 21 días. El ensayo de campo demostró el efecto inhibitorio de los extractos etanólicos de fique y coquito en la emergencia de las semillas del cilantro. El análisis de metabolitos secundarios comprobó la presencia de compuestos reportados como altamente tóxicos en fique y en menor cantidad en coquito, aunque los extractos de éste fueron los que más inhibieron la germinación.
Yong, Yi Yi; Dykes, Gary; Lee, Sui Mae; Choo, Wee Sim
2017-03-01
Betacyanins are reddish to violet pigments that can be found in red pitahaya (Hylocereus polyrhizus) and red spinach (Amaranthus dubius). This study investigated the impact of sub-fractionation (solvent partitioning) on betacyanin content in both plants. Characterization of betacyanins and evaluation of their antimicrobial activities were also carried out. Betanin was found in both plants. In addition, isobetanin, phyllocactin and hylocerenin were found in red pitahaya whereas amaranthine and decarboxy-amaranthine were found in red spinach. Sub-fractionated red pitahaya and red spinach had 23.5 and 121.5 % more betacyanin content, respectively, than those without sub-fractionation. Sub-fractionation increased the betanin and decarboxy-amaranthine content in red pitahaya and red spinach, respectively. The betacyanin fraction from red spinach (minimum inhibitory concentration [MIC] values: 0.78-3.13 mg/mL) demonstrated a better antimicrobial activity profile than that of red pitahaya (MIC values: 3.13-6.25 mg/mL) against nine Gram-positive bacterial strains. Similarly, the red spinach fraction (MIC values: 1.56-3.13 mg/mL) was more active than the red pitahaya fraction (MIC values: 3.13-6.25 mg/mL) against five Gram-negative bacterial strains. This could be because of a higher amount of betacyanin, particularly amaranthine in the red spinach.
Montero-Quintero, Keyla Carolina; Moreno-Rojas, Rafael; Molina, Edgar Alí; Colina-Barriga, Máximo Segundo; Sánchez-Urdaneta, Adriana Beatriz
2014-11-01
The incorporation of functional ingredients like amaranth (Amaranthus dubius Mart. ex Thell.) in bread making is a strategy to increase fiber intake, which is associated with beneficial health effects, improving glycemic response and lipid profile. Thirty male Sprague dawley rats were randomized into three groups: diet of bread with 0% amaranth (PA0, control), diet of bread with 10% amaranth (PA10) and bread diet with 20% amaranth (PA20) for determining the feed intake, weight gain, triglyceride, total cholesterol, VLDL-C, LDL-C, HDL-C, protein and postprandial glycemic response. Data were analyzed using a completely randomized with 10 replications analysis, using the comparison test of Tukey for biochemical parameters. Postprandial glycemic response was analyzed by the method of repeated measures over time. The daily intake and weight gain was not affected (P>0.05) in the groups with PA10 and PA20. The concentration of glucose, triglycerides and protein showed statistically significant differences (P>0.05) by the difference in content of amaranth diets. The values of total cholesterol, LDL-C, and atherogenic risk factor index were statistically significant (P. Copyright AULA MEDICA EDICIONES 2014. Published by AULA MEDICA. All rights reserved.
Ayala-Valdovinos, Miguel Angel; Galindo-García, Jorge; Sánchez-Chiprés, David; Duifhuis-Rivera, Theodor
2017-04-01
Hydrocephalus in Friesian horses is an autosomal recessive hereditary disease that can result in an abortion, a stillbirth, or euthanization of a newborn foal. Here, the hydrocephalus-associated c.1423C > T mutation in B3GALNT2 gene was detected with PCR-RFLP and PCR-PIRA methods for horse genotyping. A preliminary genotyping survey was performed on 83 randomly selected Friesian stallion horses to determine the current allele frequency in Mexico. The frequency of the mutant T allele was 9.6%. Copyright © 2016 Elsevier Ltd. All rights reserved.
Directory of Open Access Journals (Sweden)
Fernanda G. Braga
2010-06-01
Full Text Available Este estudo foi realizado em duas propriedades particulares, situadas no município de Piraí do Sul, sul do Brasil. Foram realizadas 16 fases de campo mensais, com três dias de duração, no período compreendido entre fevereiro de 2001 e maio de 2002, com o objetivo de obter informações sobre a biologia do veado-campeiro (Ozotoceros bezoarticus Linnaeus, 1758 e identificar os principais fatores de impacto sobre o mesmo. Foram computadas 1.065 observações, estimando-se 71,45 indivíduos na população, sendo o tamanho médio dos grupos de 2,29 (DV ± 0,55, e a razão sexual de 0,83. Indivíduos isolados corresponderam a 40% das observações, sendo o maior grupo composto por 10 indivíduos. Registrou-se um pico de nascimentos entre setembro e novembro, embora esses tenham acontecido ao longo de todo o estudo. Foram registrados 34 óbitos, correspondendo a uma mortalidade de 47,6%, sendo as principais causas a predação por Puma concolor (Linnaeus, 1771, a caça e os atropelamentos. A população estudada encontra-se severamente ameaçada, e não sobreviverá por muito tempo a menos que políticas que garantam a sua conservação sejam adotadas. Estas políticas devem incluir o manejo adequado das áreas e o controle dos vetores de pressão.This study was conducted in two private properties in the municipality of Piraí do Sul (Paraná state, southern Brazil. Sixteen monthly visits were made each one lasting three days between February 2001 and May 2002. The study aimed at the observation of pampas deer biology (Ozotoceros bezoarticus Linnaeus, 1758, and the evaluation of main impacts to this population. We computed 1,065 observations of estimated 71.45 individuals. The average size of the groups was 2.29 (SD ± 0.55 animals, and the sexual ratio was 0.83. Isolated deer accounted for 40% of the observations, whereas the largest group comprised 10 individuals. It was recorded a peack period of births between September and November, although
Evaluación de extractos de fique, coquito, sorgo y ruda como posibles bio-herbicidas
Directory of Open Access Journals (Sweden)
Mier Barona Carmen Elena
2009-06-01
Full Text Available En experimentos completamente al azar en condiciones de laboratorio y campo, en Palmira, Valle del Cauca, se evaluó el efecto de extractos de Macrophylla furcraea Baker (fique, Cyperus rotundus L (coquito, Sorghum bicolor L (sorgo, y Ruta graveolens L (ruda sobre la germinación de semillas de las arvenses Bidens pilosa L (papunga y Amaranthus dubius Mart (bledo y del cilantro Coriandrum sativum L. Se obtuvieron los extractos por el método Soxhlet, utilizando agua, etanol y cloroformo como solventes. Los extractos obtenidos se evaluaron en tres diluciones (0, 5 y 10 % en pruebas de germinación de semillas de las arvenses y del cultivo. Se emplearon tres repeticiones de 50 semillas cada una y el testigo se regó con agua destilada. Los extractos etanólicos y clorofórmicos de coquito y fique en las diluciones al 5 y 10 % presentaron el mayor efecto inhibitorio en la germinación a los 21 días. El ensayo de campo demostró el efecto inhibitorio de los extractos etanólicos de fique y coquito en la emergencia de las semillas del cilantro. El análisis de metabolitos secundarios comprobó la presencia de compuestos reportados como altamente tóxicos en fique y en menor cantidad en coquito, aunque los extractos de éste fueron los que más inhibieron la germinación.
Directory of Open Access Journals (Sweden)
Liliana Osorio Salazar
2009-04-01
Full Text Available En experimentos completamente al azar en condiciones de laboratorio y campo, en Palmira, Valle del Cauca, se evaluó el efecto de extractos de Macrophylla furcraea Baker (fique, Cyperus rotundus L (coquito, Sorghum bicolor L (sorgo, y Ruta graveolens L (ruda sobre la germinación de semillas de las arvenses Bidens pilosa L (papunga y Amaranthus dubius Mart (bledo y del cilantro Coriandrum sativum L. Se obtuvieron los extractos por el método Soxhlet, utilizando agua, etanol y cloroformo como solventes. Los extractos obtenidos se evaluaron en tres diluciones (0, 5 y 10 % en pruebas de germinación de semillas de las arvenses y del cultivo. Se emplearon tres repeticiones de 50 semillas cada una y el testigo se regó con agua destilada. Los extractos etanólicos y clorofórmicos de coquito y fique en las diluciones al 5 y 10 % presentaron el mayor efecto inhibitorio en la germinación a los 21 días. El ensayo de campo demostró el efecto inhibitorio de los extractos etanólicos de fique y coquito en la emergencia de las semillas del cilantro. El análisis de metabolitos secundarios comprobó la presencia de compuestos reportados como altamente tóxicos en fique y en menor cantidad en coquito, aunque los extractos de éste fueron los que más inhibieron la germinación.The objective of this work was to evaluate the effect of the extracts of the species Macrophylla furcraea Baker (cuban hemp, Cyperus rotundus L (nut sedge, Sorghum bicolor L (johnson grass and Ruta graveolens L (herb of grace on seed germination of two weeds and one crop. The extracts were obtained by the Soxhlet method, using water, ethanol and chloroform as solvents. Each extract was evaluated in three dilutions (0, 5 and 10 % v/v and was applied to Bidens pilosa L (spanish needle, Amaranthus dubius Mart (spleen amaranth and Coriandrum sativum L (coriander seeds. Three replications of 50 seeds each one were used and the control was watered only with destilled water. The results
Inverting the Army Intelligence Pyramid
2011-05-19
British experience fighting the Provisional Irish Republican Army ( PIRA ) in Northern Ireland, which began an insurgency in 1969.91...they became extremely successful.”93 Martin Van Creveld posits that the British Army’s success against the PIRA in Northern Ireland stands out as...and MI6 (Secret Intelligence Service) to defeat the PIRA .97 92 John Kiszely, "Learning About
Pfützner, Andreas; Hanefeld, Markolf; Dekordi, Lida A; Müller, Jürgen; Kleine, Iris; Fuchs, Winfried; Forst, Thomas
2011-07-01
This study investigated the effects of pioglitazone (PIO), ramipril (RAM), or their combination (PIRA) on low-grade inflammation in nondiabetic hypertensive patients with increased cardiovascular risk. Patients enrolled in this placebo-controlled, double-blind, randomized, parallel trial (72 male, 77 female, aged 60 ± 9 years, body mass index 30.4 ± 4.7 kg/m(2), duration of hypertension 9 ± 8 years) were treated with either 30/45 mg PIO (dose titration), 2.5/5 mg RAM, or their combination for 12 weeks. A reduction in high-sensitivity C-reactive protein was observed with PIO (-0.89 ± 1.98 mg/liter; -25%) and PIRA (-0.49 ± 2.11 mg/liter; -16%), while an increase was seen with RAM (0.58 ± 2.13 mg/liter; +20%, p PIRA). The 24-hour blood pressure profile showed a small increase with both monotherapies but a decrease with PIRA (p PIRA arms only [PIO/RAM/PIRA: homeostasis model of assessment of IR: -0.78 ± 1.39 (-29%)/0.15 ± 1.03 (+5%)/ -1.44 ± 2.83 (-40%); adiponectin: 8.51 ± 5.91 (+104%)/ 0.09 ± 2.63 (+1%)/ 8.86 ± 6.37 mg/liter (+107%); matrix metallo-proteinase-9: -48 ± 127 (-12%)/-1 ± 224 (0%)/-60 ± 210 ng/ml (-13%), p PIRA in all cases]. Our 3-month study in nondiabetic hypertensive patients showed a decrease in biomarkers of IR and chronic systemic inflammation with the PIO monotherapy and the PIRA combination only, which may help to explain some findings in other cardiovascular outcome trials. © 2011 Diabetes Technology Society.
Portanus Ball: descrição de uma espécie nova (Hemiptera, Cicadellidae, Xestocephalinae
Directory of Open Access Journals (Sweden)
2004-01-01
Full Text Available Portanus dubius sp. nov. é descrita e ilustrada a partir de espécimens que foram coletados com armadilha Malaise durante um levantamento entomológico no Estado do Paraná, Brasil (PROFAUPAR.Portanus Ball: description of a new species (Hemiptera, Cicadellidae, Xestocephalinae. Portanus dubius sp. nov. is described and illustrated. The specimens were collected with Malaise trap during an entomological inventory in Paraná State, Brazil (PROFAUPAR.
PirAB Toxin from Photorhabdus asymbiotica as a Larvicide against Dengue Vectors▿
Ahantarig, Arunee; Chantawat, Nantarat; Waterfield, Nicholas R.; ffrench-Constant, Richard; Kittayapong, Pattamaporn
2009-01-01
We have evaluated Photorhabdus insect-related protein (Pir) from Photorhabdus asymbiotica against dengue vectors. PirAB shows larvicidal activity against both Aedes aegypti and Aedes albopictus larvae but did not affect the Mesocyclops thermocyclopoides predator. PirAB expressed the strongest toxicity compared to PirA, PirB, or the mixture of PirA plus PirB. Whether the presence of an enterobacterial repetitive intergenic consensus sequence in PirAB, but not in PirA, PirB, or the mixture of P...
Directory of Open Access Journals (Sweden)
Ola M. EL-Houssini
2013-01-01
Full Text Available Specific stability indicating reverse-phase liquid chromatography (RP-LC assay method (SIAM was developed for the determination of cinnarizine (Cinn/piracetam (Pira and cinnarizine (Cinn/heptaminol acefyllinate (Hept in the presence of the reported degradation products of Cinn. A C 18 column and gradient mobile phase was applied for good resolution of all peaks. The detection was achieved at 210 nm and 254 nm for Cinn/Pira and Cinn/Hept, respectively. The responses were linear over concentration ranges of 20-200, 20-1000 and 25-1000 μgmL −1 for Cinn, Pira, and Hept respectively. The proposed method was validated for linearity, accuracy, repeatability, intermediate precision, and robustness via statistical analysis of the data. The method was shown to be precise, accurate, reproducible, sensitive, and selective for the analysis of Cinn/Pira and Cinn/Hept in laboratory prepared mixtures and in pharmaceutical formulations.
EL-Houssini, Ola M.; Zawilla, Nagwan H.; Mohammad, Mohammad A.
2013-01-01
Specific stability indicating reverse-phase liquid chromatography (RP-LC) assay method (SIAM) was developed for the determination of cinnarizine (Cinn)/piracetam (Pira) and cinnarizine (Cinn)/heptaminol acefyllinate (Hept) in the presence of the reported degradation products of Cinn. A C18 column and gradient mobile phase was applied for good resolution of all peaks. The detection was achieved at 210 nm and 254 nm for Cinn/Pira and Cinn/Hept, respectively. The responses were linear over concentration ranges of 20–200, 20–1000 and 25–1000 μgmL−1 for Cinn, Pira, and Hept respectively. The proposed method was validated for linearity, accuracy, repeatability, intermediate precision, and robustness via statistical analysis of the data. The method was shown to be precise, accurate, reproducible, sensitive, and selective for the analysis of Cinn/Pira and Cinn/Hept in laboratory prepared mixtures and in pharmaceutical formulations. PMID:24137049
Highway Security: Filling the Void
2011-09-01
Infrastructure Protection Plan PERF – Police Executive Research Forum PIRA – Provisional Irish Republican Army SCC – Sector Coordinating Council TSA...experience dealing with IEDs, such as the United Kingdom whose “troubles” with the Provisional Irish Republic Army ( PIRA ) was fraught with IED
A Preliminary Investigation into CNO Availability Schedule Overruns
2012-06-01
days PHNSY Pearl Harbor Naval Shipyard and IMF PIA Planned Incremental Availability PIRA Pre-Inactivated Restricted Availability PNSY Portsmouth...DSRA 6 DEM 2 EOH 6 IA 2 PIA 3 MMP 1 ERO 3 SRA 1 PIRA 2 DMP 1 RCD 2 CM 1 DPIA 2 Table 23. High Level Work Stoppage Data Characteristics 1
Curvature Analysis of Cardiac Excitation Wavefronts
2013-04-01
reconstructed the isolines of 10,000 frames, both with PIRA and the contour function of MATLAB. The first took 1.65 seconds while the second took 720...seconds. Hence, PIRA had a 444.44-fold speedup compared to contour. The platform was equipped with Intel Core i7-930 2.8 GHz LGA 1,366 130W Quad-Core
Directory of Open Access Journals (Sweden)
Benedita Maria Rodrigues
1996-01-01
Full Text Available Visando determinar um método para micropropagação a partir de bulbinhos in vitro, de cultivares de cebola (Allium cepa L., foram realizados três experimentos, avaliando-se a influência do 6-benzilaminopurina (BAP x ácido naftalenoacético (ANA e posição do explante no meio de cultura, a influência de bulbinhos desenvolvidos em diversas concentrações de sacarose e o efeito do diâmetro dos bulbinhos sobre a taxa de multiplicação in vitro. Pelos resultados, a posição vertical dos explantes mostrou maior tendência para porcentagem de regeneração nos cultivares Pira Ouro e Pirana Precoce. 0 efeito das concentrações de fitorreguladores na porcentagem de regeneração não foi verificado para o 'Pira Ouro', enquanto para o 'Pirana Precoce', porcentagem mais elevada foi obtida em 4,0 mg/L de BAP x 0,5 mg/L de ANA. Maior taxa de multiplicação foi observada para os dois cultivares em BAP (2,0 mg/L x ANA (0,25 mg/L. Bulbinhos do cultivar Pira Ouro e híbrido entre Pira Ouro e Pirana Precoce, desenvolvidos em 120 g/L de sacarose, mostraram-se mais adequados à micropropagação in vitro no material utilizado. Com relação ao diâmetro inicial do explante, o 'Pira Ouro' não mostrou diferença estatística para os parâmetros avaliados, enquanto no 'Pirana Precoce' maior porcentagem de regeneração foi obtida nos diâmetros M (5 a 10 mm e P (Series of three different experiments were carried out, in order to study the optimization of the use of bulblets obtained in vitro, in the micropropagation of the onion (Allium cepa L.. Initially, it was evaluated the effects of the interaction between two doais of 6-benzylaminopurine (BAP and naphthaleneacetic acid (NAA, and the position of the explant in the medium, for the cultivara Pira Ouro and Pirana Precoce. For 'Pira Ouro' the phytohormone concentrations did not affect the percentage of regeneration; however, for 'Pirana Precoce', the rates of 4.0 mg/L of BAP and 0.5 mg/L of NAA gave the
Altınel, Ahmet
2017-01-01
Complex vertebral malformation (CVM) is an inherited, autosomal recessive disorder of Holstein cattle. The aim of this study was to compare sensitivity, specificity, positive and negative predictive values, accuracy, and rapidity of allele-specific polymerase chain reaction (AS-PCR), created restriction-site PCR (CRS-PCR), and PCR with primer-introduced restriction analysis (PCR-PIRA), three methods used in identification of CVM carriers in a Holstein cattle population. In order to screen for the G>T mutation in the solute carrier family 35 member A3 (SLC35A3) gene, DNA sequencing as the gold standard method was used. The prevalence of carriers and the mutant allele frequency were 3.2% and 0.016, respectively, among Holstein cattle in the Thrace region of Turkey. Among the three methods, the fastest but least accurate was AS-PCR. Although the rapidity of CRS-PCR and PCR-PIRA were nearly equal, the accuracy of PCR-PIRA was higher than that of CRS-PCR. Therefore, among the three methods, PCR-PIRA appears to be the most efficacious for screening of mutant alleles when identifying CVM carriers in a Holstein cattle population. PMID:28927256
Directory of Open Access Journals (Sweden)
Silvio Júlio de Rezende Chagas
2004-02-01
Full Text Available Com o objetivo de determinar a composição físico-química e química de cultivares de cebola (Allium cepa L., conduziu-se um ensaio na Fazenda Experimental de Lavras da EPAMIG, Lavras-MG, no período de março a setembro de 1995. O delineamento experimental foi de blocos ao acaso com quatro repetições e 6 tratamentos, constituídos pelas cultivares Baia Periforme, Crioula, Granex 33, Pira Ouro, Jubileu e Texas Grano 502. Após a cura, avaliaram-se o pH, sólidos solúveis e totais (%, acidez titulável (%, ácido pirúvico (µmol/g, açúcares totais, redutores e não-redutores (% e índice industrial dos bulbos. As cultivares Crioula, Baia Periforme, Pira Ouro e Jubileu apresentaram as maiores concentrações de sólidos totais e solúveis. A acidez mais elevada foi observada nas cultivares Crioula (0,370% e Pira Ouro (0,315%. Os maiores índices industriais foram apresentados pelas cultivares Crioula (0,87 e Baia Periforme (0,75, e os menores, pelas cultivares Texas Grano 502 (0,51 e Granex 33 (0,32.This study was carried out from March to September of 1995, in the Experimental Field of EPAMIG, Lavras-MG, Brazil, with the objective of determining the physico-chemical and chemical composition of onions from different cultivars (Allium cepa L.. The experimental design was completely randomized blocks with four repetitions and six cultivars as follow: Baia Periforme, Crioula, Granex 33, Pira Ouro, Jubileu and Texas Grano 502. After the cure it was evaluated the pH, soluble and total solids (%, titrate acidity (%, pyruvic acid (µmol/g, total sugar, reducers and non reducers (% and industrial index. The cultivars Crioula, Baia Periforme, Pira Ouro and Jubileu showed the largest concentrations of total and soluble solids. The highest acidity indexes were observed in the cultivars Crioula (0.370% and Pira Ouro (0.315%. The largest industrial indexes were found in the cultivars Crioula (0.87 and Baia Periforme (0.75, and the smallest ones in the
Directory of Open Access Journals (Sweden)
Soltis Pamela S
2010-02-01
Full Text Available Abstract Background Although polyploidy has long been recognized as a major force in the evolution of plants, most of what we know about the genetic consequences of polyploidy comes from the study of crops and model systems. Furthermore, although many polyploid species have formed repeatedly, patterns of genome evolution and gene expression are largely unknown for natural polyploid populations of independent origin. We therefore examined patterns of loss and expression in duplicate gene pairs (homeologs in multiple individuals from seven natural populations of independent origin of Tragopogon mirus (Asteraceae, an allopolyploid that formed repeatedly within the last 80 years from the diploids T. dubius and T. porrifolius. Results Using cDNA-AFLPs, we found differential band patterns that could be attributable to gene silencing, novel expression, and/or maternal/paternal effects between T. mirus and its diploid parents. Subsequent cleaved amplified polymorphic sequence (CAPS analyses of genomic DNA and cDNA revealed that 20 of the 30 genes identified through cDNA-AFLP analysis showed additivity, whereas nine of the 30 exhibited the loss of one parental homeolog in at least one individual. Homeolog loss (versus loss of a restriction site was confirmed via sequencing. The remaining gene (ADENINE-DNA GLYCOSYLASE showed ambiguous patterns in T. mirus because of polymorphism in the diploid parent T. dubius. Most (63.6% of the homeolog loss events were of the T. dubius parental copy. Two genes, NUCLEAR RIBOSOMAL DNA and GLYCERALDEHYDE-3-PHOSPHATE DEHYDROGENASE, showed differential expression of the parental homeologs, with the T. dubius copy silenced in some individuals of T. mirus. Conclusions Genomic and cDNA CAPS analyses indicated that plants representing multiple populations of this young natural allopolyploid have experienced frequent and preferential elimination of homeologous loci. Comparable analyses of synthetic F1 hybrids showed only
Directory of Open Access Journals (Sweden)
Luciana Pinheiro
2004-04-01
Full Text Available Este trabalho tem por objetivo descrever os potenciais do conhecimento empírico ou prático relacionados à ictiofauna e, de um modo mais amplo, à percepção ambiental da população ribeirinha do rio Piraí, Município de Joinville, Santa Catarina, Brasil. Partindo de uma pesquisa prévia, que teve como resultado um inventário ictiológico preliminar desse rio, foram elaborados os procedimentos metodológicos relativos à dimensão qualitativa do estudo. Com base nos depoimentos dessa população ribeirinha, obtidos mediante entrevista semi-estruturada, organizaram-se as categorias de análise com vistas a uma proposta de tipologia etnográfica. Essa tipologia foi utilizada na análise dos depoimentos dos sujeitos da pesquisa, concluindo-se que o estudo ictiológico desenvolvido sob uma perspectiva de diálogo com o saber popular dos ribeirinhos pode ser muito profícuo, em face do senso de conservação ambiental atrelado à sustentabilidade de seu modo de vidaThe purpose of this paper is to describe the potential of empirical knowledge or practice related to fishes and, in more general terms, the environmental perceptions of the population living alongside the Piraí river, Joinville, Santa Catarina, Brazil. Its point of departure is initial research that resulted in a preliminary ichthyological inventory of the river, from which methodological procedures relative to the qualitative dimension of the study were developed. Based on the testimony of the river land inhabitants, obtained through semi-structured interviews, analytical categories providing an ethnographic typology were developed. This typology was then used in the analysis of the testimony of the study's informants, arriving at the conclusion that an ichthyological study based on dialogue with popular knowledge can be very valuable, given the local people's sense of environmental conservation as it is linked to their sustainable life style
Directory of Open Access Journals (Sweden)
Dalva Paulus
2012-03-01
Full Text Available O presente trabalho teve como objetivos determinar os teores de nutrientes e de nitrato e realizar análise sensorial de alface cultivada em sistema hidropônico sob água salina. O experimento foi conduzido em ambiente protegido no período de dezembro de 2007 a janeiro de 2008, em Piracicaba (SP. O delineamento experimental foi de blocos ao acaso, sendo estudados cinco níveis de salinidade da água de irrigação, utilizando-se NaCl (Condutividade elétrica da água (CEa: 0,42, 1,53, 3,52, 5,55 e 7,43 dS m-1 em duas cultivares de alface (Verônica e Pira Roxa, em esquema fatorial. Foram avaliados a análise sensorial aplicando escala hedônica e através dessa, o que os provadores mais apreciaram e o que menos gostaram de cada amostra, intenção de compra e consumo, teor de nitrato, absorção de nutrientes pela folhas e determinação dos nutrientes presentes na solução nutritiva. Para o atributo sabor a cultivar Verônica recebeu as melhores notas no nível de salinidade 1,53 e 5,55 dS m-1. Para a cultivar Pira Roxa a melhor nota foi atribuída para a alface produzida na água não salina. Para os demais atributos não houve diferença significativa nos diferentes níveis de salinidade. Com relação à intenção de compra, constatou-se que as alfaces cv. Verônica e Pira Roxa apresentaram boa aceitação de mercado. Os menores níveis de nitrato (1960 mg kg-1 e 2620 mg kg-1 de massa de matéria fresca, da Verônica e Pira Roxa, respectivamente, foram relacionados à condutividade elétrica de 0,42 dS m-1, aumentando a salinidade da água para 7,43 dS m-1, o teor foliar de nitrato aumentou para 2500 mg kg-1 e 3420 mg kg-1 para as cultivares Verônica e Pira Roxa. Como o tempo de exposição da alface à salinidade em sistema hidropônico foi curto, em torno de 25 dias, não se verificou sintomas de deficiência nutricional e toda alface foi classificada como apropriada para consumo humano.This study aimed to evaluate the content of
Asal, Victor; Rethemeyer, R. Karl; Horgan, John
2015-01-01
This paper presents an analysis of the Provisional Irish Republican Army's (PIRA) brigade level behavior during the Northern Ireland Conflict (1970-1998) and identifies the organizational factors that impact a brigade's lethality as measured via terrorist attacks. Key independent variables include levels of technical expertise, cadre age, counter-terrorism policies experienced, brigade size, and IED components and delivery methods. We find that technical expertise within a brigade allows for careful IED usage, which significantly minimizes civilian casualties (a specific strategic goal of PIRA) while increasing the ability to kill more high value targets with IEDs. Lethal counter-terrorism events also significantly affect a brigade's likelihood of killing both civilians and high-value targets but in different ways. Killing PIRA members significantly decreases IED fatalities but also significantly decreases the possibility of zero civilian IED-related deaths in a given year. Killing innocent Catholics in a Brigade's county significantly increases total and civilian IED fatalities. Together the results suggest the necessity to analyze dynamic situational variables that impact terrorist group behavior at the sub-unit level. PMID:25838603
Directory of Open Access Journals (Sweden)
P.V. Ferreira
1982-12-01
Full Text Available Em ensaios experimentais, realizados no Departamento de Genética da Escola Superior de Agricultura "Luiz de Queiroz" da Universidade de São Paulo, Piracicaba - SP, verificou-se o efeito da ce rosidade foliar na reação de variedades de cebola a herbicidas de pós-emergência. Utilizaram-se variedades do grupo não ceroso, como Granex e Texas Grano, e variedades do grupo ceroso, como Baia Periforme, Barreiro SMP-IV, Red Creole e Roxa Chata SMP-IV, no 1.º ensaio; e variedades do grupo não ceroso, como Excel Bermudas 986 e Texas Grano, e variedades do grupo ceroso, como Baia Periforme, Pira Couto, Pira Dura, Pira Ouro A/R, Red Creole e Roxa Chata SMP-IV, no 2.º ensaio. Os herbicidas de pós-emergência e as doses utilizadas foram: bentazon, 0,48 kg i.a./ha e prometryne 1,60 kg i.a./ha, no 1.0 ensaio; e ácido sulfúrico (4%, bentazon 0,48 kg i.a./ha, prometryne 1,60 kg i.a./ha e diuron 1,60 kg i.a./ha, no 2: ensaio. Os resultados obtidos mostram que a cerosidade foliar é um dos mecanismos de resistência de cebola à ação de herbicidas de pós-emergência.In experimental trials, carried out in the Department of Genetic of ESALQ, University of São Paulo, Piracicaba - SP, the effect of the foliar waxiness in reaction of onion varieties at postemergence herbicides was studied. Glossy group varieties such as Granex and Texas Grano and non-glossy group varieties such as Baia Periforme, Barreiro SMP-IV, Red Creole and Roxa-Chata SMP-IV, were tested in 1st. experiment; and glossy group varieties such as Excel Bermudas 986 and Texas Grano and nonglossy group varieties such as Baia Periforme, Pira Couto, Pira Dura, Pira Ouro A/R, Red Creole and Roxa Chata SMP-IV, in 2nd experiment. The following post-emergence herbicides and doses were used: bentazon 0,48 kg a.i./ha and prometryne 1,60 kg a.i./ha, in the last experiment: and sulphuric acid (4%, bentazon 0,48 kg a.i./ha, prometryne 1,60 kg a.i./ha and diuron 1,60 kg a.i./ha, in the 2nd experiment
International Nuclear Information System (INIS)
Tristan-Gonzalez, Margarito; Labarthe-Hernandez, Guillermo; Aguillon-Robles, Alfredo; Aguirre-DIaz, Gerardo J
2008-01-01
The volcano-tectonic events at the Villa de Reyes Graben (VRG), in the southern Sierra Madre Occidental, Mexico, include 1) a regional NNE fault system developed before 32 Ma, 2) this pre-32 Ma faulting controlled the emplacement of 31.5 Ma dacitic domes, 3) NE faulting at 28 Ma that displaced the 31.5 Ma dacitic domes and formed the VRG, as well as the oblique grabens of Bledos and Enramadas oriented NW, 4) emplacement of Panalillo ignimbrite at 28 Ma filling the VRG and erupting from fissures related to the oblique grabens, and eruption of Placa basalt apparently also from fault-controlled vents.
Energy Technology Data Exchange (ETDEWEB)
Tristan-Gonzalez, Margarito; Labarthe-Hernandez, Guillermo; Aguillon-Robles, Alfredo [Instituto de Geologia/DES IngenierIa, UASLP, Av. Dr. Manuel Nava 5, Zona Universitaria, C.P. 78240, San Luis PotosI, S.L.P. (Mexico); Aguirre-DIaz, Gerardo J [Centro de Geociencias, Universidad Nacional Autonoma de Mexico, Campus Juriquilla, Queretaro, 76230 (Mexico)], E-mail: mtiistan@uasln.mx, E-mail: ger@geociencias.unam.mx
2008-10-01
The volcano-tectonic events at the Villa de Reyes Graben (VRG), in the southern Sierra Madre Occidental, Mexico, include 1) a regional NNE fault system developed before 32 Ma, 2) this pre-32 Ma faulting controlled the emplacement of 31.5 Ma dacitic domes, 3) NE faulting at 28 Ma that displaced the 31.5 Ma dacitic domes and formed the VRG, as well as the oblique grabens of Bledos and Enramadas oriented NW, 4) emplacement of Panalillo ignimbrite at 28 Ma filling the VRG and erupting from fissures related to the oblique grabens, and eruption of Placa basalt apparently also from fault-controlled vents.
Directory of Open Access Journals (Sweden)
T. V. Zonova
2012-01-01
Full Text Available The author examines the legacy of two great Christian thinkers, the American Reinhold Niebuhr and the Italian Giorgio La Pira, both very influential during the Cold War. Niebuhr was a Protestant theologian and political adviser to the American establishment. The Mayor of Florence, La Pira, was a prominent Italian statesman and an eminent Catholic thinker. The author analyzes their views on international relations, in particularly on the western policy towards the Soviet Union, the use of nuclear weapons, the war in Vietnam and communism. The legacy of two thinkers is highly topical in front of the ethical dimension of choices needed in international politics today.
A Ludlow conodont fauna from Irian Jaya (Indonesia)
Boogaard, van den M.
1990-01-01
The conodont fauna extracted from a boulder in the Lorentz River (southern Irian Jaya) is described. Arguments are put forward that the elements of Distomodus dubius (Rhodes, 1953) sensu Jeppsson, 1972 are part of the apparatus of species of Coryssognathus Link & Druce, 1972, a genus that
Decoding Different Patterns in Various Grey Tones Incorporated in the QR Code
Directory of Open Access Journals (Sweden)
Filip Cvitić
2014-07-01
Full Text Available Using colors in bar codes causes errors that may adversely affect their readability (Tan etal. 2010, given that the contrast between data and background modules is reduced. Due to the unreliability of using color bar codes, most designers still keep to the limitations placed by Pira International (Smithers Pira in 2002 (Williams, 2004. Since the contrast between data modules and background modules is the most important aspect in the process of reliable bar code decoding, this paper explores the dependence of reliable decoding of QR codes incorporated with combinations of grey tones on the technical characteristics of the cameras on smartphones that were marketed in the period between 2008 and 2012.
Directory of Open Access Journals (Sweden)
Bosi, Lorenzo
2016-12-01
Full Text Available This article systematizes a research perspective that assesses how different types of social movement outcomes mutually influence one another over time. This should offer a different perspective on the consequences of social movements by shifting the focus from single outcomes to processes of social change that are generated by the interaction between different types of effects. The variety of ways in which movement outcomes potentially influence each other in the short-term, or over an extended period of time, will be broken down into six hypothetical processes. Empirically, through a process-tracing approach, in this article I investigate how the British state’s responses at policy level toward the disruptive mobilization of the Catholic community in Northern Ireland and to the armed campaign of the PIRA have shaped the post-movement lives of PIRA volunteers.Este artículo sistematiza una perspectiva de investigación que evalúa cómo los diferentes tipos de resultados de los movimientos sociales se influyen mutuamente en el tiempo. Esto debería ofrecer una perspectiva diferente sobre las consecuencias de los movimientos sociales, cambiando el foco de atención desde los resultados individuales a procesos de cambio social generados a partir de la interacción entre diferentes tipos de efectos. La variedad de formas en las que los resultados de los movimientos se influyen potencialmente entre sí en el corto plazo, o durante un período prolongado de tiempo, se dividen en seis procesos hipotéticos. Empíricamente, a través de un enfoque centrado en los procesos, este artículo investiga cómo las respuestas políticas ofrecidas del Estado británico a la movilización disruptiva de la comunidad católica de Irlanda del Norte y la lucha armada del PIRA han dado forma a la vida post-movimiento de los voluntarios del PIRA.
Directory of Open Access Journals (Sweden)
Dalva Paulus
2010-03-01
Full Text Available O uso de água salina na produção de hortaliças constitui no momento atividade essencial, tendo em vista o aumento da demanda de água doce, tanto pela atividade agrícola quanto pelo abastecimento urbano e industrial. O objetivo do trabalho foi avaliar a produção e os indicadores fisiológicos de alface cultivada em hidroponia com a utilização de água salina. O experimento foi conduzido em ambiente protegido, em Piracicaba-SP. O delineamento experimental foi de blocos ao acaso, sendo estudados os efeitos de cinco níveis de salinidade da água de irrigação, utilizando-se NaCl [Condutividade elétrica (Cea: 0,42, 1,53, 3,52, 5,55 e 7,43 dS m-1] em duas cultivares de alface (Verônica e Pira Roxa, em esquema fatorial. Foram determinadas massa fresca e seca de folhas, caule, raízes e da parte aérea; teor de nitrato, prolina e clorofila. O aumento da salinidade da água reduziu linearmente as massas fresca e seca das folhas, caule, raízes e da parte aérea. As massas fresca e seca foram 36% e 57% superiores na cultivar Verônica, respectivamente. A cultivar Pira Roxa apresentou maior teor de nitrato 25% (3008 mg L-1, clorofila total 50% (1,46 mg g-1massa fresca e prolina, 71,43% (0,21 µM g-1massa fresca-1 em relação à Verônica, o que pode ser um mecanismo de adaptação daquela cultivar ao estresse salino. Com relação à produtividade comercial, obteve-se uma perda de 69 e 64% para as cultivares Pira Roxa e Verônica, quando se utilizou água mais salina (7,43 dS m-1. Em relação à produção de massa seca, a perda pelo uso dessa água foi de 53% e 44%, respectivamente. Os resultados obtidos em sistema de cultivo hidropônico podem indicar a possibilidade do uso da água salina como alternativa para produção de hortaliças para produtores que têm disponibilidade de água salina e restrita disponibilidade de água doce, embora com redução na produtividade.The use of saline water in the production of vegetables constitutes
International Nuclear Information System (INIS)
Nabulo, Grace; Oryem-Origa, Hannington; Diamond, Miriam
2006-01-01
The relationship between traffic density and trace metal concentrations in roadside soils, surface films, and a selected vegetable weed, Amaranthus dubius Mart. Ex Thell., was determined in 11 farming sites along major highways around Kampala City in Uganda. Surface soil, atmospherically deposited surface films on windows, and leaves of Amaranthus dubius were sampled at known distances from the roads and analyzed for lead (Pb), zinc (Zn), and cadmium (Cd) using flame atomic absorption spectrophotometry. Atmospherically deposited trace metal particulates were sampled using window glass as an inert, passive collector. Total trace metal concentrations in soils ranged from 30.0±2.3 to 64.6±11.7 mg/kg Pb, 78.4±18.4 to 265.6±63.2 mg/kg Zn, and 0.8±0.13 to 1.40±0.16 mg/kg Cd. Total trace metal levels in soil decreased rapidly with distance from the road. Total Pb decreased with distance up to 30 m from the road, where it reached a background soil concentration of 28 mg/kg dry weight. The study found background values of 50 and 1.4 mg/kg for Zn and Cd in roadside soils, respectively. Similarly, Pb concentration in Amaranthus dubius leaves decreased with increasing distance from the road edge. The dominant pathway for Pb contamination was from atmospheric deposition, which was consistent with Pb concentrations in surface films. The mean Pb concentrations in leaves of roadside crops were higher than those in their respective roots, with the highest leaf-to-root ratio observed in the Brassica oleraceae acephala group. The lowest Pb and Zn concentrations were found in the fruit compared to the leaves of the same crops. Leaves of roadside vegetables were therefore considered a potential source of heavy metal contamination to farmers and consumers in urban areas. It is recommended that leafy vegetables should be grown 30 m from roads in high-traffic, urban areas
Directory of Open Access Journals (Sweden)
LB Falco
2015-05-01
Full Text Available The objective of this study was to relate earthworm assemblage structure with three different soil use intensities, and to indentify the physical, chemical, and microbiological soil variables that are associated to the observed differences. Three soil uses were evaluated: 1-Fifty year old naturalized grasslands, low use intensity; 2-Recent agricultural fields, intermediate use intensity, and 3-Fifty year old intensive agricultural fields, high use intensity. Three different sites for each soil use were evaluated from winter 2008 through summer 2011. Nine earthworm species were identified across all sampling sites. The sites shared five species: the native Microscolex dubius, and the introduced Aporrectodea caliginosa, A. rosea, Octalasion cyaneum, and O. lacteum, but they differed in relative abundance by soil use. The results show that the earthworm community structure is linked to and modulated by soil properties. Both species abundance and diversity showed significant differences depending on soil use intensity. A principal component analysis showed that species composition is closely related to the environmental variability. The ratio of native to exotic species was significantly lower in the intensive agricultural system when compared to the other two, lower disturbance systems. Microscolex dubius abundance was related to naturalized grasslands along with soil Ca, pH, mechanical resistance, and microbial respiration. Aporrectodea caliginosa abundance was related to high K levels, low enzymatic activity, slightly low pH, low Ca, and appeared related to the highly disturbed environment. Eukerria stagnalis and Aporrectodea rosea, commonly found in the recent agricultural system, were related to high soil moisture condition, low pH, low Ca and low enzymatic activity. These results show that earthworm assemblages can be good indicators of soil use intensities. In particular, Microscolex dubius, Aporrectodea caliginosa, and Aporrectodea rosea
Breaching the Fortress Wall. Understanding Terrorist Efforts to Overcome Defensive Technologies
2007-01-01
that affect, in overlapping ways, sequential parts of the terrorist activity chain (Figure 1.2). The purposes of each of these types of technologies...fication lineup .51 The ways in which PIRA chose to manage operations also contrib- uted to its overall counterforensic effort. For example, although
ORF Alignment: NC_002696 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available NC_002696 gi|16126641 >1uzbA 58 515 12 462 8e-77 ... ref|NP_421205.1| vanillin dehydr...ogenase [Caulobacter crescentus CB15] gb|AAK24373.1| ... vanillin dehydrogenase [Caulobacter crescent...us CB15] ... pir||A87547 vanillin dehydrogenase [imported] - ... Caulobacter crescentus ...
Directory of Open Access Journals (Sweden)
Bhatt Rajendra M
2010-05-01
Full Text Available Abstract Background Knockdown resistance in insects resulting from mutation(s in the voltage gated Na+ channel (VGSC is one of the mechanisms of resistance against DDT and pyrethroids. Recently a point mutation leading to Leu-to-Phe substitution in the VGSC at residue 1014, a most common kdr mutation in insects, was reported in Anopheles culicifacies-a major malaria vector in the Indian subcontinent. This study reports the presence of two additional amino acid substitutions in the VGSC of an An. culicifacies population from Malkangiri district of Orissa, India. Methods Anopheles culicifacies sensu lato (s.l. samples, collected from a population of Malkangiri district of Orissa (India, were sequenced for part of the second transmembrane segment of VGSC and analyzed for the presence of non-synonymous mutations. A new primer introduced restriction analysis-PCR (PIRA-PCR was developed for the detection of the new mutation L1014S. The An. culicifacies population was genotyped for the presence of L1014F substitution by an amplification refractory mutation system (ARMS and for L1014S substitutions by using a new PIRA-PCR developed in this study. The results were validated through DNA sequencing. Results DNA sequencing of An. culicifacies individuals collected from district Malkangiri revealed the presence of three amino acid substitutions in the IIS6 transmembrane segments of VGSC, each one resulting from a single point mutation. Two alternative point mutations, 3042A>T transversion or 3041T>C transition, were found at residue L1014 leading to Leu (TTA-to-Phe (TTT or -Ser (TCA changes, respectively. A third and novel substitution, Val (GTG-to-Leu (TTG or CTG, was identified at residue V1010 resulting from either of the two transversions–3028G>T or 3028G>C. The L1014S substitution co-existed with V1010L in all the samples analyzed irrespective of the type of point mutation associated with the latter. The PIRA-PCR strategy developed for the
Tate, Jennifer A; Symonds, V Vaughan; Doust, Andrew N; Buggs, Richard J A; Mavrodiev, Evgeny; Majure, Lucas C; Soltis, Pamela S; Soltis, Douglas E
2009-05-01
In plants, polyploidy has been a significant evolutionary force on both recent and ancient time scales. In 1950, Ownbey reported two newly formed Tragopogon allopolyploids in the northwestern United States. We have made the first synthetic lines of T. mirus and T. miscellus using T. dubius, T. porrifolius, and T. pratensis as parents and colchicine treatment of F(1) hybrids. We also produced allotetraploids between T. porrifolius and T. pratensis, which are not known from nature. We report on the crossability between the diploids, as well as the inflorescence morphology, pollen size, meiotic behavior, and fertility of the synthetic polyploids. Morphologically, the synthetics resemble the natural polyploids with short- and long-liguled forms of T. miscellus resulting when T. pratensis and T. dubius are reciprocally crossed. Synthetic T. mirus was also formed reciprocally, but without any obvious morphological differences resulting from the direction of the cross. Of the 27 original crosses that yielded 171 hybrid individuals, 18 of these lineages have persisted to produce 386 S(1) progeny; each of these lineages has produced S(2) seed that are viable. The successful generation of these synthetic polyploids offers the opportunity for detailed comparative studies of natural and synthetic polyploids within a nonmodel system.
NCBI nr-aa BLAST: CBRC-GACU-10-0021 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-GACU-10-0021 ref|YP_177714.1| PPE FAMILY PROTEIN [Mycobacterium tuberculosis H...37Rv] pir||A70524 probable PPE protein - Mycobacterium tuberculosis (strain H37RV) emb|CAE55269.1| PPE FAMILY PROTEIN [Mycobacterium tuberculosis H37Rv] YP_177714.1 1e-30 41% ...
Hoover, Ryan E.
This study examines (1) subject content, (2) file size, (3) types of documents indexed, (4) range of years spanned, and (5) level of indexing and abstracting in five databases which collectively provide extensive coverage of the forestry and forest products industries: AGRICOLA, CAB ABSTRACTS, FOREST PRODUCTS (AIDS), PAPERCHEM, and PIRA. The…
ORF Alignment: NC_003071 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available NC_003071 gi|42569531 >1wd2A 1 58 290 342 7e-13 ... gb|AAD32294.1| similar to Ariadne... protein from Drosophila [Arabidopsis thaliana] ... emb|CAD52893.1| ARIADNE-like protein ARI11 [Arabi...dopsis ... thaliana] pir||A84725 similar to Ariadne protein from ... Drosophila [imported] - A
2012-05-17
mid to late 18th century, a large Protestant Irish bourgeoisie had emerged that was dissatisfied with British mercantile economic policies. There was...of the cargo ship Eksund off the coast of France in 1987, which was carrying a large consignment of Libyan arms for the PIRA is one of the most
Directory of Open Access Journals (Sweden)
Soltis Pamela S
2010-09-01
Full Text Available Abstract Background Tragopogon mirus and T. miscellus are allotetraploids (2n = 24 that formed repeatedly during the past 80 years in eastern Washington and adjacent Idaho (USA following the introduction of the diploids T. dubius, T. porrifolius, and T. pratensis (2n = 12 from Europe. In most natural populations of T. mirus and T. miscellus, there are far fewer 35S rRNA genes (rDNA of T. dubius than there are of the other diploid parent (T. porrifolius or T. pratensis. We studied the inheritance of parental rDNA loci in allotetraploids resynthesized from diploid accessions. We investigate the dynamics and directionality of these rDNA losses, as well as the contribution of gene copy number variation in the parental diploids to rDNA variation in the derived tetraploids. Results Using Southern blot hybridization and fluorescent in situ hybridization (FISH, we analyzed copy numbers and distribution of these highly reiterated genes in seven lines of synthetic T. mirus (110 individuals and four lines of synthetic T. miscellus (71 individuals. Variation among diploid parents accounted for most of the observed gene imbalances detected in F1 hybrids but cannot explain frequent deviations from repeat additivity seen in the allotetraploid lines. Polyploid lineages involving the same diploid parents differed in rDNA genotype, indicating that conditions immediately following genome doubling are crucial for rDNA changes. About 19% of the resynthesized allotetraploid individuals had equal rDNA contributions from the diploid parents, 74% were skewed towards either T. porrifolius or T. pratensis-type units, and only 7% had more rDNA copies of T. dubius-origin compared to the other two parents. Similar genotype frequencies were observed among natural populations. Despite directional reduction of units, the additivity of 35S rDNA locus number is maintained in 82% of the synthetic lines and in all natural allotetraploids. Conclusions Uniparental reductions of
Yang, Qing; Zhang, Jie; Li, Tianhui; Liu, Shen; Song, Ping; Nangong, Ziyan; Wang, Qinying
2017-09-01
PirAB (Photorhabdus insect-related proteins, PirAB) toxin was initially found in the Photorhabdus luminescens TT01 strain and has been shown to be a binary toxin with high insecticidal activity. Based on GenBank data, this gene was also found in the Xenorhabdus nematophila genome sequence. The predicted amino acid sequence of pirA and pirB in the genome of X. nematophila showed 51% and 50% identity with those gene sequences from P. luminescens. The purpose of this experiment is to identify the relevant information for this toxin gene in X. nematophila. The pirA, pirB and pirAB genes of X. nematophila HB310 were cloned and expressed in Escherichia coli BL21 (DE3) using the pET-28a vector. A PirAB-fusion protein (PirAB-F) was constructed by linking the pirA and pirB genes with the flexible linker (Gly) 4 DNA encoding sequence and then efficiently expressed in E. coli. The hemocoel and oral insecticidal activities of the recombinant proteins were analyzed against the larvae of Galleria mellonella. The results show that PirA/B alone, PirA/B mixture, co-expressed PirAB protein, and PirAB-F all had no oral insecticidal activity against the second-instar larvae of G. mellonella. Only PirA/B mixture and co-expressed PirAB protein had hemocoel insecticidal activity against G. mellonella fifth-instar larvae, with an LD 50 of 2.718μg/larva or 1.566μg/larva, respectively. Therefore, we confirmed that PirAB protein of X. nematophila HB310 is a binary insecticidal toxin. The successful expression and purification of PirAB laid a foundation for further studies on the function, insecticidal mechanism and expression regulation of the binary toxin. Copyright © 2017 Elsevier Inc. All rights reserved.
ORF Alignment: NC_003317 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available ... regulator, internal deletion [Caulobacter crescentus ... CB15] pir||A87693 transcription regulato... NC_003317 gi|17988031 >1etoB 1 97 211 307 4e-07 ... ref|NP_422373.1| transcriptional regulator, internal delet...r, internal ... deletion [imported] - Caulobacter crescentus ... Len...ion [Caulobacter ... crescentus CB15] gb|AAK25541.1| transcriptional ...
ORF Alignment: NC_002696 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available ... regulator, internal deletion [Caulobacter crescentus ... CB15] pir||A87693 transcription regulato... NC_002696 gi|16127809 >1etoB 1 97 211 307 4e-07 ... ref|NP_422373.1| transcriptional regulator, internal delet...r, internal ... deletion [imported] - Caulobacter crescentus ... Len...ion [Caulobacter ... crescentus CB15] gb|AAK25541.1| transcriptional ...
ORF Alignment: NC_004431 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available NC_004431 gi|26247437 >1j9iA 1 68 1 68 7e-21 ... ref|NP_753477.1| Prophage Qin DNA packaging... protein NU1 homolog [Escherichia coli ... CFT073] gb|AAN80037.1| Prophage Qin DNA packaging ... ...teriophage ... 21] pir||A49849 DNA-packaging protein Nu1 - phage 21 ...
NCBI nr-aa BLAST: CBRC-XTRO-01-2365 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-XTRO-01-2365 ref|YP_177980.1| PE-PGRS FAMILY PROTEIN [Mycobacterium tuberculosis... H37Rv] pir||A70807 hypothetical glycine-rich protein Rv3511 - Mycobacterium tuberculosis (strain H37RV) e...mb|CAE55605.1| PE-PGRS FAMILY PROTEIN [Mycobacterium tuberculosis H37Rv] YP_177980.1 0.17 36% ...
NCBI nr-aa BLAST: CBRC-GGAL-35-0050 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-GGAL-35-0050 ref|YP_177980.1| PE-PGRS FAMILY PROTEIN [Mycobacterium tuberculosis... H37Rv] pir||A70807 hypothetical glycine-rich protein Rv3511 - Mycobacterium tuberculosis (strain H37RV) e...mb|CAE55605.1| PE-PGRS FAMILY PROTEIN [Mycobacterium tuberculosis H37Rv] YP_177980.1 2e-18 33% ...
ORF Alignment: NC_002162 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available ... antitermination factor [Ureaplasma parvum serovar 3 str. ... ATCC 700970] pir||A82874 tran...scription antitermination ... factor UU581 [imported] - Ureaplasma urealyt...icum ... Length = 137 ... Query: 24 ... HQWYIVTVVSGNEQKVIENIKDKLNGYGYGDKLSDLXXXXXXXXXXXXYEPSEAPRSMKN 83 ... ... ... HQWYIVTVVSGNEQKVIENIKDKLNGYGYGDKLSDL ... YEPSEAPRSMKN Sbjct: 1 ... HQWYIVTVVSGNEQKVIENIKDKLNGYG... NC_002162 gi|13358146 >1nz8A 2 112 24 160 9e-13 ... ref|NP_078420.1| transcription an
Directory of Open Access Journals (Sweden)
A.I.I. Cardoso
1995-08-01
Full Text Available O objetivo deste trabalho foi determinar a herança de coloração de bulbos de cebola a partir do cruzamento de bulbos brancos com resistência a Colletotrichum gloeosporioides (Mal de 7 voltas segregantes da população Roxa do Barreiro com bulbos amarelos de linhagens endogâmicas obtidas das variedades Super Precoce e Pira Ouro. Para tal obtiveram-se as gerações F1 e F2 entre (Super Precoce x Barreiro "Branca" e entre (Pira Ouro x Barreiro "Branca". Nas gerações F1 obtiveram-se apenas bulbos roxos, enquanto que nas gerações F2 obtiveram-se uma segregação para bulbos roxos, brancos e amarelos numa proporção aproximada de 9:4:3, o que permitiu concluir que a herança, para estes cruzamentos, foi devida a 2 pares de genes contrastantes nas populações progenitoras, cujos genótipos, com base na literatura, são: ii cc RR (Barreiro Branca e ii CC rr (linhagens de Super Precoce e de Pira Ouro. Conclui-se, também, que é possível, a partir destes cruzamentos, obter uma variedade ou linhagem com resistência a C. gloeosporioides somente com bulbos amarelos ou com bulbos brancos com genótipo homozigoto recessivo para todos os genes, que quando cruzada com outra amarela pode-se obter uma geração F1 com bulbos amarelos e com resistência a C. gloeosporioides.The inheritance of onion bulb color was studied utilizing white bulbs resistant to Colletotrichum gloeosporioides that segregated from the population 'Roxa do Barreiro' and two inbred Unes with yellow bulbs originated from 'Super Precoce" and 'Pira Ouro' cultivars. The white bulbs and the inbred Unes were crossed to obtain the F1 and F2 generations (yellow x white. Both F1 generations were of red bulbs and in the F2 generation there were segregations to red, white and yellow bulbs in a proportion of 9:4:3, respectively. It was concluded that the inheritance of bulb color in these crosses is controlled by two contrasting genes hi the parental (ii cc RR = white bulbs, ii CC rr
Selection for bulb maturity in onion Seleção para maturidade de bulbos em cebola
Directory of Open Access Journals (Sweden)
Antonio Ismael Inácio Cardoso
2003-02-01
Full Text Available It is possible to produce onions (Allium cepa all over the year in Brazil, but most of the Brazilian cultivars have poor quality bulbs, a fact that favours onion imports from Argentina, a producer of Valenciana type cultivars that does not bulb in Brazil, but please Brazilian consumers. To study the effect of selection for bulb maturity, seventeen half sib progenies selected for early maturity and twenty five for late maturity, from the intervarietal triple cross [Crioula x (Pira Ouro x Valenciana Sintetica 14] were grown, along with the triple cross itself and the cultivars Pira Ouro (short-day, Crioula (intermediate-day and Armada (long-day. A total of forty six treatments were tested in a randomized block design with three replications of 32 plants per plot. The progenies selected for earliness had cycles from 67 to 83 days, whereas those selected for lateness had cycles of 85 to 103 days. This difference was evident when comparisons were made for the percent thick neck bulbs, which varied from 0 to 6.2% and from 8.1 to 59.8% for the early and late progenies, respectively. High heritability estimates were obtained for all characters and they varied from 0.65 (thick neck percentage, in the late selection to 0.80 (average bulb weight, in the early selection. Progenies of higher bulb weight and maturity similar to the standard cultivars were obtained. Selection for maturity was highly efficient and the population selected for early maturity has potential to originate adapted cultivars, with bulb yield and quality superior to the available cultivars.Embora seja possível produzir cebola (Allium cepa o ano inteiro no Brasil, a maioria dos cultivares nacionais apresentam bulbos com baixa qualidade, o que proporcionou grande importação de cebola da Argentina, do tipo Valenciana, que não bulbifica no Brasil, mas que agradou os consumidores brasileiros. Para estudar o efeito da seleção para maturidade de bulbos baseada em progênies de meios irm
Directory of Open Access Journals (Sweden)
Wesley Saldanha Nogueira Oliveira
2016-12-01
Full Text Available RESUMO. Este trabalho apresenta os resultados iniciais da comparação de alguns parâmetros de funcionamento do protótipo de uma turbina de ação simples, operando com ar comprimido como fluido de trabalho, realizados na unidade do SENAI de Barra do Piraí/RJ. O protótipo foi desenvolvido integralmente no Centro Universitário Geraldo Di Biase - UGB - Campus de Barra do Piraí/RJ, que inicialmente teve como o fluido de trabalho o vapor d’água, que nos testes inicias se mostrou ineficiente. A simulação computacional do sistema foi feita através do software SolidWorks na Universidade Federal Fluminense - UFF - Campus de Volta Redonda/RJ, o que permitiu determinar a faixa de trabalho que apresentou maior eficiência nos resultados experimentais do sistema por meio da relação entre pressão de operação, velocidade angular transmitida pelo fluido ao eixo da turbina e a potência da mesma. Os valores nas simulações em velocidade tangencial na região rotacional apresentaram-se convergentes aos valores experimentais medidos no protótipo.
Directory of Open Access Journals (Sweden)
Soltis Pamela S
2009-06-01
Full Text Available Abstract Background Polyploidy (whole-genome duplication is an important speciation mechanism, particularly in plants. Gene loss, silencing, and the formation of novel gene complexes are some of the consequences that the new polyploid genome may experience. Despite the recurrent nature of polyploidy, little is known about the genomic outcome of independent polyploidization events. Here, we analyze the fate of genes duplicated by polyploidy (homoeologs in multiple individuals from ten natural populations of Tragopogon miscellus (Asteraceae, all of which formed independently from T. dubius and T. pratensis less than 80 years ago. Results Of the 13 loci analyzed in 84 T. miscellus individuals, 11 showed loss of at least one parental homoeolog in the young allopolyploids. Two loci were retained in duplicate for all polyploid individuals included in this study. Nearly half (48% of the individuals examined lost a homoeolog of at least one locus, with several individuals showing loss at more than one locus. Patterns of loss were stochastic among individuals from the independently formed populations, except that the T. dubius copy was lost twice as often as T. pratensis. Conclusion This study represents the most extensive survey of the fate of genes duplicated by allopolyploidy in individuals from natural populations. Our results indicate that the road to genome downsizing and ultimate genetic diploidization may occur quickly through homoeolog loss, but with some genes consistently maintained as duplicates. Other genes consistently show evidence of homoeolog loss, suggesting repetitive aspects to polyploid genome evolution.
African Journals Online (AJOL)
Palacio-Grüber, Jose · Palacio-Gruber, Jose · Parga-Lozano, C · Perrin, P · Phylactou, LA · Piras, IS 1 - 6 of 6 Items. ISSN: 1737-8176. AJOL African Journals Online. HOW TO USE AJOL... for Researchers · for Librarians · for Authors · FAQ's · More about AJOL · AJOL's Partners · Terms and Conditions of Use · Contact AJOL ...
An End to the Troubles: Unionism, Nationalism and the Path to Peace
2006-12-01
Nationalist community but also provided a viable alternative to the violence espoused by the PIRA.14 The policy of abstentionism was not without risk...revolutionary socialism; and the continuation of the policy of abstentionism was hindering the party’s ability to achieve political change on its terms...NAVAL POSTGRADUATE SCHOOL MONTEREY, CALIFORNIA THESIS Approved for public release: distribution is unlimited AN END TO THE
2008-05-22
Prior to the 1980s, politicians aligned with the PIRA conducted an activity called “ abstentionism ,” which meant that they participated in elections... The Prachanda Path and Óglaigh na hÉireann: A Comparative Case Study of the Insurgencies in Nepal and Northern Ireland A Monograph by MAJOR...burden for this collection of information is estimated to average 1 hour per response, including the time for reviewing instructions, searching existing
Sun, T; Liu, Z Y; Qin, L P; Long, R J
2015-01-01
In order to describe grasshopper (Orthoptera: Acrididae) species composition, diversity, abundance, and density of four rangelands types, we compared the grasshopper community composition and dynamics in the rangeland of the northern slopes of the Qilian Mountains. In total, 55 grasshopper species were collected from 2007 to 2009, representing three families and six subfamilies. The subfamily Oedipodinae was dominant, followed by Gomphocerinae and Catantopinae. Species abundance varied among rangeland types (RTs). The greatest abundance of grasshoppers was found in mountain rangeland, while the lowest abundance of grasshoppers was caught in alpine shrublands. Three species (Chorthippus cf. brunneus (Thunberg) (Acrididae), Chorthippus Dubius (Zubovski), and Gomphocerus licenti (Chang) were broadly distributed in the four RTs and constituted 7.5% of all grasshoppers collected. Ch. dubius was very abundant in desert rangeland and alpine shrubland. Bryodema dolichoptera Yin et Feng Eremippus qilianshanensis Lian and Zheng, and Filchnerella qilianshanensis Xi and Zheng (Pamphagidae) were endemic to the region of the Qilian Mountains. Species similarity between RTs ranged from 17.8 to 51.6 based on the Renkonen index. Similarly, the Sörensen index indicated a wide separation in species composition among RTs. The abundance of the eight most common species showed obvious differences among RTs and years. On average, mountain rangeland had the highest density values in 2007 and 2008, and alpine shrubland supported the smallest density. The densities in desert and mountain rangeland in 2007 were significantly higher than in 2008, while alpine rangeland and shrublands did not present obvious differences among years. © The Author 2015. Published by Oxford University Press on behalf of the Entomological Society of America.
de Sousa, Diana Nara Ribeiro; Mozeto, Antonio Aparecido; Carneiro, Renato Lajarim; Fadini, Pedro Sergio
2018-02-01
The occurrence, partitioning, and spatio-temporal distribution of seven pharmaceuticals for human use, three steroid hormones and one personal care product were determined in surface water, suspended particulate matter (SPM), and sediment of Piraí Creek and Jundiaí River (Jundiaí River Basin, São Paulo, Brazil). The maximum average detected concentrations of the compounds in the Piraí River samples were contaminants most frequently detected in sediment and SPM samples. Triclosan had the highest average proportion of SPM as opposed to in the aqueous phase (> 75%). Contaminants with acid functional groups showed, in general, a lower tendency to bind to particulate matter and sediments. In addition, hydrophobicity had an important effect on their environmental partitioning. The spatial distribution of contaminants along the Jundiaí River was mainly affected by the higher concentration of contaminants in water samples collected downstream from a sewage treatment plant (STP). The results obtained here clearly showed the importance of the analysis of some contaminants in the whole water, meaning both dissolved and particulate compartments in the water, and that the partitioning is ruled by a set of parameters associated to the physicochemical characteristics of contaminants and the matrix properties of the studied, which need be considered in an integrated approach to understand the fate of emerging chemical contaminants in aquatic environments.
Genetic variants of serum butyrylcholinesterase in Chilean Mapuche Indians.
Acuña, M; Eaton, L; Ramírez, N R; Cifuentes, L; Llop, E
2003-05-01
We estimated the frequencies of serum butyrylcholinesterase (BChE) alleles in three tribes of Mapuche Indians from southern Chile, using enzymatic methods, and we estimated the frequency of allele BCHE*K in one tribe using primer reduced restriction analysis (PCR-PIRA). The three tribes have different degrees of European admixture, which is reflected in the observed frequencies of the atypical allele BCHE*A: 1.11% in Huilliches, 0.89% in Cuncos, and 0% in Pehuenches. This result is evidence in favor of the hypothesis that BCHE*A is absent in native Amerindians. The frequencies of BCHE*F were higher than in most reported studies (3.89%, 5.78%, and 4.41%, respectively). These results are probably due to an overestimation of the frequency of allele BCHE*F, since none of the 20 BCHE UF individuals (by the enzymatic test) individuals analyzed showed either of the two DNA base substitutions associated with this allele. Although enzymatic methods rarely detect the presence of allele BCHE*K, PCR-PIRA found the allele in an appreciable frequency (5.76%), although lower than that found in other ethnic groups. Since observed frequencies of unusual alleles correspond to estimated percentages of European admixture, it is likely that none of these unusual alleles were present in Mapuche Indians before the arrival of Europeans. Copyright 2003 Wiley-Liss, Inc.
Lopez Siangas, E.I.
2005-01-01
La bioacumulación de mercurio respecto al tamaño, peso y edad, así como la influencia de aspectos biológicos como la alimentación, el crecimiento, la madurez sexual y el sexo, fueron determinadas en seis especies de peces piscívoros y no piscívoros de importancia regional: #Cichla monoculus# (Tucunaré), #Pygocentrus nattereri# (Piraña), #Psedoplatystoma fasciatum# (Surubí), #Plagioscion squamossisimus# (Corvina), #Colosoma macropomum# (Pacú) y #Piaractus brachypomus# (Tambaquí), en las cuenca...
Stepanić, Gorana
2015-01-01
Članak se bavi figuralnim pjesmama (carmina figurata) na hrvatskom i latinskom u dubrovačkom pjesništvu 16. stoljeća. Nakon uvodnog osvrta na žanr tehnopegnija i terminoloških objašnjenja rekapitulira se dosadašnje znanje o primjerima figuralne poezije kod Dinka Ranjine (Dubrovnik, 1536 – Dubrovnik, 1607) te portugalskog humanista Didaka Pira (Évora, 1517 – Dubrovnik, 1599). Analiziraju se, korigiraju i nadopunjuju studije posvećene Ranjininoj hrvatskoj pjesmi u obliku strijele (Pavličić) i k...
Directory of Open Access Journals (Sweden)
Varón de Agudelo Francia
1988-06-01
Full Text Available Se dividió la parte plana del Valle del Cauca en tres zonas (norte, centro y sur, habiéndose visitado 33 fincas. En la zona norte las malezas con mayor porcentaje de frecuencia y distribución en los cultivos de soya fueron Digitaria horizontalis, Echinochloa colonum y Leptochloa filiformis; en la zona centro Ipomoea hirta, Amaranthus dubius y Echinochloa colonum y en la zona sur predominaron Ipomoea hirta, Portulaca oleracea Cyperus rotundus. Los análisis de muestras de suelo y raíces indicaron que H. glycines se encuentra distribuido en todo el Valle del Cauca, presentando la zona sur (Candelaria, Palmira y Puerto Tejada las mayores poblaciones. Entre las especies evaluadas (malezas, cultivos, leguminosas forrajeras y silvestres, solamente Glycine max y Phaseolus vulgaris se consideraron como susceptibles a H. glycines raza 3. y P. angularis y P. multiflora permitieron muy poca infección y multiplicación del nemátodo.A nematode recognition of Heterodera glycines was focused on crops of soybean. Valle del Cauca was divided in three zones (northen, central and southern and 33 farms were visited. The results of the analysis on samples of soils and roots showe that Heterodera glycines is scattered throughout Valle del Cauca, being the southern zone (Palmira, Candelaria and Puerto Tejada the one having the highest standards in nematode population. Weeds showing a greater frequency percentage were : Digitaria horizontalis, Echinochloa colonum and Leptochloa filiformis, in the northen zone; Ipomoea hirta, Amaranthus dubius and Echinochloa colonum, in the central zone, and Ipomoea hirta, Portulaca oleracea and Cyperus rotundus, in the southern zone , From among the whole species evaluated (weeds, crops, leguminous a n d fodder plants, Glycine max and Phaseolus vulgaris were considered to be susceptible to H. Glycines race 3. Phaseolus angularis y P. multiflora let low population levels.
Two New and Four Unrecorded Species of Chironomidae (Diptera in Korea
Directory of Open Access Journals (Sweden)
Han-Il Ree
2012-01-01
Full Text Available Chironomid adults attracted to the light were collected at Dangsan-ri, Muju-eup, Muju-gun, Jeollabuk-do in 2008-2009. Two new species, Lymnophyes parakitanaides sp. nov. and Parakiefferiella mujuensis sp. nov., and four unrecorded species, Cardiolcladius capusinus, Thienemanniella vittata, Conchapelopia pallidula, and Nilotanypus dubius were found and are described with illustrations. The genera Thienemanniella and Nilotanypus have not been previously reported in Korea. The genus Thienemanniella which belongs to Orthocladiinae is characterized by the radial sector retracted and apically fused with the costa, and the genus Nilotanypus which belongs to Tanypodinae is characterized by the absence of R2+3, pubescent eyes and lack of the gonocoxal lobes.
Han, Jee Eun; Tang, Kathy F. J.; Tran, Loc H.; Lightner, Donald V.
2016-01-01
The 69 kb plasmid pVPA3-1 was identified in Vibrio parahaemolyticus strain 13-028/A3 that can cause acute hepatopancreatic necrosis disease (AHPND). This disease is responsible for mass mortalities in farmed penaeid shrimp and is referred to as early mortality syndrome (EMS). The plasmid has a GC content of 45.9% with a copy number of 37 per bacterial cell as determined by comparative quantitative PCR analyses. It consists of 92 open reading frames that encode mobilization proteins, replication enzymes, transposases, virulence-associated proteins, and proteins similar to Photorhabdus insect-related (Pir) toxins. In V. parahaemolyticus, these Pir toxin-like proteins are encoded by 2 genes ( pirA- and pirB-like) located within a 3.5 kb fragment flanked with inverted repeats of a transposase-coding sequence (1 kb). The GC content of these 2 genes is only 38.2%, substantially lower than that of the rest of the plasmid, which suggests that these genes were recently acquired. Based on a proteomic analysis, the pirA-like (336 bp) and pirB-like (1317 bp) genes encode for 13 and 50 kDa proteins, respectively. In laboratory cultures of V. parahaemolyticus 13-028/A3, both proteins were secreted into the culture medium. We developed a duplex PCR diagnostic method, with a detection limit of 105 CFU ml−1 and targeting pirA- and pirB-like genes in this strain of V. parahaemolyticus. This PCR protocol can reliably detect AHPND-causing strains of V. parahaemolyticus and does not cross react with non-pathogenic strains or with other species of Vibrio isolated from shrimp ponds. PMID:25667334
L. P. Canellas; A. A. Moraes; V. M. Rumjanek; M. R. Garcia; F. Guridi; G. A. Santos; A. C. X. Velloso; R. Braz-Filho
2002-01-01
Foram avaliadas as alterações nas características estruturais de ácidos húmicos (AH) decorrentes da adição de matéria orgânica de resíduos urbanos. Os AH foram extraídos da camada superficial (0-20 cm) de um Argissolo Vermelho-Amarelo (Seropédica, RJ) e de um Latossolo Vermelho Amarelo (Piraí, RJ), ambos tratados com o equivalente a 80 t ha-1 (em base seca) de composto de lixo urbano e lodo de estação de tratamento de esgotos. O tempo de incubação em laboratório foi de 24 semanas à temperatur...
La configuración de un modelo : los catafalcos madrileños durante el reinado de Felipe V
Directory of Open Access Journals (Sweden)
Victoria Soto Caba
1989-01-01
Full Text Available En el último tercio del siglo xvii la tendencia decorativista y la variedad tipológica fueron las características más acusadas de los aparatos provisionales de las exequias reales. Las tradiciones locales y los talleres barrocos mantuvieron ambos rasgos durante gran parte de la centuria siguiente. El tapizado ornamental recubrió túmulos en forma de torre, pira, templetes, baldaquinos... Estas estructuras heredadas apenas dejaron sitio para nuevas variantes arquitectónicas, por lo que se puede decir que el siglo xviii, al menos la primera mitad, contribuyó muy poco en el enriquecimiento del repertorio tipológico de los catafalcos reales.
Silvio Júlio de Rezende Chagas; Geraldo Milanez de Resende; Lair Victor Pereira
2004-01-01
Com o objetivo de determinar a composição físico-química e química de cultivares de cebola (Allium cepa L.), conduziu-se um ensaio na Fazenda Experimental de Lavras da EPAMIG, Lavras-MG, no período de março a setembro de 1995. O delineamento experimental foi de blocos ao acaso com quatro repetições e 6 tratamentos, constituídos pelas cultivares Baia Periforme, Crioula, Granex 33, Pira Ouro, Jubileu e Texas Grano 502. Após a cura, avaliaram-se o pH, sólidos solúveis e totais (%), acidez titulá...
Características qualitativas de cultivares de cebola no sul de Minas Gerais
Chagas, Silvio Júlio de Rezende; Resende, Geraldo Milanez de; Pereira, Lair Victor
2004-01-01
Com o objetivo de determinar a composição físico-química e química de cultivares de cebola (Allium cepa L.), conduziu-se um ensaio na Fazenda Experimental de Lavras da EPAMIG, Lavras-MG, no período de março a setembro de 1995. O delineamento experimental foi de blocos ao acaso com quatro repetições e 6 tratamentos, constituídos pelas cultivares Baia Periforme, Crioula, Granex 33, Pira Ouro, Jubileu e Texas Grano 502. Após a cura, avaliaram-se o pH, sólidos solúveis e totais (%), acidez titulá...
Application of iterative reconstruction in dynamic studies
International Nuclear Information System (INIS)
Meikle, S.R.
1998-01-01
Full text: The conventional approach to analysing dynamic tomographic data (SPECT or PET) is to reconstruct projections corresponding to each time interval separately and then fit a suitable tracer kinetic model to the dynamic sequence (method 1 ) . This approach assumes that the tracer distribution remains static during any given time interval and, for practical reasons, filtered back-projection (FBP) is the preferred reconstruction algorithm. However, alternative approaches exist which lend themselves to iterative algorithms, such as EM. One approach is to fit the model directly to the projection data, followed by EM reconstruction of the parameter estimates (method 2). This requires that the tracer model can be expressed as a linear function of the unknown model parameters. A third alternative is to incorporate the tracer model into the reconstruction algorithm (method 3). Such an extension was described during the early development of the EM algorithm, referred to as the EM parametric image reconstruction algorithm (EM-PIRA). We have investigated these various strategies for analysing dynamic data and their relative pros and cons. Tracer modelling was performed using a general model, referred to as spectral analysis, which makes no restriction on the number of physiological compartments and satisfies the linearity requirement of method 2. A kinetic software phantom was created and used to test the convergence and noise properties of the different approaches. In summary, method 2 is the most practical as it reduces the number of reconstructions by at least an order of magnitude and provides improved signal-to-noise ratios compared with method 1. EM-PIRA allows greater flexibility in the choice of parametric images and appears to have a regularising effect on convergence. Methods 2 and 3 are also better suited to dynamic scanning with a rotating camera, as they can potentially account for changes in tracer distribution between projections
Noble, P. J.; Van de Vijver, B.; Verleyen, E.; Prygiel, J.; Ivanovsky, A.; Lesven, L.; Billon, G.
2016-12-01
Diatom analysis was conducted on lake sediments in la Chaîne des Lacs (CDL), a shallow eutrophic urban park and storm control system in Villeneuve d'Ascq, France, to address both the present day water quality, and the evolution of this urban system over its 40 year history. The main lake, Lac du Héron (LDH), received recent attention because of water quality problems, including eutrophication, harmful algal blooms, and invasion by the macrophyte Elodea in 2012. A total of 17 sites were collected in CDL, 11 of which were in LDH, to document spatial variability, and a 26cm long core addresses historical changes. The bulk of the diatom assemblage in LDH can be classified as both eutrophic and moderately metal tolerant, using modern national diatom indices developed and used by the French regional water agencies. Surface sediment samples within LDH show large spatial variations in %Cocconeis placentula whose habitat is epiphytic growth on Elodea. Other variation is reflected in the phytoplankton composition both spatially, and interannually. Aulacoseira muzzanensis and Cyclostephanos dubius showed greater abundance in the open water habitats in LDH, whereas sites in CDL outside of LDH had greater Cyclotella meneghiniana. Temporally, Stephanodicsus (largely S. hantzschii), the dominant diatom in early spring, were present in greater abundances in the 2016 surface sediment samples than in any of the 2015 samples. One possible explanation is that the 2016 samples, taken March 30th, preferentially preserved the early spring Stephanodiscus bloom, in contrast to the 2015 samples, which were taken in January. The sediment core provides an historical record, where the uppermost 4cm plot with the bulk of the LDH surface samples and contain abundant Cocconeis, 4 -14cm is phytoplankton-rich, largely Cyclostephanos dubius and Aulacoseira muzzanensis, and represents a less weed-choked environment prior to the 2012 Elodea invasion. The base of the core is dominated by Amphora and
Directory of Open Access Journals (Sweden)
Zilene Moreira Pereira
2012-01-01
Full Text Available The study investigates elementary students’ perception of the species Achatina fulica (African snail and the risks this mollusc may pose to the population of Barra do Piraí – in the state of Rio de Janeiro. The research involved questionnaires, focus groups and field observations, besides A. fulica specimens parasitological analysis. The results indicated the presence of snails infected with nematodes of medical and veterinary interest in the locality. The students have a negative perception of the snail, and there is great difference between their perceptions and scientific knowledge. Based on the contributions of the perceptions study and of Meaningful Learning Theory, guidelines are suggested so that strategies for teaching the content regarding the African snail at school environment can be developed.
Czech Academy of Sciences Publication Activity Database
Cepáková, E.; Šálek, M.; Cepák, J.; Albrecht, Tomáš
2007-01-01
Roč. 54, č. 2 (2007), s. 284-288 ISSN 0006-3657 Institutional research plan: CEZ:AV0Z60930519 Keywords : Edge effect * Habitat fragmentation * Little Ringed Plover * Nest predation Subject RIV: EH - Ecology, Behaviour Impact factor: 0.880, year: 2007 http://www.ingentaconnect.com/content/bto/ bird /2007/00000054/00000002/art00019
Schockaert, Ernest R; Martens, Paul M; Revis, Nathalie; Janssen, Toon; Willems, Wim; Artois, Tom J
2014-01-22
Five new species of the new taxon Brunetorhynchus n. gen. are described: B. deconincki n. sp., B. microstylis n. sp. and B. complicatus n. sp. are from the Mediterranean, B. canariensis n. sp. is from the Canary Island Lanzarote, B. cannoni n. sp. is from the Australian East coast and one species from the Galapagos, formerly described as Limipolycystis spec., is transferred to the new genus as B. dubius n. sp.. As in Limipolycystis, these species have a single stylet, (accessory stylet type II), an accessory secretion vesicle (type II) and a prostate vesicle (type III) in the male atrium, although the latter vesicle is absent in some species. Unlike the species of Limipolycystis, where the seminal receptacle is a sclerotized tubule, the species of the new taxon have a pear-shaped seminal receptacle on the oviduct.
Directory of Open Access Journals (Sweden)
SF Blat
2011-03-01
Full Text Available Este trabalho foi desenvolvido em Ribeirão Preto-SP, de 06/02 a 07/04 de 2006. O objetivo foi avaliar o desempenho de cinco cultivares de alface (Pira Roxa, Belíssima, Locarno, Crespona Gigante e Verônica em dois ambientes de cultivo (casa de vegetação climatizada e não climatizada em sistema hidropônico NFT. O delineamento experimental foi em blocos casualizados para cada ambiente com três repetições sendo cinco cultivares. Os ambientes foram comparados por meio de análise conjunta. Avaliaram-se a massa fresca e seca da parte aérea, massas fresca e seca do caule, massa fresca e seca da raiz, número de folhas maiores que 10 cm e número total de folhas. Não houve efeito significativo da interação cultivares e ambientes, demonstrando que as cultivares tiveram comportamento similar em ambos os ambientes.This research was carried out in Ribeirão Preto, São Paulo State, Brazil, from February to April, 2006. The performance of five lettuce cultivars (Pira Roxa, Belíssima, Locarno, Crespona Gigante and Verônica was evaluated, growing the plants in two environments (conventional and acclimatized greenhouse in hydroponic system NFT. A randomized-block experimental design was used for each environment, with three replications and five cultivars. The environments were compared through joint analysis. Evaluations were done for fresh and dry mater of the aboveground part, stem, and roots; number of leaves larger than 10 cm and total number of leaves. The cultivars Crespona Gigante and Verônica were prominent with regard to green and dry mass of the aboveground part, leaves, and roots, as well as to the number of leaves larger than 10 cm. The interaction cultivar x environment was not significant, demonstrating that the cultivars had similar behavior in both environments.
Directory of Open Access Journals (Sweden)
Z. Piana
1994-12-01
Full Text Available Objetivando verificar a influência do teor de água do substrato na germinação de sementes de cebola (Allium cepa L., conduziu-se um ensaio sob condições de ambiente de laboratório. Os efeitos de cinco níveis de água no substrato solo x areia (3:1, 20, 40, 60, 80 e 100% da capacidade de retenção foram avaliados através da porcentagem de emergência no 14° dia da semeadura e pesos da matéria verde e seca das plântulas normais. Para tanto, 200 sementes do cultivar Pira Ouro por tratamento, em quatro repetições de 50, foram semeadas a 1,5 cm de profundidade, mantendo-se constantes os níveis de água no substrato. Os resultados possibilitaram concluir que os níveis de umidade do solo indicados para germinação de sementes de cebola são de 40% e 60% da capacidade de retenção do substrato, por possibilitarem uma melhor emergência, peso da matéria verde e seca das plântulas.One essay was conducted under laboratory conditions, in order to verify the influence of substrate water content on the germination of onion (Allium cepa L. seeds. The effect of five water levels in the medium soil x sand (3:1 - 20, 40, 60, 80 and 100% retention capacity-were evaluated through the emergence percentage 14 days after seedling and the weight of fresh and dry matters of normal seedlings. For that purpose, 200 treated seeds of Pira Ouro cultivar were sown 1.5 cm deep in four replicátions of 50, with a constant water content in the medium. The best results showed that the soil moisture levels suggested for the germination of onion seeds were 40% to 60% of the substrate retention capacity, once they provide better emergence, weight of the fresh and dry matters of seedlings.
Directory of Open Access Journals (Sweden)
Ratchanok Sirikharin
Full Text Available Unique isolates of Vibrio parahaemolyticus (VPAHPND have previously been identified as the causative agent of acute hepatopancreatic necrosis disease (AHPND in shrimp. AHPND is characterized by massive sloughing of tubule epithelial cells of the hepatopancreas (HP, proposed to be induced by soluble toxins released from VPAHPND that colonize the shrimp stomach. Since these toxins (produced in broth culture have been reported to cause AHPND pathology in reverse gavage bioassays with shrimp, we used ammonium sulfate precipitation to prepare protein fractions from broth cultures of VPAHPND isolates for screening by reverse gavage assays. The dialyzed 60% ammonium sulfate fraction caused high mortality within 24-48 hours post-administration, and histological analysis of the moribund shrimp showed typical massive sloughing of hepatopancreatic tubule epithelial cells characteristic of AHPND. Analysis of the active fraction by SDS-PAGE revealed two major bands at marker levels of approximately 16 kDa (ToxA and 50 kDa (ToxB. Mass spectrometry analysis followed by MASCOT analysis revealed that both proteins had similarity to hypothetical proteins of V. parahaemolyticus M0605 (contig034 GenBank accession no. JALL01000066.1 and similarity to known binary insecticidal toxins called 'Photorhabdus insect related' proteins A and B (Pir-A and Pir-B, respectively, produced by the symbiotic, nematode bacterium Photorhabdus luminescens. In in vivo tests, it was shown that recombinant ToxA and ToxB were both required in a dose dependent manner to cause AHPND pathology, indicating further similarity to Pir-A and -B. A single-step PCR method was designed for detection of the ToxA gene and was validated using 104 bacterial isolates consisting of 51 VPAHPND isolates, 34 non-AHPND VP isolates and 19 other isolates of bacteria commonly found in shrimp ponds (including other species of Vibrio and Photobacterium. The results showed 100% specificity and sensitivity for
[The issue of medico-legal assessment of noise induced hearing loss: comparison of methods].
Bosio, D; Coggiola, M; Baracco, A; Andreis, P; Perrelli, F
2011-01-01
Audiogram classification is crucial for hearing protection of workers occupationally exposed to noise. The methods that have been proposed are based on two principles: the morphological evaluation of the audiometric curve (eg. Merluzzi-Pira-Bosio--MPB) or the average hearing loss on different frequencies (eg. Albera-Beatrice--AB). The purpose of this study was to classify audiograms compatible with chronic acoustic trauma performed at the Occupational Medicine Outpatient Clinic of CTO Hospital in Turin from 2004 to 2011 with the methods outlined in Guidelines published by SIMLII. A substantial agreement among the methods was observed. While MPB is the most appropriate method for secondary prevention, the AB would seem more appropriate for the verification of a permanent weakening that has to be reported to the competent legal authorities.
Evidence of spotted fever group rickettsiae in state of Rio de Janeiro, Brazil
Directory of Open Access Journals (Sweden)
ROZENTAL Tatiana
2002-01-01
Full Text Available Ticks were obtained from dogs from February to September of 1999 at weekly intervals, in the County of Piraí, State of Rio de Janeiro. Four hundred seventy four ixodids were taxonomically identified, 103 Amblyomma cajennense, seven Amblyomma ovale, 209 Rhipicephalus sanguineus, and 155 Amblyomma sp. An hemolymph test associated with Giemsa's stain revealed two specimens in 163 ticks tested (R. sanguineus and Amblyomma sp, containing rickettsia-like organisms. Direct immunofluorescence verified the presence of spotted fever group rickettsia in one specimen of R. sanguineus. Considering the limited information on rickettsiosis in Brazil, principally in relation to the vectors involved in perpetuating it in foci, these preliminary results give us an idea on the importance of infection in ticks, allowing to expand our knowledge on this zoonosis.
Edge stability and pedestal profile sensitivity of snowflake diverted equilibria in the TCV Tokamak
International Nuclear Information System (INIS)
Medvedev, S.Yu.; Ivanov, A.A.; Martynov, A.A.; Poshekhonov, Yu.Yu.; Behn, R.; Martin, Y.R.; Moret, J.M.; Piras, F.; Pitzschke, A.; Pochelon, A.; Sauter, O.; Villard, L.
2010-01-01
A second order null divertor (snowflake) has been successfully created and controlled in the TCV tokamak[1] (F. Piras et al., Plasma Phys. Control. Fusion, 2009). The results of ideal MHD edge stability computations show an enhancement of the edge stability properties of the snowflake equilibria compared to standard x-point configurations[2] (S. Yu. Medvedev et al., 36th EPS Conference on Plasma Physics, 2009). However, a sensitivity study of the stability limits to variations of the pedestal profiles is essential for making conclusions about possibilities of ELM control in snowflake plasmas. Variations of the edge stability and beta limits for several types of snowflake equilibria, different values of triangularity and various pedestal profiles are investigated (copyright 2010 WILEY-VCH Verlag GmbH and Co. KGaA, Weinheim) (orig.)
Directory of Open Access Journals (Sweden)
Aricelso Maia LIMAVERDE FILHO
1999-01-01
Full Text Available A perda de mercúrio contido em músculo de peixes (Piraíba, Brachyplatystoma ssp; Traíra, Hoplias malabaricus submetidos a dois distintos processos de cozimento foi investigada. Os resultados mostraram perdas variando entre 0 e 30% (base seca, indicando que a maior parte do mercúrio foi retida. Assim, tais processos não protegem as populações, que deles se utilizam, contra a exposição por ingestão ao mercúrio originariamente contido na amostra "in natura".Mercury losses from flesh fish after two cooking process were investigated. Results showed losses ranging from 0 to 30% (dry weight basis. Such result indicates that fish consuming populations are not protected from mercury exposition by the studied cooking processes.
Directory of Open Access Journals (Sweden)
Elisabete Pimenta Araujo Paz
2011-11-01
Full Text Available Objetivo. Describir los estilos de vida de los pacientes hipertensos atendidos con la Estrategia de Salud de La Familia. Metodología. De octubre de 2009 a enero de 2010, se llevó a cabo un estudio transversal, en el que participaron 273 pacientes hipertensos seleccionados aleatoriamente del programa de salud familiar que atiende tres áreas de Piraí/RJ. Para la recolección de datos se utilizó el cuestionario "Estilo de Vida Fantástico". Resultados. De la muestra de estudio: el 61% eran mujeres, el 56% con 60 y más años, el 81% tenía bajo nivel de educación y 74% con bajos ingresos familiares. Los factores de riesgo más frecuentes fueron El sobrepeso u obesidad (72% y la diabetes mellitus (37%. La calificación del estilo de vida fue: 13% excelente, 55% muy bueno, 27% bueno y regular 4%. Conclusión. Aunque el estilo de invida se consideró satisfactorio, las condiciones socioeconômicas y el perfil de salud indican la persistencia de factores de riesgo de enfermedad cardiovascular.Objetivo. Descrever os estilos de vida dos pacientes hipertensos atendidos com a estratégia de Saúde Familiar. Metodologia. De outubro de 2009 a janeiro de 2010, levou-se a cabo um estudo transversal, no que participaram 273 pacientes hipertensos selecionados aleatoriamente do programa de Saúde Familiar que atende três áreas de Piraí/RJ (Brasil. Para a colheita de dados se utilizou o questionário "Estilo de Vida Fantástico". Resultados. Da mostra de estudo: o 61% eram mulheres, o 56% tinha 60 e mais anos, o 81% possuía sob nível de educação e 74% reportou ter baixos rendimentos familiares. Os fatores de risco mais frequentes foram o sobrepeso ou obesidade (72% e a diabete mellitus (37%. A qualificação do estilo de vida foi: 13% excelente, muito bom 55%, bom 27% e regular 4%. Conclusão. Ainda que o estilo de vida se considerou satisfatório, as condições e o perfil de saúde indicam a persistência de fatores de risco de doen
What I wish I had in my stockroom
Sampere, Samuel
2015-12-01
Most new teachers walk into their new classroom territory and find at least some equipment. Perhaps there are items there that you don't recognize. One way to get those types of questions answered is to post a question and/or picture on the TAP-L (Teaching Apparatus List) listserv (see: http://www.pira-online.org for more information). Within a few short minutes, the sender will receive at least a couple of responses. But what if a new teacher walks into a totally empty prep room? Now that teacher is tasked with purchasing useful equipment, and we know that the opportunity for a similar acquisition in the near future is slim. So you better choose wisely! Whether my new stockroom is well equipped or completely empty, I would make sure to have the following six items in my arsenal.
The Provisional Irish Republican Army and the Development of Mortars
Directory of Open Access Journals (Sweden)
Gary Ackerman
2016-03-01
Full Text Available The Provisional Irish Republican Army (PIRA repeatedly showed itself to be one of the most inventive and adaptive of all the violent non-state actors who operated in the latter part of the twentieth century. Among its most innovative exploits was the PIRA’s successful development and fielding – spanning almost its entire operational lifetime – of improvised mortar systems. This chapter will trace the sustained development of mortars, including the underlying motivations for pursuing mortars as a complex engineering effort, the process by which the development took place and the underpinnings of its success. The discussion will show that the PIRA’s mortar development program was born out of tactical necessity but enabled by good organizational practices and the organization’s access to materials, expertise and places in which to leverage these.
Directory of Open Access Journals (Sweden)
Maria do Desterro M dos Santos
2012-03-01
Full Text Available Onion is a crop of significant socioeconomic importance to Brazil. Onion germplasm with adaptation to tropical and sub-tropical conditions has played an important role in the development of this crop in the country. In this context, we studied the genetic diversity in a germplasm collection potentially useful for the development of cultivars for tropical and subtropical regions. The genetic variability of 21 accessions/cultivars that have been used as germplasm and/or were developed by onion breeding programs in Brazil was evaluated via RAPD markers. The following accessions were included in the study :'Red Creole', 'Roxa IPA-3', 'Valenciana 14', 'Beta Cristal', 'Diamante', 'Composto IPA-6', 'Aurora', 'Bojuda Rio Grande', 'Alfa Tropical', 'Pêra IPA-4', 'Primavera', 'Belém IPA-9', 'Crioula Alto Vale', 'Conquista', 'Pira-Ouro', 'Vale-Ouro IPA-11', 'Franciscana IPA-10', 'Serrana', 'CNPH 6400', 'Petroline', and 'Baia Periforme'. From the 520 primers used in the initial screening only 38 displayed stable polymorphisms. They produced 624 amplicons, of which 522 (83.7% were monomorphic and 102 (16.3% were polymorphic. An average similarity coefficient of 0.72 was calculated among accessions based upon this subgroup of polymorphic amplicons. This allowed the discrimination of this germplasm collection into six groups with only one of them comprising more than one accession. The main group was formed by 16 accessions ('Diamante', 'Composto IPA-6', 'Aurora', 'Bojuda Rio Grande', 'Conquista', 'Pira-Ouro', 'Serrana', 'Vale-Ouro IPA-11', 'Baia Periforme', 'Primavera', 'Franciscana IPA-10', 'Belém IPA-9', 'Crioula Alto Vale', 'Petroline', 'Pêra IPA-4' and 'Alfa Tropical', for which the genetic origin (with few exceptions can be traced back to the variety 'Baia Periforme'. The populations 'Red Creole', 'Roxa IPA-3', 'Beta Cristal', 'CNPH 6400', and 'Valenciana 14' comprised a set of five isolated groups, showing genetic divergence among them and in
Seasonal and interannual variability in grey seal diets on Sable Island, eastern Scotian Shelf
Directory of Open Access Journals (Sweden)
W D Bowen
2007-01-01
Full Text Available We studied seasonal and interannual variability in the diet of grey seals (Halichoerus grypus using faecal samples collected from Sable Island, Nova Scotia between 1991 and 1998. More than 28,000 prey from at least 28 taxa were identified from 1,245 faecal samples collect mainly in spring, fall and winter. Sand lance (Ammodytes dubius dominated the diet in all seasons and years, but the importance of this and other species varied over time. There was also evidence of seasonal and interannual variation in the size of prey consumed both within and among species. We compared diet composition with estimates of prey numbers and biomass from annual researchtrawl surveys conducted in March and July. Species-specific numerical corrections were applied to otolith counts to account for the complete digestion of otoliths, and fish catchability correction factors applied to trawl survey catches to account for trawl selectivity. Based on an odds ratio index of prey selectivity, grey seals positively selected sand lance in both seasons. Other species were either relatively avoided or eaten roughly in proportion to their estimated abundance.
Li, Peng; Kinch, Lisa N; Ray, Ann; Dalia, Ankur B; Cong, Qian; Nunan, Linda M; Camilli, Andrew; Grishin, Nick V; Salomon, Dor; Orth, Kim
2017-07-01
Acute hepatopancreatic necrosis disease (AHPND) is a newly emerging shrimp disease that has severely damaged the global shrimp industry. AHPND is caused by toxic strains of Vibrio parahaemolyticus that have acquired a "selfish plasmid" encoding the deadly binary toxins PirA vp /PirB vp To better understand the repertoire of virulence factors in AHPND-causing V. parahaemolyticus , we conducted a comparative analysis using the genome sequences of the clinical strain RIMD2210633 and of environmental non-AHPND and toxic AHPND isolates of V. parahaemolyticus Interestingly, we found that all of the AHPND strains, but none of the non-AHPND strains, harbor the antibacterial type VI secretion system 1 (T6SS1), which we previously identified and characterized in the clinical isolate RIMD2210633. This finding suggests that the acquisition of this T6SS might confer to AHPND-causing V. parahaemolyticus a fitness advantage over competing bacteria and facilitate shrimp infection. Additionally, we found highly dynamic effector loci in the T6SS1 of AHPND-causing strains, leading to diverse effector repertoires. Our discovery provides novel insights into AHPND-causing pathogens and reveals a potential target for disease control. IMPORTANCE Acute hepatopancreatic necrosis disease (AHPND) is a serious disease that has caused severe damage and significant financial losses to the global shrimp industry. To better understand and prevent this shrimp disease, it is essential to thoroughly characterize its causative agent, Vibrio parahaemolyticus Although the plasmid-encoded binary toxins PirA vp /PirB vp have been shown to be the primary cause of AHPND, it remains unknown whether other virulent factors are commonly present in V. parahaemolyticus and might play important roles during shrimp infection. Here, we analyzed the genome sequences of clinical, non-AHPND, and AHPND strains to characterize their repertoires of key virulence determinants. Our studies reveal that an antibacterial type
PCR-based methods for the detection of L1014 kdr mutation in Anopheles culicifacies sensu lato
Singh, Om P; Bali, Prerna; Hemingway, Janet; Subbarao, Sarala K; Dash, Aditya P; Adak, Tridibes
2009-01-01
Background Anopheles culicifacies s.l., a major malaria vector in India, has developed widespread resistance to DDT and is becoming resistant to pyrethroids–the only insecticide class recommended for the impregnation of bed nets. Knock-down resistance due to a point mutation in the voltage gated sodium channel at L1014 residue (kdr) is a common mechanism of resistance to DDT and pyrethroids. The selection of this resistance may pose a serious threat to the success of the pyrethroid-impregnated bed net programme. This study reports the presence of kdr mutation (L1014F) in a field population of An. culicifacies s.l. and three new PCR-based methods for kdr genotyping. Methods The IIS4-IIS5 linker to IIS6 segments of the para type voltage gated sodium channel gene of DDT and pyrethroid resistant An. culicifacies s.l. population from the Surat district of India was sequenced. This revealed the presence of an A-to-T substitution at position 1014 leading to a leucine-phenylalanine mutation (L1014F) in a few individuals. Three molecular methods viz. Allele Specific PCR (AS-PCR), an Amplification Refractory Mutation System (ARMS) and Primer Introduced Restriction Analysis-PCR (PIRA-PCR) were developed and tested for kdr genotyping. The specificity of the three assays was validated following DNA sequencing of the samples genotyped. Results The genotyping of this An. culicifacies s.l. population by the three PCR based assays provided consistent result and were in agreement with DNA sequencing result. A low frequency of the kdr allele mostly in heterozygous condition was observed in the resistant population. Frequencies of the different genotypes were in Hardy-Weinberg equilibrium. Conclusion The Leu-Phe mutation, which generates the kdr phenotype in many insects, was detected in a pyrethroid and DDT resistant An. culicifacies s.l. population. Three PCR-based methods were developed for kdr genotyping. All the three assays were specific. The ARMS method was refractory to non
Directory of Open Access Journals (Sweden)
Geraldo M. de Resende
2003-12-01
Full Text Available Identificou-se cultivares de cebola mais produtivas através de um ensaio da EPAMIG em Lavras, de março a setembro de 1994. O delineamento experimental foi de blocos ao acaso com quatro repetições e sete tratamentos, constituídos das cultivares Granex 33, Texas Grano 502, Crioula, Pira Ouro, Baia Periforme, Jubileu e Chata Roxa com parcelas de 3,84 m² de área útil. A produtividade de bulbos comerciais variou de 22,58 a 50,21 t/ha, destacando-se as cultivares Granex 33 (50,21 t/ha e Texas Grano 502 (44,36 t/ha que não mostraram diferença significativa entre si. Estas cultivares apresentaram incrementos na produtividade da ordem de 204,3 a 168,8% em relação à média nacional (16,5 t/ha. O mais baixo rendimento foi observado para a cultivar Chata Roxa com 22,58 t/ha. Observaram-se variações de 45,99 a 97,69 g/bulbo para peso médio de bulbo e 5,35 a 7,38 cm para o diâmetro transversal de bulbos.To identify onion cultivars of higher yield for the southern region of Minas Gerais State, Brazil, a field trial from EPAMIG was conducted in Lavras, Brazil, from March to September 1994.The experimental design was randomized complete blocks with four replications and seven treatments: Granex 33, Texas Grano 502, Crioula, Pira Ouro, Baia Periforme, Jubileu and Chata Roxa. The harvesting area of each plot was 3.84 m². The yield of commercial bulbs varied from 22.58 to 50.21 t/ha, and the highest yield was achieved by the cultivars Granex (50.21 t/ha and Texas Grano 502 (44.36 t/ha with no significant difference between them. These cultivars exceeded the national average yield (16.5 t/ha from 204.3 to 168.8%. The lowest yield was shown by the cultivar Chata Roxa (22.58 t/ha. A variation occurred from 45.99 to 97.69 g/bulb and 5.35 to 7.39 cm for the bulb diameter.
PCR-based methods for the detection of L1014 kdr mutation in Anopheles culicifacies sensu lato
Directory of Open Access Journals (Sweden)
Dash Aditya P
2009-07-01
Full Text Available Abstract Background Anopheles culicifacies s.l., a major malaria vector in India, has developed widespread resistance to DDT and is becoming resistant to pyrethroids–the only insecticide class recommended for the impregnation of bed nets. Knock-down resistance due to a point mutation in the voltage gated sodium channel at L1014 residue (kdr is a common mechanism of resistance to DDT and pyrethroids. The selection of this resistance may pose a serious threat to the success of the pyrethroid-impregnated bed net programme. This study reports the presence of kdr mutation (L1014F in a field population of An. culicifacies s.l. and three new PCR-based methods for kdr genotyping. Methods The IIS4-IIS5 linker to IIS6 segments of the para type voltage gated sodium channel gene of DDT and pyrethroid resistant An. culicifacies s.l. population from the Surat district of India was sequenced. This revealed the presence of an A-to-T substitution at position 1014 leading to a leucine-phenylalanine mutation (L1014F in a few individuals. Three molecular methods viz. Allele Specific PCR (AS-PCR, an Amplification Refractory Mutation System (ARMS and Primer Introduced Restriction Analysis-PCR (PIRA-PCR were developed and tested for kdr genotyping. The specificity of the three assays was validated following DNA sequencing of the samples genotyped. Results The genotyping of this An. culicifacies s.l. population by the three PCR based assays provided consistent result and were in agreement with DNA sequencing result. A low frequency of the kdr allele mostly in heterozygous condition was observed in the resistant population. Frequencies of the different genotypes were in Hardy-Weinberg equilibrium. Conclusion The Leu-Phe mutation, which generates the kdr phenotype in many insects, was detected in a pyrethroid and DDT resistant An. culicifacies s.l. population. Three PCR-based methods were developed for kdr genotyping. All the three assays were specific. The ARMS method
Directory of Open Access Journals (Sweden)
Elena Mazzini
2014-04-01
Full Text Available Il contributo punta a ricostruire la genesi e la storia dell’Amicizia ebraico-cristiana di Firenze (AEC, fondata nel capoluogo toscano nel 1950 con l’intento di promuovere un dialogo interreligioso fra ebrei e cristiani all’indomani dell’Olocausto. La periodizzazione proposta prende avvio dalla data della nascita della stessa associazione e si conclude con il 1965, anno della chiusura del Concilio Vaticano II, che decreta prospettive religiose nuove della Chiesa cattolica nei suoi rapporti con l’ebraismo. Nata per volontà di Arrigo Levasti, Giorgio La Pira, Ines Zilli, Giorgio Spini, Giacomo Devoto, Angelo Orvieto e Aldo Neppi Modona, l’Amicizia fiorentina rappresentava la sezione italiana dell’International Council of Christians and Jews e dell’Amitié judéo-chrétienne di Parigi, divenendo presto un luogo di attività feconde per il dialogo interreligioso in età pre-conciliare.
International Nuclear Information System (INIS)
Canduri, R.J.; Ward, R.J.; Azevedo Junior, G.W.F. de; Arni, R.K.; Soares, A.M.; Giglio, J.R.
1997-01-01
Full text. Phospho lipases A2 (PLA 2 ) are small enzymes that specifically hydrolysed the sn-2 ester bond of phospholipids, preferentially in lamellar or micellar aggregates at membrane surfaces. These enzymes are widely distributed in nature and have been extensively studied. Toxic proteins from venoms from Bothrops species include catalytically active PLA 2 s and calcium independent PLA 2L ys 49 homologues. The substitution of Asp49 by Lys greatly diminishes the ability of these PLA 2 to bind calcium, an ion that plays a critical role in the stabilization of the tetrahedral transition state intermediate in the catalytic mechanism. The Lys 49 PLA 2 homologues and therefore catalytically inactive yet maintain cytolytic and myotoxic activities and furthermore retain the ability to disrupt the integrity of both plasma membranes and model lipid bilayers by a poorly understood Ca 2+ independente mechanism. Lys49 PLA 2 homologues demonstrate a specific toxic activity against skeletal muscle, affecting only muscle fibers and leaving other tissue structure such as connective tissue, nerves and vessels essentially unharmed. In order to improve our understanding of the molecular basis of the myotoxic and Ca 2+ -independent membrane damaging activities, we have determined the crystal structure of Pr TX-I, a Lys49 variant from the venom of B. pirajai. The model presented has been determined at 2.8 angstrom resolution and refined to a crystallographic residual of 19.7% (R free =29.7%). (author)
wft4galaxy: a workflow testing tool for galaxy.
Piras, Marco Enrico; Pireddu, Luca; Zanetti, Gianluigi
2017-12-01
Workflow managers for scientific analysis provide a high-level programming platform facilitating standardization, automation, collaboration and access to sophisticated computing resources. The Galaxy workflow manager provides a prime example of this type of platform. As compositions of simpler tools, workflows effectively comprise specialized computer programs implementing often very complex analysis procedures. To date, no simple way to automatically test Galaxy workflows and ensure their correctness has appeared in the literature. With wft4galaxy we offer a tool to bring automated testing to Galaxy workflows, making it feasible to bring continuous integration to their development and ensuring that defects are detected promptly. wft4galaxy can be easily installed as a regular Python program or launched directly as a Docker container-the latter reducing installation effort to a minimum. Available at https://github.com/phnmnl/wft4galaxy under the Academic Free License v3.0. marcoenrico.piras@crs4.it. © The Author 2017. Published by Oxford University Press.
International conference centre, Geneva, Switzerland
PH Department
2009-01-01
On 16-17 March 2009 the Energy Pact Foundation will be holding the Energy Pact Conference in Geneva. The Conference is organised with the support of the Republic and Canton of Geneva and has the Financial Times as its media partner. It will address for the first time in a comprehensive and integrated manner the key issues of energy needs and environmental and developmental challenges. Some 800 stakeholders and experts on these issues are expected. These will include high-level government officials, opinion leaders and representatives from the United Nations, NGOs, industry, civil society and the academic world. Gerhard Schröder, former Chancellor of Germany, will chair the Conference. Speakers with different backgrounds and expertise will include Dr. Carlo Rubia, Nobel Prize Winner, Ali Al-Naimi, Minister of Petroleum and Mineral Resources of Saudi Arabia, Gholam Hossein Nozari, Oil Minister of Iran, Gary Ross, CEO of PIRA Energy, a world-renowned energy market specialist, Ashok Khosla, President of the In...
A BWR Safety and Operability Improvements
International Nuclear Information System (INIS)
Sawyer, Craig D.
1993-01-01
The A BWR is the culmination of 30 years of design, development and operating experience of BWRs around the world. It represents across the board improvements is safety, operation and maintenance practices (O and M), economics, radiation exposure and rad waste generation. More than ten years and $20m5 went into the design and development of its new features, and it is now under construction in Japan. This paper concentrates on the safety and operability improvements. In the safety area, more than a decade improvement in core damage frequency (CDFR) has been assessed by formal PIRA techniques, with CDFR less than 10 -6 /year. Severe accident mitigation has also been formally addressed in the design. Plant operations were simplified by incorporation of better materials, optimum use of redundancy in mechanical and electrical equipment so that on-line maintenance can be performed, by better arrangements which account for required maintenance practices, and by an advanced control room
Periodo de interferencia de arvenses en el cultivo de berenjena (Solanum melongena L.
Directory of Open Access Journals (Sweden)
Aramendiz-Tatis Hermes
2010-04-01
Full Text Available
Dada la importancia de la berenjena en la horticultura del Caribe colombiano, el presente trabajo buscó establecer las bases de un manejo sustentable e integrado de malezas en este cultivo, basado en el período de máxima interferencia de aquellas sobre este. El estudio se realizó en la Universidad de Córdoba, ubicada en Montería (8°39’ N; 75°58’ W. El diseño experimental consistió en bloques completamente aleatorizados, con cuatro repeticiones y siete tratamientos relacionados con periodos crecientes de control de arvenses, seguidos por ausencia de control. Los resultados muestran que las arvenses con mayor presencia fueron paja mona (Leptochloa filiformis [Lam.] Beauv., caminadora (Rottboellia cochinchinensis [Lour.] W.D. Clayton, liendre de puerco (Echinochloa colona [L.] Link., coquito (Cyperus rotundus L. y bledo (Amaranthus retroflexus L.. Las arvenses afectaron la altura de la planta, el diámetro del tallo, y el rendimiento y calidad del fruto. Este último parámetro no se ve afectado cuando el cultivar lila se mantiene limpio durante los primeros 40 días. Al considerar el tipo de productor de esta hortaliza en el valle del Sinú, se sugiere utilizar: i para áreas pequeñas, métodos físicos, como el arranque manual o corte con machete u otra herramienta, y prácticas culturales; ii para áreas grandes, la combinación de herbicidas de presiembra con métodos físicos y culturales.
Directory of Open Access Journals (Sweden)
Humaira ESSACK
Full Text Available Abstract This study investigated the effect of processing on anti-nutritional factors of thirteen traditional leafy vegetables collected in Kwa Zulu-Natal, South Africa. The aim was to determine whether processing reduced anti-nutrient levels of leafy vegetables. The vegetables were boiled in a plant-to-distilled water ratio of 1:4 (w/v at 97 °C for a time period of 5 and 15 min. The vegetables studied were: Amaranthus dubius, Amaranthus hybridus, Asystasia gangetica, Bidens pilosa, Ceratotheca triloba, Chenopodium album, Emex australis, Galinsoga parviflora, Guilleminea densa, Momordica balsamina, Oxygonum sinuatum, Physalis viscosa and Solanum nigrum. From this study, it was determined that non processed samples contained anti-nutrients such as tannins, phytic acid, alkaloids, oxalic acid, and cyanogenic glycoside. Both boiling parameters were effective in reducing the tannin, phytic acid, alkaloid, oxalic acid and cyanogenic glycoside contents of all 13 traditional leafy vegetables. The results of this study provide evidence that the local traditional leafy vegetables which the population is so reliant upon, are important contributors to micronutrient malnutrition in developing countries and can be minimized through common boiling methods for a minimum of 5 and maximum of 15 minutes.
van Grunsven, R.; Yuwati, T.; Kowalchuk, George; van der Putten, W.H.; van Veenendaal, E.
2014-01-01
Background: As a consequence of climate warming, many organisms are shifting their range towards higher latitudes and altitudes. As not all do so at the same speed, this may disrupt biotic interaction. Release from natural enemies through range expansion can result in invasiveness, whereas loss of
Esputos de papel. La historieta ‘underground’ española
Directory of Open Access Journals (Sweden)
Dopico, Pablo
2011-09-01
Full Text Available To know the origin and development of contemporary Spanish comic, we get into the suburbs of visual culture to discover the history of Spanish underground comics. A comic with which, thanks to the relative freedom of expression offered, the counterculture found a versatile vehicle that could express themselves without problems, becoming a new form of social protest and claim it offers an invaluable testimony to the Spanish reality, superior to that afforded other contemporary arts. The text examines the main features, aesthetic aspects and new language of Spanish comix, discovering the main authors (Ceesepe, Gallardo, Mariscal, Max and Nazario, series (Makoki, The Garriris, Gustavo, Anarcoma,... and magazines (El Rrollo Enmascarado, Star, La Piraña Divina, Butifarra!, Los Tebeos del Rrollo, Rock Comix, El Víbora,…, and showing its connection with other arts, as painting, cinema and photography, not to mention its relationship to the world of drugs and rock music.
Para conocer el origen y desarrollo de la historieta española contemporánea, debemos adentrarnos en los suburbios de la cultura visual. Así descubriremos la historia del cómic underground español. Un cómic donde, gracias a la relativa libertad de expresión que ofrecía, la contracultura encontró un vehículo versátil con el que podía expresarse sin trabas, convirtiéndose en una nueva forma de protesta y reivindicación social que ofreció un impagable testimonio de la realidad española, superior al que ofrecen otras artes coetáneas. El artículo analiza las principales características, aspectos estéticos y novedades lingüísticas del comix español, descubriendo sus principales autores (Ceesepe, Gallardo, Mariscal, Max y Nazario, series (Makoki, Los Garriris, Gustavo, Anarcoma,… y revistas (El Rrollo Enmascarado, Star, La Piraña Divina, Butifarra!, Los Tebeos del Rrollo, Rock Comix, El Víbora,…, y mostrando su
Midcourse Space Experiment Observations of Small Solar System Bodies
Kraemer, Kathleen E.; Lisse, C. M.; Price, Stephan D.; Mizuno, D.; Walker, R. G.; Farnham, T. L.; Mäkinen, T.
2005-11-01
Eight comets, two transition objects (extinct comet candidates), and two near-Earth asteroids were imaged in four infrared bands with the SPIRIT III instrument on the Midcourse Space Experiment, namely, C/1996 B2 (Hyakutake), C/1995 O1 (Hale-Bopp), C/1996 Q1 (Tabur), 126P/IRAS, 22P/Kopff, 46P/Wirtanen, (3200) Phaethon, (4015) 107P/Wilson-Harrington, (4179) Toutatis, (4197) 1982 TA, 125P/Spacewatch, and 55P/Tempel-Tuttle. We present maps of each object detected and a description of their characteristics. Five of the comets had extended dust tails, all of which show evidence for silicate emission in the 8.3 μm band. The comet C/Hyakutake had a strong secondary dust tail along the direction of the comet's motion, which the dynamical models showed was consistent with emission from large particles. The dust trail from P/Kopff was detected more than 2° from the coma in three of the four bands and is probably composed of large particles emitted during the 1996 apparition.
Status and distribution of migrating and breeding marine birds in north Lebanon
International Nuclear Information System (INIS)
Jarade, Gh.R.
2017-01-01
The study of marine birds in the northern part of Lebanon recorded 2681 individuals, distributed over 86 species. Among them 35 are foreshore species, 18 coastal, 6 maritime, 9 ducks, 6 herons, 9 various saltwater related species and 3 terrestrial. The highest density is shown by the yellow-legged Gull Larus michahellis and common blackheaded gull Chroicocephalus ridibundus. The globally vulnerable yelkouan shearwater Puffinus yelkouan, an endemic species to the Mediterranean, appears on the 9th rank in the classification of seabird species from the more to the least abundant, highlighting as such, beside other 6 globally near threatened species, the role that Lebanon can play in improving the conservation status of these species. Regarding the phenological status of species, 48 are passage migrant/winter visitors, 31 passage migrants, 5 winter visitors and 2 vagrant species. The surveys revealed that three coastal seabird species (Armenian gull Larus armenicus, slender-billed gull Chroicocephalus genei and sandwich tern Thalasseus sandvicensis) and one ubiquist species (Eurasian Golden Plover Pluvialis apricaria) are not rare as it was believed in previous papers but fairly common winter visitors. The study identified the yellow-legged gull breeding population to be 160 couples, and confirmed the second and third breeding records of the little ringed plover Charadrius dubius.(author)
Assessing risk to human health from tropical leafy vegetables grown on contaminated urban soils
International Nuclear Information System (INIS)
Nabulo, G.; Young, S.D.; Black, C.R.
2010-01-01
Fifteen tropical leafy vegetable types were sampled from farmers' gardens situated on nine contaminated sites used to grow vegetables for commercial or subsistence consumption in and around Kampala City, Uganda. Trace metal concentrations in soils were highly variable and originated from irrigation with wastewater, effluent discharge from industry and dumping of solid waste. Metal concentrations in the edible shoots of vegetables also differed greatly between, and within, sites. Gynandropsis gynandra consistently accumulated the highest Cd, Pb and Cu concentrations, while Amaranthus dubius accumulated the highest Zn concentration. Cadmium uptake from soils with contrasting sources and severity of contamination was consistently lowest in Cucurbita maxima and Vigna unguiculata, suggesting these species were most able to restrict Cd uptake from contaminated soil. Concentrations of Pb and Cr were consistently greater in unwashed, than in washed, vegetables, in marked contrast to Cd, Ni and Zn. The risk to human health, expressed as a 'hazard quotient' (HQ M ), was generally greatest for Cd, followed successively by Pb, Zn, Ni and Cu. Nevertheless, it was apparent that urban cultivation of leafy vegetables could be safely pursued on most sites, subject to site-specific assessment of soil metal burden, judicious choice of vegetable types and adoption of washing in clean water prior to cooking.
Directory of Open Access Journals (Sweden)
Jonathan de Oliveira Molar
2009-04-01
Full Text Available This paper is aimed at discussing the representations about the hillbilly, the national peasant based on visions of two intellectuals: writer Monteiro Lobato and painter José Ferraz de Almeida Jr. Therefore, both literature and iconographic sources will support an analysis of the living standards of the rustic, as found in the historical period covered – 1889 until 1945. Contributions from authors who work with image analysis will be used as method, such as Henry Silva’s and Ana M. Mauad’s, and authors who work with the said period and the provincial issue: Lilia Schwarcz, Glauco Barsalini and Antonio Candido. O presente trabalho se propõe a discutir as representações elaboradas acerca do caboclo, do caipira nacional a partir das visões de dois intelectuais: o escritor Monteiro Lobato e o pintor José Ferraz de Almeida Júnior. Desse modo, analisar tanto na literatura quanto no conjunto iconográfico o ir e vir que perpassa as considerações sobre o modo de vida do caboclo, de acordo com o período histórico abordado – de 1889 até 1945. Para tanto, utiliza-se de autores que trabalham com análise de imagens, tais como: Henrique Silva e Ana M. Mauad; e, autores que trabalham com o citado período e a questão cabocla: Lilia Schwarcz, Glauco Barsaline e Antônio Cândido.
Directory of Open Access Journals (Sweden)
Pascal Neige
Full Text Available New coleoid cephalopods are described from statolith remains from the Middle Eocene (Middle Lutetian of the Paris Basin. Fifteen fossil statoliths are identified and assigned to the Sepiidae (Sepia boletzkyi sp. nov.,? Sepia pira sp. nov., Loliginidae (Loligo clarkei sp. nov., and Ommastrephidae (genus indet. families. The sediments containing these fossils indicate permanent aquatic settings in the infralittoral domain. These sediments range in age from 46 Mya to 43 Mya. Analysis of the fossil record of statoliths (from findings described here, together with a review of previously published data indicates marked biases in our knowledge. Fossil statoliths are known from as far back as the Early Jurassic (199.3 to 190.8 Mya but surprisingly, to the best of our knowledge, no record occurs in the Cretaceous. This is a "knowledge bias" and clearly calls for further studies. Finally, we attempt to compare findings described here with fossils previously used to constrain divergence and/or diversification ages of some coleoid subclades in molecular phylogenies. This comparison clearly indicates that the new records detailed here will challenge some estimated divergence times of coleoid cephalopod subclades.
Directory of Open Access Journals (Sweden)
Arnaldo Maldonado Júnior
2010-11-01
Full Text Available The rat lungworm Angiostrongylus cantonensis is a worldwide-distributed zoonotic nematode that can cause human eosinophilic meningoencephalitis. Here, for the first time, we report the isolation of A. cantonensis from Achatina fulica from two Brazilian states: Rio de Janeiro (specifically the municipalities of Barra do Piraí, situated at the Paraiba River Valley region and São Gonçalo, situated at the edge of Guanabara Bay and Santa Catarina (in municipality of Joinville. The lungworms were identified by comparing morphological and morphometrical data obtained from adult worms to values obtained from experimental infections of A. cantonensis from Pernambuco, Brazil, and Akita, Japan. Only a few minor morphological differences that were determined to represent intra-specific variation were observed. This report of A. cantonensis in South and Southeast Brazil, together with the recent report of the zoonosis and parasite-infected molluscs in Northeast Brazil, provide evidence of the wide distribution of A. cantonensis in the country. The need for efforts to better understand the role of A. fulica in the transmission of meningoencephalitis in Brazil and the surveillance of molluscs and rodents, particularly in ports, is emphasized.
Maldonado, Arnaldo; Simões, Raquel O; Oliveira, Ana Paula M; Motta, Esther M; Fernandez, Mônica A; Pereira, Zilene M; Monteiro, Simone S; Torres, Eduardo J Lopes; Thiengo, Silvana Carvalho
2010-11-01
The rat lungworm Angiostrongylus cantonensis is a worldwide-distributed zoonotic nematode that can cause human eosinophilic meningoencephalitis. Here, for the first time, we report the isolation of A. cantonensis from Achatina fulica from two Brazilian states: Rio de Janeiro (specifically the municipalities of Barra do Piraí, situated at the Paraiba River Valley region and São Gonçalo, situated at the edge of Guanabara Bay) and Santa Catarina (in municipality of Joinville). The lungworms were identified by comparing morphological and morphometrical data obtained from adult worms to values obtained from experimental infections of A. cantonensis from Pernambuco, Brazil, and Akita, Japan. Only a few minor morphological differences that were determined to represent intra-specific variation were observed. This report of A. cantonensis in South and Southeast Brazil, together with the recent report of the zoonosis and parasite-infected molluscs in Northeast Brazil, provide evidence of the wide distribution of A. cantonensis in the country. The need for efforts to better understand the role of A. fulica in the transmission of meningoencephalitis in Brazil and the surveillance of molluscs and rodents, particularly in ports, is emphasized.
Neige, Pascal; Lapierre, Hervé; Merle, Didier
2016-01-01
New coleoid cephalopods are described from statolith remains from the Middle Eocene (Middle Lutetian) of the Paris Basin. Fifteen fossil statoliths are identified and assigned to the Sepiidae (Sepia boletzkyi sp. nov.,? Sepia pira sp. nov.), Loliginidae (Loligo clarkei sp. nov.), and Ommastrephidae (genus indet.) families. The sediments containing these fossils indicate permanent aquatic settings in the infralittoral domain. These sediments range in age from 46 Mya to 43 Mya. Analysis of the fossil record of statoliths (from findings described here, together with a review of previously published data) indicates marked biases in our knowledge. Fossil statoliths are known from as far back as the Early Jurassic (199.3 to 190.8 Mya) but surprisingly, to the best of our knowledge, no record occurs in the Cretaceous. This is a "knowledge bias" and clearly calls for further studies. Finally, we attempt to compare findings described here with fossils previously used to constrain divergence and/or diversification ages of some coleoid subclades in molecular phylogenies. This comparison clearly indicates that the new records detailed here will challenge some estimated divergence times of coleoid cephalopod subclades.
Directory of Open Access Journals (Sweden)
H. R. Tufts
2015-01-01
Full Text Available Background. Inflammation, together with related oxidative stress, is linked with the etiology of kwashiorkor, a form of severe acute malnutrition in children. A diet rich in anti-inflammatory and antioxidant phytochemicals may offer potential for the prevention and treatment of kwashiorkor. We selected and assayed five leafy green vegetables, two wild fruits, and six medicinal plants from Kenya for their antioxidant and anti-inflammatory properties. Consensus regarding medicinal plant use was established from ethnobotanical data. Methods. Antioxidant activity and phenolic content were determined using the oxygen radical absorbance capacity (ORAC assay and Folin-Ciocalteu procedure, respectively. Anti-inflammatory activity was assessed in vitro targeting the inflammatory mediator tumour necrosis factor-alpha (TNF-α. Results. Mangifera indica (leaves used medicinally showed the greatest antioxidant activity (5940 ± 632 µM TE/µg and total phenolic content (337 ± 3 mg GAE/g but Amaranthus dubius (leafy vegetable showed the greatest inhibition of TNF-α (IC50 = 9 ± 1 μg/mL, followed by Ocimum americanum (medicinal plant (IC50 = 16 ± 1 μg/mL. Informant consensus was significantly correlated with anti-inflammatory effects among active medicinal plants (r2=0.7639, P=0.0228. Conclusions. Several plant species commonly consumed by Kenyan children possess activity profiles relevant to the prevention and treatment of kwashiorkor and warrant further investigation.
Directory of Open Access Journals (Sweden)
Nivaldo D Costa
2008-12-01
Full Text Available Com o objetivo de avaliar a produtividade de cultivares de cebola em cultivo orgânico no Vale do São Francisco, conduziram-se dois experimentos, de maio a outubro de 2005, nos Campos Experimentais de Bebedouro, Petrolina-PE, e Mandacaru, Juazeiro-BA, em ARGISSOLO e VERTISSOLO respectivamente. O delineamento experimental utilizado foi em blocos ao acaso, utilizando-se dezoito e quatorze cultivares de cebola, respectivamente e quatro repetições. Em ARGISSOLO a produtividade total de bulbos variou de 13,52 a 39,52 t/ha. A produtividade comercial oscilou de 7,45 a 38,32 t/ha, sobressaindo-se como mais produtivas as cultivares Brisa IPA-12 (38,32 t/ha e São Paulo (35,86 t/ha que não evidenciaram diferenças significativas entre si, assim como as cultivares Botucatu-150 (26,41 t/ha e Pira Ouro (26,37 t/ha, e menos produtivas as cultivares Conquista (7,45 t/ha e Crioula Alto Vale (7,81 t/ha. Em VERTISSOLO a produtividade total de bulbos variou de 6,87 a 24,68 t/ha. Sobressairam-se com produtividade comercial as cultivares Texas Grano PRR (21,56 t/ha e IPA-10 (17,50 t/ha, que não diferiram entre si. As cultivares Crioula Alto Vale, CNPH-6348, CNPH- 6436 e CNPH-6206 não tiveram produção comercial de bulbos.In this research were evaluated the yield of onion cultivars under organic growth in the São Francisco Valley. Two field trials were evaluated, one at the Experimental Farm Station of Embrapa Tropical Semi-Arid, in Petrolina, in an ultisol type and the other at the Experimental Farm Station of Mandacaru, in Juazeiro, in a vertisol type, from February to October of 2005. The experimental design was of randomized complete blocks, with 18 and 14 cultivars, respectively, and four replications. In the ultisol, the total yield of bulbs ranged from 13.52 to 39.52 t/ha. The commercial yield ranged from 7.45 to 38.32 t/ha where the cultivars Brisa (38.32 t/ha and São Paulo (35.86 t/ha showed the highest yield without statistical difference
Directory of Open Access Journals (Sweden)
Francisco Gerson Araújo
2001-06-01
Full Text Available The Paraíba do Sul is a major running water system in southeastern Brazil (22º24' -22º26'S; 43º43' -44º16' W, draining one of the most important industrial regions in the country. Because of its location, it has suffered a large amount of alteration due to discharges of urban and industrial effluents with direct influence in the ichthyofauna. The aim of this study is to up-to-date information on fish assemblage structure and its variation in the vicinity of a major industrial effluent outfall at Volta Redonda industrial complex. A standardized fishing sampling program, using seines, casting nets, gill nets and net trays, was carried out from October 1997 to September 1999, at six sites in three zones of the river (upstream, nearby and downstream the industrial complex, aiming to compare variation in fish assemblage due to anthropogenic alteration. Fifty-two species in 13 families were identified in the total of 7286 fish specimens. Characidae was the most diverse family contributing with 28,85% to total number of species, followed by Cichlidae (17,31 %. Overall 15,38% of the species were introduced from other watershed systems, four exotic cichlids (genera Oreochromis Günther, 1862 and Tilapia A. Smith, 1840 and three aloctone (Cichla ocellaris Bloch & Schneider, 1801, Hyphessobricon callistus (Boulenger, 1900 e Metynnis maculatus (Kner, 1860. Lebistes reticulatus (Peters, 1859 was the most abundant fish species contributing to 39,7% of the total number of fish, followed by Geophagus brasiliensis (Quoy & Gaimard, 1824 amounting to 27,4%. Fish abundance was higher in the industrial zone, but only a few very dominant species were captured, while the upstream zone showed the most even community. Species replacement tolerance along the alterations gradient in the three zone seems to be a strategy to use the limited resources in the area.
Woo, Sung-Geun; Srinivasan, Sathiyaraj; Yang, Jihoon; Jung, Yong-An; Kim, Myung Kyum; Lee, Myungjin
2012-05-01
Strain MJ31(T), a gram-reaction-positive, aerobic, rod-shaped, non-motile bacterium, was isolated from a sludge sample collected at the Daejeon sewage-disposal plant, in South Korea, and characterized in order to determine its taxonomic position. Phylogenetic analysis based on 16S rRNA gene sequences indicated that strain MJ31(T) belonged to the genus Nocardioides, appearing most closely related to Nocardioides dubius KSL-104(T) (98.6 % sequence similarity), Nocardioides jensenii DSM 20641(T) (97.6 %), Nocardioides daedukensis MDN22(T) (97.2 %) and Nocardioides mesophilus MSL-22(T) (97.0 %). The chemotaxonomic properties of strain MJ31(T) were consistent with those of the genus Nocardioides: MK-8(H(4)) was the predominant menaquinone, iso-C(16 : 0), iso-C(17 : 0) and C(18 : 1)ω9c were the predominant cellular fatty acids, and the cell-wall peptidoglycan was based on LL-2,6-diaminopimelic acid. The genomic DNA G+C content of strain MJ31(T) was 71.2 mol%. Some differential phenotypic properties and low DNA-DNA relatedness values (<28 %) with the type strains of closely related species indicated that strain MJ31(T) represents a novel species, for which the name Nocardioides daejeonensis sp. nov. is proposed. The type strain is MJ31(T) ( = KCTC 19772(T) = JCM 16922(T)).
Directory of Open Access Journals (Sweden)
Hidayat Ashari
2017-04-01
Full Text Available Javan Plover named Charadrius javanicus is taxonomically under controversy and phylogenetically unresolved yet. Through an analysis of DNA barcode, this study aims (1 to confirm whether Javan Plover is separated species named Charadrius javanicus or a subspecies of C. alexandrinus which named C. a. javanicus and (2 to determine a relationship within this genus. Totally 666 bp DNA sequences of COI barcode gene were analyzed. The results showed that a sequence divergence between Javan Plover and C. alexandrinus alexandrinus was only 1.2%, while sequence divergences between C.a.alexandrinus and others species, or between Javan Plover and others species were ranged from 9-12%. Neighbour-joining (NJ and maximum-parsimony (MP analyses showed that all individuals of both Javan Plover and Kenith Plover were clustered together, and supported by 99 % and 100 % of bootstrap value in NJ and MP, respectively. This study tends to support the previous findings that Javan Plover was not a separated species named C. javanicus, but it was as a subspecies of C. alexandrinus; named C. a. javanicus. There were two groups of Plover in this study; (C. leschenaultii and C. javanicus + C.a.alexandrinus, and (C.dubius and C. melodus + C. semipalmatus. DNA barcoding analysis can give certainty taxonomic status of the bird. Then, this study has implication as a basic data that can be used to provide and support the planning of Javan plover conservation programs.
Sehrish, Tina; Symonds, V. Vaughan; Soltis, Douglas E.; Soltis, Pamela S.; Tate, Jennifer A.
2015-01-01
Allopolyploids, formed by hybridization and chromosome doubling, face the immediate challenge of having duplicated nuclear genomes that interact with the haploid and maternally inherited cytoplasmic (plastid and mitochondrial) genomes. Most of our knowledge of the genomic consequences of allopolyploidy has focused on the fate of the duplicated nuclear genes without regard to their potential interactions with cytoplasmic genomes. As a step toward understanding the fates of nuclear-encoded subunits that are plastid-targeted, here we examine the retention and expression of the gene encoding the small subunit of Ribulose-1, 5-bisphosphate carboxylase/oxygenase (Rubisco; rbcS) in multiple populations of allotetraploid Tragopogon miscellus (Asteraceae). These polyploids formed recently (~80 years ago) and repeatedly from T. dubius and T. pratensis in the northwestern United States. Examination of 79 T. miscellus individuals from 10 natural populations, as well as 25 synthetic allotetraploids, including reciprocally formed plants, revealed a low percentage of naturally occurring individuals that show a bias in either gene (homeolog) loss (12%) or expression (16%), usually toward maintaining the maternal nuclear copy of rbcS. For individuals showing loss, seven retained the maternally derived rbcS homeolog only, while three had the paternally derived copy. All of the synthetic polyploid individuals examined (S0 and S1 generations) retained and expressed both parental homeologs. These results demonstrate that cytonuclear coordination does not happen immediately upon polyploid formation in Tragopogon miscellus. PMID:26646761
Directory of Open Access Journals (Sweden)
Guilherme Grazzini
2015-01-01
Full Text Available Roedores e Marsupiais são componentes importantes da fauna na região Neotropical. Estudos sobre a riqueza e abundância destes animais são raros na Floresta Ombrófila Mista (FOM e aqui apresentamos um inventário conduzido na Floresta Nacional de Piraí do Sul. Esta área possui uma área aproximada de 150 ha, cercada por pastos e plantações de Pinus. A amostragem foi feita através de armadilhas de queda, Sherman e Tomahawk, dispostas nos principais tipos de vegetação encontrados. Pelo menos um casal de cada espécie foi coletado. Como resultado, durante 5.892 armadilhas.noite nós obtivemos um total de 1.049 capturas, representando 17 espécies: Akodon montensis, Bibimys labiosus, Brucepattersonius iheringi, Cryptonanus sp., Didelphis albiventris, D. aurita, Gracilinanus microtarsus, Monodelphis americana, M. scalops, Myocastor coypus, Nectomys squamipes, Oligoryzomys nigripes, Oxymycterus judex, O. nasutus, Sooretamys angouya e Thaptomys nigrita. Capturas por armadilhas de queda representaram 67% do total, e oito espécies foram registradas exclusivamente por este método. Akodon montensis, O. nigripes e T. nigrita foram as espécies mais abundantes.
Reliability analysis of 2 types of auxiliary feedwater system for PWR
International Nuclear Information System (INIS)
Ekariansyah, Andi Sofrany
2002-01-01
This paper will explain the application of Fault Three Method for analyzing the system reliability of Auxiliary Feedwater System with 2 different configurations taken from PWR type nuclear power plant (NPP) in the USA. The first configuration of Braidwood NPP (design A) basically consists of 1 motor driven pump and 1 diesel driven pump. The second configuration of Haddam Neck NPP (Design B) consists of 2 turbine driven pumps. Based on the P and ID and success criteria the fault trees are constructed to estimate the system failure probabilities quantified from software code PIRAS 1.0. The result shows the second configuration (Design B) with 2 turbine driven pumps have the higher failure probability of 1,06 x 10 - 2 compared with design A of 1,09 x 10 - 3 . The modification of both systems are also tried to analyze its effect to the end result. Qualitatively, the common cause failures of 2 turbine driven pumps contribute to the highest risk of system failure probability. Combination with 1 turbine driven pump and 1 motor driven pump or 1 diesel driven pump will increase the system reliability about 80% and 50% without considering if this configuration is possible to realize in a real plant
Westinghouse Advances in Passive Plant Safety
International Nuclear Information System (INIS)
Bruschi, H. J.; Manager, General; Gerstenhaber, E.
1993-01-01
On June 26, 1992, Westinghouse submitted the Ap600 Standard Safety Analysis Report and comprehensive PIRA results to the U. S. NRC for review as part of the Ap600 design certification program. This major milestone was met on time on a schedule set more than 3 years before submittal and is the result of the cooperative efforts of the U. S. Department of Energy (DOE), the Electric Power Requirements Program, and the Westinghouse Ap600 design team. These efforts were initiated in 1985 to develop a 600 MW advanced light water reactor plant design based on specific technical requirements established to provide the safety, simplicity, reliability, and economics necessary for the next generation of nuclear power plants. The Ap600 design achieves the ALRR safety requirements through ample design margins, simplified safety systems based on natural driving forces, and on a human-engineered man-machine interface system. Extensive Probabilistic Risk evolution, have recently shown that even if none of the active defense-in-depth safety systems are available, the passive systems alone meet safety goals. Furthermore, many tests in an extensive test program have begun or have been completed. Early tests show that passive safety perform well and meet design expectations
Directory of Open Access Journals (Sweden)
Luciana Shizue Matsuguma
2009-06-01
Full Text Available Two commercial varieties of Peruvian carrot ('Amarela de Carandaí' and 'Senador Amaral' were processed into flour, starch and bagasse and chemically evaluated. The starch was extracted, modified with H2O2 and characterized by the physicochemical methods. By using the methylene blue dyeing, the granules of the modified starches showed intense blue color. The carboxyl content, the reducing power and the amount of the water liberated from the pastes after the freeze-thawing were higher for the oxidized starches and their pastes were clearer than those of the native starches of the two varieties from the two production areas. The RVA viscoamylography showed that the modified starches had lower viscosities with differences between the varieties. In the thermal analysis, the temperatures of the pyrolysis were higher for the native (310.37, 299.08, 311.18 ºC than for the modified starches (294.16, 296.65 e 293.29 ºC for both the varieties. This difference could be related with the larger surface of the granules due to the partial degradation promoted by the chemical modification. In almost all results, the differences were evident between the varieties but not for the cultivation places.No presente trabalho duas variedades comerciais de mandioquinha-salsa ('Amarela de Carandaí' e 'Senador Amaral' obtidas dos municípios de Castro e de Piraí do Sul (Paraná foram processadas para a obtenção de farinha, farelo e amido e essas três frações foram caracterizadas quimicamente. O amido foi extraído, modificado com H2O2 e caracterizado por meio de análises físico-químicas. Na coloração com azul de metileno os grânulos dos amidos oxidados apresentaram coloração azul mais intensa. O teor de carboxilas, o poder redutor e a quantidade de água liberada das pastas foram maiores para as amostras de amidos modificados. As pastas dos amidos modificados foram mais claras que as dos nativos. Na análise viscoamilográfica (RVA os amidos modificados
Controle pós-emergente de plantas daninhas em cenoura Post-emergence weed control in carrot crop
Directory of Open Access Journals (Sweden)
Jeferson Zagonel
1999-03-01
Full Text Available O experimento foi conduzido em Piraí do Sul-PR no ano de 1995 em solo de textura argilo arenosa, tendo como objetivo avaliar a eficiência e a seletividade do herbicida propaquizafop no controle pós-emergente de plantas daninhas na cultura da cenoura. O delineamento experimental utilizado foi de blocos ao acaso com seis tratamentos e quatro repetições, quais sejam: propaquizafop (100, 125 e 150 g i.a./ha; fluazifop-p-butil (188 g i.a./ha; testemunha capinada e testemunha sem capina. A cultivar de cenoura utilizada foi Nantes Tim Tom semeada em 15 de junho, com espaçamento de 0,25 x 0,05 m, em parcelas com área útil de 5,00 x 1,00 m. As plantas daninhas predominantes foram Brachiaria plantaginea (capim-papuã, Digitaria horizontalis (capim-milhã e Eleusine indica (capim pé-de-galinha. As avaliações foram efetuadas aos 15, 30 e 45 dias após a aplicação dos tratamentos. Observou-se que o herbicida propaquizafop, nas doses de 100, 125 e 150 g i.a./ha foi eficiente no controle sobre capim-papuã, capim-milhã e capim pé-de-galinha. O controle de plantas daninhas realizado através de herbicidas proporcionou a mesma produção obtida com o controle manual. A perda na produção ocasionada pela presença de plantas daninhas foi da ordem de 76,4%. Não foram observados efeitos fitotóxicos nas plantas de cenoura que pudessem ser atribuídos aos produtos utilizados.The presented field trial was conducted in 1995 in Piraí do Sul, Paraná State, Brazil, on a sand-clay texture soil, to evaluate the efficiency and selectivity of propaquizafop on carrot crop weed control. The experiment was laid out in a randomized block design with six treatments and four replications, and 5.00 x 1.00 m plots. The treatmens were: propaquizafop (100, 125 and 150 g a.i/ha; fluazifop-p-butil (188 g a.i/ha; control with weeding and control without weeding. The carrot cultivar Nantes Tim Tom was sown on June 15 with plants spaced 0.25 x 0.05 m. The prevalent weeds
Clarke-Harris, Dionne; Fleischer, Shelby J
2003-06-01
Although vegetable amaranth, Amaranthus viridis L. and A. dubius Mart. ex Thell., production and economic importance is increasing in diversified peri-urban farms in Jamaica, lepidopteran herbivory is common even during weekly pyrethroid applications. We developed and validated a sampling plan, and investigated insecticides with new modes of action, for a complex of five species (Pyralidae: Spoladea recurvalis (F.), Herpetogramma bipunctalis (F.), Noctuidae: Spodoptera exigua (Hubner), S. frugiperda (J. E. Smith), and S. eridania Stoll). Significant within-plant variation occurred with H. bipunctalis, and a six-leaf sample unit including leaves from the inner and outer whorl was selected to sample all species. Larval counts best fit a negative binomial distribution. We developed a sequential sampling plan using a threshold of one larva per sample unit and the fitted distribution with a k(c) of 0.645. When compared with a fixed plan of 25 plants, sequential sampling recommended the same management decision on 87.5%, additional samples on 9.4%, and gave inaccurate recommendations on 3.1% of 32 farms, while reducing sample size by 46%. Insecticide frequency was reduced 33-60% when management decisions were based on sampled data compared with grower-standards, with no effect on crop damage. Damage remained high or variable (10-46%) with pyrethroid applications. Lepidopteran control was dramatically improved with ecdysone agonists (tebufenozide) or microbial metabolites (spinosyns and emamectin benzoate). This work facilitates resistance management efforts concurrent with the introduction of newer modes of action for lepidopteran control in leafy vegetable production in the Caribbean.
Directory of Open Access Journals (Sweden)
Mehdi Hoveida
2016-09-01
Full Text Available The studied section located in the Djam-Semnan area 55 kms south west Damghan, at the vicinity of the Amrovan rail way station, in the northern flank of Shorab unassymetric anticline. The section is 440 meters thick, including limestone, dolomitic limestone and sandstone with rich fossils contents (e.g.: trilobite, coral, brachiopod, crinoid segments and vertebrate remains. The lower boundary is covered with the recent alluvial and the upper boundary disconformably overlain by the red marls and sandstones of the Permian Dorud formation. In order to determine biostratigraphy and bifacies of the deposits of Bahram formation in Shorab section, twenty five samples (4-6 kgs were collected and processed with conventional actic/formic acid. Nineteen samples were prolific and totally yielded 340 conodont elements. The extracted conodont elements mainly separated out of the carbonate units. Thirty-one species belong to four genera (Polygnathus, Icriodus, Pelecysgnathus and Ancyrodella were discriminated as: Icriodus excavatus, I. expansus, I. cedarensis, I. subterminus, I. iowaensis, I. alternatus, I. tafilaltensis, I. brevis, I. cf. expansus, I. sp., Polygnathus brevilaminus, Poly. angustidiscus, Poly. pollocki, Poly. cf. webbi, Poly. aspelundi, Poly. politus, Poly. alatus, Poly. webbi, Poly. cf. olgae, Poly. dubius, Poly. xylus, Poly. zinaidae, Poly. sp., Pelekeygnathus inclinathus, Pele. serradentatus, Pele. sp., Ancyrodella pristina, Acny. cf. pristina, Ancy. aff. binodosa, Ancy. sp. Based on the frequency and distribution of the collected elements Late Givetian to Early Famennian age were suggested to the studied interval. Conodonts biofacies (icriodid-polygnathid confirm the deposition of the Bahram formation of the Shorab section in the shallow carbonate condition.
CUIDADO FAMILIAL DE RECÉM-NASCIDOS NO DOMICÍLIO: UM ESTUDO DE CASO ETNOGRÁFICO
Directory of Open Access Journals (Sweden)
Julliana de Souza Leandro
2011-01-01
Full Text Available El presente estudio de caso etnográfico es un estudio cualitativo con el objetivo de analizar la dinámica de la atención en el hogar de las familias de los recién nacidos en la ciudad de Piraí-RJ, Brasil. Se recogieron datos de 18 familias de los recién nacidos matriculados en la Unidad de Salud Familiar. Se emplearon los siguientes instrumentos: la entrevista no estructurada, los registros de los miembros de las familias en la Estrategia de Salud Familiar y la observación participante. El análisis temático reveló tres categorías: la dimensión psicológica del cuidado familiar al recién nacido en el hogar, la dimensión biosociocultural del cuidado familiar al recién nacido; y el cuidado familiar a los recién nacidos y su interfaz con el parto y el puerperio. En este estudio las dimensiones psicológicas y biosocioculturales de la atención familiar están presentes en diferentes espacios de la atención de la salud del recién nacido. Se concluye que en el cuidado de los recién nacidos y de la familia en su totalidad es necesario repensar las culturas que se entrelazan con el cuidado familiar y el cuidado profesional
Directory of Open Access Journals (Sweden)
Célia Maria Paiva
2016-01-01
Full Text Available O conhecimento da evapotranspiração das culturas é muito importante para o manejo da irrigação. A equação FAO56 Penman-Monteith tem sido recomendada pela FAO (Food and Agriculture Organization of the United Nations como método padrão para a estimativa da evapotranspiração de referência (ETo . Entretanto, esse método requer variáveis meteorológicas que em geral não são medidas nas estações meteorológicas no Brasil. Por isso, o objetivo deste estudo foi avaliar cinco métodos empíricos e comparar seus desempenhos com o de Penman-Monteith para as condições climáticas da região de Piraí do Sul no Estado do Paraná. Para tanto, foram utilizados dados meteorológicos registrados por uma plataforma de coleta de dados durante o período de 04/07/2008 a 12/10/2008 em uma cultura de trigo. Os resultados indicam que a ETo pode ser estimada adequadamente pelos métodos da Radiação Solar, Jensen-Haise e Makkink. O pior desempenho foi apresentado pelo método de Hargreaves-Samani, seguido do método de Camargo.
Trabalho rural e fatores de risco associados ao regime de uso de agrotóxicos em Minas Gerais, Brasil
Directory of Open Access Journals (Sweden)
Soares Wagner
2003-01-01
Full Text Available O objetivo deste artigo foi caracterizar o processo do trabalho rural em nove municípios de Minas Gerais, considerando indicadores sócio-demográficos, a estrutura agrária dos estabelecimentos rurais, práticas de trabalho relacionadas ao uso de agrotóxicos e, a intoxicação associada a seu uso. Os dados foram obtidos de uma pesquisa realizada pela Fundação Jorge Duprat Figueiredo, de Segurança e Medicina do Trabalho, que aplicou um questionário a 1.064 trabalhadores rurais, entre os anos de 1991 a 2000. Por meio de uma regressão logística, foram obtidos os fatores de risco associados à intoxicação por agrotóxicos dos grupos organofosforados e carbamatos. Cerca de 50% dos entrevistados se encontravam ao menos moderadamente intoxicados. Os fatores de risco encontrados foram: ter o último contato a menos de duas semanas com agrotóxicos; não usar proteção; ser orientado pelo vendedor; citar organofosforado ou carbamato como agrotóxico principal e trabalhar nos municípios de Teófoli Otoni, Guidoval ou Piraúba. Os resultados apontam para o alto grau de risco de agravos à saúde a que estão sujeitos trabalhadores rurais em contato com agrotóxicos.
Directory of Open Access Journals (Sweden)
Leda Restrepo
2016-09-01
Full Text Available Vibrio parahaemolyticus is a pathogenic bacteria which has been associated to the early mortality syndrome (EMS also known as hepatopancreatic necrosis disease (AHPND causing high mortality in shrimp farms. Pathogenic strains contain two homologous genes related to insecticidal toxin genes, PirA and PirB, these toxin genes are located on a plasmid contained within the bacteria. Genomic sequences have allowed the finding of two strains with a divergent structure related to the geographic region from where they were found. The isolates from the geographic collection of Southeast Asia and Mexico show variable regions on the plasmid genome, indicating that even though they are not alike they still conserve the toxin genes. In this paper, we report for the first time, a pathogenic V. parahaemolyticus strain in shrimp from South America that showed symptoms of AHPND. The genomic analysis revealed that this strain of V. parahaemolyticus found in South America appears to be more related to the Southeast Asia as compared to the Mexican strains. This finding is of major importance for the shrimp industry, especially in regards to the urgent need for disease control strategies to avoid large EMS outbreaks and economic loss, and to determine its dispersion in South America. The whole-genome shotgun project of V. parahaemolyticus strain Ba94C2 have been deposited at DDBJ/EMBL/GenBank under the accession PRJNA335761.
Directory of Open Access Journals (Sweden)
Luana Palmeira Pereira
2014-02-01
Full Text Available The habit of doing workouts combined with use of nutritional ergogenic or pharmacological has grown considerably in the last years. Whether for esthetic reasons or in order to improve some performance aspects, athletes consume a large amount of these products. In this sense, the purpose of this study is: survey the consumers profile of a nutritional ergogenic resources in Barra do Piraí gyms (RJ state, enumerate the products used by users of both sexes and verify the prescription source of these products to researched participants, ascertain if the participants achieved the expected results with use of these products and if they caused any side effects. This is an observational study, which evaluated 101 athletes of both genders and social classes. It was found that the majority of participants 75% (n = 76 reported the use of nutritional ergogenic or pharmacological, with the highest prevalence among men. Two products were the most consumed: whey protein 56.57% (n = 34 and creatine 42.10% (n = 25. The majority 45% (n = 34 reported consuming ergogenic without an expert guidance. Therefore, that the study shows the importance of each time more the professional in the field of nutrition be inserted in the sports ground for possible explanations about the effects of this product type is found between sportsman.
Strategy for infrared photometry of comets with ISO
Solc, M.; Vanysek, V.; Gruen, E.
1994-07-01
The launch of the ISO (Infrared Satellite Observatory) by the European Space Agency is scheduled for autumn 1995. Photometry and spectrophotometry observing programs of comets in the wavelength range 2.5-200 microns for the onboard spectrophotometer ISOPHOT is now under final preparation. Technical details for preparing propasals are given. Phenomena in comets to be studied are surface properties of bare cometary nuclei at large heliocentric distances, onset of coma activity, and coma dust and gas emission (in inner solar system). Dust production, dust/gas mass ratio, dust distribution in coma, and their temporal variability are important for understanding the physical processes on nuclei, and spectrophotometry in the range of 2.5-12 microns could provide us with data of the chemical composition of cometary dust. Several active comets expected for the 18-month lifetime of ISO in 1995-1997 were selected for the ISO Central Program according to their orbital and physical parameters: P/Schwassman-Wachmann 1, P/Encke, P/d'Arrest, P/Honda-Mrkos-Pajdusakova, P/Churyumov-Gerasimenko, P/Kopff, P/IRAS, P/Wirtanen, P/Wild 2, P/Grigg-Skjellerup, P/Schwassman-Wachmann 3, P/Machholz, and (2060) Chiron. Four of them match well various constraints put on the observations by the technical arrangement of the satellite and instrument. A simple four-parameter model (size, albedo, rotation, optical thickness)was developed to estimate the temperatures and thermal fluxes of both solid nuclei and dust coma.
Directory of Open Access Journals (Sweden)
E.A.S. Cícero
2007-09-01
Full Text Available A alface-d'água (Pistia stratiotes é uma das principais entre as macrófitas aquáticas que causam problemas em corpos hídricos no Brasil e são consideradas como plantas daninhas. O presente trabalho foi realizado com os objetivos de conhecer melhor a variabilidade genética dessa macrófita e relacionar essa variabilidade com a resposta à aplicação do herbicida glyphosate. Para isso, foram coletados indivíduos em 12 corpos hídricos em diferentes cidades do território nacional (Americana, Cambaratiba, Curitiba, Itapura, Jaboticabal, Lagoa Santa, Piraí, Rio Grande, Rubinéia, Salto Grande, Santa Gertrudes e Três Lagoas. Os acessos foram caracterizados pelo uso de marcadores RAPD (DNA Polimórfico Amplificado ao Acaso, que permitiram, com o auxílio de iniciadores aleatórios, a caracterização dos locos polimórficos identificados por uma matriz de ausência e presença de bandas. Utilizando essa matriz, a análise de agrupamento permitiu nítida classificação dos acessos em três grupos com diferenças genéticas entre eles. Um ensaio de controle químico, com plantas mantidas em vasos plásticos (5 L e pulverizadas com o herbicida glyphosate nas concentrações de 0,0, 0,6, 1,2, 1,8 e 2,4 kg ha-1, identificou, utilizando avaliações aos 7, 14 e 21 dias após aplicação, que as duas maiores doses promoveram melhor efeito herbicida. Foi verificado também que os acessos de Curitiba e Cambaratiba apresentaram menor suscetibilidade ao herbicida glyphosate. Não houve correspondência entre a estrutura de grupos dos acessos pela análise multivariada de agrupamento com a técnica RAPD e a suscetibilidade da alface-d'água ao glyphosate.Water lettuce (Pistia stratiotes is one the most important macrophytes, classified as weed and causing serious problems in watercourses in Brazil. The aim of this research was to evaluate the genetic variability of water lettuce and its relationship with this plant's susceptibility to glyphosate
Directory of Open Access Journals (Sweden)
Antonio Ismael Inácio Cardoso
1999-10-01
Full Text Available Com o objetivo de estudar a viabilidade de produção de bulbinhos de cebola sob ambiente protegido em diferentes tipos de bandejas de poliestireno expandido foram instalados dois experimentos. No primeiro, trabalhando com a cultivar Serrana, foram avaliadas três tipos de bandejas com diferentes números de plantas por célula: uma planta/célula na bandeja de 288 células, três a cinco plantas/célula na de 128 e cinco a nove plantas/célula na de 72 células. No outro experimento, testaram-se nove cultivares, semeadas somente em bandejas de 128 células com três plantas por célula. Utilizou-se o delineamento em blocos ao acaso com quatro repetições no primeiro ensaio e cinco no segundo, sendo cada parcela constituída por uma bandeja. Observou-se que quanto maior a densidade de plantio menor o tamanho do bulbinho (diâmetro e peso. O manejo adequado de adubações em cobertura pode viabilizar, tecnicamente, a produção de cinco bulbinhos com 1,3 cm de diâmetro (2 g por célula, na bandeja de 128 células. Quanto ao ensaio de cultivares, ‘Crioula’ da Agroflora, ‘Crioula’ da Granja Lotário e ‘Houston’ apresentaram 83%, 67% e 81% de plantas bulbificadas, enquanto que nas demais (‘Aurora’, ‘Baia Periforme’, ‘Brownsville’, ‘Petroline’, ‘Pira Ouro’, ‘Pirana’ e ‘Serrana’ obteve-se 100% de bulbificação. As principais vantagens na produção de bulbinhos em bandeja foram: uniformidade, ausência de plantas daninhas e de patógenos. É um sistema que pode ser útil aos viveiristas que tem entressafra de mudas nos meses de agosto a novembro, período de produção dos bulbinhos. Poderá, também, ser uma alternativa na produção de bulbinhos para conserva, no controle de qualidade de lotes de sementes e em programas de melhoramento de cebola.One objective was to study the production of onion Allium cepa L.. bulb sets in a protected environment in a seedling system with trays with different number of
Directory of Open Access Journals (Sweden)
LUIZ FERNANDO MANGEA DA SILVA
2014-09-01
Full Text Available Resumo: O presente artigo faz uma análise da influência da Ação Católica na atuação social e pastoral de D. Waldyr Calheiros de Novaes na Diocese de Barra do Piraí/Volta Redonda, tendo como base o contexto sociopolítico nacional e local do início da década de 1950 até 1968. Essa atuação se inicia a partir do episódio referente à violação dos direitos humanos, em que operários da Companhia Siderúrgica Nacional e intelectuais volta-redondenses foram presos após uma comemoração pelos 20 anos da Declaração Universal dos Direitos do Homem. No evento, também foram comemorados os dois anos da chegada e posse do bispo à diocese. Houve, por parte da organização do evento, a iniciativa de incluir dramatizações que simbolizavam o universo dos trabalhadores. Não podemos esquecer que Volta Redonda era uma cidade militarizada, por causa da instalação do 1º Batalhão de Infantaria Blindada em Barra Mansa, cidade vizinha. O serviço de espionagem do regime militar identificou as lideranças operárias e intelectuais, o que resultou nas prisões dos organizadores do evento. Foi nesse episódio que o bispo se declarou preso no batalhão, em protesto contra a detenção dessas lideranças.Palavras-chave: Waldyr Calheiros de Novaes – Ação Católica – Ditadura Militar e Direitos Humanos. Resumen: Este artículo analiza la influencia de la Acción Católica en el trabajo social y pastoral D. Waldyr Calheiros de Novaes en la Diócesis de Barra do Piraí/Volta Redonda, en función del contexto socio-político nacional y local de la década de 1950 hasta 1968 . Dicha acción se inicia desde el episodio relativo a la violación de los derechos humanos, en el que los trabajadores nacionales Steel Company y los intelectuales era redondenses fueron arrestados después de una celebración para el 20 aniversario de la Declaración universal de los derechos humanos. En el evento, también se celebraron dos años de la llegada e
Hossain, A M M Maruf; Islam, M Shahidul; Mamun, M Mustafa; Al-Jonaed, H M; Imran, M; Rahman, M Hasibur; Kazi, M Azizul Islam; Elahi, Syed Fazle
2016-01-01
With regard to previously reported Lead (Pb) and Chromium (Cr) contamination in egg, a semi-quantitative assessment of the general environment of Bangladesh is carried out through nation-wide sampling of commonly grown and consumed vegetables. Five vegetables, namely, White Potato ( Solanum tuberosum ), Green Cabbage ( Brassica oleracea capitata var. alba L.), Red Spinach ( Amaranthus dubius ), White Radish ( Raphanus sativus var. longipinnatus ), and Green Bean ( Phaseolus vulgaris ) were selected for sampling from all 64 Districts of the country as per their availability during the sampling season. This results in a collection of 292 samples. Due to the necessity of incorporating a wide spectrum of vegetable types (e.g. tuber, brassica, leafy, root, and fruiting vegetables) as well as the need for including the geographic expanse of the whole country, replicates were not accommodated in the study, hence, the study being semi-quantitative in nature. The results do not substantiate evidence of public health risk due to Cr yet, with only 0.69 % of the samples found contaminated with Cr. Pb contamination (concentrations above a health-based guidance value) is found in 29.47 % of the samples; and together with the insight of such contamination likely being non-point origin, communicates on potential public health risk due to Pb as residual effects of extensive ambient atmospheric Pb pollution in recent history of the country. For the purpose of comparison, Cadmium (Cd) contents of the samples are also analyzed. Although there is no extensive Cd pollution history/source in the country, the likely point-source nature of Cd contamination found in 17.83 % of the samples indicates the scope of managing any existing contamination source by directing efforts into the potential point-sources.
VICHADA: LA HOSPITALIDAD DEL ORINOCO. Pag. 150-157
Directory of Open Access Journals (Sweden)
Wilmer Velandia
2013-03-01
Full Text Available Donde el cielo y la sabana se unen en el infinito, se vislumbra una sola montaña en la lejanía, parece un gigante, antiguo y oscuro al final de la inmensidad un “Tepuye”, después de unas cuantas horas de camino se acerca este gran anciano que data del precámbrico, pero no está solo. Se observan algunos compañeros iguales a él, se podrían considerar como los guardianes del imponente y hermoso Orinoko, considerado en lengua Sikuani como la gran serpiente enroscada acompañada de una gran riqueza paisajística cultural y biodiversa; bosques de galería, diferentes tipos de sabana, esteros, lagunas, morichales, bosques inundables, las que recorren aguas blancas, negras y mixtas, rodeadas por diferentes etnias y grupos indígenas como Piaroas, Sikuanis – Guahibos, Cuibas y Amoruas, que viven en forma pacífica con llaneros y colonos, orgullosos de estas tierras, amables y hospitalarios que desde hace muchos años comparten este paraíso con: bagres, pirañas, anguilas, rayas, arawanas, anacondas, ranas, sapos, caimanes, babos, iguanas, tortugas, loros, búhos, guacamayas, azucareros, pavones, paujiles, águilas, zamuros, aulladores, armadillos, ocarros, chigüiros, osos hormigueros, ocelotes, jaguares, nutrias, murciélagos, cuerpo espines, zorros, venados y delfines, que pasan sus días entre; cedros, moriches, saladillos, caraños, yarumos, laureles, caimos, guaduas, guamos, alcornoques, chaparros, arepillos, palmiches y gualtes.
The BATENUS process for recycling mixed battery waste
Fröhlich, Siegmund; Sewing, Dirk
The first large-scale battery recycling facility implementing the hydrometallurgical BATENUS technology is expected to go into operation by 1996. The plant will be situated in Schönebeck/Sachsen-Anhalt, and has a projected maximum capacity of 7500 tons of spent batteries per year. The engineering is being carried out by Keramchemie GmbH and the plant will be operated by Batterierecycling Schönebeck GmbH. The BATENUS process was developed by Pira GmbH, a research institute in Stühlingen, Germany, during a period of five years. This new process combines hydrometallurgical operations in a nearly closed reagent cycle that involves electrochemical and membrane techniques. Effluent emissions are minimized to the greatest possible extent. Process validity has been proven in a series of pilot plant testings. After mechanical separation of the casing materials like ferrous and nonferrous metals, paper and plastics, the subsequent hydrometallurgical recovery yields zinc, copper, nickel and cadmium. The other products are manganese carbonate and a mixture of manganese oxide with carbon black. Mercury is immobilized by absorption on a selective ion-exchange resin. The BATENUS process is a master process for the hydrometallurgical reclamation of metals from secondary raw materials. It has found its first application in the treatment of spent consumer batteries (i.e., mixtures of zinc-carbon, alkaline manganese, lithium, nickel-cadmium cells, etc.). As a result of its modular process design, the individual steps can be modified easily and adapted to accommodate variations in the contents of the secondary raw materials. Further applications of this highly flexible technology are planned for the future.
West Coast U.S. : demand and prices
International Nuclear Information System (INIS)
Lund, P.G.
1997-01-01
The outlook for Canadian natural gas in Western U.S. markets through the winter of 1997 and 1998 was discussed. The effect of El Nino on West Coast gas pricing was noted, while also admitting that the best scientific minds are unable to determine what these effects actually are. Both the Cambridge Energy Research Associates (CERA) and PIRA predicted that Topock (the border pricing point) prices will track the NYMEX Henry Hub prices. The three points that were emphasized for the winter of 1997-1998 were: (1) Western U.S. pricing is higher than last year, (2) there is a surplus of gas in Canada relative to export capacity, and (3) differentials are anticipated to remain in excess of full transportation costs. The 1997 gas accord rates were also noted and its significance discussed. Increased electric load growth is likely to result in higher electricity prices which may drag gas prices along with them. Any new power generation facility is likely to be gas-fired, a fact which should also help to maintain natural gas prices. Transmission pricing is the major unknown variable. It is well known that from a capital cost perspective it is about four times more expensive to build a high -Kv transmission line than to build a gas pipeline to deliver the equivalent amount of energy. Therefore, to the degree that transmission pricing favours building new generation near load centres, gas should do well. If on the other hand, transmission pricing favours building generation plants near the fuel source, gas probably would not do nearly as well. The effects will not be known until the relevant decisions have been made. 6 figs
Nuclear Safety R and D Programs and trend in the U. S. Utility Industry
International Nuclear Information System (INIS)
Kim, Jong Hyun
1992-01-01
First of all, the deterministic approach to safety analysis, which had dominated safety research in the earlier years, has given much ground to probabilistic approach. Secondly, human factors analysis has become an important part of safety research. Third, safety research relevant to reliability, or safety combined with reliability, are gradually taking place of purely safety-oriented or stand-alone safety research. More and more nuclear utilities in the U. S. are integrating safety with reliability. This evolution is in part due to the successful completion of major safety testing and analyses of deterministic nature, and partially due to the utility industry's desire to harvest synergistic nature, and partially due to the utility industry's desire to harvest synergistic results by combining safety with reliability, as the utility industry is more and more concerned about reducing operation and maintenance costs by enhancing reliability while maintaining plant safety. Nuclear safety is a complex and comprehensive concept, defying a simple categorization or interpretation. Thus, research and development in nuclear safety is necessarily diverse, and the program areas and trend presented in this paper are not meant to be all inclusive. For instance, there are some other active areas that were not mentioned, such as seismic risk assessment program and others. Nuclear safety research and development activities have undergone a perceptible shift of emphasis in recent years. They have become more focused and product-oriented. Also, except for the severe accident analysis, the emphasis on prevention and mitigation of accident, rather than analyzing the consequences of accident, is very much in evidence; that is, reliability-based technologies using PIRA methodology, and upgrading of instrumentation and control technologies are in the main stream of activities
Directory of Open Access Journals (Sweden)
Leib Stephen L
2011-04-01
Full Text Available Abstract Background The kynurenine (KYN pathway has been shown to be altered in several diseases which compromise the central nervous system (CNS including infectious diseases such as bacterial meningitis (BM. The aim of this study was to assess single nucleotide polymorphisms (SNPs in four genes of KYN pathway in patients with meningitis and their correlation with markers of immune response in BM. Methods One hundred and one individuals were enrolled in this study to investigate SNPs in the following genes: indoleamine-2,3-dioxygenase (IDO1 gene, kynureninase (KYNU gene, kynurenine aminotransferase I (CCBL1 gene, and kynurenine aminotransferase II (AADAT gene. SNP analyses were performed by primer-introduced restriction analysis-PCR (PIRA-PCR followed by RFLP. Cytokines were measured using multiplex bead assay while immunoglobulins (IG by immunodiffusion plates and NF-kappaB and c-Jun by dot blot assay. Results The variant allele of SNP AADAT+401C/T showed prevalent frequency in patients with BM. A significant decrease (p AADAT+401C/T. Furthermore, a significant (p p KYNU+715G/A was found with low frequency in the groups, and the SNPs in IDO1+434T/G, KYNU+693G/A, CCBL1+164T/C, and AADAT+650C/T had no frequency in this population. Conclusions This study is the first report of an association of SNP AADAT+401C/T with the host immune response to BM, suggesting that this SNP may affect the host ability in recruitment of leukocytes to the infection site. This finding may contribute to identifying potential targets for pharmacological intervention as adjuvant therapy for BM.
Directory of Open Access Journals (Sweden)
Hiram Feijó Baylão Junior
2013-08-01
Full Text Available http://dx.doi.org/10.5902/1980509810542 Disturbed ecosystems do not present original floristic composition. Their soils are depleted, shallow, stony, with low infiltration and present erosion with different levels of Geodynamics. The region has areas of pasture with sparse herbaceous vegetation which is weakened in every rain and fire, covering less ground. The individuals that colonized and settled in these environments were considered rustic species. This study raised and identified by census, the rustic species and their structure in the most degraded part (lower third of the watershed of Cacaria’s river at the base of the Serra do Mar, Piraí, Rio de Janeiro state, and evaluated the influence of ecological exposure, slope, elevation, topography and rock outcrops in the establishment and growth of these species. For the vegetation survey it was conducted census in an area of 22 hectares, where it was measured, geo-referenced and identified all spontaneous tree species that were isolated in a pasture area. Ecological factors exposure, elevation and slope were determined with a compass, altimeter and clinometer, respectively. We identified 131 individuals, representing 14 species, grouped into nine families. Tabernaemontana laeta Mart., Sparattosperma leucanthum (Vell. Schum., Machaerium hirtum (Vell. Stellfeld, Tabebuia chrysotricha (Mart. ex DC. Stan., Cecropia pachystachya Trec., Peltophorum dubium (Spreng. Taub., Guarea guidonia (L. Sleumer, Acacia polyphylla DC. and Psidium guajava L.were present in portions of the slope with exposure to the north, with altitudes from 60m to 80m and with slope strongly corrugated (20-45%, indicating a preference of these species for microhabitats with those characteristics.
A systematic revision of Operclipygus Marseul (Coleoptera, Histeridae, Exosternini
Directory of Open Access Journals (Sweden)
Michael Caterino
2013-02-01
. panamensis (Wenzel & Dybas, 1941], O. sejunctus group [O. depressus (Hinton, 1935, O. itoupe sp. n., O. juninensis sp. n., O. pecki sp. n., O. punctiventer sp. n., O. sejunctus (Schmidt, 1896 comb. n., O. setiventris sp. n.], O. mortavis group [O. ecitonis sp. n., O. mortavis sp. n., O. paraguensis sp. n.], O. dytiscoides group [O. carinisternus sp. n., O. crenulatus sp. n., O. dytiscoides sp. n., O. quadratus sp. n.], O. dubitabilis group [O. dubitabilis (Marseul, 1889, O. yasuni sp. n.], O. angulifer group [O. angulifer sp. n., O. impressifrons sp. n.], O. dubius group [O. andinus sp. n., O. dubius (Lewis, 1888, O. extraneus sp. n., O. intermissus sp. n., O. lunulus sp. n., O. occultus sp. n., O. perplexus sp. n., O. remotus sp. n., O. validus sp. n., O. variabilis sp. n.], O. hospes group [O. assimilis sp. n., O. belemensis sp. n., O. bulbistoma sp. n., O. callifrons sp. n., O. colombicus sp. n., O. communis sp. n., O. confertus sp. n., O. confluens sp. n., O. curtistrius sp. n., O. diffluens sp. n., O. fusistrius sp. n., O. gratus sp. n., O. hospes (Lewis, 1902, O. ibiscus sp. n., O. ignifer sp. n., O. impositus sp. n., O. incisus sp. n., O. innocuus sp. n., O. inquilinus sp. n., O. minutus sp. n., O. novateutoniae sp. n., O. praecinctus sp. n., O. prominens sp. n., O. rileyi sp. n., O. subterraneus sp. n., O. tenuis sp. n., O. tiputinus sp. n.], O. farctus group [O. atlanticus sp. n., O. bidessois (Marseul, 1889, O. distinctus (Hinton, 1935, O. distractus (Schmidt, 1896 comb. n., O. farctissimus sp. n., O. farctus (Marseul, 1864, O. gilli sp. n., O. impressistrius sp. n., O. inflatus sp. n., O. latemarginatus (Bickhardt, 1920 comb. n., O. petrovi sp. n., O. plicatus (Hinton, 1935 comb. n., O. prolixus sp. n., O. punctifrons sp. n., O. proximus sp. n., O. subrufus sp. n.], O. hirsutipes group [O. guianensis sp. n., O. hirsutipes sp. n.], O. hamistrius group [O. arquus sp. n., O. campbelli sp. n., O. chiapensis sp. n., O. dybasi sp. n., O. geometricus (Casey, 1893 comb. n
Directory of Open Access Journals (Sweden)
--- Various Authors
2015-10-01
. Piras, A. Ravarino, R. Ambu • Cagliari and Pisa (Italy ABS 18. Pulmonary atresia: the importance of prenatal diagnosis • A.L. Costa, H. Soares, A.L. Neves, C. Moura, J.C. Areias, A.C. Fragoso, J. Estevão-Costa, H. Guimarães • Porto (Portugal ABS 19. The use of hypothermia in preterm asphyxiated neonate: new results from a metabolomics point of view • E. d’Aloja, A. Noto, E. Locci, C. Dalmazzo, G. Pomero, A. Dessì, V. Fanos, P. Gancia • Cagliari and Cuneo (Italy ABS 20. Alopecia areata in a child: case report, management and therapy • F. Farnetani, V.D. Mandel, G. Pellacani • Modena (Italy ABS 21. Physiological and therapeutic roles of mesenchymal stem cells. Is there a gap? • U. Galderisi, F. Pentimalli, A. Giordano • Philadelphia (PA, USA, Naples and Siena (Italy, Kayseri (Turkey ABS 22. Esophageal impedance baseline is correlated with exposure to reflux in newborns with GERD symptoms • F. Cresi, E. Locatelli, E. Maggiora, A. Pirra, C. Peila, E. Bertino • Turin (Italy ABS 23. Analytical pitfalls and future perspectives in the measurement of bone metabolism biomarkers • A. Fortunato • Vicenza (Italy ABS 24. Genetic analysis of surfactant proteins genes in premature newborn infants with severe respiratory distress syndrome • M. Somaschini, S. Presi, M. Ferrari P. Carrera • Milan (Italy ABS 25. Child abuse and neglect: an increasing childhood’s condition • S. Cherubini • Busto Arsizio (Italy ABS 26. When a newborn dies: European approaches to responsibility • F. Tregnaghi, R. Carter, J. Ferguson, K. Nijs • Verona (Italy, Devon (UK, and Leuven (Belgium ABS 27. NMR-based screening possibilities in the neonate and comparison to mass spectral methods • M. Spraul, C. Cannet, H. Schäfer • Rheinstetten (Germany ABS 28. Our team project: learning from mistakes • M. Susi, E.M. Padovani, A. Bertolini, M. Lavarini, S. Tardivo • Verona (Italy ABS 29. Peripheral intravenous catheters in neonates • M. Zicchi, A. Farbo • Sassari
Accuracy of a self-collection kit for the microbiological study of the vaginal content
Directory of Open Access Journals (Sweden)
Mauro Romero L. Passos
Full Text Available Diagnosis of vaginal discharge is frequently performed in an empirical way, leading to inadequate treatment. This study tested the accuracy of a self-collection kit for microbiological study of the vaginal content. One hundred and forty-two women of Family Health Program units in Niterói and Piraí cities were enrolled in order to have their vaginal content studied. A brief explanation and a self-collection kit were provided in order to sample the vaginal content. The self-collection kit was composed of one empty plastic tube, two glass slides, a long handle cytobrush, an identification card and guideline notes. The vaginal sample was applied on the glass slides by the women and stained by Gram technique. A second sampling was done by the medical personnel. The microbiological diagnosis in a blinded analysis was made under optical microscopy. A validation diagnosis test was done taking the medical collection results as a gold standard. A total of 106 women had followed the protocol and were included in the study. Microbiological analysis was unsatisfactory in 12 cases (6 cases of self-collection material and 6 cases of medical collection. The microbiological analyses in the self-collection and in the medical collection material were respectively: bacterial vaginosis in 21.7% and 17.9%, non bacillar flora in 10.3% and 11.3%, vaginal trichomoniasis in 5.66% and 5.6%, candidiasis in 3.78% and 2.8% and a normal microbiota in 52.8% and 56.6%. The Kappa coefficient suggested a "very good correlation" of the microbiological results between the two methods of collection (K=0.7945. The self-collection kit provides samples for microbiological analysis of the vaginal microbiota as good as medical collection.
Javid, J; Mir, R; Mirza, M; Imtiyaz, A; Prasant, Y; Mariyam, Z; Julka, P K; Mohan, A; Lone, M; Ray, P C; Saxena, A
2015-04-01
B cell lymphoma 2 (BCL-2) gene is a well-known regulator of apoptosis and a key element in cancer development and progression. A regulatory (-938C>A, rs2279115) single-nucleotide polymorphism in the inhibitory P2 BCL-2 gene promoter generates significantly different BCL-2 promoter activities and has been associated with different clinical outcomes in various malignancies. The aim of the present study was to analyze the possible influence of the (-938C>A) SNP on the risk and survival of Indian patients suffering from NSCLC. A hospital-based case-control study of 155 age- and sex-matched patients diagnosed with NSCLC and 155 cancer-free controls was conducted and genotyped by performing PIRA-PCR to elucidate the putative association between clinical outcome and genotypes of BCL-2 (-938C>A, rs2279115). The association of the polymorphism with the survival of NSCLC patients was analyzed by Kaplan-Meier curves. In Indian NSCLC, patients increased risk of developing NSCLC was found to be associated with BCL-2 (-938) CC genotype, [OR 3.68 (1.92-6.79), RR 1.87 (1.35-2.57) and RD 31.03 (16.79-45.27) p 0.00006 for CC and OR 2.08 (1.18-3.66), RR 1.36 (1.08-1.71) and RD 17.74 (4.68-30.81) p 0.01 for AC genotype]. Patients homozygous for C allele exhibited a significant poor overall survival compared with patients displaying AC + CC or AC or AA genotype [median survival (months) 8 vs. 11 vs. 14 vs. 35.5 (p A) polymorphism. Genetic polymorphism in the inhibitory P2 promoter region of anti-apoptotic BCL-2 genes contributes to the risk of developing non-small-cell lung cancer in Indian population. BCL-2 (-938CC) genotype was an independent adverse prognostic factor for patients with NSCLC.
Directory of Open Access Journals (Sweden)
U.R. Antuniassi
2002-01-01
Full Text Available A remoção de plantas aquáticas tem sido utilizada como opção ao controle químico e biológico, em razão de restrições ambientais em algumas regiões brasileiras. O objetivo deste trabalho foi desenvolver um modelo para análise econômica e operacional da remoção mecânica de plantas aquáticas, visando realizar estudo econômico comparativo com o controle químico. A operação foi estudada num reservatório de uma usina de bombeamento em Barra do Piraí-RJ. O sistema consiste de retroescavadeiras instaladas em balsas, usadas para cortar as plantas e liberá-las no fluxo de água. Antes da tomada d'água existe uma barreira flutuante que intercepta as plantas, as quais são removidas por um guindaste fixo nas margens. As plantas são armazenadas por algum tempo e depois descartadas. Existe, ainda, um sistema de limpeza das grades da tomada d'água. Dados do volume total de plantas descartadas foram coletados durante 14 meses, assim como foi avaliado o volume de biomassa produzido por área das principais espécies infestantes. A empreiteira que administra o serviço forneceu planilhas de custos e outro parâmetros operacionais. Um modelo foi desenvolvido para calcular custos por hectare de plantas removidas. Os resultados mostraram custo médio mensal de US$ 17.780,28 por hectare. Apesar do alto custo, o sistema de remoção demonstrou capacidade de controlar apenas 4,1% da área infestada no reservatório, na época da coleta dos dados. Simulando dados de uma aplicação de glyphosate, o controle químico custaria apenas 0,23% do custo da remoção. Análises de sensibilidade mostraram que a compactação das plantas para transporte, o volume de plantas produzidas por área e o custo do transporte são os parâmetros principais para a otimização.Mechanical removal of aquatic weeds has been an option to biological and chemical control because of environmental restrictions in some places in Brazil. The objective of this study was to
The flat bark beetles (Coleoptera, Silvanidae, Cucujidae, Laemophloeidae of Atlantic Canada
Directory of Open Access Journals (Sweden)
Christopher Majka
2008-09-01
Full Text Available As a result of the present investigations 18 species of flat bark beetles are known to occur in Atlantic Canada, 10 in New Brunswick, 17 in Nova Scotia, four on Prince Edward Island, six on insular Newfoundland, and one in Labrador. Twenty-three new provincial records are reported and nine species, Uleiota debilis (LeConte, Uleiota dubius (Fabricius, Nausibius clavicornis (Kugelann, Ahasverus advena (Waltl, Cryptolestes pusillus (Schönherr, Cryptolestes turcicus (Grouvelle, Charaphloeus convexulus (LeConte, Charaphloeus species nr. adustus, and Placonotus zimmermanni (LeConte are newly recorded in the region, one of which C. sp. nr. adustus, is newly recorded in Canada as a whole. Eight species are cosmopolitan species introduced to the region and North America, nine are native Nearctic species, and one, Pediacus fuscus Erichson, is Holarctic in distribution. All the introduced species except for one (Silvanus bidentatus (Fabricius, a saproxylic species are found on various stored products, whereas all the native species are saproxylic. Ahasverus longulus (Blatchley, is removed from the species list of New Brunswick and Charophloeus adustus (LeConte is removed from the species list of Nova Scotia. One tropical Asian species, Cryptamorpha desjardinsi (Guérin-Méneville, has been intercepted in the region in imported produce, but is not established. The substantial proportion (44% of the fauna that is comprised of introduced species is highlighted, almost all of which are synanthropic species associated with various dried stored products. The island faunas of Prince Edward Island, Cape Breton Island, and insular Newfoundland are diminished in comparison to the mainland fauna, that of Prince Edward Island being exceptionally so in comparison to other saproxylic groups found there. Of the ten native species, four can be categorized as 'apparently rare' (i.e., comprising ≤ 0.005% of specimens examined from the region. It is possibly that the
Zarate, P. F.; Israde-Alcantara, I.; Dorfler, W.; Unkel, I. B.; Dominguez Vazquez, G.; Nelle, O.; Espinoza Encinas, I. R.
2015-12-01
At Lake Chapala (103° 02'W, 20° 15'N) a linear sedimentation rate of 2 mm a-1 for the last 12,000 years was deduced from ten 14C dates. Due to the presence of very old hydrothermal bitumen (14C date: >40,000 years BP) a reservoir effect of c. 2000 years must be taken into account. Pollen results indicate a generally increase in dry forest taxa with an interruption during the middle Holocene. Diatom results allow a zonation into 6 paleoenvironmental phases. Zone 1: From 27 to 26m depth (c. 12,000 yBP), Stephanodiscus niagaraeis the dominant taxa in coincidence with high TOC percents; a transgression into moister conditions is indicated. Zone 2: From 26 to 17m (10,310-8720 cal BP) it is characterized by Aulacoseira granulata indicating an increase in ionic conditions and turbidity in lake as result of a decrease in lacustrine levels. Zone 3: From 17 to 13m (8720-5950 cal BP) it is dominated by C. aff. kuetzingiana and the presence of temperate pollen taxa at 12 m (ca. 5000 YBP) suggest an increase in humid conditions in this interval. Zone 4: From 13 to 8.5m (5950-2840 cal BP) encompass the middle Holocene. Stephanodiscus medius alternating with Surirella ovalis characterize this period and indicate very fluctuant conditions in coincidence with at a decrease of low TOC percents. Zone 5: From 8.5 to 4m (2840-1580 cal BP), mark the establishment of modern conditions until present, with a peak in S. ovalis in coincidence with the high A. granulata, indicating low lake, saline, turbid and more extreme conditions at the base and top of this interval. Zone 6: From 4 to 0m (1580 cal BP to Present) S. medius (over 50%), C. aff. dubius (20 to 40%), perifitic diatoms in low percents (<5%), and A. granulata and S.ovallis in spite of few percents, are observed in concordance with a return of saline conditions of the lake, indicate a regressive phase. Magnetic (susceptibility and paleomagnetism), microprobe analyses on tephra levels, X-ray Fluorescence (XRF) and Difraction (XRD
Samaras, Anastasios; Madesis, Panagiotis; Karaoglanidis, George S
2016-01-01
Botrytis cinerea , is a high risk pathogen for fungicide resistance development. Pathogen' resistance to SDHIs is associated with several mutations in sdh gene. The diversity of mutations and their differential effect on cross-resistance patterns among SDHIs and the fitness of resistant strains necessitate the availability of a tool for their rapid identification. This study was initiated to develop and validate a high-resolution melting (HRM) analysis for the identification of P225H/F/L//T, N230I, and H272L/R/Y mutations. Based on the sequence of sdh B subunit of resistant and sensitive isolates, a universal primer pair was designed. The specificity of the HRM analysis primers was verified to ensure against the cross-reaction with other fungal species and its sensitivity was evaluated using concentrations of known amounts of mutant's DNA. The melting curve analysis generated nine distinct curve profiles, enabling the discrimination of all the four mutations located at codon 225, the N230I mutation, the three mutations located in codon 272, and the non-mutated isolates (isolates of wild-type sensitivity). Similar results were obtained when DNA was extracted directly from artificially inoculated strawberry fruit. The method was validated by monitoring the presence of sdh B mutations in samples of naturally infected strawberry fruits and stone fruit rootstock seedling plants showing damping-off symptoms. HRM analysis data were compared with a standard PIRA-PCR technique and an absolute agreement was observed suggesting that in both populations the H272R mutation was the predominant one, while H272Y, N230I, and P225H were detected in lower frequencies. The results of the study suggest that HRM analysis can be a useful tool for sensate, accurate, and rapid identification of several sdh B mutations in B. cinerea and it is expected to contribute in routine fungicide resistance monitoring or assessments of the effectiveness of anti-resistance strategies implemented in
Directory of Open Access Journals (Sweden)
Anastasios Samaras
2016-11-01
Full Text Available Botrytis cinerea, is a high-risk pathogen for fungicide resistance development. Pathogen` resistance to SDHIs is associated with several mutations in sdh gene. The diversity of mutations and their differential effect on cross-resistance patterns among SDHIs and the fitness of resistant strains necessitate the availability of a tool for their rapid identification. This study was initiated to develop and validate a high-resolution melting (HRM analysis for the identification of P225H/F/L//T, N230I and H272L/R/Y mutations. Based on the sequence of sdhB subunit of resistant and sensitive isolates, a universal primer pair was designed. The specificity of the HRM analysis primers was verified to ensure against the cross-reaction with other fungal species and its sensitivity was evaluated using concentrations of known amounts of mutant`s DNA. The melting curve analysis generated nine distinct curve profiles, enabling the discrimination of all the 4 mutations located at codon 225, the N230I mutation, the 3 mutations located in codon 272 and the non mutated isolates (isolates of wild type sensitivity. Similar results were obtained when DNA was extracted directly from artificially inoculated strawberry fruit. The method was validated by monitoring the presence of sdhB mutations in samples of naturally infected strawberry fruits and stone fruit rootstock seedling plants showing damping off symptoms. HRM analysis data were compared with a standard PIRA-PCR technique and an absolute agreement was observed suggesting that in both populations the H272R mutation was the predominant one, while H272Y, N230I and P225H were detected in lower frequencies. The results of the study suggest that HRM analysis can be a useful tool for sensate, accurate and rapid identification of several sdhB mutations in B. cinerea and it is expected to contribute in routine fungicide resistance monitoring or assessments of the effectiveness of antiresistance strategies implemented in
Directory of Open Access Journals (Sweden)
Mura P
2017-12-01
Full Text Available Paolo Mura,1 Elisabetta Serra,1 Franco Marinangeli,2 Sebastiano Patti,3 Mario Musu,1 Ilenia Piras,3 Maria Valeria Massidda,1 Giorgio Pia,3 Maurizio Evangelista,4 Gabriele Finco1 1Department of Medical Sciences “M. Aresu”, University of Cagliari, Cagliari, Italy; 2Department of Anesthesiology, Intensive Care and Pain Medicine, University of L’Aquila, L’Aquila, Italy; 3Department of Emergency Medicine, Santissima Trinità Hospital, Cagliari, Italy; 4Department of Anesthesiology and Pain Medicine, Cattolica University, Rome, Italy Aim: Pain represents the most frequent cause for patient admission to emergency departments (EDs. Oligoanalgesia is a common problem in this field. The aims of this study were to assess prevalence and intensity of pain in patients who visited a second-level urban ED and to evaluate the efficacy of pharmacological treatment administered subsequent to variations in pain intensity. Methods: A 4-week prospective observational study was carried out on 2,838 patients who visited a second-level urban ED. Pain intensity was evaluated using the Numeric Rating Scale at the moment of triage. The efficacy of prescribed analgesic therapy was evaluated at 30 and 60 minutes, and at discharge. Data concerning pain intensity were classified as absent, slight, mild, or severe. Pain was evaluated in relation to the prescribed therapy. Results: Pain prevalence was 70.7%. Traumatic events were the primary cause in most cases (40.44%, followed by pain linked to urologic problems (13.52%, abdominal pain (13.39%, and nontraumatic musculoskeletal pain (7.10%. Only 32.46% of patients were given pharmacological therapy. Of these, 76% reported severe pain, 19% moderate, and 5% slight, and 66% received nonsteroidal anti-inflammatory drugs or paracetamol, 4% opioids, and 30% other therapies. A difference of at least 2 points on the Numerical Rating Scale was observed in 84% of patients on reevaluation following initial analgesic therapy
Directory of Open Access Journals (Sweden)
Rohtash chand Gupta
2012-05-01
indicus, Mallard Anas platyrhynchos, Gadwall Anas strepera, Northern Shoveller Anas clypeata, Northern Pintail Anas acuta, Garganey Anas querquedula, Common Teal Anas crecca, Common Pochard Aythya ferina, Tufted Pochard Aythya fuligula, Common Coot Fulica atra, Little Ringed Plover Charadrius dubius, Kentish Plover Charadrius alexandrines, Spotted Redshank Tringa erythropus, Common Redshank Tringa tetanus, Marsh Sandpiper Tringa stagnatilis, Wood Sandpiper Tringa glareola and Pied Avocet Recurivirostra avosetta arrive in the extremely dilapidated rural ponds in Haryana from far off places including Russia, Siberia, China, and Caspian region, east Asia each winter season without any break. As such the extinction of ponds in Haryana directly threatens global avian biodiversity.
Directory of Open Access Journals (Sweden)
Jens C Hegg
Full Text Available Animal migrations provide important ecological functions and can allow for increased biodiversity through habitat and niche diversification. However, aquatic migrations in general, and those of the world's largest fish in particular, are imperiled worldwide and are often poorly understood. Several species of large Amazonian catfish carry out some of the longest freshwater fish migrations in the world, travelling from the Amazon River estuary to the Andes foothills. These species are important apex predators in the main stem rivers of the Amazon Basin and make up the region's largest fishery. They are also the only species to utilize the entire Amazon Basin to complete their life cycle. Studies indicate both that the fisheries may be declining due to overfishing, and that the proposed and completed dams in their upstream range threaten spawning migrations. Despite this, surprisingly little is known about the details of these species' migrations, or their life history. Otolith microchemistry has been an effective method for quantifying and reconstructing fish migrations worldwide across multiple spatial scales and may provide a powerful tool to understand the movements of Amazonian migratory catfish. Our objective was to describe the migratory behaviors of the three most populous and commercially important migratory catfish species, Dourada (Brachyplatystoma rousseauxii, Piramutaba (Brachyplatystoma vaillantii, and Piraíba (Brachyplatystoma filamentosum. We collected fish from the mouth of the Amazon River and the Central Amazon and used strontium isotope signatures ((87Sr/(86Sr recorded in their otoliths to determine the location of early rearing and subsequent. Fish location was determined through discriminant function classification, using water chemistry data from the literature as a training set. Where water chemistry data was unavailable, we successfully in predicted (87Sr/(86Sr isotope values using a regression-based approach that related
Hegg, Jens C; Giarrizzo, Tommaso; Kennedy, Brian P
2015-01-01
Animal migrations provide important ecological functions and can allow for increased biodiversity through habitat and niche diversification. However, aquatic migrations in general, and those of the world's largest fish in particular, are imperiled worldwide and are often poorly understood. Several species of large Amazonian catfish carry out some of the longest freshwater fish migrations in the world, travelling from the Amazon River estuary to the Andes foothills. These species are important apex predators in the main stem rivers of the Amazon Basin and make up the region's largest fishery. They are also the only species to utilize the entire Amazon Basin to complete their life cycle. Studies indicate both that the fisheries may be declining due to overfishing, and that the proposed and completed dams in their upstream range threaten spawning migrations. Despite this, surprisingly little is known about the details of these species' migrations, or their life history. Otolith microchemistry has been an effective method for quantifying and reconstructing fish migrations worldwide across multiple spatial scales and may provide a powerful tool to understand the movements of Amazonian migratory catfish. Our objective was to describe the migratory behaviors of the three most populous and commercially important migratory catfish species, Dourada (Brachyplatystoma rousseauxii), Piramutaba (Brachyplatystoma vaillantii), and Piraíba (Brachyplatystoma filamentosum). We collected fish from the mouth of the Amazon River and the Central Amazon and used strontium isotope signatures ((87)Sr/(86)Sr) recorded in their otoliths to determine the location of early rearing and subsequent. Fish location was determined through discriminant function classification, using water chemistry data from the literature as a training set. Where water chemistry data was unavailable, we successfully in predicted (87)Sr/(86)Sr isotope values using a regression-based approach that related the geology
Directory of Open Access Journals (Sweden)
Luis Román Villanueva
1985-12-01
Full Text Available Los tres artículos que a continuación presentamos tienen como objeto detallar tres aspectos fundamentales de la cultura Piro. Este grupo etno-linguistico, pertenece a la familia Arahuaca, al igual que los Campa, Machiguenga y Amuesha, se ubica principalmente en las riberas del río Urubamba perteneciente al distrito de Echarate, Provincia de la Convención, Departamento del Cusco y el Distrito de Sepahua, Provincia de Atalaya, Departamento de Ucayali. La población estimada para este grupo es de 1600 habitantes (Wise, M.R. 1972 que se distribuye en 12 comunidades nativas, de las cuales la mitad están tituladas por el Estado peruano. Sobre este grupo existe regular bibliografía principalmente en lo referido a lingüística, relatos de viajeros y misioneros de diversas órdenes y en menor escala trabajos etnográficos y etno-históricos. En esta serie de artículos los autores pretenden una aproximación en detalle para profundizar el conocimiento que de esta etnia se tiene. Para ello utilizaremos los trabajos anteriores a los cuales sumaremos nuestras notas y apreciaciones recogidas durante cuatro años de trabajo en la zona. El primer artículo de L. Komán pretende explicar la relación entre lo ideológico y lo estético para lo cual se remite a la mitología y las manifestaciones estéticas del grupo piro. En el segundo artículo el mismo autor señala una transformación estructural en el sistema de parentesco piro durante el auge de la explotación del caucho, dando lugar a una variación del modelo original, que garantiza la reproducción biológica y cultural del grupo. El artículo final de V. de Szyzslo describe la forma cómo cada una de las familias de la comunidad pira de Miaría, en el Urubamba, dispone del espacio para la construcción de sus viviendas y locales comunales. Los tres artículos, por lo tanto son complementarios para obtener una visión en detalle de los aspectos ideológicos, socio-políticos y tecnológicos q u
Directory of Open Access Journals (Sweden)
Marcos Vinicius da Silva
1994-10-01
Full Text Available In order to improve the diagnosis of human leptospirosis, we standardized the dot-ELISA for the search of specific IgM antibodies in saliva. Saliva and serum samples were collected simultaneously from 20 patients with the icterohemorrhagic form of the disease, from 10 patients with other pathologies and from 5 negative controls. Leptospires of serovars icterohaemorrhagiae, canicola, hebdomadis, brasiliensis and cynopteri grown in EMJH medium and mixed together in equal volumes, were used as antigen at individual protein concentration of 0.2 µg/µl. In the solid phase of the test we used polyester fabric impregnated with N-methylolacrylamide resin. The antigen volume for each test was 1µl, the saliva volume was 8 µl, and the volume of peroxidase-labelled anti-human IgM conjugate was 30 µl. A visual reading was taken after development in freshly prepared chromogen solution. In contrast to the classic nitrocellulose membrane support, the fabric support is easy to obtain and to handle. Saliva can be collected directly onto the support, a fact that facilitates the method and reduces the expenses and risks related to blood processing.Com a finalidade de melhorar o diagnóstico da leptospirose humana, padronizou-se o teste dot-ELISA para a pesquisa de anticorpos específicos da classe IgM na saliva. Empregaram-se amostras de saliva e soro coletadas simultaneamente de 20 pacientes com a forma ictero-hemorrágica da doença, de 10 pacientes com outras patologias e 5 controles negativos. Culturas de Leptos-pira em meio EMJH, dos sorovares: icterohaemorrhagiae, canicola, hebdomadis, brasiliensis e cynopteri, foram utilizadas como antígeno, na concentração proteica individual de 0,2 µg/µl, misturadas em volumes iguais. Na fase sólida do teste empregou-se tecido de po-liéster impregnado com resina de N-metilol-acrilamida. O volume do antígeno para cada teste foi de 1µl, o de saliva 8µl, o de conjugado anti-IgM humana marcada com peroxidase, de
Mal de Asclepio o Síndrome Judicial Médico
Directory of Open Access Journals (Sweden)
Hernán Urbina Joiro
2015-12-01
Full Text Available
Se asocian crecientemente, de manera criminal, abogados, pacientes y médicos perversos contra médicos honestos, alineando el factor que peor puede degradar la medicina de hoy y potenciar sus otros males. Siendo dios de la medicina, el nacimiento y la muerte de Asclepio estuvieron marcados por la vileza, la que hoy amenaza de muerte a la profesión médica. Pero no hay que olvidar que finalmente Asclepio pudo ser resguardado de la perversidad.
No se trata de la situación de quien denuncia legítimamente una transgresión cometida por un médico. El Mal de Asclepio o Síndrome Judicial Médico describe la actuación calculada por auténticos «enfermos» —en el sentido sociopático—, con manifiesta intención de ocasionar daño a médicos inocentes, comúnmente a través de prácticas delictivas, ocasionando además males permanentes en la salud física y mental de quienes se habían esforzado, irónicamente, para sanar a los demás, en esta era de degradación de la profesión médica, en este momento extraño donde el bastón de Asclepio, dios de la medicina, fue cambiado por el caduceo de Mercurio, dios del comercio y también de los ladrones (1.
Asclepio fue un hijo no nacido, rescatado por un prodigio desde el vientre de su madre muerta y a punto de ser consumida por la pira funeraria. Coronis —o Corónide—, la madre, lo concibió tras un asalto del dios Apolo en la rivera de un río y, sin saber de su estado, cumplió con un pacto matrimonial arreglado por su padre, lo que incitó a Apolo a dar muerte a su joven esposo e impulsó a Artemisa, hermana de Apolo, a asesinar a flechazos a la propia Coronis. Fue el mismo Apolo quien, en el último momento, resolvió extraer del cadáver de Coronis al niño que puso por nombre Asclepio y que en adelante lucharía contra la muerte, incluso resucitando difuntos, hasta que la propia muerte —Hades— convenció de mala fe a Zeus, lo indujo al error —que más tarde
Rossendorf Beamline at ESRF (ROBL-CRG). Bi-annual report 2009/2010
International Nuclear Information System (INIS)
Scheinost, Andreas C.; Baehtz, Carsten
2011-01-01
be continued until May 2012, since the ESRF shuts down for a major upgrade from December 2011 to April 2012. We expect that we will be ready for user operation from June 2012 on, with a better beamline than ever. The beamline staff would like to thank all partners, research groups and organizations who supported the beamline during the last 24 months. Special thanks to the FZD management, the CRG office of the ESRF with Axel Kaprolat as liaison officer and Eric Dettona as lead technician, and to the ESRF safety group members, Paul Berkvens, Patrick Colomp and Yann Pira.
Rossendorf Beamline at ESRF (ROBL-CRG). Bi-annual report 2009/2010
Energy Technology Data Exchange (ETDEWEB)
Scheinost, Andreas C; Baehtz, Carsten [eds.
2011-07-01
be continued until May 2012, since the ESRF shuts down for a major upgrade from December 2011 to April 2012. We expect that we will be ready for user operation from June 2012 on, with a better beamline than ever. The beamline staff would like to thank all partners, research groups and organizations who supported the beamline during the last 24 months. Special thanks to the FZD management, the CRG office of the ESRF with Axel Kaprolat as liaison officer and Eric Dettona as lead technician, and to the ESRF safety group members, Paul Berkvens, Patrick Colomp and Yann Pira.
Directory of Open Access Journals (Sweden)
--- Various Authors
2016-10-01
. Neroni, P.P. Bassareo, G. Ottonello, M. PudduABS 23. KAWASAKI DISEASE IN SARDINIA: A SINGLE-CENTER EXPERIENCE • M.G. Clemente, G. Taras, P. Omeo, M. Pes, M. Pala, R. Mannazzu, R. AntonucciABS 24. COMPLETE ATRIOVENTRICULAR SEPTAL DEFECT (CAVSD AND DOWN'S SYNDROME (DS: WHEN CARDIAC SURGERY IS NOT CORRECTIVE, BUT PALLIATIVE • D. Congiu, E. Aru, M. Furno, P. Neroni, P.P. Bassareo, S. Floris, M. Puddu, G. OttonelloABS 25. CONGENITAL ATRIOVENTRICULAR BLOCK: A CASE REPORT • F. Ayari, H. Chourou, H. Mannai, M. Cheour, I. Ksibi, M. Ben Amara, S. KacemABS 26. MISDIAGNOSED IDIOPATHIC SEVERE DILATED CARDIOMYOPATHY IN A 3-YEAR-OLD BOY • G. Passarella, S. Rossin, C. Santagati, F. Rigon, V. Rametta, M. Berardi, E. Michelin, C. Lorenzetto, F. Rimondi, F. Marino, S. Innaurato, S. Malengo, M. Leopardi, M.A. Padalino, O. Milanesi, S. RugolottoABS 27. DEVELOPING A TOOL FOR THE MANAGEMENT OF PEDIATRIC EMERGENCIES • G. Piras, G. Iasiello, P. Isoni, S. Marongiu, G. Cuna, A. Anedda, I. PirasABS 28. TRAINING IN NEONATAL INTENSIVE CARE UNITS: A THREE-YEAR INNOVATIVE EXPERIENCE IN NEONATAL INTENSIVE CARE UNITS IN ROME (ITALY • M.G. Torrioli, M.F. Coletti, M. D'Agata, M. Marconi, G. Riccio, C. Rogora, G. Seganti, M. Sergo, F. VallettiABS 29. HEPATIC HEMATOPOIESIS: A COMPLEX STEM CELL NICHE AND A DYNAMIC PROCESS • F. Angotzi, C. Gerosa, F. Lai, P. Van Eyken, Y. Gibo, D. FanniABS 30. INTRAOSSEOUS LINE FOR ADENOSINE ADMINISTRATION IN THE NEWBORN: A CASE REPORT • A. Lai, V. Masile, M. MarrasABS 31. CONGENITAL DACRYOCYSTOCELE: CASE REPORT • A. Culurgioni, F. Carta, A. Olla, E. Gioia, N. Chuchueva, R. PuxedduABS 32. HEMOPHAGOCYTIC LYMPHOHISTIOCYTOSIS: THE GREAT DECEIVER • F. Lucca, A. Cappelleri, M. Guarnieri, M. Mauro, S. Spaggiari, L. Andaloro, S. Cesaro, P. BibanABS 33. SUBCLAVIAN VEIN CANNULATION IN NEONATES • D. Gaffo, R. Irmesi, N. Zadra, Z. Merchaoui, P. TissieresABS 34. IS "NARRATIVOMICS" AN OMICS SCIENCE? • K.S. McGreevy, G. DonzelliABS 35
Directory of Open Access Journals (Sweden)
--- Various Authors
2014-06-01
(Italy ABS 9. Traffiking of thymosin beta-4 in the cellular compartments of HepG2 cells at different conditions • M. Piras, M. Piludu, G. Pichiri, P. Coni, T. Cabras, R. Ambu, M. Castagnola; Cagliari and Rome (Italy ABS 10. Thyroid carcinoma in sardinian children and adolescents is often associated with autoimmune thyroiditis • P. Coni, E. Tamponi, A. Lampis, G. Pinna, A.M. Nurchi, S. Farci, M.L. Lai; Cagliari (Italy ABS 11. Prolonging nephrogenesis in preterm infants: a new approach for the prevention of renal disease in adulthood? • A. Sanna, C. Gerosa, D. Fanni, P. Van Eyken, M. Castagnola, R. Ambu; Cagliari, Rome (Italy and Leuven (Belgium ABS 12. Human adrenal gland development: morphogenesis and molecular mechanisms • E. Obinu, V. Fanos, A. Dessì, R. Ambu; Cagliari (Italy ABS 13. Biometrics application for newborns safe identification in Neonatal Intensive Care Units • A. Casanova, S. Barra, M. De Marsico, D. Riccio, L. Barberini, M. Puddu, V. Fanos; Cagliari, Rome and Naples (Italy ABS 14. Metabolomics in neonatal hypoxic-ischemic encephalopathy (HIE: a proposal for a european multicenter study • P. Gancia, G. Pomero, A. Delogu, C. Dalmazzo, G. Palmas, V. Fanos; Cuneo and Cagliari (Italy ABS 15. Longitudinal evaluation of myocardial function in infants with Hypoxic-Ischemic Encephalopathy (HIE: preliminary data • F. Vitali, S. Galletti, A. Aceti, L. Ridolfi, G. Aquilano, M. Fabi, G. Faldella; Bologna (Italy ABS 16. Changes in podocyte number during intrauterine development • M. Desogus, A. Crobe, A. Sanna, C. Gerosa, C. Fanni, C. Loddo, M. Puddu, G. Ottonello, D. Fanni; Cagliari (Italy ABS 17. Efficacy of recombinant human erythropoietin in anemic pregnant women with heterozygous beta-thalassemia • S. Angioni, V. Mais, G.B. Melis; Cagliari (Italy ABS 18. WT1 expression in ontogenesis of human fetus • R. Ambu, L. Vinci, C. Gerosa, D. Fanni, E. Obinu, A. Faa, V. Fanos; Cagliari (Italy ABS 19. Brain hypothermia in perinatal arterial ischemic
Open Source Web Tool for Tracking in a Lowcost Mobile Mapping System
Fissore, F.; Pirotti, F.; Vettore, A.
2017-11-01
During the last decade several Mobile Mapping Systems (MMSs), i.e. systems able to acquire efficiently three dimensional data using moving sensors (Guarnieri et al., 2008, Schwarz and El-Sheimy, 2004), have been developed. Research and commercial products have been implemented on terrestrial, aerial and marine platforms, and even on human-carried equipment, e.g. backpack (Lo et al., 2015, Nex and Remondino, 2014, Ellum and El-Sheimy, 2002, Leica Pegasus backpack, 2016, Masiero et al., 2017, Fissore et al., 2018). Such systems are composed of an integrated array of time-synchronised navigation sensors and imaging sensors mounted on a mobile platform (Puente et al., 2013, Tao and Li, 2007). Usually the MMS implies integration of different types of sensors, such as GNSS, IMU, video camera and/or laser scanners that allow accurate and quick mapping (Li, 1997, Petrie, 2010, Tao, 2000). The typical requirement of high-accuracy 3D georeferenced reconstruction often makes such systems quite expensive. Indeed, at time of writing most of the terrestrial MMSs on the market have a cost usually greater than 50000, which might be expensive for certain applications (Ellum and El-Sheimy, 2002, Piras et al., 2008). In order to allow best performance sensors have to be properly calibrated (Dong et al., 2007, Ellum and El-Sheimy, 2002). Sensors in MMSs are usually integrated and managed through a dedicated software, which is developed ad hoc for the devices mounted on the mobile platform and hence tailored for the specific used sensors. Despite the fact that commercial solutions are complete, very specific and particularly related to the typology of survey, their price is a factor that restricts the number of users and the possible interested sectors. This paper describes a (relatively low cost) terrestrial Mobile Mapping System developed at the University of Padua (TESAF, Department of Land Environment Agriculture and Forestry) by the research team in CIRGEO, in order to test an
New exposure ages for the Last Glacial Cycle in the Sanabria Lake region (northwestern Spain)
Rodríguez-Rodríguez, Laura; Jiménez-Sánchez, Montserrat; Domínguez-Cuesta, María Jose; Rinterknecht, Vincent; Pallàs, Raimon; Braucher, Régis; Bourlès, Didier; Valero-Garcés, Blas
2013-04-01
., 2011. Last deglaciation in northwestern Spain: New chronological and geomorphologic evidence from the Sanabria region. Geomorphology 135, 48-65. Palacios, D., Andrés, N., Úbeda, J., Alcalá, J., Marcos, J., Vázquez-Selem, L., 2012. The importance of poligenic moraines in the paleoclimatic interpretation from cosmogenic dating. Geophysical Research Abstracts 14, EGU2012-3759-1. Pérez-Alberti, A., Valcárcel-Díaz, M., Martini, I.P., Pascucci, V., Andrucci, S., 2011. Upper Pleistocene glacial valley-junction sediments at Pias, Trevinca Mountains, NW Spain. In: Martini, I.P., French, H.M., Pérez-Alberti, A. (Eds.), Ice-Marginal and Periglacial Processes and Sediments. Geological Society (London) Special Publication 354, pp. 93-110. Research funded by the projects LIMNOCLIBER (REN2003-09130-C02-02), IBERLIMNO (CGL2005-20236-E/CLI), LIMNOCAL (CGL2006-13327-C04-01) and GRACCIE (CSD2007-00067) of the Spanish Inter-Ministry Commission of Science and Technology (CICYT). Additional funding was provided by the Fundación Patrimonio Natural de Castilla y León through the project "La investigacion en el Lago de Sanabria dentro del proyecto CALIBRE: perspectivas y posibilidades", and by the projects Consolider Ingenio 2006 (CSD2006-0041, Topo-Iberia), 2003 PIRA 00256, HF02.4, and RISKNAT (2009SGR520). L. Rodríguez-Rodríguez has developed her research under a Severo Ochoa Programme fellowship (FICYT- Asturias).
Directory of Open Access Journals (Sweden)
Antonio Domingos Brescovit
1996-12-01
defolonguei (Berland; H. riveti (Berland; H. sericea (L. Koch. Two spedes are revalidated: Sillus dubius (Chickering and Hatitia defolongli (Berland. Lectotypes and paralectotypes are here designated for eigth species: Anyphaena censoria Keyserling, 1891; A. adfabilis Keyserling, 1891. A simplicipalpis Simon, 1897; Aysha septena Franganillo, 1935; A. cinereovittata Mello-Leitão, 1945; Osoriella osoriana Mello-Leitão, 1922; Teudis sordidus Mello-Leitão, 1941 e Temnida simplex Simon, 1896. A key to 32 genera of Anyphaeninae are provided. Diagnoses, descriptions and illustrations are provided for the genera and species included in this work.
Directory of Open Access Journals (Sweden)
--- Various Authors
2017-10-01
. A CASE OF NORMOCYTIC ANEMIA IN AN INFANT WITH VITAMIN B12 DEFICIENCY • S. Grantaliano, M.G. Pattumelli, M.G. Clemente, C. Locci, R. AntonucciABS 45. THE CHANGING PATTERN OF HEAD INJURY: REPORT OF TWO CASES • V. Del Volgo, M.S. Cosentino, F. Comes, M. Soliani, C. Distefano, L. Bonetti, R. Delmiglio, A.E. Scaramuzza, G. Piccini, L. Bianchini, C. CavalliABS 46. PEMPHIGUS VULGARIS IN CHILDHOOD: A CASE REPORT • A. Manconi, V. Papacciuoli, M.A. Montesu, R. Satta, R. AntonucciABS 47. WHAT ROLE DOES ULTRASONOGRAPHY PLAY IN THE STUDY OF PEDIATRIC CHEST? • M. Marras, G. Vivanet, A. Lai, P.P. Bassareo, D. LongoABS 48. CLINIC-PATHOLOGICAL FEATURES OF PEDIATRIC MYCOSIS FUNGOIDES: TWO CASES DESCRIPTION • L. Pilloni, M. Corbeddu, C. Ferreli, B. Conti, M. Pau, G. Faa, F. RongiolettiABS 49. EXPLORING LIM1 AMONG OLD AND NEW FUNCTIONS • F. Bardanzellu, M.A. Marcialis, M.C. Pintus, V. Fanos, G. FaaABS 50. NEONATAL ATRIAL FLUTTER AND SYNCHRONIZED ELECTRICAL CARDIOVERSION: YOU CAN DO IT IN NEONATAL INTENSIVE CARE UNIT! • P. Bini, G. Natalè, G. Rulfi, L. Pagani, F. Comolli, A. Castiglione, A. Pagliaro, C.M. Pagliotta, L. Leva, M. BarbariniABS 51. PULSE OXIMETRY SCREENING FOR CONGENITAL HEART DEFECTS IN THE FIRST 24 HOURS OF LIFE • S. Perrone, D. Palombo, F. Lotti, I. Fontanarosa, P. Vezzosi, G. BuonocoreABS 52. TAKE CARE OF CHILDREN. THE MEDITERRANEAN DIET IN THE FIRST 1,000 DAYS OF LIFE. A HEALTHY LIFE. WITH THE CONTRIBUTION OF “SARDEGNA RICERCHE” UNDER THE PROJECT “SCIENTIFIC SCHOOL 2017” • V. Fanos, G. Trapani, R. Pintus, A. Dessì, E. Bertino, A. Noto, P. BaireABS 53. THE EFFICACY OF LOW LEVEL LASER THERAPY FOR THE PREVENTION AND TREATMENT OF CHEMOTHERAPY-CAUSED MUCOSITIS IN PEDIATRIC PATIENTS • S. Puggioni, C. Cuscusa, M. Aprile, C. Pala, C. Spiga, N. Satta, A. Piras, G. DenottiABS 54. ENDOMETRIAL STEM CELLS: ANGELS OR DEVILS? • F. Bardanzellu, M.A. Marcialis, V. Masile, V. Fanos, D. Fanni, C. Gerosa, F. Cau, G. FaaABS 55
Directory of Open Access Journals (Sweden)
Oscar A. Shibatta
2005-12-01
Full Text Available Este trabalho teve como objetivo analisar a reprodução e as características físicas e químicas do habitat de Simpsonichthys boitonei Carvalho, 1959, uma espécie rara e endêmica do Distrito Federal. Os peixes foram coletados com peneira em uma poça temporária localizada na Reserva Ecológica do Instituto Brasileiro de Geografia e Estatística (RECOR, bacia do rio Taquara, Distrito Federal. Os exemplares foram medidos (comprimento total em mm e pesados (peso total, peso das gônadas femininas e peso do corpo em gramas para o cálculo do fator de condição (K, do índice gonado-somático (IGS e do índice gonadal (IG. Também foram feitas análises físicas e químicas do ambiente. O brejo permaneceu com água durante oito meses (de dezembro a agosto, com transparência total, profundidade não ultrapassando 25 cm, condutividade menor que 15 µS/cm e pH entre 4,70 a 5,11. O oxigênio dissolvido variou entre 2,60 a 4,15 ppm, e a temperatura da água entre 20 a 25,5ºC. A análise da reprodução evidenciou que são peixes de desova parcelada, cujas fêmeas adultas permanecem com fator de condição alto durante boa parte da vida, diminuindo à medida que envelhecem. Os ovos foram depositados no substrato, e o período de incubação variou de 55 a 100 dias. Em laboratório esses ovos foram mantidos em água, onde 15,4% completaram o desenvolvimento embrionário. A proporção de fêmeas foi significativamente maior que a de machos. Pelas características acima, pode-se inferir que duas gerações do pirá-brasília podem ser encontradas no mesmo período de inundação.This study aims to analyze the reproduction and the physical and chemical characteristics of the habitat of Simpsonichthys boitonei Carvalho, 1959, a rare and endemic species of Distrito Federal. The fish were collected with sieve in a temporary pool located in the Reserva Ecológica do Instituto Brasileiro de Geografia e Estatística (RECOR, rio Taquara basin, Distrito Federal. The specimens were measured (total length in mm, weighted (total weight, feminine gonad weight and body weight in grams, for calculation of condition factor (K, gonad-somatic index (IGS and gonad index (IG. Physical and chemical analyses of environment were also made. The temporary pool was filled with water for eight months (December to August, with total transparency, depth not surpassing 25 cm, conductivity smaller than 15 µS/cm and pH among 4,70 to 5,11. The dissolved oxygen varied among 2,60 to 4,15 ppm, and the temperature of the water among 20 to 25,5 ºC. The analysis of reproduction evidenced that the fish has fractional spawning, whose adult females stay with high condition factor during great part of life, but decreasing with their age. The eggs were deposited in the substratum, and the incubation period varied among 55 to 100 days. In laboratory these eggs were maintained in water, where 15,4% complete the embryonic development. The proportion of females was significantly larger than males. For the characteristics above, we can infer that at least two generations of pirá-brasília can be found in the same flood period.
Directory of Open Access Journals (Sweden)
--- Various Authors
2013-06-01
Full Text Available Selected Abstracts of the 9th International Workshop on Neonatology • LEARNED LESSONS, CHANGING PRACTICE AND CUTTING-EDGE RESEARCH • Cagliari (Italy • October 23rd-26th 2013The Workshop has been organized on behalf of Union of European Neonatal and Perinatal Societies, Union of Mediterranean Neonatal Societies, Italian Society of Neonatology, UNICEF, and under the High Patronage of the President of the Italian Republic. ABS 1. Aetiology and type of reference hospital for neonatal transport in Greece during 2012 • S. Mouskou, C. Varakis, D. Pyrros, N. Iacovidou; Athens (Greece ABS 2. Changes in neonatal outcomes of very low birth weight infants in Hospital of Lithuanian University of Health Sciences • K. Stuikiene, R. Tameliene, D. Stoniene, A. Kudreviciene, V. Ivanauskiene; Kaunas (Lithuania ABS 3. Autoimmune liver disease in childhood • Y. Gibo, D. Fanni, P. Van Eyken, S. Nemolato, G. Floris, C. Gerosa; Matsumoto (Japan, Leuven (Belgium and Cagliari (Italy ABS 4. Lactoferrin attenuates intestinal injury afther perinatal hypoxia and hypothermia • N. Barisic, G. Konstantinidis, V. Stojanovic, A. Doronjski, S. Spasojevic; Novi Sad (Serbia ABS 5. Osteopenia in prematurity: case report • K. Stuikiene, R. Tameliene, D. Stoniene, A. Kudreviciene, V. Ivanauskiene; Kaunas (Lithuania ABS 6. Neonatal Bartter syndrome: case report of a very unusual entity • A. Koutroumpa, K. Georgiou, H. Georgaki, F. Anatolitou; Athens (Greece ABS 7. Placental Growth Factor (PlGF and placental function • I. Atzeni, S.F. Deiana, A. Meloni, B. Piras, P. Zedda, S. Soddu, G. Parodo, G. Faa, G.B. Melis, A.M. Paoletti; Cagliari (Italy ABS 8. Neonatal ECMO: initial experience of Hospital de São João • G. Rocha, P. Soares, T. Henriques-Coelho, J. Correia-Pinto, J. Monteiro, H. Guimarães, R. Roncon-Albuquerque Jr; Porto (Portugal ABS 9. GCMS-based metabolomics analysis of urines in hypoxic neonatal piglets • C. Fattuoni, L. Barberini, N. Iacovidou, T
Directory of Open Access Journals (Sweden)
--- Various Authors
2017-10-01
IN PRETERM NEWBORNS • L. Corvaglia, S. MartiniLECT 19. ALLERGY TO COW’S MILK PROTEIN • M. De Filippo, A. Licari, G.L. MarsegliaLECT 20. GLOMERULAR NUMBER IN LBW BABIES: NOTE FOR THE FUTURE. THE FAULT IS NOT IN OUR STARS BUT MAY BE IN OUR EMBRYOS • G. RemuzziLECT 21. VACCINE-PREVENTABLE DISEASES • A. Villani, E. Bozzola, A.C. Vittucci, A. Grandin, C. Di Camillo, L. LancellaLECT 22. WHAT IS NEW IN PATENT DUCTUS ARTERIOSUS TREATMENT? • F. Bardanzellu, P. Neroni, A. Dessì, M.A. Marcialis, V. FanosLECT 23. NEW PROSPECTS FOR PEDIATRIC RESPIRATORY MEDICINE FROM METABOLOMICS • M. Stocchero, G. Giordano, P. Pirillo, E. Priante, S. Carraro, E. BaraldiLECT 24. NEW BIOMARKERS AND “OMICS” IN PREECLAMPSIA • M. Mussap, C. IeraceLECT 25. MATERNAL MILK: IMMUNOMICS AND MICROBIOMICS • D.G. PeroniLECT 26. NUTRIMETABOLOMICS OF MILK: COLOSTRUM AND MORE • A. Dessì, R. Pintus, F. Cesare Marincola, V. FanosLECT 27. AUTISM FROM CONVENTIONAL DIAGNOSIS TO METABOLOMICS: URINARY METABOLOMICS PROFILE IN A POPULATION OF CHILDREN WITH AUTISM SPECTRUM DISORDERS • P. Curatolo, A. Noto, M. Siracusano, A. Riccioni, L. Mazzone, L. Barberini, V. Fanos, C. FattuoniLECT 28. PLACENTAL BIOMARKERS • A.M. Paoletti, B. Piras, P. Abis, V. Corda, M. Neri, M.F. Marotto, M. Angiolucci, G.B. Melis, F. Coghe, V. MaisLECT 29. BIOMARKERS IN NEONATAL SEPSIS • R. ÖrsLECT 30. ACUTE KIDNEY INJURY IN NEWBORNS • C. AygunLECT 31. BIOMARKERS IN CARDIOLOGY • G. Mercuro, P.P. BassareoLECT 32. QUANTIFICATION IN NEONATAL URINE AND PROFICIENCY TESTING COMPARED TO NON-NMR METHODS • M. Spraul, H. Schäfer, C. Cannet, F. FangLECT 33. ENHANCING IMMUNE RESPONSES IN CHILDREN WITH RECURRENT RESPIRATORY INFECTIONS • G.V. Zuccotti, C. MameliLECT 34. OBSTETRICAL MANAGEMENT IN TWIN PREGNANCIES • E. Cosmi, L. Marin, S. VisentinLECT 35. THE PATHOLOGIST AND TWINS • D. Fanni, C. Gerosa, G. FaaLECT 36. TWINS: THE POWER OF EPIGENETICS • G. Corsello, A. CorselloLECT 37. MANAGEMENT OF