WorldWideScience

Sample records for dual-head pmt clearpet

  1. Validation of GEANT3 simulation studies with a dual-head PMT ClearPET TM prototype

    CERN Document Server

    Ziemons, K; Streun, M; Pietrzyk, U

    2004-01-01

    The ClearPET TM project is proposed by working groups of the Crystal Clear Collaboration (CCC) to develop a 2/sup nd/ generation high performance small animal positron emission tomograph (PET). High sensitivity and high spatial resolution is foreseen for the ClearPET TM camera by using a phoswich arrangement combining mixed lutetium yttrium aluminum perovskite (LuYAP:Ce) and lutetium oxyorthosilicate (LSO) scintillating crystals. Design optimizations for the first photomultiplier tube (PMT) based ClearPET camera are done with a Monte-Carlo simulation package implemented on GEANT3 (CERN, Geneva, Switzerland). A dual-head prototype has been built to test the frontend electronics and was used to validate the implementation of the GEANT3 simulation tool. Multiple simulations were performed following the experimental protocols to measure the intrinsic resolution and the sensitivity profile in axial and radial direction. Including a mean energy resolution of about 27.0% the simulated intrinsic resolution is about (...

  2. Making PMT halftone prints

    Energy Technology Data Exchange (ETDEWEB)

    Corey, J.D.

    1977-05-01

    In the printing process for technical reports presently used at Bendix Kansas City Division, photographs are reproduced by pasting up PMT halftone prints on the artwork originals. These originals are used to make positive-working plastic plates for offset lithography. Instructions for making good-quality halftone prints using Eastman Kodak's PMT materials and processes are given in this report. 14 figures.

  3. A PMT-Block test bench

    International Nuclear Information System (INIS)

    Adragna, P.; Antonaki, A.

    2006-01-01

    The front-end electronics of the ATLAS hadronic calorimeter (Tile Cal) is housed in a unit, called PMT-Block. The PMT-Block is a compact instrument comprising a light mixer, a PMT together with its divider and a 3-in-1 card, which provides shaping, amplification and integration for the signals. This instrument needs to be qualified before being assembled on the detector. A PMT-Block test bench has been developed for this purpose. This test bench is a system which allows fast, albeit accurate enough, measurements of the main properties of a complete PMT-Block. The system, both hardware and software, and the protocol used for the PMT-Blocks characterization are described in detail in this report. The results obtained in the test of about 10 000 PMT-Blocks needed for the instrumentation of the ATLAS (LHC-CERN) hadronic Tile Calorimeter are also reported

  4. A PMT-Block test bench

    Energy Technology Data Exchange (ETDEWEB)

    Adragna, P [Dipartimento di Fisica ' E.Fermi' , Universita di Pisa and Istituto Nazionale di Fisica Nucleare, Sezione di Pisa, Largo B. Pontecorvo 3, Pisa 56127 (Italy); Universita degli studi di Siena, via Roma 56, 53100 Siena (Italy); Antonaki, A [Institute of Accelerating Systems and Applications, P.O. Box 17214, Athens 10024 (Greece); National Capodistrian University of Athens, 30 Panepistimiou st., Athens 10679 (Greece)] (and others)

    2006-08-01

    The front-end electronics of the ATLAS hadronic calorimeter (Tile Cal) is housed in a unit, called PMT-Block. The PMT-Block is a compact instrument comprising a light mixer, a PMT together with its divider and a 3-in-1 card, which provides shaping, amplification and integration for the signals. This instrument needs to be qualified before being assembled on the detector. A PMT-Block test bench has been developed for this purpose. This test bench is a system which allows fast, albeit accurate enough, measurements of the main properties of a complete PMT-Block. The system, both hardware and software, and the protocol used for the PMT-Blocks characterization are described in detail in this report. The results obtained in the test of about 10 000 PMT-Blocks needed for the instrumentation of the ATLAS (LHC-CERN) hadronic Tile Calorimeter are also reported.

  5. Dual head screw hip nailing for trochanteric fractures

    Science.gov (United States)

    Mavrogenis, Andreas F.; Igoumenou, Vasilios G.; Megaloikonomos, Panayiotis D.; Panagopoulos, George N.; Galanopoulos, Ioannis P.; Vottis, Christos Th.; Karamanis, Eirinaios; Koulouvaris, Panayiotis; Papagelopoulos, Panayiotis J.

    2017-01-01

    Introduction: There are limited information and inconclusive results for dual head screw intramedullary hip nails for trochanteric fractures. Therefore, we performed a prospective study to evaluate the healing of fractures, and survival, function, and complications of patients operated with this implant. Methods: We prospectively studied 79 patients (61 women and 18 men; mean age: 84.7 years; range: 65–96 years) with a low-energy trochanteric fracture, treated with a dual head screw intramedullary hip nail from 2013 to 2016. The mean follow-up was 2.1 years (range: 1–3 years); seven patients were lost to follow up. This left 72 patients for further analysis. We evaluated the healing of fractures, and survival, function, and complications of patients. Results: Fracture healing was evident in 70 patients (97.2%) at 2–3 months postoperatively. One patient experienced cut-out and z-effect phenomenon of the head screws. Another patient experienced a periprosthetic femoral diaphysis fracture at the distal tip of the nail. A third patient experienced an acute postoperative superficial skin infection that was treated successfully with wound dressing changes and a course of antibiotics. Sixteen patients (22.2%) deceased within 12 months postoperatively. In the remaining patients, the Harris Hip Score (HHS) at 12 months postoperatively was excellent in 16 (28.6%), good in 23 (41.1%), fair in 10 (17.8%), and poor in 7 patients (12.5%). The function declined after the patients’ fracture. Fair and poor results were related to age > 85 years, poor pre-fracture level of function, and AO/OTA-31-A3 fracture types. Conclusion: The dual head screw intramedullary hip nail is associated with high healing and low complication rates for intertrochanteric fractures. The function of the patients is good or excellent in most cases; however, it declines, especially for those patients with age > 85 years, poor pre-fracture level of function, and AO/OTA-31-A3 fracture types

  6. Dual head screw hip nailing for trochanteric fractures

    Directory of Open Access Journals (Sweden)

    Mavrogenis Andreas F.

    2017-01-01

    Full Text Available Introduction: There are limited information and inconclusive results for dual head screw intramedullary hip nails for trochanteric fractures. Therefore, we performed a prospective study to evaluate the healing of fractures, and survival, function, and complications of patients operated with this implant. Methods: We prospectively studied 79 patients (61 women and 18 men; mean age: 84.7 years; range: 65–96 years with a low-energy trochanteric fracture, treated with a dual head screw intramedullary hip nail from 2013 to 2016. The mean follow-up was 2.1 years (range: 1–3 years; seven patients were lost to follow up. This left 72 patients for further analysis. We evaluated the healing of fractures, and survival, function, and complications of patients. Results: Fracture healing was evident in 70 patients (97.2% at 2–3 months postoperatively. One patient experienced cut-out and z-effect phenomenon of the head screws. Another patient experienced a periprosthetic femoral diaphysis fracture at the distal tip of the nail. A third patient experienced an acute postoperative superficial skin infection that was treated successfully with wound dressing changes and a course of antibiotics. Sixteen patients (22.2% deceased within 12 months postoperatively. In the remaining patients, the Harris Hip Score (HHS at 12 months postoperatively was excellent in 16 (28.6%, good in 23 (41.1%, fair in 10 (17.8%, and poor in 7 patients (12.5%. The function declined after the patients’ fracture. Fair and poor results were related to age > 85 years, poor pre-fracture level of function, and AO/OTA-31-A3 fracture types. Conclusion: The dual head screw intramedullary hip nail is associated with high healing and low complication rates for intertrochanteric fractures. The function of the patients is good or excellent in most cases; however, it declines, especially for those patients with age > 85 years, poor pre-fracture level of function, and AO/OTA-31-A3

  7. Monte Carlo simulation for dual head gamma camera

    International Nuclear Information System (INIS)

    Osman, Yousif Bashir Soliman

    2015-12-01

    Monte Carlo (MC) simulation technique was used widely in medical physics applications. In nuclear medicine MC was used to design new medical imaging devices such as positron emission tomography (PET), gamma camera and single photon emission computed tomography (SPECT). Also it can be used to study the factors affecting image quality and internal dosimetry, Gate is on of monte Carlo code that has a number of advantages for simulation of SPECT and PET. There is a limit accessibilities in machines which are used in clinics because of the work load of machines. This makes it hard to evaluate some factors effecting machine performance which must be evaluated routinely. Also because of difficulties of carrying out scientific research and training of students, MC model can be optimum solution for the problem. The aim of this study was to use gate monte Carlo code to model Nucline spirit, medico dual head gamma camera hosted in radiation and isotopes center of Khartoum which is equipped with low energy general purpose LEGP collimators. This was used model to evaluate spatial resolution and sensitivity which is important factor affecting image quality and to demonstrate the validity of gate by comparing experimental results with simulation results on spatial resolution. The gate model of Nuclide spirit, medico dual head gamma camera was developed by applying manufacturer specifications. Then simulation was run. In evaluation of spatial resolution the FWHM was calculated from image profile of line source of Tc 99m gammas emitter of energy 140 KeV at different distances from modeled camera head at 5,10,15,20,22,27,32,37 cm and for these distances the spatial resolution was founded to be 5.76, 7.73, 10.7, 13.8, 14.01,16.91, 19.75 and 21.9 mm, respectively. These results showed a decrement of spatial resolution with increase of the distance between object (line source) and collimator in linear manner. FWHM calculated at 10 cm was compared with experimental results. The

  8. Perspectives about family meals from single-headed and dual-headed households: a qualitative analysis.

    Science.gov (United States)

    Berge, Jerica M; Hoppmann, Caroline; Hanson, Carrie; Neumark-Sztainer, Dianne

    2013-12-01

    Cross-sectional and longitudinal research has shown that family meals are protective for adolescent healthful eating behaviors. However, little is known about what parents think of these findings and whether parents from single- vs dual-headed households have differing perspectives about the findings. In addition, parents' perspectives regarding barriers to applying the findings on family meals in their own homes and suggestions for more widespread adoption of the findings are unknown. The current study aimed to identify single- and dual-headed household parents' perspectives regarding the research findings on family meals, barriers to applying the findings in their own homes, and suggestions for helping families have more family meals. The current qualitative study included 59 parents who participated in substudy of two linked multilevel studies-EAT 2010 (Eating and Activity in Teens) and Families and Eating and Activity in Teens (F-EAT). Parents (91.5% female) were racially/ethnically and socioeconomically diverse. Data were analyzed using a grounded theory approach. Results from the current study suggest that parents from both single- and dual-headed households have similar perspectives regarding why family meals are protective for healthful eating habits for adolescents (eg, provides structure/routine, opportunities for communication, connection), but provide similar and different reasons for barriers to family meals (eg, single-headed=cost vs dual-headed=lack of creativity) and ideas and suggestions for how to increase the frequency of family meals (eg, single-headed=give fewer options vs dual-headed=include children in the meal preparation). Findings can help inform public health intervention researchers and providers who work with adolescents and their families to understand how to approach discussions regarding reasons for having family meals, barriers to carrying out family meals, and ways to increase family meals depending on family structure. Copyright

  9. Analysis of time resolution in a dual head LSO+PSPMT PET system using low pass filter interpolation and digital constant fraction discriminator techniques

    International Nuclear Information System (INIS)

    Monzo, Jose M.; Lerche, Christoph W.; Martinez, Jorge D.; Esteve, Raul; Toledo, Jose; Gadea, Rafael; Colom, Ricardo J.; Herrero, Vicente; Ferrando, Nestor; Aliaga, Ramon J.; Mateo, Fernando; Sanchez, Filomeno; Mora, Francisco J.; Benlloch, Jose M.; Sebastia, Angel

    2009-01-01

    PET systems need good time resolution to improve the true event rate, random event rejection, and pile-up rejection. In this study we propose a digital procedure for this task using a low pass filter interpolation plus a Digital Constant Fraction Discriminator (DCFD). We analyzed the best way to implement this algorithm on our dual head PET system and how varying the quality of the acquired signal and electronic noise analytically affects timing resolution. Our detector uses two continuous LSO crystals with a position sensitive PMT. Six signals per detector are acquired using an analog electronics front-end and these signals are processed using an in-house digital acquisition board. The test bench developed simulates the electronics and digital algorithms using Matlab. Results show that electronic noise and other undesired effects have a significant effect on the timing resolution of the system. Interpolated DCFD gives better results than non-interpolated DCFD. In high noise environments, differences are reduced. An optimum delay selection, based on the environment noise, improves time resolution.

  10. Analysis of time resolution in a dual head LSO+PSPMT PET system using low pass filter interpolation and digital constant fraction discriminator techniques

    Energy Technology Data Exchange (ETDEWEB)

    Monzo, Jose M. [Digital Systems Design (DSD) Group, ITACA Institute, Universidad Politecnica de Valencia, Camino de Vera s/n, 46022 Valencia (Spain)], E-mail: jmonfer@aaa.upv.es; Lerche, Christoph W.; Martinez, Jorge D.; Esteve, Raul; Toledo, Jose; Gadea, Rafael; Colom, Ricardo J.; Herrero, Vicente; Ferrando, Nestor; Aliaga, Ramon J.; Mateo, Fernando [Digital Systems Design (DSD) Group, ITACA Institute, Universidad Politecnica de Valencia, Camino de Vera s/n, 46022 Valencia (Spain); Sanchez, Filomeno [Nuclear Medical Physics Group, IFIC Institute, Consejo Superior de Investigaciones Cientificas (CSIC), 46980 Paterna (Spain); Mora, Francisco J. [Digital Systems Design (DSD) Group, ITACA Institute, Universidad Politecnica de Valencia, Camino de Vera s/n, 46022 Valencia (Spain); Benlloch, Jose M. [Nuclear Medical Physics Group, IFIC Institute, Consejo Superior de Investigaciones Cientificas (CSIC), 46980 Paterna (Spain); Sebastia, Angel [Digital Systems Design (DSD) Group, ITACA Institute, Universidad Politecnica de Valencia, Camino de Vera s/n, 46022 Valencia (Spain)

    2009-06-01

    PET systems need good time resolution to improve the true event rate, random event rejection, and pile-up rejection. In this study we propose a digital procedure for this task using a low pass filter interpolation plus a Digital Constant Fraction Discriminator (DCFD). We analyzed the best way to implement this algorithm on our dual head PET system and how varying the quality of the acquired signal and electronic noise analytically affects timing resolution. Our detector uses two continuous LSO crystals with a position sensitive PMT. Six signals per detector are acquired using an analog electronics front-end and these signals are processed using an in-house digital acquisition board. The test bench developed simulates the electronics and digital algorithms using Matlab. Results show that electronic noise and other undesired effects have a significant effect on the timing resolution of the system. Interpolated DCFD gives better results than non-interpolated DCFD. In high noise environments, differences are reduced. An optimum delay selection, based on the environment noise, improves time resolution.

  11. X-band Linac for a 6 MeV dual-head radiation therapy gantry

    Energy Technology Data Exchange (ETDEWEB)

    Lee, Seung Hyun; Shin, Seung-Wook; Lee, Jongchul; Kim, Hui-Su [WCU Department of Energy Science, Suwon 440-746 (Korea, Republic of); Lee, Byeong-No; Lee, Byung-Chul [Radiation Instrumentation Research Division, Korea Atomic Energy Research Institute, Jeongeup 56212 (Korea, Republic of); Park, Hyung-dal; Song, Ki-back [Radiation Technology eXcellence (RTX), Daejeon 305-500 (Korea, Republic of); Song, Ho-seung; Mun, Sangchul; Ha, Donghyup [School of Information and Communication Engineering, Sungkyunkwan University, Suwon 440-746 (Korea, Republic of); Chai, Jong-Seo, E-mail: jschai@skku.edu [School of Information and Communication Engineering, Sungkyunkwan University, Suwon 440-746 (Korea, Republic of)

    2017-04-21

    We developed a design for a 6 MeV X-band linear accelerator for radiation therapy in a dual-head gantry layout. The dual-head gantry has two linacs that can be operated independently. Each X-band linac accelerates electron bunches using high-power RF and generates X-rays for radiation therapy. It requires a versatile RF system and pulse sequence to accomplish various radiation therapy procedures. The RF system consists of 9.3 GHz, 2 MW X-band magnetron and associated RF transmission components. A test linac was assembled and operated to characterize its RF performance without beam. This paper presents these results along with a description of the gantry linacs and their operational requirements.

  12. A data acquisition system for coincidence imaging using a conventional dual head gamma camera

    Science.gov (United States)

    Lewellen, T. K.; Miyaoka, R. S.; Jansen, F.; Kaplan, M. S.

    1997-06-01

    A low cost data acquisition system (DAS) was developed to acquire coincidence data from an unmodified General Electric Maxxus dual head scintillation camera. A high impedance pick-off circuit provides position and energy signals to the DAS without interfering with normal camera operation. The signals are pulse-clipped to reduce pileup effects. Coincidence is determined with fast timing signals derived from constant fraction discriminators. A charge-integrating FERA 16 channel ADC feeds position and energy data to two CAMAC FERA memories operated as ping-pong buffers. A Macintosh PowerPC running Labview controls the system and reads the CAMAC memories. A CAMAC 12-channel scaler records singles and coincidence rate data. The system dead-time is approximately 10% at a coincidence rate of 4.0 kHz.

  13. A data acquisition system for coincidence imaging using a conventional dual head gamma camera

    International Nuclear Information System (INIS)

    Lewellen, T.K.; Miyaoka, R.S.; Kaplan, M.S.

    1996-01-01

    A low cost data acquisition system (DAS) was developed to acquire coincidence data from an unmodified General Electric Maxxus dual head scintillation camera. A high impedance pick-off circuit provides position and energy signals to the DAS without interfering with normal camera operation. The signals are pulse-clipped to reduce pileup effects. Coincidence is determined with fast timing signals derived from constant fraction discriminators. A charge-integrating FERA 16 channel ADC feeds position and energy data to two CAMAC FERA memories operated as ping-pong buffers. A Macintosh PowerPC running Labview controls the system and reads the CAMAC memories. A CAMAC 12-channel scaler records singles and coincidence rate data. The system dead-time is approximately 10% at a coincidence rate of 4.0 kHz

  14. The value of attenuation correction in dual-head coincidence imaging

    International Nuclear Information System (INIS)

    Shi Yiping; Huang Gang; Liu Jianjun

    2004-01-01

    Objective: To elucidate the value of attenuation correction (AC) in dual-head coincidence imaging by comparison of phantom and patients images with and without AC. Methods: We used a 20-cm-diameter cylindrical phantom, which contains four spheres of inside diameters of 1.4-2.9 cm for phantom study (1.4 cm, n=2; 2.0 cm, n=l; 2.9 cm, n=1). The axial length of the phantom was 30 cm. The wall thickness of the spheres was 1 mm. Both the phantom and spheres were filled with a solution that contained 18F-FDG. Three acquisitions were performed with the concentrations adjusted to provide a ratio of sphere-to-background activity of 3:1, 5:1 and 10:1. There were 38 patients (30 men and 8 women, age range 31 to 78 years) with suspected lung cancer included in clinical study. All patients were performed pneumonectomies and verified by histopathology. The histological tumor types were adenocarcinoma (n=11), squamous carcinoma (n=8), adenosquamous carcinoma (n=4), large cell carcinoma (n=2), neuroendocrine carcinoma (n=l), metastatic carcinoma (n=4), bronchiolo-alveolar carcinoma (n=1) and benign mass (n=7). The patients were fasted for at least 6 hours before the start of the study. Sixty minutes after intravenous administration of 111-185MBq (3-5mCi) 18F-FDG, emission scanning was performed using a dual-head gamma camera with a 128x128x16 matrix, with energy windows of 511 keV, 180 degree rotation, 32 steps and an acquisition time of 40 s per step. Subsequently, transmission scanning was performed with energy windows of 662 keV, 360 degree rotation, 96 steps and an acquisition time of 2s per step. The coincidence gamma camera imaging data were reconstructed by MCD iterative Methods with a Wiener filter (noise factor 0.75, pixel size 3.95 mm 3 ). Visual analysis and semiquantitative analysis were performed in AC and NAC images. For visual interpretation, a positive lesion was defined as any activity above local background. The count ratio of tumor to surrounded normal tissue (T

  15. Synthetic Pulse Dilation - PMT Model for high bandwidth gamma measurements

    Science.gov (United States)

    Geppert-Kleinrath, H.; Herrmann, H. W.; Kim, Y. H.; Zylstra, A. B.; Meaney, K. D.; Lopez, F. E.; Khater, H.; Horsfield, C. J.; Gales, S.; Leatherland, A.; Hilsabeck, T.; Kilkenny, J. D.; Hares, J. D.; Dymoke-Bradshaw, T.; Milnes, J.

    2017-10-01

    The Cherenkov mechanism used in Gas Cherenkov Detectors (GCD) is exceptionally fast. However, the temporal resolution of GCDs, such as the Gamma Reaction History diagnostic (GRH), is limited by the current state-of-the-art photomultiplier tube (PMT) to 100 ps. The new pulse dilation - PMT (PD-PMT) for NIF allows for a temporal resolution comparable to that of the gas cell, or of 10ps. Enhanced resolution will contribute to the quest for ignition in a crucial way through precision measurement of reaction history and areal density (ρ R) history, leading to better constrained models. Features such as onset of alpha heating, shock reverberations and burn truncation due to dynamically evolving failure modes will become visible for the first time. PD-PMT will be deployed on GCD-3 at NIF in 2018. Our synthetic PD-PMT model evaluates the capabilities of these future measurements, as well as minimum yield requirements for measurements performed in a well at 3.9 m from target chamber center (TCC), and within a diagnostic inserter at 0.2m from TCC.

  16. An application specific integrated circuit for multi-anode PMT

    Energy Technology Data Exchange (ETDEWEB)

    Gaglione, Renaud [Laboratoire de Physique Corpusculaire, 24 avenue des Landais, 63177 Aubiere (France)]. E-mail: gaglione@clermont.in2p3.fr; Bohner, Gerard [Laboratoire de Physique Corpusculaire, 24 avenue des Landais, 63177 Aubiere (France); Lecoq, Jacques [Laboratoire de Physique Corpusculaire, 24 avenue des Landais, 63177 Aubiere (France); Montarou, Gerard [Laboratoire de Physique Corpusculaire, 24 avenue des Landais, 63177 Aubiere (France); Royer, Laurent [Laboratoire de Physique Corpusculaire, 24 avenue des Landais, 63177 Aubiere (France)

    2006-11-01

    The main purpose of this development is to design an 'intelligent sensor', composed of one multi-anode PMT (Hamamatsu H8500), four custom front-end analog chips with embedded analog-to-digital converter and a pre-processing logical unit. The idea of this design is to improve as far as possible the treatment speed of signals of the PMT. This design must be compact to fit the PMT dimensions, in order to combine them together to form an assembly which will be used in medical imaging research, especially for gamma-ray camera at 141keV (Tc99m) with NaI(Tl) crystal.

  17. F-18 FDG PET with coincidence detection, dual-head gamma camera, initial experience in oncology

    Energy Technology Data Exchange (ETDEWEB)

    Chu, J.M.G.; Pocock, N.; Quach, T.; Camden, B.M.C. [Liverpool Health Services, Liverpool, NSW (Australia). Department of Nuclear Medicine and Clinical Ultrasound

    1998-06-01

    Full text: The development of Co-incidence Detection (CD) in gamma camera technology has allowed the use of positron radiopharmaceuticals in clinical practice without dedicated PET facilities. We report our initial experience of this technology in Oncological applications. All patients were administered 200 MBq of F- 18 FDG intravenously in a fasting state, with serum glucose below 8.9 mmol/L., and hydration well maintained. Tomography was performed using an ADAC Solus Molecular Co-incidence Detection (MCD) dual-head gamma camera, 60 minutes after administration and immediately after voiding. Tomography of the torso required up to three collections depending on the length of the patient, with each collection requiring 32 steps of 40 second duration, and a 50% overlap. Tomography of the brain required a single collection with 32 steps of 80 seconds. Patients were scanned in the supine position. An iterative reconstruction algorithm was employed without attenuation correction. All patients had histologically confirmed malignancy. Scan findings were correlated with results of all conventional diagnostic imaging procedures that were pertinent to the evaluation and management of each individual patient`s disease. Correlation with tumour type and treatment status was also undertaken. F-18 FDG uptake as demonstrated by CD-PET was increased in tumour bearing sites. The degree of increased uptake varied with tumour type and with treatment status. Our initial experience with CD-PET has been very encouraging, and has led us to undertake prospective short and long term studies to define its role in oncology

  18. Design of a coincidence processing board for a dual-head PET scanner for breast imaging

    International Nuclear Information System (INIS)

    Martinez, J.D.; Toledo, J.; Esteve, R.; Sebastia, A.; Mora, F.J.; Benlloch, J.M.; Fernandez, M.M.; Gimenez, M.; Gimenez, E.N.; Lerche, Ch.W.; Pavon, N.; Sanchez, F.

    2005-01-01

    This paper describes the design of a coincidence processing board for a dual-head Positron Emission Tomography (PET) scanner for breast imaging. The proposed block-oriented data acquisition system relies on a high-speed DSP processor for fully digital trigger and on-line event processing that surpasses the performance of traditional analog coincidence detection systems. A mixed-signal board has been designed and manufactured. The analog section comprises 12 coaxial inputs (six per head) which are digitized by means of two 8-channel 12-bit 40-MHz ADCs in order to acquire the scintillation pulse, the charge division signals and the depth of interaction within the scintillator. At the digital section, a state-of-the-art FPGA is used as deserializer and also implements the DMA interface to the DSP processor by storing each digitized channel into a fast embedded FIFO memory. The system incorporates a high-speed USB 2.0 interface to the host computer

  19. Accelerating image reconstruction in dual-head PET system by GPU and symmetry properties.

    Directory of Open Access Journals (Sweden)

    Cheng-Ying Chou

    Full Text Available Positron emission tomography (PET is an important imaging modality in both clinical usage and research studies. We have developed a compact high-sensitivity PET system that consisted of two large-area panel PET detector heads, which produce more than 224 million lines of response and thus request dramatic computational demands. In this work, we employed a state-of-the-art graphics processing unit (GPU, NVIDIA Tesla C2070, to yield an efficient reconstruction process. Our approaches ingeniously integrate the distinguished features of the symmetry properties of the imaging system and GPU architectures, including block/warp/thread assignments and effective memory usage, to accelerate the computations for ordered subset expectation maximization (OSEM image reconstruction. The OSEM reconstruction algorithms were implemented employing both CPU-based and GPU-based codes, and their computational performance was quantitatively analyzed and compared. The results showed that the GPU-accelerated scheme can drastically reduce the reconstruction time and thus can largely expand the applicability of the dual-head PET system.

  20. Dual head HIPDM SPECT imaging in the differential diagnosis of dementia with MR and CT correlation

    International Nuclear Information System (INIS)

    Wellman, H.N.; Gilmor, R.; Hendrie, H.; Mock, B.; Kapuscinski, A.; Appledorn, C.R.; Krepshaw, J.

    1985-01-01

    Dual head SPECT brain imaging was performed in 25 patients with a clinical diagnosis of dementia approximately one-half hour after a 5mCi dose of high purity (p,5n) I-123 HIPDM (N,N,N'-Trimethyl-N'-(2-hydroxy-3-methyl-5-iodobenzyl)- 1,3-propane diamine). Tomographic reconstruction used a 30th order, moderate cutoff (0.2) Butterworth filter found previously to optimize low noise and conspicuity. Most patients had CT and MR imaging and some patients were studied more than once. In approximately one-half of patients referred with a diagnosis of dementia of the Alzheimer's type, SPECT results were consistent with multiple infarct dementia (MID). MR studies in most of these patients with MID demonstrated multiple white matter defects correlating with multiple gray matter defects seen with SPECT and consistent with angiogenic disease of the Binswanger's type. While CT demonstrated cortical abnormalities in some patients, the findings were often nonspecific with enlarged ventricles and widened sulci

  1. Multi-modality image reconstruction for dual-head small-animal PET

    International Nuclear Information System (INIS)

    Huang, Chang-Han; Chou, Cheng-Ying

    2015-01-01

    The hybrid positron emission tomography/computed tomography (PET/CT) or positron emission tomography/magnetic resonance imaging (PET/MRI) has become routine practice in clinics. The applications of multi-modality imaging can also benefit research advances. Consequently, dedicated small-imaging system like dual-head small-animal PET (DHAPET) that possesses the advantages of high detection sensitivity and high resolution can exploit the structural information from CT or MRI. It should be noted that the special detector arrangement in DHAPET leads to severe data truncation, thereby degrading the image quality. We proposed to take advantage of anatomical priors and total variation (TV) minimization methods to reconstruct PET activity distribution form incomplete measurement data. The objective is to solve the penalized least-squares function consisted of data fidelity term, TV norm and medium root priors. In this work, we employed the splitting-based fast iterative shrinkage/thresholding algorithm to split smooth and non-smooth functions in the convex optimization problems. Our simulations studies validated that the images reconstructed by use of the proposed method can outperform those obtained by use of conventional expectation maximization algorithms or that without considering the anatomical prior information. Additionally, the convergence rate is also accelerated.

  2. Design of 6 MeV X-band electron linac for dual-head gantry radiotherapy system

    Science.gov (United States)

    Shin, Seung-wook; Lee, Seung-Hyun; Lee, Jong-Chul; Kim, Huisu; Ha, Donghyup; Ghergherehchi, Mitra; Chai, Jongseo; Lee, Byung-no; Chae, Moonsik

    2017-12-01

    A compact 6 MeV electron linac is being developed at Sungkyunkwan University, in collaboration with the Korea atomic energy research institute (KAERI). The linac will be used as an X-ray source for a dual-head gantry radiotherapy system. X-band technology has been employed to satisfy the size requirement of the dual-head gantry radiotherapy machine. Among the several options available, we selected a pi/2-mode, standing-wave, side-coupled cavity. This choice of radiofrequency (RF) cavity design is intended to enhance the shunt impedance of each cavity in the linac. An optimum structure of the RF cavity with a high-performance design was determined by applying a genetic algorithm during the optimization procedure. This paper describes the detailed design process for a single normal RF cavity and the entire structure, including the RF power coupler and coupling cavity, as well as the beam dynamics results.

  3. Magnetic shield of PMT used in DAMPE electromagnetic calorimeter

    CERN Document Server

    Wang, Peilong; Wang, Xiaolian; Xu, Zizong

    2014-01-01

    The magnetic characteristics of photomultiplier tube R5610A-01 are studied in this paper. The experimental data shows that the gain of R5610A-01 loses about 53% when the magnetic field is 3G along its +X axis. A cylinder of one-layer permalloy strip is able to reduce the effect of 3G magnetic field on the PMT's gain to less than 1%. A cylinder of two-layer permalloy is finally used to shield the PMT from the outside field.

  4. Optimization design of a 20-in. elliptical MCP-PMT

    International Nuclear Information System (INIS)

    Chen, Ping; Tian, Jinshou; Wei, Yonglin; Liu, Hulin; Sai, Xiaofeng; He, Jianping; Chen, Lin; Wang, Xing; Lu, Yu

    2017-01-01

    This paper describes the simulation work for optimizing the newly developed 20-in. elliptical MCP-PMT by enlarging the outside diameters of the two focusing electrodes and the open area of the glass bulb. Effects of biasing voltages applied to the two focusing electrodes and the MCP input facet are studied. With the new design of the 20 in. MCP-PMT, the transit time spread of the prototype can be less than 3 ns and the collection efficiency is as much as the present prototype.

  5. Evaluation of flat panel PMT for gamma ray imaging

    International Nuclear Information System (INIS)

    Pani, R.; Cinti, M.N.; Pellegrini, R.; Trotta, C.; Trotta, G.; Montani, L.; Ridolfi, S.; Garibaldi, F.; Scafe, R.; Belcari, N.; Del Guerra, A.

    2003-01-01

    The first position sensitive PMT, Hamamatsu R2486, developed in 1985, represented a strong technological advance for gamma-ray imaging. Hamamatsu H8500 Flat Panel PMT is the last generation position sensitive PMT: extremely compact with 2 in. active area. Its main features are: minimum peripheral dead zone (1 mm) and height of 12 mm. It was designed to be assembled in array to cover large detection area. It can represent a technical revolution for many applications in the field of gamma-ray imaging as for example nuclear medicine. This tube is based on metal channel dynode for charge multiplication and 8x8 anodes for charge collection and position calculation. In this paper we present a preliminary evaluation of the imaging performances addressed to nuclear medicine application. To this aim we have taken into account two different electronic readouts: resistive chain with Anger Camera principle and multianode readout. Flat panel PMT was coupled to CsI(Tl) and NaI(Tl) scintillation arrays. The results were also compared with the first generation PSPMT

  6. Electromagnetic Compatibility (EMC) and Noise Background Testing for Double Chooz PMT System

    Energy Technology Data Exchange (ETDEWEB)

    Cepero, J. R.; Encabo Fernandez, F. J.; Pepe, I.; Verdugo, A.

    2009-05-21

    The Double Chooz PMT system is a HV/signal splitter. In this report is presented an electromagnetic compatibility and background noise testing for the Double Chooz PMT system. It was possible to proceed the EMC testing on different grounding configurations of PMT splitter due to its special PCB design, endowed of jumping points and a metal box ground electrode. (Author)

  7. Electromagnetic Compatibility (EMC) and Noise Background Testing for Double Chooz PMT System

    International Nuclear Information System (INIS)

    Cepero, J. R.; Encabo Fernandez, F. J.; Pepe, I.; Verdugo, A.

    2009-01-01

    The Double Chooz PMT system is a HV/signal splitter. In this report is presented an electromagnetic compatibility and background noise testing for the Double Chooz PMT system. It was possible to proceed the EMC testing on different grounding configurations of PMT splitter due to its special PCB design, endowed of jumping points and a metal box ground electrode. (Author)

  8. Dynamic molecular imaging of cardiac innervation using a dual head pinhole SPECT system

    International Nuclear Information System (INIS)

    Hu, Jicun; Boutchko, Rostyslav; Sitek, Arkadiusz; Reutter, BryanW.; Huesman, Ronald H.; Gullberg, Grant T.

    2008-01-01

    Typically 123I-MIBG is used for the study of innervation and function of the sympathetic nervous system in heart failure. The protocol involves two studies: first a planar or SPECT scan is performed to measure initial uptake of the tracer, followed some 3-4 hours later by another study measuring the wash-out of the tracer from the heart. A fast wash-out is indicative of a compromised heart. In this work, a dual head pinhole SPECT system was used for imaging the distribution and kinetics of 123I-MIBG in the myocardium of spontaneous hypertensive rats (SHR) and normotensive Wistar Kyoto (WKY) rats. The system geometry was calibrated based on a nonlinear point projection fitting method using a three-point source phantom. The angle variation effect of the parameters was modeled with a sinusoidal function. A dynamic acquisition was performed by injecting 123I-MIBG into rats immediately after starting the data acquisition. The detectors rotated continuously performing a 360o data acquisition every 90 seconds. We applied the factor analysis (FA)method and region of interest (ROI) sampling method to obtain time activity curves (TACs)in the blood pool and myocardium and then applied two-compartment modeling to estimate the kinetic parameters. Since the initial injection bolus is too fast for obtaining a consistent tomographic data set in the first few minutes of the study, we applied the FA method directly to projections during the first rotation. Then the time active curves for blood and myocardial tissue were obtained from ROI sampling. The method was applied to determine if there were differences in the kinetics between SHR and WKY rats and requires less time by replacing the delayed scan at 3-4 hours after injection with a dynamic acquisition over 90 to 120 minutes. The results of a faster washout and a smaller distribution volume of 123I-MIBG near the end of life in the SHR model of hypertrophic cardiomyopthy may be indicative of a failing heart in late stages of heart

  9. Usefulness of FDG PET for nodal staging using a dual head coincidence camera in patients with lung cancer

    International Nuclear Information System (INIS)

    Yoon, Seok Nam; Park, Chan H.; Lee, Myoung Hoon; Hwang, Kyung Hoon; Hwang, Kyung Hoon

    2001-01-01

    Staging of lung cancer requires an accurate evaluation of the mediastinum. Positron imaging with dual head cameras may be not as sensitive as dedicated PET. Therefore, the purpose of the study was to evaluated the usefulness of F-18 FDG coincidence (CoDe) PET using a dual-head gamma camera in the nodal staging of the lung cancer. CoDe-PET studies were performed in 51 patients with histologically proven non small cell lung cancer. CoDe-PET began 60 minutes after the injection of 111-185 MBq of F-18 FDG. CoDe-PET was performed using a dual-head gamma camera equipped with coincidence detection circuitry (Elscints Varicam, Haifa, lsrael). There was no attenuation correction made and reconstruction was done using a filtered back-projection. Surgery was performed in 49 patients CoDe-PET studies were evaluated visually. Any focal increased uptake was considered abnormal. The nodal stating of CoDe-PET studies were evaluated visually. Any focal increased uptake was considered abnormal. The nodal staging of CoDe-PET and of CT were compared with the nodal stating of surgical (49) and mediastinoscopical (2) pathology. All primary lung lesions were hypermetabolic and easily visualized. Compared with surgical nodal staging as a gold standard, false positives occurred in 13 CoDe PET and 17 CT studies and false negative occurred in 5 CoDe-PET and 4 CT studies. Assessment of lymph node involvement by CoDe-PET depicted a sensitivity of 67%, specificity of 64% and accuracy of 65%. CT revealed a sensitivity of 73%, specificity of 53% and accuracy of 59% in the assessment of lymph node involvement. The detection of primary lesions were 100% but nodal staging was suboptimal for routine clinical use. This is mainly due to limited resolution of our system

  10. PMT signal increase using a wavelength shifting paint

    Energy Technology Data Exchange (ETDEWEB)

    Allada, K. [Massachusetts Institute of Technology, Cambridge, MA 02139 (United States); Hurlbut, Ch. [Eljen Technology, Sweetwater, TX 79556 (United States); Ou, L.; Schmookler, B. [Massachusetts Institute of Technology, Cambridge, MA 02139 (United States); Shahinyan, A. [Yerevan Physics Institute, Yerevan (Armenia); Wojtsekhowski, B., E-mail: bogdanw@jlab.org [Thomas Jefferson National Accelerator Facility, Newport News, VA 23606 (United States)

    2015-05-11

    We report a 1.65 times increase of the PMT signal and a simple procedure of application of a new wavelength shifting (WLS) paint for PMTs with non-UV-transparent windows. Samples of four different WLS paints, made from hydrocarbon polymers and organic fluors, were tested on a 5-in. PMT (ET 9390KB) using Cherenkov radiation produced in fused silica disks by {sup 106}Ru electrons on a ‘table-top’ setup. The best performing paint was employed on two different types of 5-in. PMTs (ET 9390KB and XP4572B), installed in atmospheric pressure CO{sub 2} gas Cherenkov detectors, and tested using GeV electrons.

  11. Our experience with the acceptance and dosimetric validation of Somatom Force dual head MDCT in the Royal Hospital, Oman

    International Nuclear Information System (INIS)

    Al-Harthi, Ruqaia; Al-Kalbani, Munira; Arun Kumar, L.S.; Al-Shanfari, Jamal

    2017-01-01

    Computed Tomography (CT) has revolutionized diagnostic imaging since its discovery in early 70's. In Oman; 70,353 CT examinations were carried out in the year 2015. The increase in CT examinations will eventually result in the increase of population dose and the consequent risk of cancer in adults and particularly in children. Here, we discuss and share our experience with the acceptance and dosimetric validation of second Dual Head Somatom Force MDCT installed in the Royal Hospital, Oman using Ministry of Health's radiation acceptance and quality assurance protocol, before handing over for routine patient care work

  12. A novel high resolution and high efficiency dual head detector for molecular breast imaging: New results from clinical trials

    Energy Technology Data Exchange (ETDEWEB)

    Garibaldi, F., E-mail: franco.garibaldi@iss.infn.i [ISS and INFN Roma, gr. Sanita, Rome (Italy); Cisbani, E.; Colilli, S.; Cusanno, F.; Fratoni, R.; Giuliani, F.; Gricia, M.; Lucentini, M.; Magliozzi, M.L.; Santavenere, F.; Torrioli, S. [ISS and INFN Roma, gr. Sanita, Rome (Italy); Musico, P. [INFN Genova, Genova (Italy); Argentieri, A. [INFN Bari, Bari (Italy); Cossu, E.; Padovano, F.; Simonetti, G. [ISS and INFN Roma, gr. Sanita, Rome (Italy); Schillaci, O. [University of Tor Vergata, Rome (Italy); Majewski, S. [West Virginia University, Morgantown, West Virginia (United States)

    2010-05-21

    Detecting small breast tumors is a challenging task. Molecular Breast Imaging with radionuclides has a central role to play in this respect. Our group has recently designed and implemented a dual detector setup that allows spot compression and improves significantly the performance of the system. The single head detector has been successfully used for clinical trials with 10 patients in comparison with a commercial high resolution detector. Then the dual head system has been showed to have significant advantages for the detection of small tumors.

  13. Equalisation of the PMT response to charge particles for the LUCID detector of the ATLAS experiment

    CERN Document Server

    Vittori, Camilla

    2014-01-01

    With a view to the Run II of LHC, 44 Hamamatsu R760 PMTs have been calibrated with a 207Bi source. The working point of each PMT has been xed in order to equalise the PMT gain at a value smaller than $10^{5}$. Studies on the reproducibility and the stability in time of such calibration permitted to reach a 5% accuracy on PMT gain. In addition, an evaluation of the relative gain of 10 modied PMTs has been performed.

  14. Flat Panel PMT: advances in position sensitive photodetection

    International Nuclear Information System (INIS)

    Pani, R.; Pellegrini, R.; Trotta, C.; Cinti, M.N.; Bennati, P.; Trotta, G.; Iurlaro, G.; Montani, L.; Ridolfi, S.; Cusanno, F.; Garibaldi, F.

    2003-01-01

    Over the last ten years there was being a strong advancement in photodetection. Different application fields are involved in their use in particular high energy physics, astrophysics and nuclear medicine. They usually work by coupling a scintillation crystal and more recent scintillation arrays with pixel size as small as 0.5 mm. PSPMT represents today the most ready technology for photodetection with large detection areas and very high spatial resolution. Flat panel PMT represents the last technological advancement. Its dimension is 50x50 mm 2 with a narrow peripheral dead zone (0.5 mm final goal). Its compactness allow to assemble different modules closely packed, achieving large detection areas with an effective active area of 97%. In this paper we analyze the imaging performances of PSPMT by coupling two scintillation arrays and by light spot scanning of photocathode to evaluate the linearity position response, spatial resolution and uniformity gain response as a function of light distribution spread and the number of photoelectrons generated on photocathode. The results point out a very narrow PMT intrinsic charge spread and low cross-talk between anodes. Energy resolution and spatial resolution show a good linearity with DRF variation. An unexpected intra-anode gain variation is carried out. In this paper we present the results obtained with this PSPMT regarding imaging performances principally addressed to nuclear medicine application

  15. Development of an ultrahigh-resolution Si-PM-based dual-head GAGG coincidence imaging system

    Science.gov (United States)

    Yamamoto, Seiichi; Watabe, Hiroshi; Kanai, Yasukazu; Kato, Katsuhiko; Hatazawa, Jun

    2013-03-01

    A silicon photomultiplier (Si-PM) is a promising photodetector for high resolution PET systems due to its small channel size and high gain. Using Si-PMs, it will be possible to develop a high resolution imaging systems. For this purpose, we developed a small field-of-view (FOV) ultrahigh-resolution Si-PM-based dual-head coincidence imaging system for small animals and plant research. A new scintillator, Ce doped Gd3Al12Ga3O12 (GAGG), was selected because of its high light output and its emission wavelength matched with the Si-PM arrays and contained no radioactivity. Each coincidence imaging block detector consists of 0.5×0.5×5 mm3 GAGG pixels combined with a 0.1-mm thick reflector to form a 20×17 matrix that was optically coupled to a Si-PM array (Hamamatsu MPPC S11064-050P) with a 1.5-mm thick light guide. The GAGG block size was 12.0×10.2 mm2. Two GAGG block detectors were positioned face to face and set on a flexible arm based detector stand. All 0.5 mm GAGG pixels in the block detectors were clearly resolved in the 2-dimensional position histogram. The energy resolution was 14.4% FWHM for the Cs-137 gamma ray. The spatial resolution was 0.7 mm FWHM measured using a 0.25 mm diameter Na-22 point source. Small animal and plant images were successfully obtained. We conclude that our developed ultrahigh-resolution Si-PM-based dual-head coincidence imaging system is promising for small animal and plant imaging research.

  16. A PMT mass testing facility for the JUNO experiment

    Energy Technology Data Exchange (ETDEWEB)

    Tietzsch, Alexander; Alsheimer, Isabell; Blum, David; Lachenmaier, Tobias; Sterr, Tobias [Physikalisches Institut, Universitaet Tuebingen (Germany); Bein, Bosse; Bick, Daniel; Ebert, Joachim; Hagner, Caren; Rebber, Henning; Steppat, Lisa; Wonsak, Bjoern [Institut fuer Experimentalphysik, Universitaet Hamburg (Germany)

    2016-07-01

    The JUNO (Jiangmen Underground Neutrino Observatory) experiment will be one of the big neutrino oscillation experiments starting in the next years. The main goal of JUNO is the determination of the neutrino mass hierarchy. To detect the sub-dominant effects in the oscillation pattern which depend on the mass hierarchy, the JUNO detector is planned with almost 20 kt fiducial volume, high light yield and energy resolution of better than 3%. In order to reach this, roughly 17000 newly developed high QE PMTs for the central detector, and additionally 2000 for the veto will be used. Each PMT has to be tested and characterized before it will be mounted in the experiment. This talk gives an overview on our plans and strategy for the mass test of all PMTs, and on the current status of the experimental test setup and next steps. The testing facility is developed in a cooperation between the Physical Institutes in Tuebingen and Hamburg within the JUNO collaboration.

  17. A novel PMT test system based on waveform sampling

    Science.gov (United States)

    Yin, S.; Ma, L.; Ning, Z.; Qian, S.; Wang, Y.; Jiang, X.; Wang, Z.; Yu, B.; Gao, F.; Zhu, Y.; Wang, Z.

    2018-01-01

    Comparing with the traditional test system based on a QDC and TDC and scaler, a test system based on waveform sampling is constructed for signal sampling of the 8"R5912 and the 20"R12860 Hamamatsu PMT in different energy states from single to multiple photoelectrons. In order to achieve high throughput and to reduce the dead time in data processing, the data acquisition software based on LabVIEW is developed and runs with a parallel mechanism. The analysis algorithm is realized in LabVIEW and the spectra of charge, amplitude, signal width and rising time are analyzed offline. The results from Charge-to-Digital Converter, Time-to-Digital Converter and waveform sampling are discussed in detailed comparison.

  18. A simple method to increase effective PMT gain by amplifier circuit powered from voltage divider

    International Nuclear Information System (INIS)

    Popov, V.; Majewski, S.; Wojtsekhowski, B.; Guerin, D

    2001-01-01

    A novel concept is introduced of additional effective signal amplification by employing a dedicated circuit to process anode or dynode signals prior to sending them through a standard 50 /spl Omega/ line/cable. The circuit is entirely powered by the current flowing through the base voltage divider. Additional gain factors of 2-10 were easily achieved with preserved operation speed and rate capability up to several MHz. This additional signal boost can be used in many applications where higher gain and/or lower PMT operational voltages are desirable. For example, in the case of a PMT employed in a low input light signal (such as a Cherenkov counter), this technique will permit operation at a lower voltage and, therefore, will result in better operational PMT stability and longer PMT lifetime. At present, two experimental set-ups at Jefferson Lab are using PMT bases using this concept

  19. Performance evaluation of a rotatory dual-head PET system with 90o increments for small animal imaging

    Science.gov (United States)

    Meng, F.; Zhu, S.; Li, L.; Wang, J.; Cao, X.; Cao, X.; Chen, X.; Liang, J.

    2017-09-01

    A rotatory dual-head positron emission tomography (PET) system with 90o increments has been built up by our lab. In this study, a geometric calibration phantom was designed and then used to calibrate the geometric offset of the system. With the geometric calibration, the artifacts in the reconstructed images were greatly eliminated. Then, we measured the imaging performance including resolution, sensitivity and image quality. The results showed that the full width at half maximum (FWHMs) of the point source were about 1.1 mm in three directions. The peak absolute sensitivity in the center of the field of view varied from 5.66% to 3.17% when the time window was fixed to 10 ns and the energy window was changed from 200-800 keV to 350-650 keV. The recovery coefficients ranged from 0.13 with a standard deviation of 17.5% to 0.98 with a standard deviation of 15.76%. For the air-filled and water-filled chamber, the spill-over ratio was 14.48% and 15.38%, respectively. The in vivo mouse experiment was carried out and further demonstrated the potential of our system in small animal studies.

  20. Role of Fluorine-18-Fluorodeoxyglucose in the Work-up of Febrile AIDS Patients. Experience with Dual Head Coincidence Imaging.

    Science.gov (United States)

    Santiago, Jonas F.; Jana, Suman; Gilbert, Holly M.; Salem, Shahenda; Bellman, Paul Curtis; Hsu, Ricky K.S.; Naddaf, Sleiman; Abdel-Dayem, Hussein M.

    1999-11-01

    OBJECTIVE AND METHODS: This study was undertaken to find the role of fluorine-18-fluorodeoxyglucose (F18-FDG) in the diagnostic work-up of febrile Acquired Immune Deficiency Syndrome (AIDS) patients. Forty-seven (42 male and 5 female; mean age = 40.3 years) febrile patients with AIDS underwent imaging with F18-FDG by Dual Head Coincidence Imaging (DHCI). Findings were correlated with other imaging modalities.RESULTS: Our data show good sensitivity for scanning with F18-FDG by DHCI in determining the extent of Castleman's disease, lymphoma, Kaposi's sarcoma (KS), adenocarcinoma, and germ cell carcinoma. Various opportunistic infections also manifest with increased F18-FDG uptake.CONCLUSION: Total-body imaging can be done with F18-FDG with better resolution and a shorter procedure time compared to imaging with Gallium-67 (Ga-67). Furthermore, F18-FDG is more sensitive than Ga-67 for evaluating extent of involvement in various pathologies affecting AIDS patients. The new technology of DHCI is a good alternative for hospitals with no dedicated positron emission tomography (PET) scanner.

  1. Performance evaluation of a rotatory dual-head PET system with 90o increments for small animal imaging

    International Nuclear Information System (INIS)

    Meng, F.; Zhu, S.; Li, L.; Wang, J.; Cao, X.; Cao, X.; Chen, X.; Liang, J.

    2017-01-01

    A rotatory dual-head positron emission tomography (PET) system with 90 o increments has been built up by our lab. In this study, a geometric calibration phantom was designed and then used to calibrate the geometric offset of the system. With the geometric calibration, the artifacts in the reconstructed images were greatly eliminated. Then, we measured the imaging performance including resolution, sensitivity and image quality. The results showed that the full width at half maximum (FWHMs) of the point source were about 1.1 mm in three directions. The peak absolute sensitivity in the center of the field of view varied from 5.66% to 3.17% when the time window was fixed to 10 ns and the energy window was changed from 200-800 keV to 350–650 keV. The recovery coefficients ranged from 0.13 with a standard deviation of 17.5% to 0.98 with a standard deviation of 15.76%. For the air-filled and water-filled chamber, the spill-over ratio was 14.48% and 15.38%, respectively. The in vivo mouse experiment was carried out and further demonstrated the potential of our system in small animal studies.

  2. Initial experience with a prototype dual-crystal (LSO/NaI) dual-head coincidence camera in oncology

    International Nuclear Information System (INIS)

    Joshi, Urvi; Boellaard, Ronald; Comans, Emile F.I.; Raijmakers, Pieter G.H.M.; Pijpers, Rik J.; Teule, Gerrit J.J.; Lingen, Arthur van; Hoekstra, Otto S.; Miller, Steven D.

    2004-01-01

    The aim of this study was to evaluate the in vivo performance of a prototype dual-crystal [lutetium oxyorthosilicate (LSO)/sodium iodide (NaI)] dual-head coincidence camera (DHC) for PET and SPET (LSO-PS), in comparison to BGO-PET with fluorine-18 fluorodeoxyglucose (FDG) in oncology. This follows earlier reports that LSO-PS has noise-equivalent counting (NEC) rates comparable to partial ring BGO-PET, i.e. clearly higher than standard NaI DHCs. Twenty-four randomly selected oncological patients referred for whole-body FDG-PET underwent BGO-PET followed by LSO-PS. Four nuclear medicine physicians were randomised to read a single scan modality, in terms of lesion intensity, location and likelihood of malignancy. BGO-PET was considered the gold standard. Forty-eight lesions were classified as positive with BGO-PET, of which LSO-PS identified 73% (95% CI 60-86%). There was good observer agreement for both modalities in terms of intensity, location and interpretation. Lesions were missed by LSO-PS in 13 patients in the chest (n=6), neck (n=3) and abdomen (n=4). The diameter of these lesions was estimated to be 0.5-1 cm. Initial results justify further evaluation of LSO-PS in specific clinical situations, especially if a role as an instrument of triage for PET is foreseen. (orig.)

  3. Use of dual-head gamma camera in radionuclide internal contamination monitoring on radiation workers from a nuclear medicine department

    International Nuclear Information System (INIS)

    Rodriguez-Laguna, A.; Brandan, M.E.

    2008-01-01

    As a part of an internal dosimetry program that is performed at the Mexican National Institute of Cancerology - Nuclear Medicine Department, in the present work we suggest a procedure for the routinely monitoring of internal contamination on radiation workers and nuclear medicine staff. The procedure is based on the identification and quantification of contaminating radionuclides in human body by using a dual-head whole-body gamma camera. The results have shown that the procedures described in this study can be used to implement a method to quantify minimal accumulated activity in the main human organs to evaluate internal contamination with radionuclides. The high sensitivity of the uncollimated gamma camera is advantageous for the routinely detection and identification of small activities of internal contamination. But, the null spatial resolution makes impossible the definition of contaminated region of interest. Then, the use of collimators is necessary to the quantification of incorporated radionuclides activities in the main human organs and for the internal doses assessment. (author)

  4. The O-methyltransferase PMT2 mediates methylation of pinosylvin in Scots pine.

    Science.gov (United States)

    Paasela, Tanja; Lim, Kean-Jin; Pietiäinen, Milla; Teeri, Teemu H

    2017-06-01

    Heartwood extractives are important determinants of the natural durability of pine heartwood. The most important phenolic compounds affecting durability are the stilbenes pinosylvin and its monomethylether, which in addition have important functions as phytoalexins in active defense. A substantial portion of the synthesized pinosylvin is 3-methoxylated but the O-methyltransferase responsible for this modification has not been correctly identified. We studied the expression of the stilbene pathway during heartwood development as well as in response to wounding of xylem and UV-C treatment of needles. We isolated and enzymatically characterized a novel O-methyltransferase, PMT2. The methylated product was verified as pinosylvin monomethylether using ultra performance liquid chromatography-tandem mass spectrometry and high performance liquid chromatography analyses. The PMT2 enzyme was highly specific for stilbenes as substrate, in contrast to caffeoyl-CoA O-methyltransferase (CCoAOMT) and PMT1 that were multifunctional. Expression profile and multifunctional activity of CCoAOMT suggest that it might have additional roles outside lignin biosynthesis. PMT1 is not involved in the stilbene pathway and its biological function remains an open question. We isolated a new specific O-methyltransferase responsible for 3-methoxylation of pinosylvin. Expression of PMT2 closely follows stilbene biosynthesis during developmental and stress induction. We propose that PMT2 is responsible for pinosylvin methylation in Scots pine (Pinus sylvestris), instead of the previously characterized methyltransferase, PMT1. © 2017 The Authors. New Phytologist © 2017 New Phytologist Trust.

  5. Auranofin Inhibits the Enzyme Activity of Pasteurella multocida Toxin PMT in Human Cells and Protects Cells from Intoxication

    Directory of Open Access Journals (Sweden)

    Stefan Carle

    2017-01-01

    Full Text Available The AB-type protein toxin from Pasteurella multocida (PMT contains a functionally important disulfide bond within its catalytic domain, which must be cleaved in the host cell cytosol to render the catalytic domain of PMT into its active conformation. Here, we found that the reductive potential of the cytosol of target cells, and more specifically, the activity of the thioredoxin reductase (TrxR is crucial for this process. This was demonstrated by the strong inhibitory effect of the pharmacological TrxR inhibitor auranofin, which inhibited the intoxication of target cells with PMT, as determined by analyzing the PMT-catalyzed deamidation of GTP-binding proteins (G-proteins in the cytosol of cells. The amount of endogenous substrate levels modified by PMT in cells pretreated with auranofin was reduced compared to cells treated with PMT alone. Auranofin had no inhibitory effect on the activity of the catalytic domain of constitutively active PMT in vitro, demonstrating that auranofin did not directly inhibit PMT activity, but interferes with the mode of action of PMT in cells. In conclusion, the results show that TrxR is crucial for the mode of action of PMT in mammalian cells, and that the drug auranofin can serve as an efficient inhibitor, which might be a starting point for novel therapeutic options against toxin-associated diseases.

  6. Quality control in dual head γ-cameras: comparison between methods and software s used for image analysis

    International Nuclear Information System (INIS)

    Nayl E, A.; Fornasier, M. R.; De Denaro, M.; Sulieman, A.; Alkhorayef, M.; Bradley, D.

    2017-10-01

    Patient radiation dose and image quality are the main issues in nuclear medicine (Nm) procedures. Currently, many protocols are used for image acquisition and analysis of quality control (Qc) tests. National Electrical Manufacturers Association (Nema) methods and protocols are widely accepted method used for providing accurate description, measurement and reporting of γ-camera performance parameters. However, no standard software is available for image analysis. The aim os this study was to compare between the vendor Qc software analysis and three software from different developers downloaded free from internet; NMQC, Nm Tool kit and ImageJ-Nm Tool kit software. The three software are used for image analysis of some Qc tests for γ-cameras based on Nema protocols including non-uniformity evaluation. Ten non-uniformity Qc images were taken from dual head γ-camera (Siemens Symbia) installed in Trieste general hospital (Italy), and analyzed. Excel analysis was used as baseline calculation of the non-uniformity test according Nema procedures. The results of the non-uniformity analysis showed good agreement between the three independent software and excel calculation (the average differences were 0.3%, 2.9%, 1.3% and 1.6% for UFOV integral, UFOV differential, CFOV integral and CFOV differential respectively), while significant difference was detected on the analysis of the company Qc software with compare to the excel analysis (the average differences were 14.6%, 20.7%, 25.7% and 31.9% for UFOV integral, UFOV differential, CFOV integral and CFOV differential respectively). NMQC software was the best in comparison with the excel calculations. The variation in the results is due to different pixel sizes used for analysis in the three software and the γ-camera Qc software. Therefore, is important to perform the tests by the vendor Qc software as well as by independent analysis to understand the differences between the values. Moreover, the medical physicist should know

  7. Quality control in dual head γ-cameras: comparison between methods and software s used for image analysis

    Energy Technology Data Exchange (ETDEWEB)

    Nayl E, A. [Sudan Atomic Energy Commission, Radiation Safety Institute, Khartoum (Sudan); Fornasier, M. R.; De Denaro, M. [Azienda Sanitaria Universitaria Integrata di Trieste, Medical Physics Department, Via Giovanni Sai 7, 34128 Trieste (Italy); Sulieman, A. [Prince Sattam bin Abdulaziz University, College of Applied Medical Sciences, Radiology and Medical Imaging Department, P. O. Box 422, 11942 Al-Kharj (Saudi Arabia); Alkhorayef, M.; Bradley, D., E-mail: abdwsh10@hotmail.com [University of Surrey, Department of Physics, GU2-7XH Guildford, Surrey (United Kingdom)

    2017-10-15

    Patient radiation dose and image quality are the main issues in nuclear medicine (Nm) procedures. Currently, many protocols are used for image acquisition and analysis of quality control (Qc) tests. National Electrical Manufacturers Association (Nema) methods and protocols are widely accepted method used for providing accurate description, measurement and reporting of γ-camera performance parameters. However, no standard software is available for image analysis. The aim os this study was to compare between the vendor Qc software analysis and three software from different developers downloaded free from internet; NMQC, Nm Tool kit and ImageJ-Nm Tool kit software. The three software are used for image analysis of some Qc tests for γ-cameras based on Nema protocols including non-uniformity evaluation. Ten non-uniformity Qc images were taken from dual head γ-camera (Siemens Symbia) installed in Trieste general hospital (Italy), and analyzed. Excel analysis was used as baseline calculation of the non-uniformity test according Nema procedures. The results of the non-uniformity analysis showed good agreement between the three independent software and excel calculation (the average differences were 0.3%, 2.9%, 1.3% and 1.6% for UFOV integral, UFOV differential, CFOV integral and CFOV differential respectively), while significant difference was detected on the analysis of the company Qc software with compare to the excel analysis (the average differences were 14.6%, 20.7%, 25.7% and 31.9% for UFOV integral, UFOV differential, CFOV integral and CFOV differential respectively). NMQC software was the best in comparison with the excel calculations. The variation in the results is due to different pixel sizes used for analysis in the three software and the γ-camera Qc software. Therefore, is important to perform the tests by the vendor Qc software as well as by independent analysis to understand the differences between the values. Moreover, the medical physicist should know

  8. Comparison between a dual-head and a brain-dedicated SPECT system in the measurement of the loss of dopamine transporters with [123I]FP-CIT

    International Nuclear Information System (INIS)

    Varrone, Andrea; Sansone, Valeria; Pappata, Sabina; Salvatore, Marco; Pellecchia, Maria T.; Salvatore, Elena; de Michele, Giuseppe; Filla, Alessandro; Barone, Paolo; Amboni, Marianna

    2008-01-01

    Dual-head SPECT systems are used by many clinical departments for [ 123 I]FP-CIT SPECT imaging, while triple-head or brain-dedicated systems with better imaging performance are more commonly used by research institutions. There are limited data comparing the capability of the two types of system to measure dopamine transporter (DAT) loss in vivo. The aim of this study was to compare the ability of a dual-head and a brain-dedicated SPECT system to estimate the degree of DAT loss in different movement disorders with variable nigrostriatal impairment, with [ 123 I]FP-CIT. Four patients with essential tremor, 24 with Parkinson's disease (PD), six with spinocerebellar ataxia type 2 and six controls were studied with [ 123 I]FP-CIT. SPECT scans were performed on a dual-head (E.CAM - Siemens) and subsequently on a brain-dedicated system (Ceraspect - DSI). Striatal DAT outcome measures on the E.CAM and the Ceraspect were strongly correlated and the putamen-to-caudate ratios were almost identical. Although the measured values were lower by 52 ± 25% in caudate and by 51 ± 31% in putamen on the E.CAM (p < 0.0001), the average striatal DAT decrease in each patient group compared with controls was similar for both systems. In PD patients, similar correlations (p < 0.05) were found between motor UPDRS or Hoehn and Yahr stage and striatal DAT density. Despite underestimation of striatal DAT outcome measures, the E.CAM showed similar capability as the Ceraspect in measuring the degree of nigrostriatal dopaminergic deficit and assessing the correlation between DAT outcome measures and clinical variables of PD severity and stage. (orig.)

  9. Investigation about decoupling capacitors of PMT voltage divider effects on neutron-gamma discrimination

    International Nuclear Information System (INIS)

    Divani, Nazila; Firoozabadi, Mohammad M.; Bayat, Esmail

    2014-01-01

    Scintillators are almost used in any nuclear laboratory. These detectors combine of scintillation materials, PMT and a voltage divider. Voltage dividers are different in resistive ladder design. But the effect of decoupling capacitors and damping resistors haven’t discussed yet. In this paper at first a good equilibrium circuit designed for PMT, and it was used for investigating about capacitors and resistors in much manner. Results show that decoupling capacitors have great effect on PMT output pulses. In this research, it was tried to investigate the effect of Capacitor’s value and places on PMT voltage divider in Neutron-Gamma discrimination capability. Therefore, the voltage divider circuit for R329-02 Hamamatsu PMT was made and Zero Cross method used for neutron-gamma discrimination. The neutron source was a 20Ci Am-Be. Anode and Dynode pulses and discrimination spectrum were saved. The results showed that the pulse height and discrimination quality change with the value and setting of capacitors

  10. Clinical value of FDG dual-head tomography with coincidence imaging in suspected malignant pleural effusion or atelectasis

    International Nuclear Information System (INIS)

    Wang Huoqiang; Wu Jiyang; Pan Huizhong; Liu Jinjun; Shen Yi; Zhao Xianguo

    2004-01-01

    Objective: To determine the ability of 18F-fluorodeoxyglucose (FDG) dual-head tomography with coincidence (DHTC) imaging in detecting lung cancer in patients with suspected malignant pleural effusion or malignant atelectasis on CT scanning. On the other hand, used FDG DHTC to differentiate benign and malignant pleural effusions in patients with lung cancer. Methods: Over a 4-year period, 110 patients with abnormal findings on CT scanning for presence of pleural effusion (n=84) and/or pleural thickening or mediastinal lymph nodes enlargement, or presence of atelectasis (n-26). All patients were suspected malignant pleural effusion or atelectasis caused by lung cancer. But all of them could not found primary lesions in the lungs on CT scanning. FDG DHTC was underwent for all the patients. Imagings were visually analyzed by two experienced observers. They were considered positive if the FDG uptake was increased relative to that in the adjacent lung tissue, and the uptake appeared localized pattern. They were considered negative if the uptake was the same as or less than the adjacent lung tissue, and/or the uptake appeared diffused pattern. Results of FDG DHTC were correlated with pathologic diagnosis for lung cancer. In these patients with proven lung cancer and a suspected malignant pleural effusion, FDG DHTC revealed positive findings (malignant pleural effusion) if pleural activity was greater than background mediastinal activity; or FDG DHTC revealed negative findings (benign pleural effusion) if pleural activity was the same or less than background mediastinal activity. Results of FDG DHTC were compared to pleural cytology, histologic findings of pleural biopsy, or clinical follow-up for presence or absence of malignant pleural effusion. Results: 38 of 110 patients were proven with lung cancer. Among the 38 lung cancer patients, 30 of them had a pleural effusion and 8 of them had a atelectasis. 72 of 110 patients were proven with lung benign diseases (50 with

  11. Development of 10×10 Matrix-anode MCP-PMT

    Science.gov (United States)

    Yang, Jie; Li, Yongbin; Xu, Pengxiao; Zhao, Wenjin

    2018-02-01

    10×10 matrix-anode is developed by high-temperature co-fired ceramics (HTCC) technology. Based on the new matrix-anode, a new kind of photon counting imaging detector - 10×10 matrix-anode MCP-PMT is developed, and its performance parameters are tested. HTCC technology is suitable for the MCP-PMT's air impermeability and its baking process. Its response uniformity is better than the metal-ceramic or metal-glass sealing anode, and it is also a promising method to realize a higher density matrix-anode.

  12. A 30 ps Timing Resolution for Single Photons with Multi-pixel Burle MCP-PMT

    Energy Technology Data Exchange (ETDEWEB)

    Va' vra, J.; Benitez, J.; Coleman, J.; Leith, D.W.G.S.; Mazaheri, G.; Ratcliff, B.; Schwiening, J.; /SLAC

    2006-07-05

    We have achieved {approx}30 psec single-photoelectron and {approx}12ps for multi-photoelectron timing resolution with a new 64 pixel Burle MCP-PMT with 10 micron microchannel holes. We have also demonstrated that this detector works in a magnetic field of 15kG, and achieved a single-photoelectron timing resolution of better than 60 psec. The study is relevant for a new focusing DIRC RICH detector for particle identification at future Colliders such as the super B-factory or ILC, and for future TOF techniques. This study shows that a highly pixilated MCP-PMT can deliver excellent timing resolution.

  13. Studies oriented to optimize the image quality of the small animal PET: Clear PET, modifying some of the parameters of the reconstruction algorithm IMF-OSEM 3D on the data acquisition simulated with GAMOS; Estudios para la optimizaciOn de la calidad de imagen en el escaner ClearPET, modifi cando parametros del algoritmo IMF-OSEM 3D sobre adquisiciones simuladas con GAMOS

    Energy Technology Data Exchange (ETDEWEB)

    Canadas, M.; Mendoza, J.; Embid, M.

    2007-09-27

    This report presents studies oriented to optimize the image quality of the small animal PET: Clear- PET. Certain figures of merit (FOM) were used to assess a quantitative value of the contrast and delectability of lesions. The optimization was carried out modifying some of the parameters in the reconstruction software of the scanner, imaging a mini-Derenzo phantom and a cylinder phantom with background activity and two hot spheres. Specifically, it was evaluated the incidence of the inter-update Metz filter (IMF) inside the iterative reconstruction algorithm 3D OSEM. The data acquisition was simulated using the GAMOS framework (Monte Carlo simulation). Integrating GAMOS output with the reconstruction software of the scanner was an additional novelty of this work, to achieve this, data sets were written with the list-mode format (LMF) of ClearPET. In order to verify the optimum values obtained, we foresee to make real acquisitions in the ClearPET of CIEMAT. (Author) 17 refs.

  14. Optical Module Front-End for a Neutrino Underwater Telescope PMT interface

    CERN Document Server

    Lo Presti, D; Caponetto, L

    2007-01-01

    A proposal for a new system to capture signals in the Optical Module (OM) of an Underwater Neutrino Telescope is described. It concentrates on the problem of power consumption in relation to precision. In particular, a solution for the interface between the photomultiplier (PMT) and the front-end electronics is presented.

  15. SCOTT: A time and amplitude digitizer ASIC for PMT signal processing

    Science.gov (United States)

    Ferry, S.; Guilloux, F.; Anvar, S.; Chateau, F.; Delagnes, E.; Gautard, V.; Louis, F.; Monmarthe, E.; Le Provost, H.; Russo, S.; Schuller, J.-P.; Stolarczyk, Th.; Vallage, B.; Zonca, E.; KM3NeT Consortium

    2013-10-01

    SCOTT is an ASIC designed for the readout electronics of photomultiplier tubes developed for KM3NeT, the cubic-kilometer scale neutrino telescope in Mediterranean Sea. To digitize the PMT signals, the multi-time-over-threshold technique is used with up to 16 adjustable thresholds. Digital outputs of discriminators feed a circular sampling memory and a “first in first out” digital memory. A specific study has shown that five specifically chosen thresholds are suited to reach the required timing accuracy. A dedicated method based on the duration of the signal over a given threshold allows an equivalent timing precision at any charge. To verify that the KM3NeT requirements are fulfilled, this method is applied on PMT signals digitized by SCOTT.

  16. The mDOM. A multi-PMT optical module for IceCube-Gen2

    Energy Technology Data Exchange (ETDEWEB)

    Classen, Lew; Kappes, Alexander [Institut fur Kernphysik, Westfaelische Wilhelms-Universitaet Muenster (Germany); Karg, Timo; Kretzschmann, Axel [DESY, Zeuthen (Germany); Koelpin, Alexander; Lindner, Stefan; Roeber, Juergen [LTE, Friedrich-Alexander-Universitaet Erlangen-Nuernberg (Germany)

    2016-07-01

    Following the discovery of an astrophysical neutrino flux by IceCube in 2013, planning is under way for the next generation neutrino telescope at the South Pole, IceCube-Gen2, which will significantly enhance and expand IceCube's sensitivity both towards high neutrino energies as well as in the low-energy regime. In the scope of these efforts, a novel multi-PMT optical sensor is being developed which, following the KM3NeT design, consists of an array of several small PMTs inside a transparent pressure vessel. This design provides some significant advantages compared to the conventional single-PMT module design, such as an increased effective area, homogeneous coverage of the full solid angle, and intrinsic angular sensitivity. The talk presents an overview of the project and its current status, featuring hardware development, testing, and simulation efforts.

  17. Correlates of Protective Motivation Theory (PMT) to adolescents' drug use intention.

    Science.gov (United States)

    Wu, Cynthia Sau Ting; Wong, Ho Ting; Chou, Lai Yan; To, Bobby Pak Wai; Lee, Wai Lok; Loke, Alice Yuen

    2014-01-03

    Early onset and increasing proliferation of illicit adolescent drug-use poses a global health concern. This study aimed to examine the correlation between Protective Motivation Theory (PMT) measures and the intention to use drugs among adolescents. An exploratory quantitative correlation design and convenience sampling were adopted. A total of 318 students completed a self-reported questionnaire that solicited information related to their demographics and activities, measures of threat appraisal and coping appraisal, and the intention to use drugs. Logistic regression analysis showed that intrinsic and extrinsic rewards were significant predictors of intention. The odds ratios were equal to 2.90 (p < 0.05) and 8.04 (p < 0.001), respectively. The logistic regression model analysis resulted in a high Nagelkerke R2 of 0.49, which suggests that PMT related measures could be used in predicting drug use intention among adolescents. Further research should be conducted with non-school adolescents to confirm the application.

  18. R&D of a pioneering system for a high resolution photodetector: The VSiPMT

    Science.gov (United States)

    Barbato, F. C. T.; Barbarino, G.; Campajola, L.; Di Capua, F.; Mollo, C. M.; Valentini, A.; Vivolo, D.

    2017-12-01

    The VSiPMT (Vacuum Silicon PhotoMultiplier Tube) is an innovative design for a hybrid photodetector. The idea, born with the purpose to use a SiPM for large detection volumes, consists in replacing the classical dynode chain with a special SiPM. In this configuration, we match the large sensitive area of a photocathode with the performances of the SiPM technology, which therefore acts like an electron detector and so like a current amplifier. The excellent photon counting capability, fast response, low power consumption and the stability are among the most attractive features of the VSiPMT.We now present the progress on the realization of a 1-in. prototype and the preliminary tests we are performing on it.

  19. Programmable integrated front-end for SiPM/PMT PET detectors with continuous scintillating crystal

    OpenAIRE

    Herrero Bosch, Vicente; Monzó Ferrer, José María; Ros García, Ana; Aliaga Varea, Ramón José; González Martínez, Antonio Javier; Montoliu, C.; Colom Palero, Ricardo José; Benlloch Baviera, Jose María

    2012-01-01

    AMIC architecture has been introduced in previous works in order to provide a generic and expandable solution for implementing large number of outputs SiPM array/PMT detectors. The underlying idea in AMIC architecture is to calculate the moments of the detected light distribution in an analog fashion. These moments provide information about energy, x/y position, etc. of the light distribution of the detected event. Moreover this means that a small set of signals contains most of the informati...

  20. PMT response drift of ATLAS Tile Laser II calibration system: an introduction of a new method

    CERN Document Server

    Di Gregorio, Giulia

    2016-01-01

    In this article I describe the performance of the monitoring diodes of the Laser II system, a new system for run II used to calibrate the gain variation of PMTs in between two cesium scan. I also show a new method to measure the PMT drift response that it is compared to the method used up to now (Clermont-Ferrant) corrected with the Pisa method. The agreement between the two method is within 0.2%.

  1. Significance of delayed /sup 99m/Tc-PMT scintigraphy in diagnosis of hepatocellular carcinoma. Comparison between /sup 99m/Tc-PMT and /sup 67/Ga-citrate scintigraphy

    Energy Technology Data Exchange (ETDEWEB)

    Hasegawa, Yoshihisa; Nakano, Shunichi; Hashizume, Terumi and others

    1985-03-01

    The usefulness of delayed hepatobiliary imaging with /sup 99m/Tc-PMT in diagnosis of hepatocellular carcinoma was studied in 30 patients with histologically verified hepatocellular carcinoma. Of 30 patients, delayed /sup 99m/Tc-PMT images showed 13 patients (43 %) of increased radioactivity and 4 (13 %) of equilibrated radioactivity in carcinoma as compared with that in the surrounding normal liver tissues. Furthermore, 3 of 6 patients who showed no filling defects in /sup 99m/Tc-Sn colloid liver images, showed increased uptake of radioactivity in carcinoma in delayed /sup 99m/Tc-PMT images. These results suggest that the complementary use of delayed /sup 99m/Tc-PMT imaging to /sup 99m/Tc-Sn colloid liver imaging is useful for detecting hepatoma lesions. The hepatic lesions were positively visualized on /sup 99m/Tc-PMT and/or /sup 67/Ga-citrate images in 21 (70 %) of 30 patients. These results indicate that use of delayed /sup 99m/Tc-PMT and /sup 67/Ga-citrate imaging in combination is useful for positive visualization of hepatocellular carcinoma.

  2. Cross-talk of a multi-anode PMT and attainment of a σ∼10ps TOF counter

    International Nuclear Information System (INIS)

    Enari, Y.; Hayasaka, K.; Hokuue, T.; Inami, K.; Ohshima, T.; Sato, N.; Akatsu, M.; Kawakami, S.; Miyabayashi, Y.; Tokuda, H.; Yanase, H.; Shimoi, H.; Fujimori, T.

    2005-01-01

    We extensively studied a cross-talk phenomenon that seriously deteriorates the high time-resolution of a multi-anode 16-channel linear array photo-multiplier tube (PMT); the dynode structures were modified to eliminate the cross-talk effect and to recover a time resolution of σ=70-80ps for single photons. The use of 16 anode signals of the modified PMT enabled us to attain σ=12ps for a small TOF counter of Cherenkov radiation

  3. PET with a dual-head coincidence gamma camera in head and neck cancer: A comparison with computed tomography and dedicated PET

    International Nuclear Information System (INIS)

    Zimny, M.

    2001-01-01

    Positron emission tomography with 18 F-fluoro-deoxyglucose (FDG PET) is a promising imaging tool for detecting and staging of primary or recurrent head and neck cancer. The aim of this study was to evaluate a dual-head gamma camera modified for coincidence detection (KGK-PET) in comparison to computed tomography (CT) and dedicated PET (dPET). 50 patients with known or suspected primary or recurrent head and neck cancer were enrolled. 32 patients underwent KGK-PET and dPET using a one-day protocol. The sensitivity for the detection of primary/ recurrent head and neck cancer for KGK-PET and CT was 80% and 54%, respectively, specificity was 73% and 82%, respectively. The sensitivity and specificity for the detection of lymph node metastases based on neck sides with KGK-PET was 71% (CT: 65%) and 88% (CT: 89%) respectively. In comparison to dPET, KGK-PET revealed concordant results in 32/32 patients with respect to primary tumor/recurrent disease and in 55/60 evaluated neck sides. All involved neck sides that were missed by KGK-PET were also negative with dPET. These results indicate that in patients with head and neck cancer KGK-PET reveals information, that are similar to dPET and complementary to CT. (orig.) [de

  4. Correlates of Protective Motivation Theory (PMT to Adolescents’ Drug Use Intention

    Directory of Open Access Journals (Sweden)

    Cynthia Sau Ting Wu

    2014-01-01

    Full Text Available Early onset and increasing proliferation of illicit adolescent drug-use poses a global health concern. This study aimed to examine the correlation between Protective Motivation Theory (PMT measures and the intention to use drugs among adolescents. An exploratory quantitative correlation design and convenience sampling were adopted. A total of 318 students completed a self-reported questionnaire that solicited information related to their demographics and activities, measures of threat appraisal and coping appraisal, and the intention to use drugs. Logistic regression analysis showed that intrinsic and extrinsic rewards were significant predictors of intention. The odds ratios were equal to 2.90 (p < 0.05 and 8.04 (p < 0.001, respectively. The logistic regression model analysis resulted in a high Nagelkerke R2 of 0.49, which suggests that PMT related measures could be used in predicting drug use intention among adolescents. Further research should be conducted with non-school adolescents to confirm the application.

  5. Evaluation of RI images of hepatic blood flow using Tc-99m PMT

    Energy Technology Data Exchange (ETDEWEB)

    Fujiwara, Hiromichi; Iwasaki, Naoya; Ichikawa, Kesato

    1988-03-01

    To evaluate the clinical significance of RI images of hepatic blood flow using Tc-99m-PMT, analysis of the RI images and estimation of hepatic blood flow were carried out in patients with various liver diseases (37 cases). After intravenous injection of Tc-99m-PMT, hepatic accumulation curve of ROI positioned at whole liver area and time activity curve of ROI positioned at celiac artery were obtained through scintillation camera images with the computer-analysed system. Hepatic blood flow coefficient (K) was calculated from the hepatic accumulation curve. Based on the differential curve calculated from the time activity curve, chronological images of arterial, portal, parenchymal and saturated parenchymal phases were obtained. Results ; 1) K was 0.50 + 0.04, 0.35 + 0.02 and 0.26 + 0.04/min in normal type, CH type and LC type respectively. These coefficients well correlated with clinical severity of hepatic diseases. 2) Perfusional phase images of the liver became poorer in accordance with progression of liver disease, while images of spleen, portal venous system and collateral channels were more clearly obtained in liver cirrhosis. This method was shown to have a potential to understanding of severity of liver disease and hepatic blood flow dynamics.

  6. Dual parameter analysis of CsI:Tl/PMT with a digital oscilloscope

    CERN Document Server

    Devol, T A; Fjeld, R A

    1999-01-01

    Scintillation pulses from alpha-particle and gamma-ray excited CsI:Tl were recorded with a photomultiplier tube and digital oscilloscope card in single parameter (pulse shape or pulse height) and dual parameter (simultaneous pulse shape and pulse height) modes. A 2.8x1.3x1.3 cm sup 3 CsI:Tl crystal was coupled to a Burle 8850 photomultiplier tube (PMT) and excited with sup 1 sup 4 sup 8 Gd (E subalpha=3.18 MeV) and sup 1 sup 3 sup 7 Cs (E subgamma=0.662 MeV). The timing pulses (50 OMEGA terminated dynode signal) from the PMT base were directly input to a GaGe CompuScope 8012A/PCI sup T sup M (12-bit, 50 MHz dual channel digital oscilloscope card) that resided in a P6-300 MHz personal computer. Individual digitized pulses were processed via a LabVIEW sup T sup M V 4.1 interface to the oscilloscope. The ratio of the charge collected over a short time interval to the total charge collected was used for the single parameter pulse shape spectrum while the total charge collected was used for the single parameter pu...

  7. Diagnosis of myocardial viability by dual-head coincidence gamma camera fluorine-18 fluorodeoxyglucose positron emission tomography with and without non-uniform attenuation correction

    International Nuclear Information System (INIS)

    Nowak, B.; Zimmy, M.; Kaiser, H.-J.; Schaefer, W.; Reinartz, P.; Buell, U.; Schwarz, E.R.; Dahl, J. vom

    2000-01-01

    This study assessed a dual-head coincidence gamma camera (hybrid PET) equipped with single-photon transmission for myocardial fluorine-18 fluorodeoxyglucose (FDG) imaging by comparing this technique with conventional positron emission tomography (PET) using a dedicated ring PET scanner. Twenty-one patients were studied with dedicated FDG ring PET and FDG hybrid PET for evaluation of myocardial glucose metabolism, as well as technetium-99 m tetrofosmin single-photon emission tomography (SPET) to estimate myocardial perfusion. All patients underwent transmitted attenuation correction using germanium-68 rod sources for ring PET and caesium-137 point sources for hybrid PET. Ring PET and hybrid PET emission scans were started 61±12 and 98±15 min, respectively, after administration of 154±31 MBq FDG. Attenuation-corrected images were reconstructed iteratively for ring PET and hybrid PET (ac-hybrid PET), and non-attenuation-corrected images for hybrid PET (non-ac-hybrid PET) only. Tracer distribution was analysed semiquantitatively using a volumetric vector sampling method dividing the left ventricular wall into 13 segments. FDG distribution in non-ac-hybrid PET and ring PET correlated with r=0.36 (P<0.0001), and in ac-hybrid PET and ring PET with r=0.79 (P<0.0001). Non-ac-hybrid PET significantly overestimated FDG uptake in the apical and supra-apical segments, and underestimated FDG uptake in the remaining segments, with the exception of one lateral segment. Ac-hybrid PET significantly overestimated FDG uptake in the apical segment, and underestimated FDG uptake in only three posteroseptal segments. A three-grade score was used to classify diagnosis of viability by FDG PET in 136 segments with reduced perfusion as assessed by SPET. Compared with ring PET, non-ac-hybrid PET showed concordant diagnoses in 80 segments (59%) and ac-hybrid PET in 101 segments (74%) (P<0.001). Agreement between ring PET and non-ac-hybrid PET was best in the basal lateral wall and in the

  8. Evaluation of pulmonary nodules: comparison of a prototype dual crystal (LSO/NAI) dual head coincidence camera and full ring positron emission tomography (PET)

    International Nuclear Information System (INIS)

    Joshi, U.; Raijmakers, P.G.H.M.; Lingen, A. van; Comans, E.F.I.; Pijpers, R.; Teule, G.J.J.; Hoekstra, O.S.

    2005-01-01

    Purpose: To determine the concordance of a prototype dual head coincidence camera (LSO-PS) and full ring PET (BGO-PET) using 18 F-fluorodeoxyglucose (FDG) in the evaluation of pulmonary nodules (PNs). Materials and methods: Patients referred for evaluation of ≤3 PNs (≤3 cm diameter) were prospectively studied on the same day with both BGO-PET and LSO-PS. Imaging was performed at 60 and 120 min after injection of 370 MBq FDG, respectively. Images were independently interpreted by four observers with each observer blinded to the other modality for the same patient. Lesions were scored in terms of relative intensity versus background. Non-attenuation corrected (nonAC) BGO-PET was used as the reference test. Results: Forty-seven patients with 54 PNs (mean diameter 1.7 cm, S.D. 0.7) were included. Twelve nodules were in the ≤1.0 cm - 27 in the 1.1-2.0 cm - and 15 in the 2.1-3.0 cm range. Interobserver agreement was similar for both FDG imaging modalities. Using a sensitive assessment strategy with LSO-PS (≥ faint intensity deemed positive), there was a 97% (38/39, 95%CI 87-100%) concordance with BGO-PET and one false positive case with LSO-PS. Conservative reading (moderate or intense intensity deemed positive) resulted in a 92% (36/39, 95%CI 80-97%) concordance with BGO-PET, without false positives. The only lesion missed by LSO-PS using both assessment strategies involved a nodule 1.5 cm diameter that demonstrated moderate increased FDG uptake on BGO-PET. Conclusion: Depending on the test positivity criteria, LSO-PS demonstrates a high concordance (92-97%) with nonAC BGO-PET for the characterization of pulmonary nodules

  9. PMT Dark Noise Monitoring System for Neutrino Detector Borexino Based on the Devicenet Protocol and WEB-Access

    International Nuclear Information System (INIS)

    Chepurnov, A.S.; Orekhov, D.I.; Maimistov, D.A.; Sabelnikov, A.A.; Etenko, A.V.

    2006-01-01

    Monitoring of PMT dark noise in a neutrino detector BOREXINO is a procedure that indicates condition of the detector. Based on CAN industrial network, top level DeviceNet protocol and WEB visualization, the dark noise monitoring system having 256 channels for the internal detector and for the external muon veto was created. The system is composed as a set of controllers, converting the PMT signals to frequency and transmitting them over Can network. The software is the stack of the DeviceNet protocols, providing the data collecting and transporting. Server-side scripts build web pages of user interface and graphical visualization of data

  10. Investigation of a Multi-Anode Microchannel Plate PMT for Time-of-Flight PET

    Science.gov (United States)

    Choong, Woon-Seng

    2010-10-01

    We report on an investigation of a mulit-anode microchannel plate PMT for time-of-flight PET detector modules. The primary advantages of an MCP lie in its excellent timing properties (fast rise time and low transit time spread), compact size, and reasonably large active area, thus making it a good candidate for TOF applications. In addition, the anode can be segmented into an array of collection electrodes with fine pitch to attain good position sensitivity. In this paper, we investigate using the Photonis Planacon MCP-PMT with a pore size of 10 μm to construct a PET detector module, specifically for time-of-flight applications. We measure the single electron response by exciting the Planacon with pulsed laser diode. We also measure the performance of the Planacon as a PET detector by coupling a 4 mm×4 mm×10 mm LSO crystal to individual pixel to study its gain uniformity, energy resolution, and timing resolution. The rise time of the Planacon is 440 ps with pulse duration of about 1 ns. A transit time spread of 120 ps FWHM is achieved. The gain is fairly uniform across the central region of the Planacon, but drops off by as much as a factor of 2.5 around the edges. The energy resolution is fairly uniform across the Planacon with an average value of 18.6 ± 0.7% FWHM. While the average timing resolution of 252 ± 7 ps FWHM is achieved in the central region of the Planacon, it degrades to 280 ± 9 ps FWHM for edge pixels and 316 ± 15 ps FWHM for corner pixels. We compare the results with measurements performed with a fast timing conventional PMT (Hamamatsu R-9800). We find that the R9800, which has significantly higher PDE, has a better timing resolution than the Planacon. Furthermore, we perform detector simulations to calculate the improvement that can be achieved with a higher PDE Planacon. The calculation shows that the Planacon can achieve significantly better timing resolution if it can attain the same PDE as the R-9800, while only a 30% improvement is

  11. Protecting children from myopia: a PMT perspective for improving health marketing communications.

    Science.gov (United States)

    Lwin, May O; Saw, Seang-Mei

    2007-01-01

    This research examined the predictive utility of the protection motivation theory (PMT) model for myopia prevention amongst children. An integrative model for myopia prevention behavior of parents was first developed in the context of theory and survey instruments then refined using information gathered from two focus groups. Empirical data then was collected from parents of primary school children in Singapore, a country with one of the highest rates of myopia in the world, and analyzed using structural equation modeling (SEM). Our findings revealed that coping appraisal variables were more significantly associated with protection motivation, relative to threat appraisal variables. In particular, perceived self-efficacy was the strongest predictor of parental intention to enforce good visual health behaviors, while perceived severity was relatively weak. Health marketing communications and public policy implications are discussed.

  12. ATLAS TileCal Sub-Module Production at UIUC - Photos of Prototype PMT Test Setup

    CERN Multimedia

    Errede, Steve

    2001-01-01

    Photo 1 - Entrance to the lab. Photo 2 - A shot of the center of the lab. Photo 3 - The back of the lab. The Dark Box: Photo 4 - A view of the outside of the Dark Box along with its dry nitrogen system. Photo 5 - A view of the inside of the Dark Box. Photo 6 - The LED holder, beam splitter (removed in this shot), and a pulsing circuit. Photo 7 - The PMT holder. Photo 8 - A possible design for a Stepper Motor controlled filter wheel. Photo 9 - Polishing area for the optical fibers. R&D Work on Stepper Motor/Motion Control: Photo 10 - The complete prototype of the Stepper Motor setup. Photo 11 - The prototype of the Main Stepper Motor Driver Board. Photo 12 - The prototype of the Stepper Motor Power Amplifer. Photo 13 - The prototype of the Stepper Motor LabPC + Interface Board.

  13. Electron optics design of an 8-in. spherical MCP-PMT

    Energy Technology Data Exchange (ETDEWEB)

    Chen, Ping, E-mail: chenping@opt.cn [Key Laboratory of Ultra-fast photoelectric Diagnostics Technology, Xi’an Institute of Optics and Precision Mechanics (XIOPM), Chinese Academy of Sciences, Xi’an 710119 (China); University of Chinese Academy of Sciences, Beijing 100049 (China); Collaborative Innovation Center of Extreme Optics, Shanxi University, Taiyuan 030006, Shanxi (China); Tian, Jinshou [Key Laboratory of Ultra-fast photoelectric Diagnostics Technology, Xi’an Institute of Optics and Precision Mechanics (XIOPM), Chinese Academy of Sciences, Xi’an 710119 (China); Collaborative Innovation Center of Extreme Optics, Shanxi University, Taiyuan 030006, Shanxi (China); Qian, Sen; Zhao, Tianchi [Institute of High Energy Physics, Chinese Academy of Sciences, Beijing 100049 (China); Liu, Hulin; Wei, Yonglin; Sai, Xiaofeng; He, Jianping; Wang, Xing; Lu, Yu [Key Laboratory of Ultra-fast photoelectric Diagnostics Technology, Xi’an Institute of Optics and Precision Mechanics (XIOPM), Chinese Academy of Sciences, Xi’an 710119 (China); Chen, Lin; Guo, Lehui; Pei, Chengquan; Hui, Dandan [Key Laboratory of Ultra-fast photoelectric Diagnostics Technology, Xi’an Institute of Optics and Precision Mechanics (XIOPM), Chinese Academy of Sciences, Xi’an 710119 (China); University of Chinese Academy of Sciences, Beijing 100049 (China)

    2017-03-11

    This paper discusses the electron optical system of an 8-in. spherical MCP-PMT. The MCP assembly, the supporting pole and the supply voltages are carefully designed to optimize the photoelectron collection efficiency and the transit time spread. Coating the MCP nickel-chromium electrode with an additional high secondary emission material is employed to make a breakthrough on the collection efficiency. With the simulation software CST, the Finite Integration method and the Monte Carlo method are combined to evaluate the collection efficiency, the time properties and the Earth's magnetic field effects. Simulation results show that the photocathode active solid angle is over 3.5 πsr, the average collection efficiency can exceed 95% with the coated MCP and the mean transit time spread is 2.2 ns for a typical electric potential of 500 V applied between the photocathode and the MCP input facet. The prototype and the measured single photoelectron spectrum are also presented.

  14. Pengaruh pemberian makanan tambahan (PMT pada ibu hamil terhadap berat lahir bayi

    Directory of Open Access Journals (Sweden)

    Hana Shafiyyah Zulaidah

    2014-10-01

    Full Text Available Background: Anemia causes fetal growth disorders that affect birth weight. Antenatal care (ANC coverage and provision of high Fe if not followed by a decrease in the incidence of anemia can result indirectly in the risk of low birth weight. Supplementary feeding is expected to resolve the issue. Objective: To assess the effect of supplementary feeding on the third trimester of pregnancy on birth weight. Method: This was a quantitative study with a study design of quasi-experiment and non-equivalent control group. The given intervention was fish-processed feeding for 30 days. The study population was pregnant women in the third trimester in all health centers in the City of Yogyakarta and the samples were 104 pregnant women in some health centers with convenience sampling technique. The subjects were divided into two, namely the treatment group (PMT and the comparison group (non-PMT. Birth weight was weighed immediately after the baby was born. Statistical analysis used t-test and logistic regression. Results: The mean birth weight of infants in the treatment group and the comparison group was 3248 g and 2974 g, respectively, so that the difference in the mean birth weight of both groups was 274 g (p=0.0002; 95%C:131-416. Thus, supplementary feeding was shown significantly affect the birth weight. The extraneous variables that significantly influenced birth weight were pregnancy interval. Other extraneous variables were age, mid-upper-arm circumference (MUAC, education, occupation, economic status, parity, protein intake, compliance of Fe tablet intake, antenatal care, gestational age at delivery and anemia status were not proven statistically significant to affect birth weight. Conclusion: Supplementary feeding effect on birth weight.

  15. The C-terminal MIR-containing region in the Pmt1 O-mannosyltransferase restrains sporulation and is dispensable for virulence in Beauveria bassiana.

    Science.gov (United States)

    He, Zhangjiang; Luo, Linli; Keyhani, Nemat O; Yu, Xiaodong; Ying, Shenghua; Zhang, Yongjun

    2017-02-01

    Protein O-mannosyltransferases (Pmts) belong to a highly conserved protein family responsible for the initiation of O-glycosylation of many proteins. Pmts contain one dolichyl-phosphate-mannose-protein mannosyltransferases (PMT) domain and three MIR motifs (mannosyltransferase, inositol triphosphate, and ryanodine receptor) that are essential for activity in yeast. We report that in the insect fungal pathogen, Beauveria bassiana, deletion of the C-terminal Pmt1 MIR-containing region (Pmt1∆ 311-902 ) does not alter O-mannosyltransferase activity, but does increase total cell wall protein O-mannosylation levels and results in phenotypic changes in fungal development and cell wall stability. B. bassiana mutants harboring the Pmt1 ∆ 311-902 mutation displayed a significant increase in conidiation with up-regulation of conidiation-associated genes and an increase in biomass accumulation as compared to the wild-type parent. However, decreased vegetative growth and blastospore production was noted, and Pmt1 ∆ 311-902 mutants were altered in cell wall composition and cell surface features. Insect bioassays revealed little effect on virulence for the Pmt1 ∆ 311-902 strain via cuticle infection or intrahemocoel injection assays, although differences in hyphal body differentiation in the host hemolymph and up-regulation of virulence-associated genes were noted. These data suggest novel roles for Pmt1 in negatively regulating conidiation and demonstrate that the C-terminal Pmt1 MIR-containing region is dispensable for enzymatic activity and organismal virulence.

  16. Chronic bacterial osteomyelitis: prospective comparison of 18F-FDG imaging with a dual-head coincidence camera and 111In-labelled autologous leucocyte scintigraphy

    International Nuclear Information System (INIS)

    Meller, J.; Siefker, U.; Lehmann, K.; Meyer, I.; Schreiber, K.; Altenvoerde, G.; Becker, W.; Liersch, T.

    2002-01-01

    Indium-111-labelled white blood cells ( 111 In-WBCs) are currently considered the tracer of choice in the diagnostic work-up of suspected active chronic osteomyelitis (COM). Previous studies in a limited number of patients, performed with dedicated PET systems, have shown that [ 18 F]2'-deoxy-2-fluoro-D-glucose (FDG) imaging may offer at least similar diagnostic accuracy. The aim of this prospective study was to compare FDG imaging with a dual-head coincidence camera (DHCC) and 111 In-WBC imaging in patients with suspected COM. Thirty consecutive non-diabetic patients with possible COM underwent combined skeletal scintigraphy (30/30 patients), 111 In-WBC imaging (28/30 patients) and FDG-PET with a DHCC (30/30 patients). During diagnostic work-up, COM was proven in 11/36 regions of suspected skeletal infection and subsequently excluded in 25/36 regions. In addition, soft tissue infection was present in five patients and septic arthritis in three. 111 In-WBC imaging in 28 patients was true positive in 2/11 regions with proven COM and true negative in 21/23 regions without further evidence of COM. False-positive results occurred in two regions and false-negative results in nine regions suspected for COM. Most of the false-negative results (7/9) occurred in the central skeleton. If the analysis was restricted to the 18 regions with available histology (n=17) or culture (n=1), 111 In-WBC imaging was true positive in 2/18 regions, true negative in 8/18 regions, false negative in 7/18 regions and false positive in 1/18 regions. FDG-DHCC imaging was true positive in 11/11 regions with proven COM and true negative in 23/25 regions without further evidence of COM. False-positive results occurred in two regions. If the analysis was restricted to the 19 regions with available histology (n=18) or culture (n=1), FDG-DHCC imaging was true positive in 9/9 regions with proven COM and true negative in 10/10 regions without further evidence of COM. It is concluded that FDG

  17. PEMANFAATAN TEPUNG SUKUN (Artocarpus altilis sp. PADA PEMBUATAN ANEKA KUDAPAN SEBAGAI ALTERNATIF MAKANAN BERGIZI UNTUK PMT-AS

    Directory of Open Access Journals (Sweden)

    Dewanti Putri Pratiwi

    2013-11-01

    Full Text Available ABSTRACTBreadfruit is valuable fruit and has a good of nutrient content, but its usage is limited by poor storage properties of fresh fruit. Processing into flour, can increase its utilization. The aim of this research was to utilize breadfruit flour in production of nutritious snack foods for School Supplementary Feeding Programme (PMT-AS. There were three products developed in this study; brownies, pia, and croquette. The research was conducted using experimental design. The proportions of breadfruit flour and wheat flour were different for each product, which brownies was formulated using 70:30, 80:20, 90:10, and 100:0; whereas pia and croquette was formulated by 50:50, 60:40, 70:30, and 80:20. Proximate analysis showed that 100 g brownies contained 409 kcal energy and 7.5 g protein, 100 g pia had 383 kcal energy and 6.7 g protein and croquette had the highest energy and protein content is 455 kcal and 9.9 g protein. In conclusion, all products were suitable as alternative snacks for PMT-AS. The products have met 300 kcal energy and 5 g protein per serving size. Considered also the cost of production, these products have fulfilled criteria to be used in PMT-AS.Keywords: breadfruit, PMT-AS, snacksABSTRAKSukun merupakan buah yang bernilai dan memiliki kandungan gizi yang baik, tetapi penggunaannya terbatas oleh penyimpanan ketika berbentuk buah segar. Sukun yang diubah ke dalam bentuk tepung dapat meningkatkan pemanfaatannya. Tujuan dari penelitian ini adalah memanfaatkan tepung sukun dalam pembuatan kudapan sebagai alternatif makanan bergizi untuk PMT-AS. Terdapat tiga produk dalam penelitian ini, yaitu brownies, pia, dan kroket. Penelitian ini menggunakan desain eksperimental. Perbandingan tepung sukun dan tepung terigu berbeda untuk masing-masing produk. Formulasi brownies adalah 70:39, 80:20, 90:10, dan 100:0, sedangkan formulasi pia dan kroket adalah 50:50, 60:40, 70:30, dan 80:20. Berdasarkan uji organoleptik diketahui bahwa produk

  18. Characterization of cDNA for PMT: a Partial Nicotine Biosynthesis-Related Gene Isolated from Indonesian Local Tobacco (Nicotiana tabacum cv. Sindoro1

    Directory of Open Access Journals (Sweden)

    SESANTI BASUKI

    2013-12-01

    Full Text Available Nicotine is the major alkaloid compound in cultivated tobacco (Nicotiana tabacum that could potentially be converted into carcinogenic compound (nor-nicotine. The PMT gene encoding putrescine N-methyltransferase (PMT is one of the two key genes that play a prominent role in nicotine biosynthesis. The aimed of this study was to isolate and characterize the cDNA sequence originated from Indonesian local tobacco cv. Sindoro1 (Ntpmt_Sindoro1. The results showed that the Ntpmt_Sindoro1 was 1124 bp in length. This cDNA fragment encodes for 374 amino acid residues. The predicted polypeptide from the cDNA is a hidrophilic protein, and has a predicted molecular weight of 40.95 kDa. The predicted amino acids sequence also showed high similarity to the PMT gene product Nicotiana sp. available in the GenBank data base. The amino acid sequences also exert conserved residues specifically exhibited only by PMT gene originated from N. tabacum. Clustering analysis revealed that Ntpmt_Sindoro1 belongs to the same clade as the PMT3 gene, a member of the N. tabacum PMT gene family. The Ntpmt_Sindoro1 cDNA sequence covering exon1-exon8 of the PMT gene fragment has been registered in the GenBank data base, under the accession number JX978277.

  19. A high resolution animal PET scanner using compact PS-PMT detectors

    International Nuclear Information System (INIS)

    Watanabe, M.; Okada, H.; Shimizu, K.; Omura, T.

    1996-01-01

    A new high resolution PET scanner dedicated to animal studies has been designed, built and tested. The system utilizes 240 block detectors, each of which consists of a new compact position-sensitive photomultiplier tube (PS-PMT) and an 8 x 4 BGO array. A total number of 7,680 crystals (480 per ring) are positioned to form a 508 mm diameter of 16 detector rings with 7.2 mm pitch and 114 mm axial field of view (FOV). The system is designed to perform activation studies using a monkey in a sitting position. The data can be acquired in either 2D or 3D mode, where the slice collimators are retracted in 3D mode. The transaxial resolution is 2.6 mm FWHM at the center of the FOV, and the average axial resolution on the axis of the ring is 3.3 mm FWHM in the direct slice and 3.2 mm FWHM in the cross slice. The scatter fraction, sensitivity and count rate performance were evaluated for a 10 cm diameter cylindrical phantom. The total system sensitivity is 2.3 kcps/kBq/ml in 2D mode and 22.8 kcps/kBq/ml in 3D mode. The noise equivalent count rate with 3D mode is equivalent to that with 2D mode at five times higher radioactivity level. The applicable imaging capabilities of the scanner was demonstrated by animal studies with a monkey

  20. Analysis and Toxicity of Plain (PMP) and Blended (PMT) Indian Pan Masala (PM).

    Science.gov (United States)

    Nigam, Suresh Kumar; Venkatakrishna-Bhatt, H

    2013-02-01

    Betel leaf combined with areca nut is known as betel quid pan masala (PM), and tobacco with areca nut, catechu and lime is pan masala (PMT) blended with gulkhand. These narcotics are popular among young and old individuals. A prima facia chemical analysis and a toxicity assessment of PM in mice were conducted to study the relationship between longtime consumption of PM and health hazards. Chemical analysis of different types of PM was done employing HPLC, GLC, AAS, ES, TLC, GCMS and sequential extraction for PAH, pesticides, metals and minerals, electrolytes, drugs and xenobiotics. Ethanolic PM extracts were tested by IP and PO routes in inbred Swiss mice. PAH, which are known xenobiotics for pre-cancerous lesions, were significantly high (peffect on blood and organ weights (kidney, heart, spleen and liver), but we did observe attenuated testis. However, in the bone marrow of the mice, chromosomes were most affected in the mice fed PM-Zarda blend for 3 months. The chromosomal abnormalities included ploidy, loss, breaks, gaps, deletions and exchanges in ring chromosomes. The PM caused sperm head anomalies (narrow, blunt, triangular and banana shapes), and the sperm were irregular, amorphous, tailless and rudimentary, with the maximum effect among the groups fed PM for 3 months. Significantly higher levels (p<0.01) of testis glycogen, cholesterol and protein were found. The group fed for 16 days showed no change in red blood corpuscles (RBC), white blood corpuscles (WBC), hemoglobin and erythrocyte sedimentation counts.

  1. Optimization of the electron collection efficiency of a large area MCP-PMT for the JUNO experiment

    Energy Technology Data Exchange (ETDEWEB)

    Chen, Lin, E-mail: chenlin@opt.cn [State Key Laboratory of Transient Optics and Photonics, Xi’an Institute of Optics and Precision Mechanics (XIOPM), Chinese Academy of Sciences (CAS), Xi’an 710119 (China); Graduate School of Chinese Academy of Sciences (CAS), Beijing 100049 (China); Xi’an Jiaotong University, Xi’an 710049 (China); Tian, Jinshou [Graduate School of Chinese Academy of Sciences (CAS), Beijing 100049 (China); Liu, Chunliang [Xi’an Jiaotong University, Xi’an 710049 (China); Wang, Yifang; Zhao, Tianchi [Institute of High Energy Physics (IHEP) of CAS, Beijing 100049 (China); Liu, Hulin; Wei, Yonglin; Sai, Xiaofeng [Graduate School of Chinese Academy of Sciences (CAS), Beijing 100049 (China); Chen, Ping [State Key Laboratory of Transient Optics and Photonics, Xi’an Institute of Optics and Precision Mechanics (XIOPM), Chinese Academy of Sciences (CAS), Xi’an 710119 (China); Graduate School of Chinese Academy of Sciences (CAS), Beijing 100049 (China); Wang, Xing; Lu, Yu [Graduate School of Chinese Academy of Sciences (CAS), Beijing 100049 (China); Hui, Dandan; Guo, Lehui [State Key Laboratory of Transient Optics and Photonics, Xi’an Institute of Optics and Precision Mechanics (XIOPM), Chinese Academy of Sciences (CAS), Xi’an 710119 (China); Graduate School of Chinese Academy of Sciences (CAS), Beijing 100049 (China); Liu, Shulin; Qian, Sen; Xia, Jingkai; Yan, Baojun; Zhu, Na [Institute of High Energy Physics (IHEP) of CAS, Beijing 100049 (China); Sun, Jianning; Si, Shuguang [North Night Vision Technology (NNVT) CO., LTD, Nanjing 210110 (China); and others

    2016-08-11

    A novel large-area (20-inch) photomultiplier tube based on microchannel plate (MCP-PMTs) is proposed for the Jiangmen Underground Neutrino Observatory (JUNO) experiment. Its photoelectron collection efficiency C{sub e} is limited by the MCP open area fraction (A{sub open}). This efficiency is studied as a function of the angular (θ), energy (E) distributions of electrons in the input charge cloud and the potential difference (U) between the PMT photocathode and the MCP input surface, considering secondary electron emission from the MCP input electrode. In CST Studio Suite, Finite Integral Technique and Monte Carlo method are combined to investigate the dependence of C{sub e} on θ, E and U. Results predict that C{sub e} can exceed A{sub open}, and are applied to optimize the structure and operational parameters of the 20-inch MCP-PMT prototype. C{sub e} of the optimized MCP-PMT is expected to reach 81.2%. Finally, the reduction of the penetration depth of the MCP input electrode layer and the deposition of a high secondary electron yield material on the MCP are proposed to further optimize C{sub e}.

  2. Cross Talk Study to the Single Photon Response of a Flat Panel PMT for the RICH Upgrade at LHCb

    CERN Multimedia

    Arnaboldi, C; Calvi, M; Fanchini, E; Gotti, C; Maino, M; Matteuzzi, C; Perego, D L; Pessina, G; Wang, J C

    2009-01-01

    The Ring Imaging CHerenkov, RICH, detector at LHCb is now readout by Hybrid Photon Detectors. In view of its upgrade a possible option is the adoption of the flat panel Photon Multipliers Tubes, PMT. An important issue for the good determination of the rings produced in the sensitive media is a negligible level of cross talk. We have experimentally studied the cross talk from the 64x64 pixels of the H9500 PMT from Hamamatsu. Results have shown that at the single photon signal level, as expected at LHCb, the statistics applied to the small number of electrons generated at the first dynode of the PMT chain leads to a cross talk mechanism that must be interpreted in term of the percentage of the number of induced signals rather than on the amplitude of the induced signals. The threshold to suppress cross talk must be increased to a significant fraction of the single photon signal for the worst case. The number of electrons generated at the first dynode is proportional to the biasing voltage. Measurements have sh...

  3. Optimization of the electron collection efficiency of a large area MCP-PMT for the JUNO experiment

    International Nuclear Information System (INIS)

    Chen, Lin; Tian, Jinshou; Liu, Chunliang; Wang, Yifang; Zhao, Tianchi; Liu, Hulin; Wei, Yonglin; Sai, Xiaofeng; Chen, Ping; Wang, Xing; Lu, Yu; Hui, Dandan; Guo, Lehui; Liu, Shulin; Qian, Sen; Xia, Jingkai; Yan, Baojun; Zhu, Na; Sun, Jianning; Si, Shuguang

    2016-01-01

    A novel large-area (20-inch) photomultiplier tube based on microchannel plate (MCP-PMTs) is proposed for the Jiangmen Underground Neutrino Observatory (JUNO) experiment. Its photoelectron collection efficiency C e is limited by the MCP open area fraction (A open ). This efficiency is studied as a function of the angular (θ), energy (E) distributions of electrons in the input charge cloud and the potential difference (U) between the PMT photocathode and the MCP input surface, considering secondary electron emission from the MCP input electrode. In CST Studio Suite, Finite Integral Technique and Monte Carlo method are combined to investigate the dependence of C e on θ, E and U. Results predict that C e can exceed A open , and are applied to optimize the structure and operational parameters of the 20-inch MCP-PMT prototype. C e of the optimized MCP-PMT is expected to reach 81.2%. Finally, the reduction of the penetration depth of the MCP input electrode layer and the deposition of a high secondary electron yield material on the MCP are proposed to further optimize C e .

  4. Promoting scopolamine biosynthesis in transgenic Atropa belladonna plants with pmt and h6h overexpression under field conditions.

    Science.gov (United States)

    Xia, Ke; Liu, Xiaoqiang; Zhang, Qiaozhuo; Qiang, Wei; Guo, Jianjun; Lan, Xiaozhong; Chen, Min; Liao, Zhihua

    2016-09-01

    Atropa belladonna is one of the most important plant sources for producing pharmaceutical tropane alkaloids (TAs). T1 progeny of transgenic A. belladonna, in which putrescine N-methyltransferase (EC. 2.1.1.53) from Nicotiana tabacum (NtPMT) and hyoscyamine 6β-hydroxylase (EC. 1.14.11.14) from Hyoscyamus niger (HnH6H) were overexpressed, were established to investigate TA biosynthesis and distribution in ripe fruits, leaves, stems, primary roots and secondary roots under field conditions. Both NtPMT and HnH6H were detected at the transcriptional level in transgenic plants, whereas they were not detected in wild-type plants. The transgenes did not influence the root-specific expression patterns of endogenous TA biosynthetic genes in A. belladonna. All four endogenous TA biosynthetic genes (AbPMT, AbTRI, AbCYP80F1 and AbH6H) had the highest/exclusive expression levels in secondary roots, suggesting that TAs were mainly synthesized in secondary roots. T1 progeny of transgenic A. belladonna showed an impressive scopolamine-rich chemotype that greatly improved the pharmaceutical value of A. belladonna. The higher efficiency of hyoscyamine conversion was found in aerial than in underground parts. In aerial parts of transgenic plants, hyoscyamine was totally converted to downstream alkaloids, especially scopolamine. Hyoscyamine, anisodamine and scopolamine were detected in underground parts, but scopolamine and anisodamine were more abundant than hyoscyamine. The exclusively higher levels of anisodamine in roots suggested that it might be difficult for its translocation from root to aerial organs. T1 progeny of transgenic A. belladonna, which produces scopolamine at very high levels (2.94-5.13 mg g(-1)) in field conditions, can provide more valuable plant materials for scopolamine production. Copyright © 2016 Elsevier Masson SAS. All rights reserved.

  5. Forward physics in CMS: Simulation of PMT hits in HF and Higgs mass reconstruction methods with a focus on forward jet tagging

    CERN Document Server

    Moeller, Anthony Richard

    2014-01-01

    Abnormally high energy events were seen in the Hadronic Forward (HF) calorimeter for pion and muon data during testbeam in 2004. Analysis of testbeam data suggested that such events were caused by particles traveling the entire length of HF and striking the photomultiplier (PMT) windows in the readout box behind HF. Charged particles traversing the window of the PMT emit cerenkov radiation, which creates abnormally high energy events in the data. To further study these events, a modification of the existing official CMS HF simulation was created that added the PMT windows to the simulation as sensitive detectors. In agreement with testbeam data, abnormally high energy events in the PMTs were seen in the simulation for muons and pions. The simulation was then extended to jets simulated with Pythia, and then for collision like events as well. PMT hits were seen in both of these cases. Energy sharing between PMTs for long and short fibers in HF as well as timing differences between normal HF events and PMT event...

  6. A front end ASIC for the readout of the PMT in the KM3NeT detector

    International Nuclear Information System (INIS)

    Gajanana, D; Gromov, V; Timmer, P; Heine, E; Kluit, R

    2010-01-01

    In this work, we describe the front end ASIC to readout the Photo-Multiplier-Tube of the KM3NeT detector, in detail. Stringent power budgeting, area constraints and lowering cost motivate us to design a custom front-end ASIC for reading the PMT. The ASIC amplifies the PMT signal and discriminates it against a threshold level and delivers the information via low voltage differential signals (LVDS). These LVDS signals carry highly accurate timing information of the photons . The length of the LVDS signals or Time over Threshold (ToT) gives information on the number of detected photons. A one-time programmable read-only memory (PROM) block provides unique identification to the chip. The chip communicates with the data acquisition electronics via an I 2 C bus. The data is transmitted to shore via fiber optics, where processing is done. The ASIC was fabricated in 0.35u CMOS process from AustriaMicroSystems (AMS).

  7. A Study of Personal Health Record User's Behavioral Model Based on the PMT and UTAUT Integrative Perspective.

    Science.gov (United States)

    Hsieh, Hui-Lung; Kuo, Yu-Ming; Wang, Shiang-Ru; Chuang, Bi-Kun; Tsai, Chung-Hung

    2016-12-23

    The personal health record (PHR) is a system that enables borderless medical care services by combining technological innovation and human consideration. This study explored factors affecting the adoption of PHR from technical, medical, and social perspectives according to the Protection Motivation Theory (PMT) and Unified Theory of Acceptance and Use of Technology (UTAUT) model. A survey using a structured questionnaire was subsequently conducted, which produced the following results: (1) The PMT and UTAUT were effective at predicting PHR usage behaviors; (2) Perceived ease-of-use was the most decisive factor influencing the use of PHR, followed by self-efficacy and perceived usefulness; and (3) Behavioral intention for PHR was significantly and positively correlated with usage behavior. From the obtained results, this study recommends that health authorities and medical institutions promote self-efficacy in the use of PHR to improve the levels of behavioral intention and usage behavior among the people. Additionally, medical care institutions are recommended to promote health management and preventive healthcare concepts to help improve public acceptance of the PHR system as a means to self-manage their health. Finally, community centers, medical institutions, and health authorities are urged to work together to enhance public medical knowledge and pool resources for the PHR system, both of which are essential for improving the popularity of the PHR, public quality of life, and the effectiveness of health management.

  8. A Study of Personal Health Record User’s Behavioral Model Based on the PMT and UTAUT Integrative Perspective

    Directory of Open Access Journals (Sweden)

    Hui-Lung Hsieh

    2016-12-01

    Full Text Available The personal health record (PHR is a system that enables borderless medical care services by combining technological innovation and human consideration. This study explored factors affecting the adoption of PHR from technical, medical, and social perspectives according to the Protection Motivation Theory (PMT and Unified Theory of Acceptance and Use of Technology (UTAUT model. A survey using a structured questionnaire was subsequently conducted, which produced the following results: (1 The PMT and UTAUT were effective at predicting PHR usage behaviors; (2 Perceived ease-of-use was the most decisive factor influencing the use of PHR, followed by self-efficacy and perceived usefulness; and (3 Behavioral intention for PHR was significantly and positively correlated with usage behavior. From the obtained results, this study recommends that health authorities and medical institutions promote self-efficacy in the use of PHR to improve the levels of behavioral intention and usage behavior among the people. Additionally, medical care institutions are recommended to promote health management and preventive healthcare concepts to help improve public acceptance of the PHR system as a means to self-manage their health. Finally, community centers, medical institutions, and health authorities are urged to work together to enhance public medical knowledge and pool resources for the PHR system, both of which are essential for improving the popularity of the PHR, public quality of life, and the effectiveness of health management.

  9. PERILAKU MAKAN MURID SEKOLAH DASAR PENERIMA PMT-AS DI DESA CIHEULEUT DAN PASIR GAOK KABUPATEN BOGOR

    Directory of Open Access Journals (Sweden)

    Hermina Hermina

    2012-11-01

    Full Text Available FOOD CONSUMPTION BEHAVIOR OF ELEMENTARY SCHOOL PUPILS PARTICIPATING IN "PMT-AS" PROGRAM AT THE CIHEULEUT AND PASIR GAOK VILLAGE DISTRICT OF BOGOR.Objective: To collect informations regarding actual food consumption behaviour of the pupils, i.e. to develop right message to improve food consumption and nutrition status of the pupils.Results: Most of the pupils have not been applying good and acceptable food consumption behavior, i.e. quantitatively and qualitatively as well; their dietary food consumption patterns relatively monotoneous, vegetables are consumted very limited and also protein sources are less varieties. Snack foods which are usually consumed at school are less varieties and relatively unsafe.Conclusions: There are important messages developed to improve food consumption and nutrition status of the pupils, i.e. eat breakfast before go to school, have complete meal 2-3 times a day and consumed vegetables every day.Key Words: food consumption behavior, school suplementary feeding program (PMT-AS, nutrition education, elementary school pupils

  10. A Study of Personal Health Record User’s Behavioral Model Based on the PMT and UTAUT Integrative Perspective

    Science.gov (United States)

    Hsieh, Hui-Lung; Kuo, Yu-Ming; Wang, Shiang-Ru; Chuang, Bi-Kun; Tsai, Chung-Hung

    2016-01-01

    The personal health record (PHR) is a system that enables borderless medical care services by combining technological innovation and human consideration. This study explored factors affecting the adoption of PHR from technical, medical, and social perspectives according to the Protection Motivation Theory (PMT) and Unified Theory of Acceptance and Use of Technology (UTAUT) model. A survey using a structured questionnaire was subsequently conducted, which produced the following results: (1) The PMT and UTAUT were effective at predicting PHR usage behaviors; (2) Perceived ease-of-use was the most decisive factor influencing the use of PHR, followed by self-efficacy and perceived usefulness; and (3) Behavioral intention for PHR was significantly and positively correlated with usage behavior. From the obtained results, this study recommends that health authorities and medical institutions promote self-efficacy in the use of PHR to improve the levels of behavioral intention and usage behavior among the people. Additionally, medical care institutions are recommended to promote health management and preventive healthcare concepts to help improve public acceptance of the PHR system as a means to self-manage their health. Finally, community centers, medical institutions, and health authorities are urged to work together to enhance public medical knowledge and pool resources for the PHR system, both of which are essential for improving the popularity of the PHR, public quality of life, and the effectiveness of health management. PMID:28025557

  11. Assessment the Effect of Educational Intervention on Preventive Behaviors of Home Accidents in Mothers with Children Less than 5- Year Based on Protection Motivation Theory (PMT

    Directory of Open Access Journals (Sweden)

    Farbod Ebadi Fardazar

    2016-07-01

    Full Text Available Background: The accidents are the leading cause of morbidity and mortality among children in in the world. The aim of this study was to determine the effect of Educational intervention on promotion of prevention behaviors of home accidents in mothers with children less than 5- year based on protection motivation theory (PMT in 2015. Materials and Methods: In this controlled interventional study 190 mothers with children less than 5 years were participated (95 in intervention group and 95 in control group.The data collection tool was researcher made questionnaire based on the structures of PMT. After done pre-test and the results obtained from it, appropriate educational intervention designed and was conducted only in intervention group. Then two months after the educational intervention, evaluation was done and data analysis was using SPSS-20. Results: Statistically significant difference was found between mean scores of all structures of PMT in intervention and control groups after the educational intervention (P

  12. Hepatobiliary scintigraphy and function test with sup(99m)Tc-N-pyridoxyl-5-methyltryptophan (sup(99m)Tc-PMT)

    International Nuclear Information System (INIS)

    Sugimura, Kazuro; Nishiyama, Shoji; Narabayashi, Isamu

    1985-01-01

    The authors studied the effectiveness of sup(99m)Tc-N-pyridoxyl-5-methyltryptophan (sup(99m)Tc-PMT) for dynamic imaging and function on 40 patients with various hepatobiliary diseases and on healthy individuals. In healthy subjects, sup(99m)Tc-PMT is rapidly removed from the blood by the parenchymal cells of the liver and is excreted through the biliary system. The imaging of the liver, bile ducts, gallbladder and intestines with sup(99m)Tc-PMT was satisfactory. There was no renal visualization. In the case of serial images of healthy individuals, the gallbladder, intrahepatic bile duct and small intestine were visualized after 18.8 +- 7.2, 8.8 +- 1.4, and 16.7 +- 6.3 min, respectively; the mean peak time on the hepatogram was 8.0 +- 5.3 min. The bile ducts of patients with liver disorders were visualized later than those of healthy individuals. Particularly in the case of severe liver parenchymal diseases, the appearance time for the bile duct was significantly delayed. However, the delays in appearance time did not correlate well with low scores on the liver function test. At 70 min after the intravenous administration of sup(99m)Tc-PMT, 2.5 +- 1.5 % of the injected dose was excreted into the urine of the healthy individuals. The urinary excretion of sup(99m)Tc-PMT by the patients with hepatobiliary diseases showed no increase, and it was not entirely related to the results of the serum function tests. However, a larger amount of sup(99m)Tc-PMT was retained in the blood of the patients with hepatobiliary diseases. The blood retention values at 20 min after injection into those with liver cirrhosis and hepatoma were significantly delayed. (author)

  13. Structural Redesigning Arabidopsis Lignins into Alkali-Soluble Lignins through the Expression of p-Coumaroyl-CoA:Monolignol Transferase PMT1

    Science.gov (United States)

    Sibout, Richard; Le Bris, Philippe; Cézard, Laurent

    2016-01-01

    Grass lignins can contain up to 10% to 15% by weight of p-coumaric esters. This acylation is performed on monolignols under the catalysis of p-coumaroyl-coenzyme A monolignol transferase (PMT). To study the impact of p-coumaroylation on lignification, we first introduced the Brachypodium distachyon Bradi2g36910 (BdPMT1) gene into Arabidopsis (Arabidopsis thaliana) under the control of the constitutive maize (Zea mays) ubiquitin promoter. The resulting p-coumaroylation was far lower than that of lignins from mature grass stems and had no impact on stem lignin content. By contrast, introducing either the BdPMT1 or the Bradi1g36980 (BdPMT2) gene into Arabidopsis under the control of the Arabidopsis cinnamate-4-hydroxylase promoter boosted the p-coumaroylation of mature stems up to the grass lignin level (8% to 9% by weight), without any impact on plant development. The analysis of purified lignin fractions and the identification of diagnostic products confirmed that p-coumaric acid was associated with lignins. BdPMT1-driven p-coumaroylation was also obtained in the fah1 (deficient for ferulate 5-hydroxylase) and ccr1g (deficient for cinnamoyl-coenzyme A reductase) lines, albeit to a lower extent. Lignins from BdPMT1-expressing ccr1g lines were also found to be feruloylated. In Arabidopsis mature stems, substantial p-coumaroylation of lignins was achieved at the expense of lignin content and induced lignin structural alterations, with an unexpected increase of lignin units with free phenolic groups. This higher frequency of free phenolic groups in Arabidopsis lignins doubled their solubility in alkali at room temperature. These findings suggest that the formation of alkali-leachable lignin domains rich in free phenolic groups is favored when p-coumaroylated monolignols participate in lignification in a grass in a similar manner. PMID:26826222

  14. Photomultiplier tube artifacts on 67Ga-citrate imaging caused by loss of correction floods due to an off-peak status of one head of a dual-head γ-camera.

    Science.gov (United States)

    Glaser, Joseph E; Song, Na; Jaini, Sridivya; Lorenzo, Ruth; Love, Charito

    2012-12-01

    γ-cameras use flood-field corrections to ensure image uniformity during clinical imaging. A loss or corruption of the correction data of one head of a dual-head camera can result in an off-peak artifactual appearance. We present our experience with the occurrence of such an incident on a (67)Ga scan. A patient was referred for a whole-body (67)Ga scan to evaluate for causes of neutropenic fever. Whole-body planar and static images of the head, chest, abdomen, pelvis, and lower extremities in multiple projections were obtained. Whole-body images showed decreased image quality on the anterior view obtained with detector 1 and an unremarkable posterior image obtained with detector 2. A problem with detector 2 was suspected, and additional static images were obtained after rotation of the detector heads. The posterior images taken with detector 1 showed photomultiplier tube outlines. The anterior images taken with detector 2 showed improved count and image quality. It was later found that the uniformity map for detector 2 had been lost and that this software malfunction led to the resulting imaging problem. When artifacts with an off-peak appearance are seen on scintigraphic images, evaluation of possible causes should include not only isotope window settings but also an incorrect or corrupted uniformity map.

  15. Simulation of the electron collection efficiency of a PMT based on the MCP coated with high secondary yield material

    Energy Technology Data Exchange (ETDEWEB)

    Chen, Lin, E-mail: chenlin@opt.cn [State Key Laboratory of Transient Optics and Photonics, Xi' an Institute of Optics and Precision Mechanics (XIOPM), Chinese Academy of Sciences (CAS), Xi' an 710119 (China); Graduate School of Chinese Academy of Sciences (CAS), Beijing 100049 (China); Xi' an Jiaotong University, Xi' an 710049 (China); Collaborative Innovation Center of Extreme Optics, Shanxi University, Taiyuan 030006 (China); Tian, Jinshou [State Key Laboratory of Transient Optics and Photonics, Xi' an Institute of Optics and Precision Mechanics (XIOPM), Chinese Academy of Sciences (CAS), Xi' an 710119 (China); Collaborative Innovation Center of Extreme Optics, Shanxi University, Taiyuan 030006 (China); Zhao, Tianchi [Institute of High Energy Physics (IHEP) of CAS, Beijing 100049 (China); Liu, Chunliang [Xi' an Jiaotong University, Xi' an 710049 (China); Liu, Hulin; Wei, Yonglin; Sai, Xiaofeng [State Key Laboratory of Transient Optics and Photonics, Xi' an Institute of Optics and Precision Mechanics (XIOPM), Chinese Academy of Sciences (CAS), Xi' an 710119 (China); Chen, Ping [State Key Laboratory of Transient Optics and Photonics, Xi' an Institute of Optics and Precision Mechanics (XIOPM), Chinese Academy of Sciences (CAS), Xi' an 710119 (China); Graduate School of Chinese Academy of Sciences (CAS), Beijing 100049 (China); Wang, Xing; Lu, Yu [State Key Laboratory of Transient Optics and Photonics, Xi' an Institute of Optics and Precision Mechanics (XIOPM), Chinese Academy of Sciences (CAS), Xi' an 710119 (China); Hui, Dandan [State Key Laboratory of Transient Optics and Photonics, Xi' an Institute of Optics and Precision Mechanics (XIOPM), Chinese Academy of Sciences (CAS), Xi' an 710119 (China); Graduate School of Chinese Academy of Sciences (CAS), Beijing 100049 (China)

    2016-11-01

    Owning to the serious loss of photoelectrons striking at the input electrode of traditional microchannel plate (MCP), photoelectron collection efficiency (CE) of photomultiplier tubes based on MCP (MCP-PMTs) fluctuates around the MCP open area fraction and cannot make a breakthrough. Depositing a thin film of high secondary electron yield material on the MCP is proposed as an effective approach to improve the CE. The available simulation and experimental data to validate it, however, is sparse. In our work, a three-dimensional small area MCP model is developed in CST Studio Suite to evaluate the collection efficiencies of PMTs based on the traditional MCP and the coated one, respectively. Results predict that CE of the PMT based on the coated MCP has a significant increase and a better uniformity, which is expected to reach 100%.

  16. Noise Filter Studies for CMS Forward Hadron Calorimeter (HF) Between Old and New PMT's Using Data in 2012

    CERN Document Server

    Dumanoglu, Isa; Gurpinar, Emine; Kunori, Shuichi; Lezki, Samet; Tali, Bayram

    2016-01-01

    During the data taking before 2012 some abnormal events which have higher signals than expected were observed. Most of these were due to muons. When a muon hits the PMT glass window it creates a huge signal. To eliminate this kind of events 24 old HF PMTs (Hamamatsu R7525) in HF Minus at iphi 43 (corresponds to one sector) were replaced with new multi anode PMTs (Hamamatsu multi anode R7600) which have thin glass windows. These new PMTs were installed and tested in H2 test beam area in 2009 [1]. To check whether these new PMTs perform better than the old ones data taken in 2012 were analyzed using various predefined noise filters. Noisy rechits percentage was found to be around 6-7 \\% for the new PMTs while it varies between 29-66 \\% for the old PMTs for various trigger selections and for HFLongShortFilter after an energy cut of 500GeV [2].

  17. Faktor – Faktor yang Berhubungan demgan Pemberian Makanan Tambahan (PMT pada Bayi Usia (0-6 Bulan di Wilayah Kerja Puskesmas Garuda Kelurahan Tangkerang Tengah Kota Pekanbaru

    Directory of Open Access Journals (Sweden)

    Meliza Rasyid

    2017-12-01

    Full Text Available Pemberian Makanan Tambahan (PMT pada bayi adalah pemberian makanan atau minuman yang mengandung zat gizi pada bayi atau anak usia 6-24 bulan untuk memenuhi kebutuhan gizi setelah pemberian ASI Eksklusif. Pencapaian angka pemberian ASI eksklusif di Provinsi Riau Tahun 2011 adalah 45,9%, tahun 2012 meningkat menjadi 46,2%. Cakupan ASI Eksklusif Puskesmas tahun 2012 sebesar 60,4%, tahun 2013 menurun menjadi 32,5%. Tujuan penelitian untuk mengetahui faktor-faktor yang berhubungan dengan pemberian makanan tambahan (PMT pada bayi usia (0-6 bulan di Wilayah Kerja Puskesmas Garuda Kelurahan Tangkerang Tengah Kota Pekanbaru. Penelitian ini bersifat analitik kuantitatif observasional dengan desain (cross sectional dengan variable dependen pemberian makanan tambahan (PMT dan variabel independen (pendidikan, pekerjaan, pengetahua, dan sumber informasi. Populasi dalam penelitian ini adalah seluruh ibu-ibu yang memiliki bayi usia (0-6 bulan sebanyak 388 orang dengan sampel sebagian ibu-ibu yang memiliki bayi usia (0-6 bulan sebanyak 128. Teknik pengambilan sampel adalah quota sampling. Jenis data terdiri dari data primer dan data sekunder. Pengumpulan data primer diperoleh langsung dari pengamatan di lapangan melalui wawancara dengan alat pengukuran kuesioner. Analisis yang digunakan adalah analisis univariat, bivariat dengan uji Chi-square dan multivariat. Hasil penelitian menunjukkan terdapat hubungan antara pendidikan dengan Pemberian Makanan Tambahan dengan (P value 0,032, POR 95% CI = 2,338 1,137-4,808, pengetahuan dengan (P value 0,002, nilai POR 95% CI = 3,844 1,710-8,639 Disarankan ke instansi terkait untuk meningkatkan program komunikasi, informasi, dan edukasi (KIE, menjalin kerja sama lintas program dan lintas sektor, lebih aktif memberikan informasi kepada ibu yang memiliki bayi usia (0-6 bulan dengan pendidikan dan pengetahuan yang masih rendah salah satunya melalui penyuluhan tentang pemberian makanan tambahan (PMT.   Kata Kunci

  18. First Tests of a New Fast Waveform Digitizer for PMT Signal Read-out from Liquid Argon Dark Matter Detectors

    Science.gov (United States)

    Szelc, A. M.; Canci, N.; Cavanna, F.; Cortopassi, A.; D'Incecco, M.; Mini, G.; Pietropaolo, F.; Romboli, A.; Segreto, E.; Acciarri, R.

    A new generation Waveform Digitizer board as been recently made available on the market by CAEN. The new board CAEN V1751 with 8 Channels per board, 10 bit, 1 GS/s Flash ADC Waveform Digitizer (or 4 channel, 10 bit, 2 GS/s Flash ADC Waveform Digitizer -Dual Edge Sampling mode) with threshold and Auto-Trigger capabilities provides an ideal (relatively low-cost) solution for reading signals from liquid Argon detectors for Dark Matter search equipped with an array of PMTs for the detection of scintillation light. The board was extensively used in real experimental conditions to test its usefulness for possible future uses and to compare it with a state of the art digital oscilloscope. As results, PMT Signal sampling at 1 or 2 GS/s is appropriate for the reconstruction of the fast component of the signal scintillation in Argon (characteristic time of about 4 ns) and the extended dynamic range, after a small customization, allows for the detection of signals in the range of energy needed. The bandwidth is found to be adequate and the intrinsic noise is very low.

  19. Proof-of-principle study of a small animal PET/field-cycled MRI combined system using conventional PMT technology

    International Nuclear Information System (INIS)

    Peng Hao; Handler, William B.; Scholl, Timothy J.; Simpson, P.J.; Chronik, Blaine A.

    2010-01-01

    There are currently several approaches to the development of combined PET/MRI systems, all of which need to address adverse interactions between the two systems. Of particular relevance to the majority of proposed PET/MRI systems is the effect that static and dynamic magnetic fields have on the performance of PET detection systems based on photomultiplier tubes (PMTs). In the work reported in this paper, performance of two conventional PMTs has been systematically investigated and characterized as a function of magnetic field exposure conditions. Detector gain, energy resolution, time resolution, and efficiency were measured for static field exposures between 0 and 6.3 mT. Additionally, the short-term recovery and long-term stability of gain and energy resolution were measured in the presence of repeatedly applied dynamic magnetic fields changing at 4 T/s. It was found that the detectors recovered normal operation within several milliseconds following the end of large pulsed magnetic fields. In addition, the repeated applications of large pulsed magnetic fields did not significantly affect detector stability. Based on these results, we implemented a proof-of-principle PET/field-cycled MRI (FCMRI) system for small animal imaging using commercial PMT-based PET detectors. The first PET images acquired within the PET/FCMRI system are presented. The image quality, in terms of spatial resolution, was compared between standalone PET and the PET/FCMRI system. Finally, the relevance of these results to various aspects of PET/MRI system design is discussed.

  20. Assessment of hepatic functional reserve for hepatic resection using {sup 99m}Tc-PMT scintigraphy in comparison with {sup 99m}Tc-GSA scintigraphy

    Energy Technology Data Exchange (ETDEWEB)

    Sakuma, Atsushi [Dokkyo Univ. School of Medicine, Mibu, Tochigi (Japan)

    2000-03-01

    {sup 99m}Tc-diethylenetriamine-pentaacetic acid-galactosyl human serum albumin({sup 99m}Tc-GSA) scintigraphy has been reported as a useful study of hepatic functional reserve recently. We have performed {sup 99m}Tc-N-pyridoxyl-5-methyl-tryptophan({sup 99m}Tc-PMT) and {sup 99m}Tc-GSA preoperatively for evaluation of hepatic functional reserve and compared the usefulness of those scintigraphy study. Twenty-four patients who were the candidates of hepatic resection underwent {sup 99m}Tc-PMT scintigraphy preoperatively. Hepatic blood flow coefficient (K value), the amount of hepatic blood flow (HBF), and the ratio of portal blood flow (PVR) were computed. {sup 99m}Tc-GSA scintigraphy was also performed within two weeks of the {sup 99m}Tc-PMT scintigraphy, and the ratio of disappearance (HH{sub 15}) and the hepatic uptake ratio (LHL{sub 15}) were computed. The relationship between K value, HBF, PVR, HH{sub 15} and LHL{sub 15} was analyzed. Their correlation with other liver function tests was also examined. K value and HBF did not show statistically significant correlations with HH{sub 15} and LHL{sub 15}, PVR correlated statistically significantly HH{sub 15} and LHL{sub 15}. K value correlated with the preoperative values of cholinesterase, Fischer ratio, {gamma}-globulin, ICGR{sub 15}, albumin, and platelet count. There was a statistically significant correlation between LHL{sub 15} and the value of cholinesterase, {gamma}-globulin, platelet count, and Fischer ratio. When the liver resection of subsegmentectomy or more was indicated in 10 patients, nine patients had LHL{sub 15} value less than 0.9 which delineated possibility of poor prognosis. However, judging from K value and HBF, liver resection was considered feasible and it was all successfully performed, resulting in good prognosis. From this study, it is suspected that {sup 99m}Tc-GSA scintigraphy reflect the severity of liver fibrosis and the amount of portal blood flows, and {sup 99m}Tc-PMT scintigraphy

  1. Assessment of hepatic functional reserve for hepatic resection using 99mTc-PMT scintigraphy in comparison with 99mTc-GSA scintigraphy

    International Nuclear Information System (INIS)

    Sakuma, Atsushi

    2000-01-01

    99m Tc-diethylenetriamine-pentaacetic acid-galactosyl human serum albumin( 99m Tc-GSA) scintigraphy has been reported as a useful study of hepatic functional reserve recently. We have performed 99m Tc-N-pyridoxyl-5-methyl-tryptophan( 99m Tc-PMT) and 99m Tc-GSA preoperatively for evaluation of hepatic functional reserve and compared the usefulness of those scintigraphy study. Twenty-four patients who were the candidates of hepatic resection underwent 99m Tc-PMT scintigraphy preoperatively. Hepatic blood flow coefficient (K value), the amount of hepatic blood flow (HBF), and the ratio of portal blood flow (PVR) were computed. 99m Tc-GSA scintigraphy was also performed within two weeks of the 99m Tc-PMT scintigraphy, and the ratio of disappearance (HH 15 ) and the hepatic uptake ratio (LHL 15 ) were computed. The relationship between K value, HBF, PVR, HH 15 and LHL 15 was analyzed. Their correlation with other liver function tests was also examined. K value and HBF did not show statistically significant correlations with HH 15 and LHL 15 , PVR correlated statistically significantly HH 15 and LHL 15 . K value correlated with the preoperative values of cholinesterase, Fischer ratio, γ-globulin, ICGR 15 , albumin, and platelet count. There was a statistically significant correlation between LHL 15 and the value of cholinesterase, γ-globulin, platelet count, and Fischer ratio. When the liver resection of subsegmentectomy or more was indicated in 10 patients, nine patients had LHL 15 value less than 0.9 which delineated possibility of poor prognosis. However, judging from K value and HBF, liver resection was considered feasible and it was all successfully performed, resulting in good prognosis. From this study, it is suspected that 99m Tc-GSA scintigraphy reflect the severity of liver fibrosis and the amount of portal blood flows, and 99m Tc-PMT scintigraphy reflect the hepatic blood flow and ability of protein synthesis. It was proved that 99m Tc-PMT scintigraphy is

  2. Clinical evaluation of the scoring of optical findings with technetium-99m-N-pyridoxyl-5-methyl-tryptophan (PMT) hepatobiliary scintigraphy for fulminant hepatitis

    International Nuclear Information System (INIS)

    Uchiyama, Katsuhiro; Kuniyasu, Yoshio; Niio, Yasuo

    1998-01-01

    Fulminant hepatitis is one of the most life-threatening diseases for which adequate medical therapy does not exist. Then, we evaluated the usefulness of technetium-99m-N-pyridoxyl-5-methyl-tryptophan (PMT) hepatobiliary scintigraphy to estimate the diagnosis and prognosis of fulminant hepatitis. In total 60 patients, 23 with fulminant hepatitis (FH), 25 with severe acute hepatitis (SAH) and 12 with acute hepatitis (AH), computer data acquisition by gamma-camera system started just after the injection of 185 MBq 99m Tc-PMT. The optical finding score which included cardiac blood pool remaining time (0-3), distribution of radioactivity in the liver (0-3), extrahepatic bile duct (EHBD) and intestine appearance time (0-3) were studied. The cardiac blood pool remaining time score was 2.8±0.5 in FH, 2.2±0.8 in SAH, 0.9±1.1 in AH. The intrahepatic distribution score was 2.1±0.8 in FH, 0.3±0.6 in SAH, 0.1±0.3 in AH. The EHBD and intestine appearance time score was 1.9±1.1 in FH, 1.5±1.2 in SAH, 0.3±0.6 in AH. The total score was 6.7±1.4 in FH, 4.0±1.6 in SAH, 1.3±1.3 in AH. There were significantly statistical differences among three groups. While, the cardiac blood pool remaining time score was 3.0±0 in 14 hospital death patients (HD), 1.9±1.0 in 46 alive patients (AL). The intrahepatic distribution score was 2.2±0.8 in HD, 0.5±0.9 in AL. The EHBD and intestine appearance time score was 2.1±1.2 in HD, 1.2±1.1 in AL. The total score was 7.3±1.3 in HD, 3.6±2.2 in AL. There were significantly statistical differences in these groups. The optimal finding score of 99m Tc-PMT hepatobiliary scintigraphy was useful in establishing the diagnosis and prognosis of FH. (author)

  3. PCR method for the rapid detection and discrimination of Legionella spp. based on the amplification of pcs, pmtA, and 16S rRNA genes.

    Science.gov (United States)

    Janczarek, Monika; Palusińska-Szysz, Marta

    2016-05-01

    Legionella bacteria are organisms of public health interest due to their ability to cause pneumonia (Legionnaires' disease) in susceptible humans and their ubiquitous presence in water supply systems. Rapid diagnosis of Legionnaires' disease allows the use of therapy specific for the disease. L. pneumophila serogroup 1 is the most common cause of infection acquired in community and hospital environments. The non-L. pneumophila infections are likely under-detected because of a lack of effective diagnosis. In this work, simplex and duplex PCR assays with the use of new molecular markers pcs and pmtA involved in phosphatidylcholine synthesis were specified for rapid and cost-efficient identification and distinguishing Legionella species. The sets of primers developed were found to be sensitive and specific for reliable detection of Legionella belonging to the eight most clinically relevant species. Among these, four primer sets I, II, VI, and VII used for duplex-PCRs proved to have the highest identification power and reliability in the detection of the bacteria. Application of this PCR-based method should improve detection of Legionella spp. in both clinical and environmental settings and facilitate molecular typing of these organisms.

  4. Dimensionless parameterization of lidar for laser remote sensing of the atmosphere and its application to systems with SiPM and PMT detectors.

    Science.gov (United States)

    Agishev, Ravil; Comerón, Adolfo; Rodriguez, Alejandro; Sicard, Michaël

    2014-05-20

    In this paper, we show a renewed approach to the generalized methodology for atmospheric lidar assessment, which uses the dimensionless parameterization as a core component. It is based on a series of our previous works where the problem of universal parameterization over many lidar technologies were described and analyzed from different points of view. The modernized dimensionless parameterization concept applied to relatively new silicon photomultiplier detectors (SiPMs) and traditional photomultiplier (PMT) detectors for remote-sensing instruments allowed predicting the lidar receiver performance with sky background available. The renewed approach can be widely used to evaluate a broad range of lidar system capabilities for a variety of lidar remote-sensing applications as well as to serve as a basis for selection of appropriate lidar system parameters for a specific application. Such a modernized methodology provides a generalized, uniform, and objective approach for evaluation of a broad range of lidar types and systems (aerosol, Raman, DIAL) operating on different targets (backscatter or topographic) and under intense sky background conditions. It can be used within the lidar community to compare different lidar instruments.

  5. Design and simulation of a novel method for determining depth-of-interaction in a PET scintillation crystal array using a single-ended readout by a multi-anode PMT

    International Nuclear Information System (INIS)

    Ito, Mikiko; Sim, Kwang-Souk; Lee, Jae Sung; Park, Min-Jae; Hong, Seong Jong

    2010-01-01

    PET detectors with depth-of-interaction (DOI) encoding capability allow high spatial resolution and high sensitivity to be achieved simultaneously. To obtain DOI information from a mono-layer array of scintillation crystals using a single-ended readout, the authors devised a method based on light spreading within a crystal array and performed Monte Carlo simulations with individual scintillation photon tracking to prove the concept. A scintillation crystal array model was constructed using a grid method. Conventional grids are constructed using comb-shaped reflector strips with rectangular teeth to isolate scintillation crystals optically. However, the authors propose the use of triangularly shaped teeth, such that scintillation photons spread only in the x-direction in the upper halves of crystals and in the y-direction in lower halves. DOI positions can be estimated by considering the extent of two-dimensional light dispersion, which can be determined from the multiple anode outputs of a position-sensitive PMT placed under the crystal array. In the main simulation, a crystal block consisting of a 29 x 29 array of 1.5 mm x 1.5 mm x 20 mm crystals and a multi-anode PMT with 16 x 16 pixels were used. The effects of crystal size and non-uniform PMT output gain were also explored by simulation. The DOI resolution estimated for 1.5 x 1.5 x 20 mm 3 crystals was 2.16 mm on average. Although the flood map was depth dependent, each crystal was well identified at all depths when a corner of the crystal array was irradiated with 511 keV gamma rays (peak-to-valley ratio ∼9:1). DOI resolution was better than 3 mm up to a crystal length of 28 mm with a 1.5 x 1.5 mm 2 or 2.0 x 2.0 mm 2 crystal surface area. The devised light-sharing method allowed excellent DOI resolutions to be obtained without the use of dual-ended readout or multiple crystal arrays.

  6. Optimisation of a dual head semiconductor Compton camera using Geant4

    Energy Technology Data Exchange (ETDEWEB)

    Harkness, L.J. [Department of Physics, University of Liverpool, Oliver Lodge Laboratory, Liverpool L697ZE (United Kingdom)], E-mail: ljh@ns.ph.liv.ac.uk; Boston, A.J.; Boston, H.C.; Cooper, R.J.; Cresswell, J.R.; Grint, A.N.; Nolan, P.J.; Oxley, D.C.; Scraggs, D.P. [Department of Physics, University of Liverpool, Oliver Lodge Laboratory, Liverpool L697ZE (United Kingdom); Beveridge, T.; Gillam, J. [School of Physics and Materials Engineering, Monash University, Melbourne (Australia); Lazarus, I. [STFC Daresbury Laboratory, Warrington, Cheshire (United Kingdom)

    2009-06-01

    Conventional medical gamma-ray camera systems utilise mechanical collimation to provide information on the position of an incident gamma-ray photon. Systems that use electronic collimation utilising Compton image reconstruction techniques have the potential to offer huge improvements in sensitivity. Position sensitive high purity germanium (HPGe) detector systems are being evaluated as part of a single photon emission computed tomography (SPECT) Compton camera system. Data have been acquired from the orthogonally segmented planar SmartPET detectors, operated in Compton camera mode. The minimum gamma-ray energy which can be imaged by the current system in Compton camera configuration is 244 keV due to the 20 mm thickness of the first scatter detector which causes large gamma-ray absorption. A simulation package for the optimisation of a new semiconductor Compton camera has been developed using the Geant4 toolkit. This paper will show results of preliminary analysis of the validated Geant4 simulation for gamma-ray energies of SPECT, 141 keV.

  7. Dual-head gamma camera system for intraoperative localization of radioactive seeds

    International Nuclear Information System (INIS)

    Arsenali, B; Viergever, M A; Gilhuijs, K G A; De Jong, H W A M; Beijst, C; Dickerscheid, D B M

    2015-01-01

    Breast-conserving surgery is a standard option for the treatment of patients with early-stage breast cancer. This form of surgery may result in incomplete excision of the tumor. Iodine-125 labeled titanium seeds are currently used in clinical practice to reduce the number of incomplete excisions. It seems likely that the number of incomplete excisions can be reduced even further if intraoperative information about the location of the radioactive seed is combined with preoperative information about the extent of the tumor. This can be combined if the location of the radioactive seed is established in a world coordinate system that can be linked to the (preoperative) image coordinate system. With this in mind, we propose a radioactive seed localization system which is composed of two static ceiling-suspended gamma camera heads and two parallel-hole collimators. Physical experiments and computer simulations which mimic realistic clinical situations were performed to estimate the localization accuracy (defined as trueness and precision) of the proposed system with respect to collimator-source distance (ranging between 50 cm and 100 cm) and imaging time (ranging between 1 s and 10 s). The goal of the study was to determine whether or not a trueness of 5 mm can be achieved if a collimator-source distance of 50 cm and imaging time of 5 s are used (these specifications were defined by a group of dedicated breast cancer surgeons). The results from the experiments indicate that the location of the radioactive seed can be established with an accuracy of 1.6 mm  ±  0.6 mm if a collimator-source distance of 50 cm and imaging time of 5 s are used (these experiments were performed with a 4.5 cm thick block phantom). Furthermore, the results from the simulations indicate that a trueness of 3.2 mm or less can be achieved if a collimator-source distance of 50 cm and imaging time of 5 s are used (this trueness was achieved for all 14 breast phantoms which were used in this study). Based on these results we conclude that the proposed system can be a valuable tool for (real-time) intraoperative breast cancer localization. (paper)

  8. Activity quantification of phantom using dual-head SPECT with two-view planar image

    International Nuclear Information System (INIS)

    Guo Leiming; Chen Tao; Sun Xiaoguang; Huang Gang

    2005-01-01

    The absorbed radiation dose from internally deposited radionuclide is a major factor in assessing risk and therapeutic utility in nuclear medicine diagnosis or treatment. The quantification of absolute activity in vivo is necessary procedure of estimating the absorbed dose of organ or tissue. To understand accuracy in the determination of organ activity, the experiments on 99 Tc m activity quantification were made for a body phantom using dual-heat SPECT with the two-view counting technique. Accuracy in the activity quantification is credible and is not affected by depth of source organ in vivo. When diameter of the radiation source is ≤2 cm, the most accurate activity quantification result can be obtained on the basis of establishing the system calibration factor and transmission factor. The use of Buijs's method is preferable, especially at very low source-to-background activity concentration rations. (authors)

  9. Tomographic evaluation of a dual-head positron emission tomography system

    International Nuclear Information System (INIS)

    Efthimiou, N; Maistros, S; Tripolitis, X; Panayiotakis, G; Samartzis, A; Loudos, G

    2011-01-01

    In this paper we present the performance evaluation results, in the planar and tomographic modes, of a low-cost positron emission tomography camera dedicated to small-animal imaging. The system consists of two pixelated Lu 2 SiO 5 crystals, two Hamamatsu H8500 position sensitive photomultiplier tubes, fast amplification electronics and an FPGA-USB-based read-out system. The parameters that have been studied are (i) saturation as a function of the head distance and photon acceptance angle, (ii) effect of the number of projections and half or complete head's rotation, (iii) spatial resolution as a function of the head distance, (iv) spatial resolution as a function of acceptance angle, (v) system's sensitivity as a function of these parameters and (vi) performance in small mice imaging. Image reconstruction has been carried out using open source software developed by our group (QSPECT), which is designed mainly for SPECT imaging. The results indicate that the system has a linear response for activities up to at least 2 MBq, which are typical in small-animal imaging. Best tomographic spatial resolution was measured to be ∼2 mm. The system has been found suitable for imaging of small mice both in the planar and tomographic modes

  10. Ferroelectric properties of bismuth-doped PMT-PT ceramics

    International Nuclear Information System (INIS)

    Hyun, June Won; Kim, Yeon Jung; Kim, Gang Bae

    2010-01-01

    This study examined the ferroelectric properties of Bi-doped 0.66(Pb (1-3x/2) Bi x )(Mg 1/3 Ta 2/3 )O 3 - 0.34PbTiO 3 ceramics for use as a piezoelectric transformer. The optimum conditions for obtaining samples with high density and improved electrical properties were a sintering temperature of 1200 .deg. C/4 h and the addition of 3 mol% Bi. The temperature dependent dielectric constant of the ceramics was examined at frequencies ranging from 1 kHz to 100 kHz. The broad dielectric constant anomaly coupled with a shift in the dielectric maximum towards higher temperature with increasing frequency indicates a relaxor-type behavior in the ceramics. The piezoelectric coefficient (d 33 ) and the planar coupling factor (K p ) increase with the addition of 3 mol% Bi, and then decrease with further addition of Bi. The dielectric constant and the dissipation factor at room temperature could be improved by the addition of 3 mol% Bi.

  11. Asking the Right Questions: Action Learning and PMT 401

    Science.gov (United States)

    2016-08-01

    program aimed at improving leadership, critical thinking , problem solving and decision­making skills. Participants in this rigorous, in­residence...problem • Skill Development • Urgent and complex problems requiring unique systems thinking • Groups charged with implementing the solution as...most pressing organi­ zational issues: problem solving, organizational learning, team building, leadership development, and professional growth and

  12. Determination of kidney function with 99mTc-DTPA renography using a dual-head camera

    DEFF Research Database (Denmark)

    Madsen, Claus J; Møller, Michael L; Zerahn, Bo

    2013-01-01

    Single-head gamma camera renography has been used for decades to estimate kidney function. An estimate of the glomerular filtration rate (GFR) can be obtained using Tc-diethylenetriaminepentaacetic acid (Tc-DTPA). However, because of differing attenuation, an error is introduced when the kidney...

  13. First full-beam PET acquisitions in proton therapy with a modular dual-head dedicated system

    Science.gov (United States)

    Sportelli, G.; Belcari, N.; Camarlinghi, N.; Cirrone, G. A. P.; Cuttone, G.; Ferretti, S.; Kraan, A.; Ortuño, J. E.; Romano, F.; Santos, A.; Straub, K.; Tramontana, A.; Del Guerra, A.; Rosso, V.

    2014-01-01

    During particle therapy irradiation, positron emitters with half-lives ranging from 2 to 20 min are generated from nuclear processes. The half-lives are such that it is possible either to detect the positron signal in the treatment room using an in-beam positron emission tomography (PET) system, right after the irradiation, or to quickly transfer the patient to a close PET/CT scanner. Since the activity distribution is spatially correlated with the dose, it is possible to use PET imaging as an indirect method to assure the quality of the dose delivery. In this work, we present a new dedicated PET system able to operate in-beam. The PET apparatus consists in two 10 cm × 10 cm detector heads. Each detector is composed of four scintillating matrices of 23 × 23 LYSO crystals. The crystal size is 1.9 mm × 1.9 mm × 16 mm. Each scintillation matrix is read out independently with a modularized acquisition system. The distance between the two opposing detector heads was set to 20 cm. The system has very low dead time per detector area and a 3 ns coincidence window, which is capable to sustain high single count rates and to keep the random counts relatively low. This allows a new full-beam monitoring modality that includes data acquisition also while the beam is on. The PET system was tested during the irradiation at the CATANA (INFN, Catania, Italy) cyclotron-based proton therapy facility. Four acquisitions with different doses and dose rates were analysed. In all cases the random to total coincidences ratio was equal or less than 25%. For each measurement we estimated the accuracy and precision of the activity range on a set of voxel lines within an irradiated PMMA phantom. Results show that the inclusion of data acquired during the irradiation, referred to as beam-on data, improves both the precision and accuracy of the range measurement with respect to data acquired only after irradiation. Beam-on data alone are enough to give precisions better than 1 mm when at least 5 Gy are delivered.

  14. First full-beam PET acquisitions in proton therapy with a modular dual-head dedicated system

    International Nuclear Information System (INIS)

    Sportelli, G; Belcari, N; Camarlinghi, N; Ferretti, S; Kraan, A; Straub, K; Guerra, A Del; Rosso, V; Cirrone, G A P; Cuttone, G; Romano, F; Tramontana, A; Ortuño, J E; Santos, A

    2014-01-01

    During particle therapy irradiation, positron emitters with half-lives ranging from 2 to 20 min are generated from nuclear processes. The half-lives are such that it is possible either to detect the positron signal in the treatment room using an in-beam positron emission tomography (PET) system, right after the irradiation, or to quickly transfer the patient to a close PET/CT scanner. Since the activity distribution is spatially correlated with the dose, it is possible to use PET imaging as an indirect method to assure the quality of the dose delivery. In this work, we present a new dedicated PET system able to operate in-beam. The PET apparatus consists in two 10 cm × 10 cm detector heads. Each detector is composed of four scintillating matrices of 23 × 23 LYSO crystals. The crystal size is 1.9 mm × 1.9 mm × 16 mm. Each scintillation matrix is read out independently with a modularized acquisition system. The distance between the two opposing detector heads was set to 20 cm. The system has very low dead time per detector area and a 3 ns coincidence window, which is capable to sustain high single count rates and to keep the random counts relatively low. This allows a new full-beam monitoring modality that includes data acquisition also while the beam is on. The PET system was tested during the irradiation at the CATANA (INFN, Catania, Italy) cyclotron-based proton therapy facility. Four acquisitions with different doses and dose rates were analysed. In all cases the random to total coincidences ratio was equal or less than 25%. For each measurement we estimated the accuracy and precision of the activity range on a set of voxel lines within an irradiated PMMA phantom. Results show that the inclusion of data acquired during the irradiation, referred to as beam-on data, improves both the precision and accuracy of the range measurement with respect to data acquired only after irradiation. Beam-on data alone are enough to give precisions better than 1 mm when at least 5 Gy are delivered. (paper)

  15. 18F-FDG imaging with a coincidence dual-headed gamma camera (Co-PET) in the diagnosis, staging and management of lung cancer

    International Nuclear Information System (INIS)

    Lin, P.; Chu, J.; Pocock, N.; Quach, T.; Sorensen, B.

    1999-01-01

    Full text: FDG-PET has an established role in the management of lung cancer, while the experience with FDG-Co-PET is limited. Our study aims to demonstrate the feasibility of Co-PET in staging and management of lung cancer. Thirty-nine Co-PET studies were performed on our first 36 patients (pts) with primary lung cancer between November 1997 and October 1998. Tomography of brain and torso with an ADAC Solus MCD gamma camera was performed (60 min after 200 MBq of 18 FFDG and > 6 h fasting). Histology subgroups included squamous (14 pts), small cell (1), adeno-carcinoma (11), broncho-alveolar (1), large cell (8), carcinoid (1). CT/clinical staging subgroups included 18 pts in stage 1, 4 in stage 2, 7 in stage 3a, 2 in stage 3b, 8 in stage 4. Compared with CT/clinical staging, FDG upstaged 5 pts (14%) with regional nodal metastases (mets) and 8 pts (22%) with distant mets (cervical = 2, lung = 1, brain = 3, bone = 3, abdomen = 4). FDG under-staged 2 pts in 3 sites (all < 15 mm). Surgical nodal staging was performed in 14 pts: false-positives occurred in 3 CT and 1 Co-PET studies, and false-negatives in one CT/Co-PET. Site sensitivities for primary (smallest 7 mm) and regional lymph nodes are 100% and 88% respectively. Specificities for primary and regional nodes are 100% and 96% respectively. Co-PET also has impact on management: treatment intent (6 pts), radiotherapy fields (1), diagnosis of lung mets (2) and radiation pneumonitis (1). In conclusion, our initial data demonstrate FDG-Co-PET scanning could provide a valuable addition to conventional imaging studies in diagnosis, staging and management of lung cancer

  16. Design of a Multi-Pinhole Collimator for I-123 DaTscan Imaging on Dual-Headed SPECT Systems in Combination with a Fan-Beam Collimator.

    Science.gov (United States)

    King, Michael A; Mukherjee, Joyeeta M; Könik, Arda; Zubal, I George; Dey, Joyoni; Licho, Robert

    2016-02-01

    For the 2011 FDA approved Parkinson's Disease (PD) SPECT imaging agent I-123 labeled DaTscan, the volume of interest (VOI) is the interior portion of the brain. However imaging of the occipital lobe is also required with PD for calculation of the striatal binding ratio (SBR), a parameter of significance in early diagnosis, differentiation of PD from other disorders with similar clinical presentations, and monitoring progression. Thus we propose the usage of a combination of a multi-pinhole (MPH) collimator on one head of the SPECT system and a fan-beam on the other. The MPH would be designed to provide high resolution and sensitivity for imaging of the interior portion of the brain. The fan-beam collimator would provide lower resolution but complete sampling of the brain addressing data sufficiency and allowing a volume-of-interest to be defined over the occipital lobe for calculation of SBR's. Herein we focus on the design of the MPH component of the combined system. Combined reconstruction will be addressed in a subsequent publication. An analysis of 46 clinical DaTscan studies was performed to provide information to define the VOI, and design of a MPH collimator to image this VOI. The system spatial resolution for the MPH was set to 4.7 mm, which is comparable to that of clinical PET systems, and significantly smaller than that of fan-beam collimators employed in SPECT. With this set, we compared system sensitivities for three aperture array designs, and selected the 3 × 3 array due to it being the highest of the three. The combined sensitivity of the apertures for it was similar to that of an ultra-high resolution fan-beam (LEUHRF) collimator, but smaller than that of a high-resolution fan-beam collimator (LEHRF). On the basis of these results we propose the further exploration of this design through simulations, and the development of combined MPH and fan-beam reconstruction.

  17. Detection of recurrences of colorectal cancer using [F-18]FDG scintigraphy performed on a dual-head coincidence gamma-camera (CDET)

    International Nuclear Information System (INIS)

    Montravers, F.; Grahek, D.; Kerrou, K.; Beco, V. de; Younsi, N.; Talbot, J.N.; Beco, V. de; Tofighi, M.; Moretti, J.L.

    2001-01-01

    The aim of this study was to assess the clinical performances of FDG-CDET for the detection of recurrences of colorectal cancer. One hundred and ninety five examinations (ex) were analyzed, performed for suspicion of recurrence of colorectal cancer (148 ex) or in search of unknown foci prior to surgical resection of known recurrence(s) (47 ex). Recurrence was suspected because of rising CEA levels (50 ex) or isolated pain (8 ex) or equivocal conventional imaging (62 ex) or rising CEA levels and equivocal conventional imaging (28 ex). The results were analyzed according to histology (98 ex) or according to the one year follow-up (97 ex). On an examination basis, the results were the following: Sensitivity -143/164 = 87 %, Specificity = 28/31= 90%, Accuracy -171 /195 = 88 %. Histology was obtained in 98 patients who underwent surgery leading to the analysis of 169 sites. On a site basis, the results were the following: Sensitivity =104/152 = 68 %, Specificity =12/17 = 75 %, Accuracy -116/169 = 69 %. These results were not different from those reported with dedicated PET and show that FDG-CDET is a powerful tool for the detection of recurrent colorectal cancer. (authors)

  18. A PET system based on 2-18FDG production with a low energy electrostatic proton accelerator and a dual headed PET scanner.

    Science.gov (United States)

    Sandell, A; Ohlsson, T; Erlandsson, K; Hellborg, R; Strand, S E

    1992-01-01

    We have developed a comparatively inexpensive PET system, based on a rotating scanner with two scintillation camera heads, and a nearby low energy electrostatic proton accelerator for production of short-lived radionuclides. Using a 6 MeV proton beam of 5 microA, and by optimization of the target geometry for the 18O(p,n)18F reaction, 750 MBq of 2-18FDG can be obtained. The PET scanner shows a spatial resolution of 6 mm (FWHM) and a sensitivity of 80 s-1kBq-1ml-1 (3 kcps/microCi/ml). Various corrections are included in the imaging process, to compensate for spatial and temporal response variations in the detector system. Both filtered backprojection and iterative reconstruction methods are employed. Clinical studies have been performed with acquisition times of 30-40 min. The system will be used for clinical experimental research with short- as well as long-lived positron emitters. Also the possibility of true 3D reconstruction is under evaluation.

  19. A multichannel front end ASIC for PMT readout in LHAASO WCDA

    Science.gov (United States)

    Liang, Y.; Zhao, L.; Guo, Y.; Qin, J.; Yang, Y.; Cheng, B.; Liu, S.; An, Q.

    2018-01-01

    Time and charge measurements over a large dynamic range from 1 Photo Electron (P.E.) to 4000 P.E. are required for the Water Cherenkov Detector Array (WCDA), which is one of the key components in the Large High Altitude Air Shower Observatory (LHAASO). To simplify the circuit structure of the readout electronics, a front end ASIC was designed. Based on the charge-to-time conversion method, the output pulse width of the ASIC corresponds to the input signal charge information while time information of the input signal is picked off through a discriminator, and thus the time and charge information can be digitized simultaneously using this ASIC and a following Time-to-Digital Converter (TDC). To address the challenge of mismatch among the channels observed in the previous prototype version, this work presents approaches for analyzing the problem and optimizing the circuits. A new version of the ASIC was designed and fabricated in the GLOBALFOUNDRIES 0.35 μm CMOS technology, which integrates 6 channels (corresponding to the readout of the 3 PMTs) in each chip. The test results indicate that the mismatch between the channels is significantly reduced to less than 20% using the proposed approach. The time measurement resolution better than 300 ps is achieved, and the charge measurement resolution is better than 10% at 1 P.E., and 1% at 4000 P.E., which meets the application requirements.

  20. The system of high-voltage power PMT for experiments at the JINR Nuclotron

    International Nuclear Information System (INIS)

    Piyadin, S.M.; Ladygin, V.P.; Pilyar, A.V.; Reznikov, S.G.; Janek, M.

    2015-01-01

    An 8-channel high-voltage power system based on the use of the module «Wenzel Elektronik N1130» is described. Specifications of control modules 8DAC-12 and 8ADC-14 designed for the high-voltage systems in CAMAC standard are presented. This system is designed to provide the power for the detectors used in physics experiments at the JINR Nuclotron.

  1. Multi-PMT optical module for the KM3NeT neutrino telescope

    NARCIS (Netherlands)

    Kavatsyuk, O.; Dorosti-Hasankiadeh, Q.; Löhner, H.

    2012-01-01

    The future cubic kilometre scale neutrino telescope KM3NeT will employ a novel type of a Digital Optical Module (DOM), developed during the recent FP6 Design Study. A pressure-resistant glass sphere hosts 31 photomultiplier tubes (PMTs) of 3-in, diameter, together with all the electronics for

  2. The Upgraded Calibration System for the Scintillator-PMT Tile Hadronic Calorimeter of the ATLAS experiment at CERN/LHC

    CERN Document Server

    Chakraborty, Dhiman; The ATLAS collaboration

    2017-01-01

    The ATLAS Tile Calorimeter (TileCal) is the central section of the hadronic calorimeter of the ATLAS experiment and provides important information for reconstruction of hadrons, jets, hadronic decays of tau leptons and missing transverse energy in highest energy proton-proton and heavy-ion collisions at CERN’s Large Hadron Collider. This sampling calorimeter uses steel plates as absorber and scintillating tiles as active medium. The light produced by the passage of charged particles is transmitted by wavelength shifting fibres to photomultiplier tubes (PMTs) located on the outside of the calorimeter. The readout is segmented into about 5000 cells (longitudinally and transversally), each read out by two PMTs in parallel. A multi-component calibration system is employed to calibrate and monitor the stability and performance of each part of the readout chain during data taking. The TileCal calibration system comprises Cesium radioactive sources, laser and charge injection elements and it allows to monitor and ...

  3. Electronics for a prototype variable field of view PET camera using the PMT-quadrant-sharing detector array

    Science.gov (United States)

    Li, H.; Wong, Wai-Hoi; Zhang, N.; Wang, J.; Uribe, J.; Baghaei, H.; Yokoyama, S.

    1999-06-01

    Electronics for a prototype high-resolution PET camera with eight position-sensitive detector modules has been developed. Each module has 16 BGO (Bi/sub 4/Ge/sub 3/O/sub 12/) blocks (each block is composed of 49 crystals). The design goals are component and space reduction. The electronics is composed of five parts: front-end analog processing, digital position decoding, fast timing, coincidence processing and master data acquisition. The front-end analog circuit is a zone-based structure (each zone has 3/spl times/3 PMTs). Nine ADCs digitize integration signals of an active zone identified by eight trigger clusters; each cluster is composed of six photomultiplier tubes (PMTs). A trigger corresponding to a gamma ray is sent to a fast timing board to obtain a time-mark, and the nine digitized signals are passed to the position decoding board, where a real block (four PMTs) can be picked out from the zone for position decoding. Lookup tables are used for energy discrimination and to identify the gamma-hit crystal location. The coincidence board opens a 70-ns initial timing window, followed by two 20-ns true/accidental time-mark lookup table windows. The data output from the coincidence board can be acquired either in sinogram mode or in list mode with a Motorola/IRONICS VME-based system.

  4. Selección de Personal basada en la misión: Prosocial Motivation Test (PMT)

    OpenAIRE

    María C., Córdoba Llamas

    2017-01-01

    Las personas y su motivación son la clave de éxito de las empresas. Para que una empresa pueda mantenerse en un mundo globalizado de cambios continuos y alta competitividad es necesario que cuente con las personas adecuadas, ya que el capital humano se ha convertido en el capital más importante de las empresas, su capital diferencial. Pero, ¿qué quiere decir las “personas más adecuadas”? Revisando la bibliografía, se observa que las respuestas a esta pregunta responden a una preocupación tan ...

  5. Development of a new fast shower maximum detector based on microchannel plates photomultipliers (MCP-PMT) as an active element

    Energy Technology Data Exchange (ETDEWEB)

    Ronzhin, A., E-mail: ronzhin@fnal.gov [Fermilab, Batavia, IL 60510 (United States); Los, S.; Ramberg, E. [Fermilab, Batavia, IL 60510 (United States); Spiropulu, M.; Apresyan, A.; Xie, S. [California Institute of Technology, Pasadena, CA (United States); Kim, H. [University of Chicago, Chicago, IL 60637 (United States); Zatserklyaniy, A. [University of California, Santa Cruz, CA (United States)

    2014-09-21

    One possibility to make a fast and radiation resistant shower maximum (SM) detector is to use a secondary emitter as an active element. We present below test beam results, obtained with different types of photodetectors based on microchannel plates (MCPs) as the secondary emitter. We performed the measurements at the Fermilab Test Beam Facility with 120 GeV proton beam and 12 GeV and 32 GeV secondary beams. The goal of the measurement with 120 GeV protons was to determine time resolution for minimum ionizing particles (MIPs). The SM time resolution we obtained for this new type of detector is at the level of 20–30 ps. We estimate that a significant contribution to the detector response originates from secondary emission of the MCP. This work can be considered as the first step in building a new type of calorimeter based on this principle.

  6. The upgraded calibration system for the scintillator-PMT Tile Hadronic Calorimeter of the ATLAS experiment at CERN/LHC

    CERN Document Server

    Chakraborty, Dhiman; The ATLAS collaboration

    2017-01-01

    The ATLAS Tile Calorimeter (TileCal) is the central section of the hadronic calorimeter of the ATLAS experiment and provides important information for reconstruction of hadrons, jets, hadronic decays of tau leptons and missing transverse energy in highest energy proton-proton and heavy-ion collisions at CERN’s Large Hadron Collider. This sampling calorimeter uses steel plates as absorber and scintillating tiles as active medium. The light produced by the passage of charged particles is transmitted by wavelength shifting fibres to photomultiplier tubes (PMTs) located on the outside of the calorimeter. The readout is segmented into about 5000 cells (longitudinally and transversally), each read out by two PMTs in parallel. A multi-component calibration system is employed to calibrate and monitor the stability and performance of each part of the readout chain during data taking. The TileCal calibration system comprises Cesium radioactive sources, laser and charge injection elements and it allows to monitor and ...

  7. Quotation for the Delivery of the Star Sensor Instrument to Fly On-board the CHAMP Satellite

    DEFF Research Database (Denmark)

    Jørgensen, John Leif; Nielsen, Rene Bøje; Liebe, Carl Christian

    The quotation give as comphrehensive description of a dual head star camera, its operation, physical and electrical interfaces.......The quotation give as comphrehensive description of a dual head star camera, its operation, physical and electrical interfaces....

  8. ATLAS TileCal Sub-Module Production at UIUC

    CERN Multimedia

    Errede, Steve

    2001-01-01

    Photos of Current PMT Test Setup: Photo 1 - View of the PC, Electronics Rack and PMT Dark Box Photo 2 - Another View of the PC, Electronics Rack and PMT Dark Box. Photo 3 - Overhead shot of PMT Grid inside PMT Dark Box. Photo 4 - View of inside of PMT Light Box.

  9. Pengaruh Pemberian Makanan Tambahan Pemulihan (Pmt-p) terhadap Pertumbuhan Balita Bawah Garis Merah (Bgm) di Puskesmas Kota Wilayah Selatan Kediri

    OpenAIRE

    Hari Poernomo, Dewi Ika Sari; Anggraeni, Santi

    2011-01-01

    Less nutrition in under five years children was manifested of less weight and growth with under red line influence brain development, it is very close relationship to mental development and thinking capability. Because of sufficient nutrient will create human resources who have health, cleverness, activeness and productivity. Less nutrition in this age effects in disorder that can delay further development. Giving recovered supplementary food correctly, in purpose, to add intake nutrient in u...

  10. In-treatment tests for the monitoring of proton and carbon-ion therapy with a large area PET system at CNAO

    Energy Technology Data Exchange (ETDEWEB)

    Rosso, V., E-mail: valeria.rosso@pi.infn.it [Department of Physics, University of Pisa and INFN, Pisa (Italy); Battistoni, G. [INFN Sezione di Milano, Milano (Italy); Belcari, N.; Camarlinghi, N. [Department of Physics, University of Pisa and INFN, Pisa (Italy); Ciocca, M. [Fondazione CNAO, Pavia (Italy); Collini, F. [Department of Physical Sciences, Earth and Environment, University of Siena and INFN, Pisa (Italy); Ferretti, S.; Kraan, A.C.; Lucenò, S. [Department of Physics, University of Pisa and INFN, Pisa (Italy); Molinelli, S.; Pullia, M. [Fondazione CNAO, Pavia (Italy); Sportelli, G.; Zaccaro, E.; Del Guerra, A. [Department of Physics, University of Pisa and INFN, Pisa (Italy)

    2016-07-11

    One of the most promising new radiotherapy techniques makes use of charged particles like protons and carbon ions, rather than photons. At present, there are more than 50 particle therapy centers operating worldwide, and many new centers are being constructed. Positron Emission Tomography (PET) is considered a well-established non-invasive technique to monitor range and delivered dose in patients treated with particle therapy. Nuclear interactions of the charged hadrons with the patient tissue lead to the production of β+ emitting isotopes (mainly {sup 15}O and {sup 11}C), that decay with a short lifetime producing a positron. The two 511 keV annihilation photons can be detected with a PET detector. In-beam PET is particularly interesting because it could allow monitoring the ions range also during dose delivery. A large area dual head PET prototype was built and tested. The system is based on an upgraded version of the previously developed DoPET prototype. Each head covers now 15×15 cm{sup 2} and is composed by 9 (3×3) independent modules. Each module consists of a 23×23 LYSO crystal matrix (2 mm pitch) coupled to H8500 PMT and is readout by custom front-end and a FPGA based data acquisition electronics. Data taken at the CNAO treatment facility in Pavia with proton and carbon beams impinging on heterogeneous phantoms demonstrate the DoPET capability to detect the presence of a small air cavity in the phantom.

  11. Protein (Cyanobacteria): 78779802 [PGDBj - Ortholog DB

    Lifescience Database Archive (English)

    Full Text Available 1196 ... hypothetical protein PMT9312_1418 Prochlorococcus marinus str. MIT 9312 MKFLTTLFLKLLLLSNFVIAETIPTKSNILKQSSECIKDSQNQICRELVSKLEKLQYVVFDQNRFKCQSSLLGLQSELIEAYFLKSLSKKRISFMIPYVIKNC

  12. Studies oriented to optimize the image quality of the small animal PET: Clear PET, modifying some of the parameters of the reconstruction algorithm IMF-OSEM 3D on the data acquisition simulated with GAMOS

    International Nuclear Information System (INIS)

    Canadas, M.; Mendoza, J.; Embid, M.

    2007-01-01

    This report presents studies oriented to optimize the image quality of the small animal PET: Clear- PET. Certain figures of merit (FOM) were used to assess a quantitative value of the contrast and delectability of lesions. The optimization was carried out modifying some of the parameters in the reconstruction software of the scanner, imaging a mini-Derenzo phantom and a cylinder phantom with background activity and two hot spheres. Specifically, it was evaluated the incidence of the inter-update Metz filter (IMF) inside the iterative reconstruction algorithm 3D OSEM. The data acquisition was simulated using the GAMOS framework (Monte Carlo simulation). Integrating GAMOS output with the reconstruction software of the scanner was an additional novelty of this work, to achieve this, data sets were written with the list-mode format (LMF) of ClearPET. In order to verify the optimum values obtained, we foresee to make real acquisitions in the ClearPET of CIEMAT. (Author) 17 refs

  13. Catheter-directed thrombolysis and pharmacomechanical thrombectomy improve midterm outcome in acute iliofemoral deep vein thrombosis

    Directory of Open Access Journals (Sweden)

    Tzu-Ting Kuo

    2017-02-01

    Conclusion: CDT and PMT have similar venous outcomes in patients with acute iliofemoral DVT, although PTS is less severe following PMT than after CDT. We propose that early and thorough removal of thrombus, using either CDT or PMT, is beneficial to prevent PTS.

  14. Characterization of the Pichia pastoris protein-O-mannosyltransferase gene family.

    Directory of Open Access Journals (Sweden)

    Juergen H Nett

    Full Text Available The methylotrophic yeast, Pichiapastoris, is an important organism used for the production of therapeutic proteins. However, the presence of fungal-like glycans, either N-linked or O-linked, can elicit an immune response or enable the expressed protein to bind to mannose receptors, thus reducing their efficacy. Previously we have reported the elimination of β-linked glycans in this organism. In the current report we have focused on reducing the O-linked mannose content of proteins produced in P. pastoris, thereby reducing the potential to bind to mannose receptors. The initial step in the synthesis of O-linked glycans in P. pastoris is the transfer of mannose from dolichol-phosphomannose to a target protein in the yeast secretory pathway by members of the protein-O-mannosyltransferase (PMT family. In this report we identify and characterize the members of the P. pastoris PMT family. Like Candida albicans, P. pastoris has five PMT genes. Based on sequence homology, these PMTs can be grouped into three sub-families, with both PMT1 and PMT2 sub-families possessing two members each (PMT1 and PMT5, and PMT2 and PMT6, respectively. The remaining sub-family, PMT4, has only one member (PMT4. Through gene knockouts we show that PMT1 and PMT2 each play a significant role in O-glycosylation. Both, by gene knockouts and the use of Pmt inhibitors we were able to significantly reduce not only the degree of O-mannosylation, but also the chain-length of these glycans. Taken together, this reduction of O-glycosylation represents an important step forward in developing the P. pastoris platform as a suitable system for the production of therapeutic glycoproteins.

  15. Arf6-Dependent Intracellular Trafficking of Pasteurella multocida Toxin and pH-Dependent Translocation from Late Endosomes

    Directory of Open Access Journals (Sweden)

    Tracy P. M. Chong

    2011-03-01

    Full Text Available The potent mitogenic toxin from Pasteurella multocida (PMT is the major virulence factor associated with a number of epizootic and zoonotic diseases caused by infection with this respiratory pathogen. PMT is a glutamine-specific protein deamidase that acts on its intracellular G-protein targets to increase intracellular calcium, cytoskeletal, and mitogenic signaling. PMT enters cells through receptor-mediated endocytosis and then translocates into the cytosol through a pH-dependent process that is inhibited by NH4Cl or bafilomycin A1. However, the detailed mechanisms that govern cellular entry, trafficking, and translocation of PMT remain unclear. Co-localization studies described herein revealed that while PMT shares an initial entry pathway with transferrin (Tfn and cholera toxin (CT, the trafficking pathways of Tfn, CT, and PMT subsequently diverge, as Tfn is trafficked to recycling endosomes, CT is trafficked retrograde to the ER, and PMT is trafficked to late endosomes. Our studies implicate the small regulatory GTPase Arf6 in the endocytic trafficking of PMT. Translocation of PMT from the endocytic vesicle occurs through a pH-dependent process that is also dependent on both microtubule and actin dynamics, as evidenced by inhibition of PMT activity in our SRE-based reporter assay, with nocodazole and cytochalasin D, respectively, suggesting that membrane translocation and cytotoxicity of PMT is dependent on its transfer to late endosomal compartments. In contrast, disruption of Golgi-ER trafficking with brefeldin A increased PMT activity, suggesting that inhibiting PMT trafficking to non-productive compartments that do not lead to translocation, while promoting formation of an acidic tubulovesicle system more conducive to translocation, enhances PMT translocation and activity.

  16. Gain monitoring of telescope array photomultiplier cameras for the first 4 years of operation

    Energy Technology Data Exchange (ETDEWEB)

    Shin, B.K., E-mail: bkshin@hanyang.ac.kr [Hanyang University, Seongdong-gu, Seoul (Korea, Republic of); Tokuno, H.; Tsunesada, Y. [Tokyo Institute of Technology, Meguro, Tokyo (Japan); Abu-Zayyad, T. [University of Utah, High Energy Astrophysics Institute, Salt Lake City, UT (United States); Aida, R. [University of Yamanashi, Interdisciplinary Graduate School of Medicine and Engineering, Kofu, Yamanashi (Japan); Allen, M.; Anderson, R. [University of Utah, High Energy Astrophysics Institute, Salt Lake City, UT (United States); Azuma, R. [Tokyo Institute of Technology, Meguro, Tokyo (Japan); Barcikowski, E.; Belz, J.W.; Bergman, D.R.; Blake, S.A.; Cady, R. [University of Utah, High Energy Astrophysics Institute, Salt Lake City, UT (United States); Cheon, B.G., E-mail: bgcheon@hanyang.ac.kr [Hanyang University, Seongdong-gu, Seoul (Korea, Republic of); Chiba, J. [Tokyo University of Science, Noda, Chiba (Japan); Chikawa, M. [Kinki University, Higashi Osaka, Osaka (Japan); Cho, E.J. [Hanyang University, Seongdong-gu, Seoul (Korea, Republic of); Cho, W.R. [Yonsei University, Seodaemun-gu, Seoul (Korea, Republic of); Fujii, H. [Institute of Particle and Nuclear Studies, KEK, Tsukuba, Ibaraki (Japan); Fujii, T. [Osaka City University, Osaka, Osaka (Japan); and others

    2014-12-21

    The stability of the gain of the photomultiplier (PMT) camera for the Fluorescence Detector (FD) of the Telescope Array experiment was monitored using an {sup 241}Am loaded scintillator pulsers (YAP) and a diffused xenon flasher (TXF) for a selected set of 35 PMT-readout channels. From the monitoring of YAP pulses over four years of FD operation, we found slow monotonic drifts of PMT gains at a rate of −1.7∼+1.7%/year. An average of the PMT gains over the 35 channels stayed nearly constant with a rate of change measured at −0.01±0.31(stat)±0.21(sys)%/year. No systematic decrease of the PMT gain caused by the night sky background was observed. Monitoring by the TXF also tracked the PMT gain drift of the YAP at 0.88±0.14(stat)%/year.

  17. Calibration and Process of Signal of Photomultiplier Tube in Rayleigh Scattering of Supersonic Jet Clusters

    International Nuclear Information System (INIS)

    Lu Jianfeng; Liu Meng; Han Jifeng; Li Jia; Luo Xiaobing; Miao Jingwei; Yang Chaowen

    2009-01-01

    In the experiments of Rayleigh scattering of gas-jet clusters, the signal amplitude of PMT is not only affected by duster itself, but also by the intensity of light source and work voltage of PMT. When the back pressure of cluster source varies from 10 atm to about 100atm, the signal amplitude of PMT may be from linear to nonlinear. In order to solve the problem, signal calibration of PMT under different intensifies of light and voltage of PMT has been done. The relationship between the amplitude of signal and intensities of light as well as voltage of PMT has been obtained. The function of scatter factor of Ar clusters with the back pressure of cluster source is gotten experimentally, and agrees with related experimental and theoretical results. (authors)

  18. Identification of O-mannosylated virulence factors in Ustilago maydis.

    Directory of Open Access Journals (Sweden)

    Alfonso Fernández-Álvarez

    Full Text Available The O-mannosyltransferase Pmt4 has emerged as crucial for fungal virulence in the animal pathogens Candida albicans or Cryptococcus neoformans as well as in the phytopathogenic fungus Ustilago maydis. Pmt4 O-mannosylates specific target proteins at the Endoplasmic Reticulum. Therefore a deficient O-mannosylation of these target proteins must be responsible for the loss of pathogenicity in pmt4 mutants. Taking advantage of the characteristics described for Pmt4 substrates in Saccharomyces cerevisiae, we performed a proteome-wide bioinformatic approach to identify putative Pmt4 targets in the corn smut fungus U. maydis and validated Pmt4-mediated glycosylation of candidate proteins by electrophoretic mobility shift assays. We found that the signalling mucin Msb2, which regulates appressorium differentiation upstream of the pathogenicity-related MAP kinase cascade, is O-mannosylated by Pmt4. The epistatic relationship of pmt4 and msb2 showed that both are likely to act in the same pathway. Furthermore, constitutive activation of the MAP kinase cascade restored appressorium development in pmt4 mutants, suggesting that during the initial phase of infection the failure to O-mannosylate Msb2 is responsible for the virulence defect of pmt4 mutants. On the other hand we demonstrate that during later stages of pathogenic development Pmt4 affects virulence independently of Msb2, probably by modifying secreted effector proteins. Pit1, a protein required for fungal spreading inside the infected leaf, was also identified as a Pmt4 target. Thus, O-mannosylation of different target proteins affects various stages of pathogenic development in U. maydis.

  19. 4th International Conference on New Photo-Detectors

    CERN Document Server

    2016-01-01

    The purpose of this Conference is to discuss new ideas and recent developments in photo-detectors and their applications in various fields: high energy physics, neutrino physics, particle and astroparticle physics, nuclear physics, nuclear medicine and industry. The main topics of the Conference relate to APD, SiPM, PMT, Hybrid PMT, MCP-PMT, and electronics: front-end and readout of large systems.

  20. Correction of distortions in a discontinuous image

    International Nuclear Information System (INIS)

    Geagan, M.J.; Chase, B.B.; Muehllehner, G.

    1994-01-01

    Large area position-sensitive NaI detectors have been successfully applied to positron emission tomography (PET). Typical PET studies involve detector singles rates in excess of 500 kcps, which can lead to pile-up and image degradation as a function of countrate. Better high countrate performance can be achieved with a local centroid algorithm, in which the position of each event is calculated from a small group of photomultipliers (PMTs) immediately surrounding the PMT with the highest signal (the peak PMT). The local centroid contains most of the light from the scintillation. If a local centroid of only seven PMTs is used, the position resolution becomes quite stable at high countrates, however, discontinuities appear in the detector flood image as events cluster around each PMT. We therefore developed a method for distortion correction of a discontinuous flood image. For each PMT on the detector, a peak PMT domain is defined. The peak PMT domain is the area on the detector where that PMT could have the highest signal. The peak PMT domains overlap slightly, so that all combinations of peak PMT and position are represented. A collimated source is moved through a regular grid of points - a template - over each peak PMT region. A short collection is performed at each point, and the real and measured position data are recorded. For each point in the spatial range of a given PMT, distortion correction offsets are computed by interpolating between the data points which correspond to that PMT. This new method has been implemented and evaluated. System resolution has been measured at low and high countrates. The high countrate resolution is better with the new method, with no degradation in low countrate resolution. The axial sensitivity profile is also more stable at high countrates, compared to the previously developed method. 3-D brain phantom images show a clear improvement in image quality at high countrates. ((orig.))

  1. Physicochemical and Sensory Properties of Appenzeller Cheese Supplemented with Powdered Microcapsule of Tomato Extract during Ripening

    Science.gov (United States)

    Kwak, Hae-Soo; Chimed, Chogsom; Yoo, Sang-Hun

    2016-01-01

    The objective of this study was to determine the physicochemical and sensory properties of Appenzeller cheese supplemented with different concentrations (0, 1, 2, 3, and 4%, w/w) of powdered microcapsules of tomato extracts (PMT) during ripening at 14℃ for 6 mon. The particle sizes of PMT ranged from 1 to 10 m diameter with an average particle size of approximately 2 m. Butyric acid (C4) concentrations of PMT-added Appenzeller cheese were significantly higher than that of the control. Lactic acid bacteria counts in the cheese were not significantly influenced by ripening time from 0 to 6 mon or the concentrations (0-4%, w/w) of PMT. In terms of texture, the hardness of PMT-added Appenzeller cheese was significantly increased compared to the control. The gumminess and chewiness of PMT-added Appenzeller cheese were similar to those of the control. However, both cohesiveness and springiness of PMT-added Appenzeller cheese were slightly decreased. In sensory analysis, bitterness and sourness of Appenzeller cheese were not significantly changed after supplementation of PMT, but sweetness of the cheese was significantly increased after increasing the ripening time from 0 to 6 mon and increasing the concentration from 1 to 4% (w/w). Based on these results, the addition of the concentrations (1-4%, w/w) of PMT to Appenzeller cheese can be used to develop functional Appenzeller cheese. PMID:27194934

  2. Design and study of photomultiplier pulse-shaping amplifier powered by the current flowing through a voltage divider

    International Nuclear Information System (INIS)

    Vladimir Popov

    2003-01-01

    A new version of Photomultiplier Tube (PMT) pulse amplifier, entirely powered by the current flowing through the base voltage divider, was designed and tested. This amplifier was designed for application in the JLAB G0 Experiment E00-006 as a part of high voltage base for XP2262 Photonis PMT. According to JLAB G0 experiment requirement, these PMT's operate with plastic scintillators at high counting rate (about MHz). Tests in JLAB experimental Hall C indicate that low energy gamma background cause up to 0.1 mA of PMT average anode current (without amplifier). At this radiation condition, PMT gain decreases by 50% within about 1 month of operation. The amplifier needs to reduce PMT anode current and to shape PMT anode pulse prior to sending it through a long cable line (more then 400 ft of RG-213 and RG-58 coax cables). Shaping of the PMT output pulse helps to reduce attenuation effect of the long cable line without significant reduction of timing accuracy. The results of this study of designed amplifier and PMT plus amplifier system are presented

  3. Mucoadhesive and pH-sensitive thiolated Eudragit microspheres for oral delivery of Pasteurella multocida antigens containing dermonecrotoxin.

    Science.gov (United States)

    Islam, Mohammad Ariful; Jiang, Hu-Lin; Quan, Ji-Shan; Arote, Rohidas B; Kang, Mi-Lan; Yoo, Han-Sang; Yun, Cheol-Heui; Choi, Yun-Jaie; Cho, Chong-Su

    2011-05-01

    In this study, cysteine was conjugated to the Eudragit to have mucoadhesive and pH-sensitive properties. Pasteurella multocida dermonecrotoxin (PMT) is a major virulence factor as a causative agent of atrophic rhinitis (AR) in swine and, therefore, inactivated P. multocida was used as a candidate vaccine in the current study. PMT-loaded thiolated Eudragit microspheres (TEMS) prepared using W/O/W emulsion-solvent evaporation method were characterized to assess their efficacy in oral vaccination. PMT-loaded TEMS were observed as spherical shapes with smooth surfaces and average particle sizes were 5.2 +/- 0.55 microm. The loading efficiency of PMT in the TEMS was about 75.3%. A significantly higher percentage of PMT from PMT-loaded TEMS was released at pH 7.4 than at pH 1.5. Murine macrophage stimulated with PMT-loaded TEMS facilitated a gradual secretion of tumor necrosis factor-alpha and nitric oxide as immune stimulatory mediators in a time dependent manner, suggesting that the released PMT from PMT-loaded TEMS had immune stimulating activity of AR vaccine in vitro.

  4. Meiosis and SUMO

    DEFF Research Database (Denmark)

    Holm, Lærke Rebekka

    to target proteins can be catalyzed by the SUMO E3 ligase Pli1. In this study we investigate the role of Pli1 and Pmt3 during meiotic differentiation and at repetitive DNA during mitotic growth. Target proteins for Pmt3 are many; however, Pli1 has a meiosis-specic function regulating meiotic recombination...

  5. Molecular cloning and functional expression of a stress-induced multifunctional O-methyltransferase with pinosylvin methyltransferase activity from Scots pine (Pinus sylvestris L.).

    Science.gov (United States)

    Chiron, H; Drouet, A; Claudot, A C; Eckerskorn, C; Trost, M; Heller, W; Ernst, D; Sandermann, H

    2000-12-01

    Formation of pinosylvin (PS) and pinosylvin 3-O-monomethyl ether (PSM), as well as the activities of stilbene synthase (STS) and S-adenosyl-1-methionine (SAM):pinosylvin O-methyltransferase (PMT), were induced strongly in needles of Scots pine seedlings upon ozone treatment, as well as in cell suspension cultures of Scots pine upon fungal elicitation. A SAM-dependent PMT protein was purified and partially characterised. A cDNA encoding PMT was isolated from an ozone-induced Scots pine cDNA library. Southern blot analysis of the genomic DNA suggested the presence of a gene family. The deduced protein sequence showed the typical highly conserved regions of O-methyltransferases (OMTs), and average identities of 20-56% to known OMTs. PMT expressed in Escherichia coli corresponded to that of purified PMT (40 kDa) from pine cell cultures. The recombinant enzyme catalysed the methylation of PS, caffeic acid, caffeoyl-CoA and quercetin. Several other substances, such as astringenin, resveratrol, 5-OH-ferulic acid, catechol and luteolin, were also methylated. Recombinant PMT thus had a relatively broad substrate specificity. Treatment of 7-year old Scots pine trees with ozone markedly increased the PMT mRNA level. Our results show that PMT represents a new SAM-dependent OMT for the methylation of stress-induced pinosylvin in Scots pine needles.

  6. Psychosocial Correlates of HIV Protection Motivation among Black Adolescents in Venda, South Africa

    Science.gov (United States)

    Boer, Henk; Mashamba, M. Tshilidzi

    2005-01-01

    We assessed the usefulness of the theory of planned behavior (TPB) and protection motivation theory (PMT) to predict intended condom use among 201 adolescents from Venda, South Africa. Results indicated that both the TPB and the PMT could significantly predict intended condom use, although the level of explained variance was limited. Hierarchical…

  7. Proximity focusing RICH with TOF capabilities

    International Nuclear Information System (INIS)

    Korpar, S.; Adachi, I.; Fujita, K.; Fukushima, T.; Gorisek, A.; Hayashi, D.; Iijima, T.; Ikado, T.; Ishikawa, T.; Kawai, H.; Kozakai, Y.; Krizan, P.; Kuratani, A.; Mazuka, Y.; Nakagawa, T.; Nishida, S.; Ogawa, S.; Pestotnik, R.; Seki, T.; Sumiyoshi, T.; Tabata, M.; Unno, Y.

    2007-01-01

    A proximity focusing RICH counter with a multi-channel micro-channel plate (MCP) PMT was tested as a time-of-flight counter. Cherenkov photons emitted in the radiator medium as well as in the entrance window of the PMT were used for the time-of-flight measurement, and an excellent performance of the counter could be demonstrated

  8. Maternal Attributions and Expressed Emotion as Predictors of Attendance at Parent Management Training

    Science.gov (United States)

    Peters, Sarah; Calam, Rachel; Harrington, Richard

    2005-01-01

    Background: The effectiveness of parent management training (PMT) as a treatment for child behaviour problems is reduced by high attrition rates. One difficulty with engaging mothers is that, by definition, PMT is directed at the parent, yet many parents believe the "cause" of the problem lies within the child. Hence the model of therapy offered…

  9. Application of the protection motivation theory in predicting cigarette smoking among adolescents in China.

    Science.gov (United States)

    Yan, Yaqiong; Jacques-Tiura, Angela J; Chen, Xinguang; Xie, Nianhua; Chen, Jing; Yang, Niannian; Gong, Jie; Macdonell, Karen Kolmodin

    2014-01-01

    Reducing tobacco use among adolescents in China represents a significant challenge for global tobacco control. Existing behavioral theories developed in the West - such as the Protection Motivation Theory (PMT) - may be useful tools to help tackle this challenge. We examined the relationships between PMT factors and self-reported cigarette smoking behavior and intention among a random sample of vocational high school students (N=553) in Wuhan, China. Tobacco-related perceptions were assessed using the PMT Scale for Adolescent Smoking. Among the total sample, 45% had initiated cigarette smoking, and 25% smoked in the past month. Among those who never smoked, 15% indicated being likely or very likely to smoke in a year. Multiple regression modeling analysis indicated the significance of the seven PMT constructs, the four PMT perceptions and the two PMT pathways in predicting intention to smoke and actual smoking behavior. Overall, perceived rewards of smoking, especially intrinsic rewards, were consistently positively related to smoking intentions and behavior, and self-efficacy to avoid smoking was negatively related to smoking. The current study suggests the utility of PMT for further research examining adolescent smoking. PMT-based smoking prevention and clinical smoking cessation intervention programs should focus more on adolescents' perceived rewards from smoking and perceived efficacy of not smoking to reduce their intention to and actual use of tobacco. © 2013.

  10. Rhetorical Dissent as an Adaptive Response to Classroom Problems: A Test of Protection Motivation Theory

    Science.gov (United States)

    Bolkan, San; Goodboy, Alan K.

    2016-01-01

    Protection motivation theory (PMT) explains people's adaptive behavior in response to personal threats. In this study, PMT was used to predict rhetorical dissent episodes related to 210 student reports of perceived classroom problems. In line with theoretical predictions, a moderated moderation analysis revealed that students were likely to voice…

  11. The R&D of the 20 in. MCP–PMTs for JUNO

    Energy Technology Data Exchange (ETDEWEB)

    Chang, Yaping [Institute of High Energy Physics, Chinese Academy of Sciences, Beijing 100049 (China); State Key Laboratory of Particle Detection and Electronics, Beijing 100049 (China); University of Chinese Academy of Sciences, Beijing 100049 (China); Huang, Guorui [North Night Vision Tech. Ltd., Nanjing 211106 (China); Heng, Yuekun [Institute of High Energy Physics, Chinese Academy of Sciences, Beijing 100049 (China); State Key Laboratory of Particle Detection and Electronics, Beijing 100049 (China); Li, Dong [North Night Vision Tech. Ltd., Nanjing 211106 (China); Liu, Huilin [Xi’an Institute of Optics and Precision Mechanics, Chinese Academy of Sciences, Xi’an 710068 (China); Liu, Shulin [Institute of High Energy Physics, Chinese Academy of Sciences, Beijing 100049 (China); State Key Laboratory of Particle Detection and Electronics, Beijing 100049 (China); Li, Weihua [Xi’an Institute of Optics and Precision Mechanics, Chinese Academy of Sciences, Xi’an 710068 (China); Ning, Zhe [Institute of High Energy Physics, Chinese Academy of Sciences, Beijing 100049 (China); State Key Laboratory of Particle Detection and Electronics, Beijing 100049 (China); Qi, Ming [Department of Physics, Nanjing University, Nanjing 210093 (China); Qian, Sen, E-mail: qians@ihep.ac.cn [Institute of High Energy Physics, Chinese Academy of Sciences, Beijing 100049 (China); State Key Laboratory of Particle Detection and Electronics, Beijing 100049 (China); Sun, Jianning; Si, Shuguang [North Night Vision Tech. Ltd., Nanjing 211106 (China); Tian, Jinshou [Xi’an Institute of Optics and Precision Mechanics, Chinese Academy of Sciences, Xi’an 710068 (China); Wang, Xingchao [North Night Vision Tech. Ltd., Nanjing 211106 (China); and others

    2016-07-11

    A new concept of large area photomultiplier based on MCPs was conceived for JUNO by the scientists in IHEP, and with the collaborative work of the MCP–PMT collaboration in China, 8 in. and 20 in. prototypes were produced. Test results show that this type of MCP–PMT can have good SPE performance as the traditional dynode type PMTs.

  12. Analytical Study of the Effect of the System Geometry on Photon Sensitivity and Depth of Interaction of Positron Emission Mammography

    Directory of Open Access Journals (Sweden)

    Pablo Aguiar

    2012-01-01

    Full Text Available Positron emission mammography (PEM cameras are novel-dedicated PET systems optimized to image the breast. For these cameras it is essential to achieve an optimum trade-off between sensitivity and spatial resolution and therefore the main challenge for the novel cameras is to improve the sensitivity without degrading the spatial resolution. We carry out an analytical study of the effect of the different detector geometries on the photon sensitivity and the angle of incidence of the detected photons which is related to the DOI effect and therefore to the intrinsic spatial resolution. To this end, dual head detectors were compared to box and different polygon-detector configurations. Our results showed that higher sensitivity and uniformity were found for box and polygon-detector configurations compared to dual-head cameras. Thus, the optimal configuration in terms of sensitivity is a PEM scanner based on a polygon of twelve (dodecagon or more detectors. We have shown that this configuration is clearly superior to dual-head detectors and slightly higher than box, octagon, and hexagon detectors. Nevertheless, DOI effects are increased for this configuration compared to dual head and box scanners and therefore an accurate compensation for this effect is required.

  13. Health Risk Perceptions and Exercise in Older Adulthood: An Application of Protection Motivation Theory.

    Science.gov (United States)

    Ruthig, Joelle C

    2016-09-01

    Protection Motivation Theory (PMT) was applied to explore the relationship between perceived risk of acute health crises and intent to exercise. Interviews of 351 community-living older adults assessed prior physical activity (PPA), all PMT components, and exercise intent. A multi-group structural equation model revealed gender differences in PMT predictors of exercise intent. PPA, age, self-efficacy, and response efficacy directly predicted men's intent. Women's PPA and age predicted PMT components of self-efficacy and response costs, which predicted intent. Findings have implications for devising interventions to enhance physical activity in later life by targeting different PMT components for older men and women. © The Author(s) 2014.

  14. Structure and function of C-terminal catalytic region of pasteurella multocida toxin

    International Nuclear Information System (INIS)

    Kitadokoro, Kengo; Kamitami, Shigeki; Horiguchi, Yasuhiko

    2008-01-01

    Pasteurella multocida toxin (PMT) is one of virulence factors responsible for the pathogenesis in some Pasteurellosis. We determined the crystal structure of the C-terminal region of PMT (C-PMT), which carries an intracellularly active moiety. The overall structure of C-PMT displays three different domains designated C1, C2 and C3. We found in the C3 domain the Cys-His-Asp catalytic triad that is organized only when the Cys is released from a disulfide bond. The steric alignment of the triad corresponded well to that of papain or other enzymes carrying the Cys-His-Asp triad. Our results demonstrate that PMT is an enzymatic toxin carrying the cysteine-protease like catalytic triad, which is organized only under reducing conditions. (author)

  15. 'PET -Compton' system. Comparative evaluation with PET system using Monte Carlo simulation

    International Nuclear Information System (INIS)

    Diaz Garcia, Angelina; Arista Romeu, Eduardo; Abreu Alfonso, Yamiel; Leyva Fabelo, Antonio; Pinnera Hernandez, Ibrahin; Bolannos Perez, Lourdes; Rubio Rodriguez, Juan A; Perez Morales, Jose M.; Arce Dubois, Pedro; Vela Morales, Oscar; Willmott Zappacosta, Carlos

    2011-01-01

    Positron Emission Tomography (PET) in small animals has actually achieved spatial resolution round about 1 mm and currently there are under study different approaches to improve this spatial resolution. One of them combines PET technology with Compton Cameras. This paper presents the idea of the so called 'PET-Compton' systems and includes comparative evaluation of spatial resolution and global efficiency in both PET and PET-Compton system by means of Monte Carlo simulations using Geant4 code. Simulation is done on a PET-Compton system consisting of LYSO-LuYAP scintillating detectors of particular small animal PET scanner named 'Clear-PET' and for Compton detectors based on CdZnTe semiconductor. A group of radionuclides that emits a positron (e + ) and γ quantum almost simultaneously and fulfills some selection criteria for their possible use in PET-Compton systems for medical and biological applications were studied under simulation conditions. (Author)

  16. Simulation of time curves in small animal PET using GATE

    International Nuclear Information System (INIS)

    Simon, Luc; Strul, Daniel; Santin, Giovanni; Krieguer, Magalie; Morel, Christian

    2004-01-01

    The ClearPET project of the Crystal Clear Collaboration (CCC) is building spin-off technology for high resolution small animal Positron Emission Tomography (PET). Monte Carlo simulation is essential for optimizing the specifications of these systems with regards to their most important characteristics, such as spatial resolution, sensitivity, or count rate performance. GATE, the Geant4 Application for Tomographic Emission simulates the passing of time during real acquisitions, allowing to handle dynamic systems such as decaying source distributions or moving detectors. GATE output is analyzed on an event-by-event basis. The time associated with each single event allows to sort coincidences and to model dead-time. This leads to the study of time curves for a prospective small animal PET scanner design. The count rates of true, and random coincidences are discussed together with the corresponding Noise Equivalent Count (NEC) rates as a function of some PET scanner specifications such as detector dead time, or coincidence time window

  17. Design and construction of a small animal PET/CT scanner combining scintillation Phoswich modules and hybrid pixels detectors

    International Nuclear Information System (INIS)

    Nicol, St.

    2010-07-01

    The pathway that has been followed by the imXgam team at CPPM was to combine on a single rotating device the detector modules of the small animal PET scanner ClearPET with a photon counting X-ray detector in order to perform simultaneous acquisition of images from the anatomy (X-ray CT) and from the metabolic function (PET) of the common field-of-view. A preliminary study of the hybrid imaging system ClearPET/XPAD3 carried out using Gate led us to form a new PET detection assembly based on 21 Phoswich modules, to fix the design of the PET/CT device, as well as to study and solve the difficulties arising from simultaneous hybrid imaging. Last but not least, the simulation tool also allowed us for thinking how well such a system could judiciously use the spatial and temporal correlations between anatomic and functional information. From an instrumentation point of view, we succeeded to set up the ClearPET/XPAD3 prototype. Once both imaging systems were operational individually, we demonstrated on one side that the ClearPET prototype was perfectly capable of performing correctly in simultaneous acquisition conditions, providing that the detector modules were appropriately shielded. On the other side, the new generation of the hybrid pixel camera using the XPAD3-S chip proved to be quite promising given the good quality of the first reconstructed images. Finally, the proof of concept of simultaneous PET/CT data acquisition was made using a sealed positron source and an X-ray tube. (author)

  18. Introduction of leadership training based on PM theory at a nuclear power plant. An analysis of leadership, morale and self-efficacy

    Energy Technology Data Exchange (ETDEWEB)

    Yoshida, Michio [Kumamoto Univ. (Japan). Dept. of Physics; Yoshiyama, Naohiro; Misumi, Emiko; Matsuda, Ryosuke; Misumi, Jyuji; Hiraki, Tadao; Sakurai, Yukihiro

    1997-09-01

    PM leadership training(PMT) course was introduced into three nuclear power plants for the purpose of accident prevention. PMT is a six-month training course consisting of three parts, i.e., lecture, PM survey, and participants` practice at their workplace. The major aim of PMT is to change participants` leadership behavior into PM-type that is the most desirable for group effectiveness. In this study, we examined the effects of PMT on participants` leadership, subordinates` morale and participants` self-efficacy. Participants were fifty-six supervisors working in operation or maintenance in each nuclear power plant. The supervisors have eight hundred forty five subordinates in all. The major results were as follows: (1) Not only participants` leadership Performance(P) and Maintenance(M) behavior was strengthened, but also their subordinates` morale increased during PMT`s 6-month course. (2) Strengthening both P and M behavior was the most effective in building up subordinates` morale, especially in teamwork, meeting satisfaction, and communication. (3) Participants` self-efficacy was related with the strength of their P behavior and subordinates` group morale. These results show that PMT course is effective in accident prevention in nuclear power plants. Finally, we discuss some future problems of the development of PMT in nuclear power plants. (author)

  19. Clinical evaluation of sup(99m)Tc-N-pyridoxyl-5-methyltryptophan hepatobiliary scintigraphy in hepatocellular carcinoma

    Energy Technology Data Exchange (ETDEWEB)

    Kashiwagi, Toru; Azuma, Masayoshi; Matsuda, Hiroyuki; Yoshioka, Hiroaki; Ishizu, Hiroshi; Mitsutani, Natsuki; Koizumi, Takeo; Kobayashi, Yasushi

    1985-09-01

    We have assessed the diagnostic value of sup(99m)Tc-N-pyridoxyl-5-methyltryptophan (sup(99m)Tc-PMT) hepatobiliary scintigraphy in 28 patients with hepatocellular carcinoma (HCC) who had obvious filling defects on sup(99m)Tc-phytate liver scintigram. Uptake of sup(99m)Tc-PMT in obvious defects on sup(99m)Tc-phytate liver scintigram was observed in 16 out of 28 patients (57.1 %). Most of HCC with sup(99m)Tc-PMT uptake were histologically well-differenciated. However, well-differenciated HCC did not always take up sup(99m)Tc-PMT. No correlation was observed between sup(99m)Tc-PMT uptake in the tumor and levels of serum alpha-fetoprotein. Patients with high alpha-fetoprotein level (>3000 ng/ml) were only 9 patients (32.1 %) in our study. By the combined results of sup(99m)Tc-PMT hepatobiliary scintigraphy and alpha-fetoprotein level (>3000 ng/ml), diagnostic rate for HCC was markedly elevated up to 75 %. Therefore, it is considered that sup(99m)Tc-PMT hepatobiliary scintigraphy is clinically useful for specific diagnosis of HCC. Furthermore, it provides the information for invasion of HCC into the bile duct.

  20. Clinical evaluation of sup(99m)Tc-N-pyridoxyl-5-methyltryptophan hepatobiliary scintigraphy in hepatocellular carcinoma

    International Nuclear Information System (INIS)

    Kashiwagi, Toru; Azuma, Masayoshi; Matsuda, Hiroyuki; Yoshioka, Hiroaki; Ishizu, Hiroshi; Mitsutani, Natsuki; Koizumi, Takeo; Kobayashi, Yasushi

    1985-01-01

    We have assessed the diagnostic value of sup(99m)Tc-N-pyridoxyl-5-methyltryptophan (sup(99m)Tc-PMT) hepatobiliary scintigraphy in 28 patients with hepatocellular carcinoma (HCC) who had obvious filling defects on sup(99m)Tc-phytate liver scintigram. Uptake of sup(99m)Tc-PMT in obvious defects on sup(99m)Tc-phytate liver scintigram was observed in 16 out of 28 patients (57.1 %). Most of HCC with sup(99m)Tc-PMT uptake were histologically well-differenciated. However, well-differenciated HCC did not always take up sup(99m)Tc-PMT. No correlation was observed between sup(99m)Tc-PMT uptake in the tumor and levels of serum alpha-fetoprotein. Patients with high alpha-fetoprotein level (>3000 ng/ml) were only 9 patients (32.1 %) in our study. By the combined results of sup(99m)Tc-PMT hepatobiliary scintigraphy and alpha-fetoprotein level (>3000 ng/ml), diagnostic rate for HCC was markedly elevated up to 75 %. Therefore, it is considered that sup(99m)Tc-PMT hepatobiliary scintigraphy is clinically useful for specific diagnosis of HCC. Furthermore, it provides the information for invasion of HCC into the bile duct. (author)

  1. A test of an adherence-enhancing adjunct to physiotherapy steeped in the protection motivation theory.

    Science.gov (United States)

    Bassett, Sandra F; Prapavessis, Harry

    2011-07-01

    The primary aim of this study was to test the effect of a Protection Motivation Theory (PMT)-based patient education intervention on physiotherapy patients' beliefs about their injury and physiotherapy, intentions to adhere, rehabilitation adherence, and ankle function. A secondary aim was to explore the relationships between the patients' injury and physiotherapy beliefs, intentions, adherence behaviours, and ankle function. A randomized controlled trial was undertaken in New Zealand; 71 people with ankle sprains were allocated to either PMT present video information or two control groups (non-PMT information about ankle sprains and no formal information) before commencing their course of physiotherapy. The two information groups watched a video about ankle sprains and physiotherapy before answering the Beliefs about Ankle Sprains and Physiotherapy Scale and behavioural intentions questionnaires that measured the PMT constructs. Adherence was assessed at each treatment and ankle function was measured before and after the physiotherapy program. After viewing the video, the PMT present information group's beliefs about severity, vulnerability, and response efficacy were significantly higher than the other two groups. The groups did not differ significantly on their self-efficacy, intentions, rehabilitation adherence, and post-physiotherapy program ankle function. Significant correlations existed between the patients' PMT-based beliefs and intentions, intentions and adherence, and adherence and post-physiotherapy ankle function. With the exception of self-efficacy, the findings indicate that persuasive information grounded in PMT does enhance physiotherapy patients' beliefs about their injury and treatment.

  2. Evolution of the key alkaloid enzyme putrescine N-methyltransferase from spermidine synthase.

    Directory of Open Access Journals (Sweden)

    Anne eJunker

    2013-07-01

    Full Text Available Putrescine N-methyltransferases (PMTs are the first specific enzymes of the biosynthesis of nicotine and tropane alkaloids. PMTs transfer a methyl group onto the diamine putrescine from S-adenosyl-L-methionine (SAM as coenzyme. PMT proteins have presumably evolved from spermidine synthases (SPDSs, which are ubiquitous enzymes of polyamine metabolism. SPDS use decarboxylated SAM as coenzyme to transfer an aminopropyl group onto putrescine. In an attempt to identify possible and necessary steps in the evolution of PMT from SPDS, homology based modeling of Datura stramonium SPDS1 and PMT was employed to gain deeper insight in the preferred binding positions and conformations of the substrate and the alternative coenzymes. Based on predictions of amino acids responsible for the change of enzyme specificities, sites of mutagenesis were derived. PMT activity was generated in Datura stramonium SPDS1 after few amino acid exchanges. Concordantly, Arabidopsis thaliana SPDS1 was mutated and yielded enzymes with both, PMT and SPDS activities. Kinetic parameters were measured for enzymatic characterization. The switch from aminopropyl to methyl transfer depends on conformational changes of the methionine part of the coenzyme in the binding cavity of the enzyme. The rapid generation of PMT activity in SPDS proteins and the wide-spread occurrence of putative products of N-methylputrescine suggest that PMT activity is present frequently in the plant kingdom.

  3. Maternal-fetal disease information as a source of exercise motivation during pregnancy.

    Science.gov (United States)

    Gaston, Anca; Prapavessis, Harry

    2009-11-01

    A Protection Motivation Theory (PMT) framework was used to examine whether information about the role of exercise in preventing maternal-fetal disease served as a meaningful source of exercise motivation. Pregnant women (n = 208) were randomly assigned into one of three conditions: PMT, attention control, and noncontact control. Women in the PMT group read a brochure about the benefits of exercise during pregnancy incorporating the major components of PMT; perceived vulnerability (PV), perceived severity (PS), response efficacy (RE), and self-efficacy (SE). Participants in the attention-control condition read a brochure about diet. Following treatment, all participants completed measures of their beliefs toward maternal-fetal disease and exercise, goal intention (GI), and implementation intention (IMI). One week later, a measure of self-reported exercise behavior was collected. Main outcome measures were PMT variables (PV, PS, RE, and SE), GI, IMI, and follow-up physical activity. Participants assigned to the PMT-present group reported significantly higher PS, RE, SE, GI, and increased exercise behavior. PS, RE, and SE predicted GI, GI predicted IMI, and IMI predicted exercise behavior. Information grounded in PMT is effective in influencing pregnant women's beliefs and intentions as well as changing their initial behavior. PsycINFO Database Record (c) 2009 APA, all rights reserved.

  4. Charge reconstruction in large-area photomultipliers

    Science.gov (United States)

    Grassi, M.; Montuschi, M.; Baldoncini, M.; Mantovani, F.; Ricci, B.; Andronico, G.; Antonelli, V.; Bellato, M.; Bernieri, E.; Brigatti, A.; Brugnera, R.; Budano, A.; Buscemi, M.; Bussino, S.; Caruso, R.; Chiesa, D.; Corti, D.; Dal Corso, F.; Ding, X. F.; Dusini, S.; Fabbri, A.; Fiorentini, G.; Ford, R.; Formozov, A.; Galet, G.; Garfagnini, A.; Giammarchi, M.; Giaz, A.; Insolia, A.; Isocrate, R.; Lippi, I.; Longhitano, F.; Lo Presti, D.; Lombardi, P.; Marini, F.; Mari, S. M.; Martellini, C.; Meroni, E.; Mezzetto, M.; Miramonti, L.; Monforte, S.; Nastasi, M.; Ortica, F.; Paoloni, A.; Parmeggiano, S.; Pedretti, D.; Pelliccia, N.; Pompilio, R.; Previtali, E.; Ranucci, G.; Re, A. C.; Romani, A.; Saggese, P.; Salamanna, G.; Sawy, F. H.; Settanta, G.; Sisti, M.; Sirignano, C.; Spinetti, M.; Stanco, L.; Strati, V.; Verde, G.; Votano, L.

    2018-02-01

    Large-area PhotoMultiplier Tubes (PMT) allow to efficiently instrument Liquid Scintillator (LS) neutrino detectors, where large target masses are pivotal to compensate for neutrinos' extremely elusive nature. Depending on the detector light yield, several scintillation photons stemming from the same neutrino interaction are likely to hit a single PMT in a few tens/hundreds of nanoseconds, resulting in several photoelectrons (PEs) to pile-up at the PMT anode. In such scenario, the signal generated by each PE is entangled to the others, and an accurate PMT charge reconstruction becomes challenging. This manuscript describes an experimental method able to address the PMT charge reconstruction in the case of large PE pile-up, providing an unbiased charge estimator at the permille level up to 15 detected PEs. The method is based on a signal filtering technique (Wiener filter) which suppresses the noise due to both PMT and readout electronics, and on a Fourier-based deconvolution able to minimize the influence of signal distortions—such as an overshoot. The analysis of simulated PMT waveforms shows that the slope of a linear regression modeling the relation between reconstructed and true charge values improves from 0.769 ± 0.001 (without deconvolution) to 0.989 ± 0.001 (with deconvolution), where unitary slope implies perfect reconstruction. A C++ implementation of the charge reconstruction algorithm is available online at [1].

  5. Introduction of leadership training based on PM theory at a nuclear power plant. An analysis of leadership, morale and self-efficacy

    International Nuclear Information System (INIS)

    Yoshida, Michio; Yoshiyama, Naohiro; Misumi, Emiko; Matsuda, Ryosuke; Misumi, Jyuji; Hiraki, Tadao; Sakurai, Yukihiro.

    1997-01-01

    PM leadership training(PMT) course was introduced into three nuclear power plants for the purpose of accident prevention. PMT is a six-month training course consisting of three parts, i.e., lecture, PM survey, and participants' practice at their workplace. The major aim of PMT is to change participants' leadership behavior into PM-type that is the most desirable for group effectiveness. In this study, we examined the effects of PMT on participants' leadership, subordinates' morale and participants' self-efficacy. Participants were fifty-six supervisors working in operation or maintenance in each nuclear power plant. The supervisors have eight hundred forty five subordinates in all. The major results were as follows: (1) Not only participants' leadership Performance(P) and Maintenance(M) behavior was strengthened, but also their subordinates' morale increased during PMT's 6-month course. (2) Strengthening both P and M behavior was the most effective in building up subordinates' morale, especially in teamwork, meeting satisfaction, and communication. (3) Participants' self-efficacy was related with the strength of their P behavior and subordinates' group morale. These results show that PMT course is effective in accident prevention in nuclear power plants. Finally, we discuss some future problems of the development of PMT in nuclear power plants. (author)

  6. The effect of the rotational orientation of circular photomultipliers in a PET camera block detector design

    International Nuclear Information System (INIS)

    Uribe, J.; Wong, Wai-Hoi; Hu, Guoju

    1996-01-01

    This is a study of the effects of geometric asymmetries in circular photomultipliers (PMT) on the design of PET position-sensitive block detectors. The dynodes of linear-focus circular PMT's are asymmetric relative to the axis of the photocathode, despite the rotational symmetry of the photocathode. Hence, there are regional photocathode differences in the anode signal, which affect the decoding characteristics of position sensitive block detectors. This orientation effect, as well as the effect of introducing light diffusers, are studied in a block detector design (BGO) using the PMT-quadrant-sharing configuration. The PMT studied is the Philips XP-1911 (19mm diameter). Seven symmetrical and representative orientations of the four decoding PMT were investigated, as well as one asymmetric orientation. The measurements performed include block-composite pulse-height spectra and crystal decoding maps. Two orientation effects were observed: (A) distortion variation in decoding maps, and (B) decoding resolution variation. The introduction of circular plastic pieces, used as light diffusers, prove to be useful by improving the decoding of crystals on the periphery of the detector block and minimizing distortion in the decoding map. These measurements have shown optimal PMT orientations for the PMT-quadrant-sharing design, as well as for conventional block designs

  7. Program Management Tool

    Science.gov (United States)

    Gawadiak, Yuri; Wong, Alan; Maluf, David; Bell, David; Gurram, Mohana; Tran, Khai Peter; Hsu, Jennifer; Yagi, Kenji; Patel, Hemil

    2007-01-01

    The Program Management Tool (PMT) is a comprehensive, Web-enabled business intelligence software tool for assisting program and project managers within NASA enterprises in gathering, comprehending, and disseminating information on the progress of their programs and projects. The PMT provides planning and management support for implementing NASA programmatic and project management processes and requirements. It provides an online environment for program and line management to develop, communicate, and manage their programs, projects, and tasks in a comprehensive tool suite. The information managed by use of the PMT can include monthly reports as well as data on goals, deliverables, milestones, business processes, personnel, task plans, monthly reports, and budgetary allocations. The PMT provides an intuitive and enhanced Web interface to automate the tedious process of gathering and sharing monthly progress reports, task plans, financial data, and other information on project resources based on technical, schedule, budget, and management criteria and merits. The PMT is consistent with the latest Web standards and software practices, including the use of Extensible Markup Language (XML) for exchanging data and the WebDAV (Web Distributed Authoring and Versioning) protocol for collaborative management of documents. The PMT provides graphical displays of resource allocations in the form of bar and pie charts using Microsoft Excel Visual Basic for Application (VBA) libraries. The PMT has an extensible architecture that enables integration of PMT with other strategic-information software systems, including, for example, the Erasmus reporting system, now part of the NASA Integrated Enterprise Management Program (IEMP) tool suite, at NASA Marshall Space Flight Center (MSFC). The PMT data architecture provides automated and extensive software interfaces and reports to various strategic information systems to eliminate duplicative human entries and minimize data integrity

  8. Evaluation of triggering schemes for KM3NeT

    Energy Technology Data Exchange (ETDEWEB)

    Seitz, T., E-mail: Thomas.Seitz@physik.uni-erlangen.de [Erlangen Centre for Astroparticle Physics, Erwin-Rommel-Str. 1, 91058 Erlangen (Germany); Herold, B., E-mail: Bjoern.Herold@physik.uni-erlangen.de [Erlangen Centre for Astroparticle Physics, Erwin-Rommel-Str. 1, 91058 Erlangen (Germany); Shanidze, R., E-mail: shanidze@physik.uni-erlangen.de [Erlangen Centre for Astroparticle Physics, Erwin-Rommel-Str. 1, 91058 Erlangen (Germany)

    2013-10-11

    The future neutrino telescope KM3NeT, to be built in the Mediterranean Sea, will be the largest of its kind. It will include nearly two hundred thousand photomultiplier tubes (PMT) mounted in multi-PMT digital optical modules (DOM). The dominant source of the PMT signals is decays of {sup 40}K and marine fauna bioluminescence. Selection of neutrino and muon events from this continuous optical background signals requires the implementation of fast and efficient triggers. Various schemes for the filtering of background data and the selection of neutrino and muon events were evaluated for the KM3NeT telescope using Monte Carlo simulations.

  9. Influence of ursodeoxycholic acid on hepatobiliary scintigraphy with /sup 99m/Tc-N-pyridoxyl-5-methyltryptophan in chronic liver diseases

    Energy Technology Data Exchange (ETDEWEB)

    Hayakawa, Tomihiro; Katagiri, Kenji; Shiraki, Shigehiro and others

    1988-11-01

    Hepatobiliary scintigraphy using /sup 99m/Tc-N-pyridoxyl-5-methyltryptophan (PMT) was used to elucidate the effect of ursodeoxycholic acid (UDCA) treatment on chronic liver diseases. After UDCA administration, the peak of the hepatic uptake-excretion curve of /sup 99m/Tc-PMT (peak time) was significantly shortened. Serum ..gamma..-GTP level also improved during UDCA therapy. These results suggest that UDCA enhances uptake especially of anions like /sup 99m/Tc-PMT, and increases their secretion into bile. Consequently, UDCA may be pharmachologically useful for chronic liver diseases.

  10. The influence of ursodeoxycholic acid on hepatobiliary scintigraphy with 99mTc-N-pyridoxyl-5-methyltryptophan in chronic liver diseases

    International Nuclear Information System (INIS)

    Hayakawa, Tomihiro; Katagiri, Kenji; Shiraki, Shigehiro

    1988-01-01

    Hepatobiliary scintigraphy using 99m Tc-N-pyridoxyl-5-methyltryptophan (PMT) was used to elucidate the effect of ursodeoxycholic acid (UDCA) treatment on chronic liver diseases. After UDCA administration, the peak of the hepatic uptake-excretion curve of 99m Tc-PMT (peak time) was significantly shortened. Serum γ-GTP level also improved during UDCA therapy. These results suggest that UDCA enhances uptake especially of anions like 99m Tc-PMT, and increases their secretion into bile. Consequently, UDCA may be pharmachologically useful for chronic liver diseases. (author)

  11. An exact formula to describe the amplification process in a photomultiplier tube

    International Nuclear Information System (INIS)

    Rademacker, Jonas

    2002-01-01

    An analytical function is derived that exactly describes the amplification process due to a series of discrete, Poisson-like amplifications like those in a photo multiplier tube (PMT). A numerical recipe is provided that implements this function as a computer program. It is shown how the program can be used as the core element of a faster, simplified routine to fit PMT spectra with high efficiency. The functionality of the method is demonstrated by fitting both, Monte Carlo generated and measured PMT spectra

  12. Transport mechanisms of hepatic uptake and bile excretion in clinical hepatobiliary scintigraphy with 99mTc-N-pyridoxyl-5-methyltryptophan

    International Nuclear Information System (INIS)

    Kobayashi, Masato; Nakanishi, Takeo; Nishi, Kodai; Higaki, Yusuke; Okudaira, Hiroyuki; Ono, Masahiro; Tsujiuchi, Takafumi; Mizutani, Asuka; Nishii, Ryuichi; Tamai, Ikumi; Arano, Yasushi; Kawai, Keiichi

    2014-01-01

    Introduction: In clinical hepatobiliary scintigraphy, 99m Tc-N-pyridoxyl-5-methyltryptophan ( 99m Tc-PMT) is an effective radiotracer among the 99m Tc-pyridoxylaminates. However, the mechanisms of human hepatic uptake and bile excretion transport of 99m Tc-PMT have not been determined. We thus investigated the transport mechanisms of human hepatic uptake and bile excretion in hepatobiliary scintigraphy with 99m Tc-PMT. Methods: Four solute carrier (SLC) transporters involved in hepatic uptake were evaluated using human embryonic kidney (HEK) and HeLa cells with high expression of SLC transporters (organic anion transporting polypeptide (OATP)1B1, OATP1B3, OATP2B1, organic anion transporters (OAT)2 and organic cation transporters (OCT)1) after 5 min of 99m Tc-PMT incubation. Metabolic analysis of 99m Tc-PMT was performed using pooled human liver S9. Adenosine triphosphate (ATP)-binding cassette (ABC) transporters for bile excretion were examined using hepatic ABC transporter vesicles human expressing multiple drug resistance 1 (MDR1), multidrug resistance-associated protein 2 (MRP2), breast cancer resistance protein or bile salt export pump. 99m Tc-PMT was incubated for 1, 3 and 5 min with ATP or adenosine monophosphate and these vesicles. SPECT scans were performed in normal and Eisai hyperbilirubinemic (EHBR) model rats, deficient in Mrp2 transporters, without and with verapamil (rat Mdr1 and human MDR1 inhibitor) after intravenous injection of 99m Tc-PMT. Results: Uptake of 99m Tc-PMT in HEK293/OATP1B1 and HeLa/OATP1B3 was significantly higher than that in HEK293- and HeLa-mock cells. 99m Tc-PMT was not metabolized in the human liver S9. In vesicles with high expression of ABC transporters, uptake of MDR1 or MRP2 was significantly higher at all incubation times. Bile excretion of 99m Tc-PMT was also identified by comparison between normal and EHBR rats with and without verapamil on in-vivo imaging. Conclusions: Human hepatic uptake of 99m Tc-PMT was transferred

  13. Protection motivation theory and physical activity in the general population: a systematic literature review.

    Science.gov (United States)

    Bui, Linh; Mullan, Barbara; McCaffery, Kirsten

    2013-01-01

    An appropriate theoretical framework may be useful for guiding the development of physical activity interventions. This review investigates the effectiveness of the protection motivation theory (PMT), a model based on the cognitive mediation processes of behavioral change, in the prediction and promotion of physical activity participation. A literature search was conducted using the databases MEDLINE, PsycINFO, PubMed, and Web of Science, and a manual search was conducted on relevant reference lists. Studies were included if they tested or applied the PMT, measured physical activity, and sampled from healthy populations. A total of 20 studies were reviewed, grouped into four design categories: prediction, stage discrimination, experimental manipulation, and intervention. The results indicated that the PMT's coping appraisal construct of self-efficacy generally appears to be the most effective in predicting and promoting physical activity participation. In conclusion, the PMT shows some promise, however, there are still substantial gaps in the evidence.

  14. Protection motivation theory and physical activity: a longitudinal test among a representative population sample of Canadian adults.

    Science.gov (United States)

    Plotnikoff, Ronald C; Rhodes, Ryan E; Trinh, Linda

    2009-11-01

    The purpose of this study was to examine the Protection Motivation Theory (PMT) to predict physical activity (PA) behaviour in a large, population-based sample of adults. One thousand six hundred and two randomly selected individuals completed two telephone interviews over two consecutive six-month periods assessing PMT constructs. PMT explained 35 per cent and 20 per cent of the variance in intention and behaviour respectively. Coping cognitions as moderators of threat explained 1 per cent of the variance in intention and behaviour. Age and gender as moderators of threat did not provide additional variance in the models. We conclude that salient PMT predictors (e.g. self-efficacy) may guide the development of effective PA interventions in the general population.

  15. Ocean Color Underwater Low Light Advanced Radiometer—Ocean Color at Night

    Data.gov (United States)

    National Aeronautics and Space Administration — The OCULLAR activity pairs a miniature and ruggedized photomultiplier tube (PMT) with an existing commercial-off-the-shelf (COTS) silicon photodetector (SiP)...

  16. E3 Success Story - Plastic Molding Technology, Inc.

    Science.gov (United States)

    Customer surveys prompted PMT to address new areas which included sustainability issues and reduction goals for energy, water and solid wastes; they were looking for a way to link their reduction projects into their system.

  17. Performance of 8- and 12-dynode stage multianode photo-multipliers

    Energy Technology Data Exchange (ETDEWEB)

    Bibby, J.H. [University of Oxford, Oxford (United Kingdom); Buckley, A. [Cavendish Laboratory, University of Cambridge, Cambridge (United Kingdom); Chamonal, R.J.U. [University of Edinburgh, Edinburgh (United Kingdom)]. E-mail: chamonal@ph.ed.ac.uk; Easo, S. [CCLRC, Rutherford Aplleton Laboratory, Chilton, Didcot, Oxfordshire (United Kingdom); Eisenhardt, S. [University of Edinburgh, Edinburgh (United Kingdom); Gibson, V. [Cavendish Laboratory, University of Cambridge, Cambridge (United Kingdom); Harnew, N. [University of Oxford, Oxford (United Kingdom); Muheim, F. [University of Edinburgh, Edinburgh (United Kingdom); Howard, A. [Imperial College, London (United Kingdom); Lawrence, J. [University of Edinburgh, Edinburgh (United Kingdom); Pickford, A. [University of Glasgow, Glasgow (United Kingdom); Plackett, R. [Imperial College, London (United Kingdom); Price, D.R. [Imperial College, London (United Kingdom); Rademacker, J. [University of Oxford, Oxford (United Kingdom); Smale, N. [University of Oxford, Oxford (United Kingdom); Soler, F.J.P. [University of Glasgow, Glasgow (United Kingdom); CCLRC, Rutherford Aplleton Laboratory, Chilton, Didcot, Oxfordshire (United Kingdom); Somerville, L. [University of Oxford, Oxford (United Kingdom); Storey, J. [Cavendish Laboratory, University of Cambridge, Cambridge (United Kingdom); Websdale, D. [Imperial College, London (United Kingdom); Wotton, S. [Cavendish Laboratory, University of Cambridge, Cambridge (United Kingdom)

    2006-11-01

    We report on studies of 64-channel Multianode Photo-Multiplier Tubes (MaPMTs) as photo-detectors for Ring Imaging CHerenkov (RICH) counters. The newly available 8-dynode stage MaPMT was tested in particle beams at CERN. The MaPMT signals were read out directly with the Beetle1.2 chip which was designed for the LHCb environment and operates at 40MHz. The photon yield and signal losses were determined for a cluster of 3x3 close-packed MaPMTs. The performance of the 8-dynode stage MaPMT was compared to that of the 12-dynode stage MaPMT which has a larger intrinsic gain.

  18. Predictors of Iranian women's intention to first papanicolaou test practice: An application of protection motivation theory.

    Science.gov (United States)

    Dehdari, T; Hassani, L; Shojaeizadeh, D; Hajizadeh, E; Nedjat, S; Abedini, M

    2016-01-01

    Given the importance of papanicolaou (Pap) test in the early detection and timely treatment of cervical cancer, present study was designed to determine predictors of a sample of Iranian women's intention to first Pap test practice based on the protection motivation theory (PMT) variables. In this cross-sectional study, a total of 240 women referral to the 30 primary health care clinics were selected. They completed a developed scale based on PMT variables including intention, perceived vulnerability and severity, fear, response costs, response efficacy and self-efficacy. Path analysis was used to determine the association between predictive factors and intention. The results showed that PMT had goodness of fit with a χ2/df = 2.37, df = 28, P= 0.001 and RMSEA = 0.076. PMT explained 42% of the variance in women's intention to get first Pap smear test. Self-efficacy (b = 0.55, Ptheory-based educational interventions associated with Pap testing among women.

  19. The Effect of Parent Management Training on children with attention ...

    African Journals Online (AJOL)

    The Effect of Parent Management Training on children with attention deficit hyperactivity disorder. ... Log in or Register to get access to full text downloads. ... Training (PMT) on behaviour of children diagnosed with attention deficit hyperactivity ...

  20. Characterization of photo-multiplier tube as ex-vessel radiation detector in tokamak

    Science.gov (United States)

    Jo, Jungmin; Cheon, MunSeong; Kim, Junghee; An, YoungHwa; Park, Seungil; Chung, Kyoung-Jae; Hwang, Y. S.

    2017-09-01

    Feasibility of using conventional photo-multiplier tubes (PMTs) without a scintillator as an ex-vessel radiation detector in a tokamak environment is studied. Basic irradiation tests using standard gamma ray sources and a d-d neutron generator showed that the PMT is responding both to gamma photons and neutrons, possibly due to the direct generation of secondary electrons inside the PMT by the impingement of high energy photons. Because of the selective sensitivity of the PMT to hard x-ray and neutrons in ohmic and neutral beam injected plasmas, respectively, it is shown that the PMT with certain configuration can be utilized either to monitor the fluctuation in the fusion neutron generation rate or to study the behavior of runaway electrons in tokamaks.

  1. QUALITY ASSESSMENT OF CONFOCAL MICROSCOPY SLIDE-BASED SYSTEMS: INSTABLITY

    Science.gov (United States)

    Background: All slide-based fluorescence cytometry detections systems basically include an excitation light source, intermediate optics, and a detection device (CCD or PMT). Occasionally, this equipment becomes unstable, generating unreliable and inferior data. Methods: A num...

  2. Phosphaturic mesenchymal tumor of the brain without tumor-induced osteomalacia in an 8-year-old girl: case report.

    Science.gov (United States)

    Ellis, Mark B; Gridley, Daniel; Lal, Suresh; Nair, Geetha R; Feiz-Erfan, Iman

    2016-05-01

    Phosphaturic mesenchymal tumor (mixed connective tissue variant) (PMT-MCT) are tumors that may cause tumor-induced osteomalacia and rarely appear intracranially. The authors describe the case of an 8-year-old girl who was found to have PMT-MCT with involvement of the cerebellar hemisphere and a small tumor pedicle breaching the dura mater and involving the skull. This was removed surgically in gross-total fashion without further complication. Histologically the tumor was confirmed to be a PMT-MCT. There was no evidence of tumor-induced osteomalacia. At the 42-month follow-up, the patient is doing well, has no abnormalities, and is free of recurrence. PMT-MCTs are rare tumors that may involve the brain parenchyma. A gross-total resection may be effective to cure these lesions.

  3. Political micro-targeting: a Manchurian candidate or just a dark horse?

    Directory of Open Access Journals (Sweden)

    Balázs Bodó

    2017-12-01

    Full Text Available Political micro-targeting (PMT has become a popular topic both in academia and in the public discussions after the surprise results of the 2016 US presidential election, the UK vote on leaving the European Union, and a number of general elections in Europe in 2017. Yet, we still know little about whether PMT is a tool with such destructive potential that it requires close societal control, or if it’s “just” a new phenomenon with currently unknown capacities, but which can ultimately be incorporated into our political processes.   In this article we identify the points where we think we need to further develop our analytical capacities around PMT. We argue that we need to decouple research from the US context, and through more non-US and comparative research we need to develop a better understanding of the macro, meso, and micro level factors that affect the adoption and success of PMTs across different countries. One of the most under-researched macro-level factors is law. We argue that PMT research must develop a better understanding of law, especially in Europe, where the regulatory frameworks around platforms, personal data, political and commercial speech do shape the use and effectiveness of PMT. We point out that the incorporation of such new factors calls for the sophistication of research designs, which currently rely too much on qualitative methods, and use too little of the data that exists on PMT. And finally, we call for distancing PMT research from the hype surrounding the new PMT capabilities, and the moral panics that quickly develop around its uses.

  4. Determinants of Preventive Intentions for Endocrine Disrupters : An Application of the Protection Motivation Theory

    OpenAIRE

    Tozuka, Tadashi; Hayakawa, Masanori; Fukada, Hiromi

    2001-01-01

    Protection motivation theory (PMT) suggested by Rogers (1983) is one of the theories concerning threat appeal. The purpose of this study was to explore the determinants of preventive intentions for endocrine disrupters (estrogen mimics), by using the PMT framework. Independent variables were (1) threat (high or low), (2) response efficacy (high or low), (3) response cost (high or low), and (4) gender (men or women). Four hundred university students (200 men and 200 women) were assigned to one...

  5. The data acquisition system for a SPECT with cylindrical detector

    International Nuclear Information System (INIS)

    Jin Yongjie; Liu Yinong; Li Yuanjing

    1995-01-01

    The data acquisition and position estimation system has been developed for a multi-crystal SPECT with modular cylindrical detector. The electronics screen photon energy determines the detector module stricken by incident photon. The relevant PMT outputs are digitized and passed onto a Pentium PC. Then PMT gain normalization, detector bar identification, energy correction, event coordinates calculation and linearity correction are real-time performed by the PC. The system has been employed in clinical brain imaging

  6. Adolescents' protection motivation and smoking behaviour

    OpenAIRE

    Thrul, Johannes; Stemmler, Mark; Bühler, Anneke; Kuntsche, Emmanuel

    2017-01-01

    The protection motivation theory (PMT) is a well-known theory of behaviour change. This study tested the applicability of the sub-constructs of threat and coping appraisal in predicting adolescents' smoking-related behavioural intentions and smoking behaviour longitudinally. Adolescents (N = 494) aged 11-16 years and not currently smoking at baseline participated in the study. Predictive validity of PMT constructs was tested in a path analysis model. Self-efficacy significantly predicted beha...

  7. Specific diagnosis of hepatocellular carcinoma by delayed hepatobiliary imaging

    International Nuclear Information System (INIS)

    Hasegawa, Y.; Nakano, S.; Ibuka, K.

    1986-01-01

    For assessment of the value of delayed hepatobiliary imaging with technetium 99m (/sup 99m/Tc)-(Sn)-N-pyridoxyl-5-methyltryptophan (/sup 99m/Tc-PMT) for specific diagnosis of hepatocellular carcinoma, 88 patients with various malignant and benign liver diseases (49 with hepatocellular carcinoma, 4 with cholangiocellular carcinoma, 10 with metastatic liver carcinoma, 2 with liver cysts, 2 with liver hemangioma, 1 with liver abscess, 2 with intrahepatic lithiasis, 12 with liver cirrhosis, and 6 with chronic hepatitis) were studied. In 20 (41%) of the 49 patients with hepatocellular carcinoma, greater uptake of /sup 99m/Tc-PMT by the tumor than by the surrounding liver tissue was seen in delayed hepatobiliary images, whereas in eight patients (16%), equilibrated uptake was seen. No increased uptake of the radioisotope by hepatic lesions was seen in 21 patients with localized liver diseases other than hepatoma. Moreover, in 18 patients with diffuse liver diseases, no focal accumulation of the radioisotope was seen in delayed /sup 99m/Tc-PMT images. In addition, of 28 patients with hepatocellular carcinoma in whom the serum alpha-fetoprotein level showed little or no increase, 12 showed increased uptake of /sup 99m/Tc-PMT by the tumor. In assessing delayed /sup 99m/Tc-PMT images, however, it was necessary to consider following complications: accumulation of tracer in obstructed and dilated biliary trees; retention of radioactivity in nonneoplastic liver tissues; difficulties in evaluating /sup 99m/Tc-PMT uptake by small hepatic tumors; overlapping of radioactivity in the gut and gallbladder in delayed /sup 99m/Tc-PMT images of tumors. This study indicates that delayed /sup 99m/Tc-PMT images can be useful in the diagnosis of hepatocellular carcinoma

  8. High energy positron imaging

    International Nuclear Information System (INIS)

    Chen Shengzu

    2003-01-01

    The technique of High Energy Positron Imaging (HEPI) is the new development and extension of Positron Emission Tomography (PET). It consists of High Energy Collimation Imaging (HECI), Dual Head Coincidence Detection Imaging (DHCDI) and Positron Emission Tomography (PET). We describe the history of the development and the basic principle of the imaging methods of HEPI in details in this paper. Finally, the new technique of the imaging fusion, which combined the anatomical image and the functional image together are also introduced briefly

  9. Acute Pancreatitis after Percutaneous Mechanical Thrombectomy: Case Report and Review of the Literature

    International Nuclear Information System (INIS)

    Hershberger, Richard C.; Bornak, Arash; Aulivola, Bernadette; Mannava, Krishna

    2011-01-01

    Purpose: We describe a case of severe acute pancreatitis after percutaneous mechanical thrombectomy (PMT) and review the literature for the occurrence of this complication. Materials and Methods: A 53-year-old man with a history of bilateral external iliac artery stent placement sought care for acute onset of lifestyle-limiting left claudication. Angiography confirmed left external iliac stent occlusion, and PMT with the AngioJet Xpeedior catheter (Possis Medical, Minneapolis MN) was performed. Results: After PMT of the occluded external iliac artery, a residual in-stent stenosis required the placement of a second iliac stent. The procedure was complicated by severe acute pancreatitis. Other causes of pancreatitis were eliminated during the patient’s hospital stay. A literature review revealed nine cases of acute pancreatitis after PMT. Conclusion: Although rare, pancreatitis can be a devastating complication of PMT. The development of pancreatitis seems to be related to the products of extensive hemolysis triggering an inflammatory process. To prevent this complication, we recommend that close attention be paid to the duration and extent of PMT, thereby avoiding extensive hemolysis and subsequent complications.

  10. Plant Defensins NaD1 and NaD2 Induce Different Stress Response Pathways in Fungi

    Directory of Open Access Journals (Sweden)

    Peter M. Dracatos

    2016-09-01

    Full Text Available Nicotiana alata defensins 1 and 2 (NaD1 and NaD2 are plant defensins from the ornamental tobacco that have antifungal activity against a variety of fungal pathogens. Some plant defensins interact with fungal cell wall O-glycosylated proteins. Therefore, we investigated if this was the case for NaD1 and NaD2, by assessing the sensitivity of the three Aspergillus nidulans (An O-mannosyltransferase (pmt knockout (KO mutants (An∆pmtA, An∆pmtB, and An∆pmtC. An∆pmtA was resistant to both defensins, while An∆pmtC was resistant to NaD2 only, suggesting NaD1 and NaD2 are unlikely to have a general interaction with O-linked side chains. Further evidence of this difference in the antifungal mechanism was provided by the dissimilarity of the NaD1 and NaD2 sensitivities of the Fusarium oxysporum f. sp. lycopersici (Fol signalling knockout mutants from the cell wall integrity (CWI and high osmolarity glycerol (HOG mitogen-activated protein kinase (MAPK pathways. HOG pathway mutants were sensitive to both NaD1 and NaD2, while CWI pathway mutants only displayed sensitivity to NaD2.

  11. Colon cancer information as a source of exercise motivation for relatives of patients with colon cancer.

    Science.gov (United States)

    McGowan, Erin L; Prapavessis, Harry

    2010-12-01

    Using a Protection Motivation Theory (PMT) framework, this study examined whether factual colon cancer information is a meaningful source of exercise motivation for relatives of patients with colon cancer. One hundred sixty-six inactive relatives were randomly assigned to one of two treatment conditions: PMT group (intervention); and non-PMT group (attention control). At baseline (T1) participants completed demographic information, a questionnaire designed to assess their beliefs toward exercise and colon cancer as well as their exercise intentions. At T2 (one week following T1) participants watched one of two DVD videos that were created for the study. The intervention DVD contained exercise and colon cancer information that was yoked within the four major components of PMT: perceived vulnerability (PV); perceived severity (PS); response efficacy (RE); and self-efficacy (SE), while the attention control DVD contained general diet and cancer information. Immediately following watching the DVD, participants completed the same measures as in T1. Participants assigned to the PMT intervention group showed significant improvement in PV, RE, SE and exercise intentions, whereas participants assigned to the attention control group showed significant improvement only in RE. RE, SE, and PS made significant and unique contributions to prediction of exercise intention. Overall, the results of the present study demonstrate that a single exposure media intervention grounded in a PMT framework can change individuals' exercise and colon cancer beliefs, as well as change their exercise intentions. Implications of these findings and direction for future research are discussed.

  12. Predicting short and long-term exercise intentions and behaviour in patients with coronary artery disease: A test of protection motivation theory.

    Science.gov (United States)

    Tulloch, Heather; Reida, Robert; D'Angeloa, Monika Slovinec; Plotnikoff, Ronald C; Morrina, Louise; Beatona, Louise; Papadakisa, Sophia; Pipe, Andrew

    2009-03-01

    The purpose of this study was to examine the utility of protection motivation theory (PMT) in the prediction of exercise intentions and behaviour in the year following hospitalisation for coronary artery disease (CAD). Patients with documented CAD (n = 787), recruited at hospital discharge, completed questionnaires measuring PMT's threat (i.e. perceived severity and vulnerability) and coping (i.e. self-efficacy, response efficacy) appraisal constructs at baseline, 2 and 6 months, and exercise behaviour at baseline, 6 and 12 months post-hospitalisation. Structural equation modelling showed that the PMT model of exercise at 6 months had a good fit with the empirical data. Self-efficacy, response efficacy, and perceived severity predicted exercise intentions, which, in turn predicted exercise behaviour. Overall, the PMT variables accounted for a moderate amount of variance in exercise intentions (23%) and behaviour (20%). In contrast, the PMT model was not reliable for predicting exercise behaviour at 12 months post-hospitalisation. The data provided support for PMT applied to short-term, but not long-term, exercise behaviour among patients with CAD. Health education should concentrate on providing positive coping messages to enhance patients' confidence regarding exercise and their belief that exercise provides health benefits, as well as realistic information about disease severity.

  13. Interaction of promethazine and adiphenine to human hemoglobin: A comparative spectroscopic and computational analysis

    Science.gov (United States)

    Maurya, Neha; ud din Parray, Mehraj; Maurya, Jitendra Kumar; Kumar, Amit; Patel, Rajan

    2018-06-01

    The binding nature of amphiphilic drugs viz. promethazine hydrochloride (PMT) and adiphenine hydrochloride (ADP), with human hemoglobin (Hb) was unraveled by fluorescence, absorbance, time resolved fluorescence, fluorescence resonance energy transfer (FRET) and circular dichroism (CD) spectral techniques in combination with molecular docking and molecular dynamic simulation methods. The steady state fluorescence spectra indicated that both PMT and ADP quenches the fluorescence of Hb through static quenching mechanism which was further confirmed by time resolved fluorescence spectra. The UV-Vis spectroscopy suggested ground state complex formation. The activation energy (Ea) was observed more in the case of Hb-ADP than Hb-PMT interaction system. The FRET result indicates the high probability of energy transfer from β Trp37 residue of Hb to the PMT (r = 2.02 nm) and ADP (r = 2.33 nm). The thermodynamic data reveal that binding of PMT with Hb are exothermic in nature involving hydrogen bonding and van der Waal interaction whereas in the case of ADP hydrophobic forces play the major role and binding process is endothermic in nature. The CD results show that both PMT and ADP, induced secondary structural changes of Hb and unfold the protein by losing a large helical content while the effect is more pronounced with ADP. Additionally, we also utilized computational approaches for deep insight into the binding of these drugs with Hb and the results are well matched with our experimental results.

  14. The effect of adding Coping Power Program-Sweden to Parent Management Training-effects and moderators in a randomized controlled trial.

    Science.gov (United States)

    Helander, Maria; Lochman, John; Högström, Jens; Ljótsson, Brjánn; Hellner, Clara; Enebrink, Pia

    2018-04-01

    For children with oppositional defiant disorder (ODD), Parent Management Training (PMT) is a recommended treatment in addition to child Cognitive Behavioral Therapy (child-CBT). There is however a lack of studies investigating the additive effect of group-based child-CBT to PMT for children between 8 and 12 years. The current study investigated the incremental effect of group-based child-CBT, based on the Coping Power Program, when added to the Swedish group-based PMT program KOMET. Outcomes were child behavior problems, child prosocial behavior, parenting skills and the moderating effect of child characteristics. One hundred and twenty children 8-12 years with ODD or Disruptive Behavioral Disorder NOS and their parents were randomized either to combined child-CBT and PMT (n = 63) or to PMT only (n = 57) in Swedish Child- and Adolescent Psychiatric settings. Participants were assessed pre- and post-treatment using semi-structured interviews and child- and parent ratings. After treatment, behavior problems were reduced in both groups. Prosocial behavior were significantly more improved in the combined treatment. Parenting skills were improved in both groups. In moderator analyses, behavior problems and prosocial behavior improved significantly more in the combined treatment compared to PMT only in the group of children with high levels of ODD symptoms. Copyright © 2018 Elsevier Ltd. All rights reserved.

  15. Protection motivation theory and the prediction of physical activity among adults with type 1 or type 2 diabetes in a large population sample.

    Science.gov (United States)

    Plotnikoff, Ronald C; Lippke, Sonia; Trinh, Linda; Courneya, Kerry S; Birkett, Nick; Sigal, Ronald J

    2010-09-01

    To investigate the utility of the protection motivation theory (PMT) for explaining physical activity (PA) in an adult population with type 1 diabetes (T1D) and type 2 diabetes (T2D). Cross-sectional and 6-month longitudinal analysis using PMT. Two thousand three hundred and eleven individuals with T1D (N=697) and T2D (N=1,614) completed self-report PMT constructs of vulnerability, severity, response efficacy, self-efficacy, and intention, and PA behaviour at baseline and 6-month follow-up. Multi-group structural equation modelling was conducted to: (1) test the fit of the PMT structure; (2) determine the similarities and differences in the PMT structure between the two types of diabetes; and (3) examine the explained variance and compare the strength of association of the PMT constructs in predicting PA intention and behaviour. The findings provide evidence for the utility of the PMT in both diabetes samples (chi(2)/df=1.27-4.08, RMSEA=.02-.05). Self-efficacy was a stronger predictor of intention (beta=0.64-0.68) than response efficacy (beta=0.14-0.16) in individuals with T1D or T2D. Severity was significantly related to intention (beta=0.06) in T2D individuals only, whereas vulnerability was not significantly related to intention or PA behaviour. Self-efficacy (beta's=0.20-0.28) and intention (beta's=0.12-0.30) were significantly associated with PA behaviour. Promotion of PA behaviour should primarily target self-efficacy to form intentions and to change behaviour. In addition, for individuals with T2D, severity information should be incorporated into PA intervention materials in this population.

  16. The protection motivation theory within the stages of the transtheoretical model - stage-specific interplay of variables and prediction of exercise stage transitions.

    Science.gov (United States)

    Lippke, Sonia; Plotnikoff, Ronald C

    2009-05-01

    Two different theories of health behaviour have been chosen with the aim of theory integration: a continuous theory (protection motivation theory, PMT) and a stage model (transtheoretical model, TTM). This is the first study to test whether the stages of the TTM moderate the interrelation of PMT-variables and the mediation of motivation, as well as PMT-variables' interactions in predicting stage transitions. Hypotheses were tested regarding (1) mean patterns, stage pair-comparisons and nonlinear trends using ANOVAs; (2) prediction-patterns for the different stage groups employing multi-group structural equation modelling (MSEM) and nested model analyses; and (3) stage transitions using binary logistic regression analyses. Adults (N=1,602) were assessed over a 6 month period on their physical activity stages, PMT-variables and subsequent behaviour. (1) Particular mean differences and nonlinear trends in all test variables were found. (2) The PMT adequately fitted the five stage groups. The MSEM revealed that covariances within threat appraisal and coping appraisal were invariant and all other constrains were stage-specific, i.e. stage was a moderator. Except for self-efficacy, motivation fully mediated the relationship between the social-cognitive variables and behaviour. (3) Predicting stage transitions with the PMT-variables underscored the importance of self-efficacy. Only when threat appraisal and coping appraisal were high, stage movement was more likely in the preparation stage. Results emphasize stage-specific differences of the PMT mechanisms, and hence, support the stage construct. The findings may guide further theory building and research integrating different theoretical approaches.

  17. ASIC design in the KM3NeT detector

    International Nuclear Information System (INIS)

    Gajanana, D; Gromov, V; Timmer, P

    2013-01-01

    In the KM3NeT project [1], Cherenkov light from the muon interactions with transparent matter around the detector, is used to detect neutrinos. Photo multiplier tubes (PMT) used as photon sensor, are housed in a glass sphere (aka Optical Module) to detect single photons from the Cherenkov light. The PMT needs high operational voltage ( ∼ 1.5 kV) and is generated by a Cockroft-Walton (CW) multiplier circuit. The electronics required to control the PMT's and collect the signals is integrated in two ASIC's namely: 1) a front-end mixed signal ASIC (PROMiS) for the readout of the PMT and 2) an analog ASIC (CoCo) to generate pulses for charging the CW circuit and to control the feedback of the CW circuit. In this article, we discuss the two integrated circuits and test results of the complete setup. PROMiS amplifies the input charge, converts it to a pulse width and delivers the information via LVDS signals. These LVDS signals carry accurate information on the Time of arrival ( 2 C bus. This unique combination of the ASIC's results in a very cost and power efficient PMT base design.

  18. Effects of Workplace Parent Management Training on Marital and Job Satisfaction among Iranian Working Parents

    Directory of Open Access Journals (Sweden)

    Masoumeh Mousavi

    2017-11-01

    Full Text Available BackgroundShifting the focus of parent management training (PMT to parents and discussing implications for maximizing the outcomes of PMT for the entire family is new and promising.ObjectiveWe aimed to examine the efficacy of work place PMT on job and marital satisfaction among staff members of an academic center.MethodsWe held 8 PMT sessions (1.5 h each for 20 staff members who were parents to children in the age range of 2–12 years. Dyadic Adjustment Scale (DAS and Occupational Descriptive Index [Health and Safety Executive (HSE] were used for baseline and post-intervention data gathering. DAS higher scores indicate higher marital adjustment satisfaction and higher HSE scores indicate higher occupational stress. To analyze changes in HSE and DAS scores over time, paired t-test and Wilcoxon signed rank test were used, respectively.ResultsAll DAS subscales show significant increased from baseline to the final session except for affectional expression which was not significant. We found no significant changes in total or subscale HSE scores among participants.ConclusionFindings of this study underscore the role of psycho-education usage in work environment and provide evidence about the importance of designing interventions concerning working parents. Implications of PMT are discussed in the text.

  19. The nucleus is an intracellular propagator of tensile forces in NIH 3T3 fibroblasts

    Science.gov (United States)

    Alam, Samer G.; Lovett, David; Kim, Dae In; Roux, Kyle J.; Dickinson, Richard B.; Lele, Tanmay P.

    2015-01-01

    ABSTRACT Nuclear positioning is a crucial cell function, but how a migrating cell positions its nucleus is not understood. Using traction-force microscopy, we found that the position of the nucleus in migrating fibroblasts closely coincided with the center point of the traction-force balance, called the point of maximum tension (PMT). Positioning of the nucleus close to the PMT required nucleus–cytoskeleton connections through linker of nucleoskeleton-to-cytoskeleton (LINC) complexes. Although the nucleus briefly lagged behind the PMT following spontaneous detachment of the uropod during migration, the nucleus quickly repositioned to the PMT within a few minutes. Moreover, traction-generating spontaneous protrusions deformed the nearby nucleus surface to pull the nuclear centroid toward the new PMT, and subsequent retraction of these protrusions relaxed the nuclear deformation and restored the nucleus to its original position. We propose that the protruding or retracting cell boundary transmits a force to the surface of the nucleus through the intervening cytoskeletal network connected by the LINC complexes, and that these forces help to position the nucleus centrally and allow the nucleus to efficiently propagate traction forces across the length of the cell during migration. PMID:25908852

  20. Study of various photomultiplier tubes with muon beams and Cerenkov light produced in electron showers

    International Nuclear Information System (INIS)

    2010-01-01

    The PMTs of the CMS Hadron Forward calorimeter were found to generate a large size signal when their windows were traversed by energetic charged particles. This signal, which is due to Cerenkov light production at the PMT window, could interfere with the calorimeter signal and mislead the measurements. In order to find a viable solution to this problem, the response of four different types of PMTs to muons traversing their windows at different orientations is measured at the H2 beam-line at CERN. Certain kinds of PMTs with thinner windows show significantly lower response to direct muon incidence. For the four anode PMT, a simple and powerful algorithm to identify such events and recover the PMT signal using the signals of the quadrants without window hits is also presented. For the measurement of PMT responses to Cerenkov light, the Hadron Forward calorimeter signal was mimicked by two different setups in electron beams and the PMT performances were compared with each other. Superior performance of particular PMTs was observed.

  1. Grass cell wall feruloylation: distribution of bound ferulate and candidate gene expression in Brachypodium distachyon

    Directory of Open Access Journals (Sweden)

    Hugo Bruno Correa Molinari

    2013-03-01

    Full Text Available The cell walls of grasses such as wheat, maize, rice and sugar cane, contain large amounts of ferulate that is ester-linked to the cell wall polysaccharide glucuronoarabinoxylan (GAX. This ferulate is considered to limit the digestibility of polysaccharide in grass biomass as it forms covalent linkages between polysaccharide and lignin components. Candidate genes within a grass-specific clade of the BAHD acyl-coA transferase superfamily have been identified as being responsible for the ester linkage of ferulate to GAX. Manipulation of these BAHD genes may therefore be a biotechnological target for increasing efficiency of conversion of grass biomass into biofuel. Here, we describe the expression of these candidate genes and amounts of bound ferulate from various tissues and developmental stages of the model grass Brachypodium distachyon. BAHD candidate transcripts and significant amounts of bound ferulate were present in every tissue and developmental stage. We hypothesise that BAHD candidate genes similar to the recently described rice OsPMT gene (PMT sub-clade are principally responsible for the bound coumaric acid (pCA, and that other BAHD candidates (non-PMT sub-clade are responsible for bound ferulic acid (FA. There were some similarities with between the ratio of expression non-PMT / PMT genes and the ratio of bound FA / pCA between tissue types, compatible with this hypothesis. However, much further work to modify BAHD genes in grasses and to characterise the heterologously expressed proteins is required to demonstrate their function.

  2. Global Insight into Lysine Acetylation Events and Their Links to Biological Aspects in Beauveria bassiana, a Fungal Insect Pathogen

    Science.gov (United States)

    Wang, Zhi-Kang; Cai, Qing; Liu, Jin; Ying, Sheng-Hua; Feng, Ming-Guang

    2017-01-01

    Lysine acetylation (Kac) events in filamentous fungi are poorly explored. Here we show a lysine acetylome generated by LC-MS/MS analysis of immunoaffinity-based Kac peptides from normal hyphal cells of Beauveria bassiana, a fungal entomopathogen. The acetylome comprised 283 Kac proteins and 464 Kac sites. These proteins were enriched to eight molecular functions, 20 cellular components, 27 biological processes, 20 KEGG pathways and 12 subcellular localizations. All Kac sites were characterized as six Kac motifs, including a novel motif (KacW) for 26 Kac sites of 17 unknown proteins. Many Kac sites were predicted to be multifunctional, largely expanding the fungal Kac events. Biological importance of identified Kac sites was confirmed through functional analysis of Kac sites on Pmt1 and Pmt4, two O-mannosyltransferases. Singular site mutations (K88R and K482R) of Pmt1 resulted in impaired conidiation, attenuated virulence and decreased tolerance to oxidation and cell wall perturbation. These defects were close to or more severe than those caused by the deletion of pmt1. The Pmt4 K360R mutation facilitated colony growth under normal and stressful conditions and enhanced the fungal virulence. Our findings provide the first insight into the Kac events of B. bassiana and their links to the fungal potential against insect pests. PMID:28295016

  3. Predicting adherence to eye patching in children with amblyopia: an application of protection motivation theory.

    Science.gov (United States)

    Norman, Paul; Searle, Aidan; Harrad, Richard; Vedhara, Kav

    2003-02-01

    This study reports an application of protection motivation theory (PMT) to the prediction of parental adherence to eye patching recommendations for children with amblyopia over a 2-month period. The study also considered the role of past behaviour in PMT. A total of 151 parents of children with amblyopia who were attending follow-up appointments for orthoptic treatment participated. They completed questionnaires based on PMT to assess their beliefs about amblyopia and eye patching. Of the parents, 105 were contacted again at 2-month follow-up to obtain a measure of adherence to the recommended treatment for their child. PMT was found to be predictive of adherence intentions and behaviour at 2-month follow-up. Regression analyses revealed perceived vulnerability, response efficacy and self-efficacy to be significant predictors of protection motivation, whereas perceived vulnerability and response costs were significant predictors of adherence behaviour. Past adherence behaviour was found to have a direct effect on future adherence behaviour over and above the influence of PMT. The results are discussed in relation to the sufficiency of PMTas a model of adherence behaviour. The practical implications for attempts to increase adherence to eye patching among children with amblyopia are outlined.

  4. Laboratory tests of the response stability of the ATLAS Tile Calorimeter photomultipliers

    CERN Document Server

    AUTHOR|(INSPIRE)INSPIRE-00216540; The ATLAS collaboration; Leone, Sandra; Scuri, Fabrizio

    2017-01-01

    High performance of the ATLAS Tile Calorimeter response is achieved with a multi- stage calibration. One step of the calibration is based on measurements of the response to laser pulse excitation of the PMTs used to read out the calorimeter cells. A facility to study the PMT stability response is operating in the PISA-INFN laboratories since 2015. Goals of the tests are to study the time evolution of the PMT response as a function of the integrated anode charge and to compare test bench results with the observed response drifts of the Tile Calorimeter PMTs during LHC Run I and Run II. A new statistical approach was used to measure the drift of the absolute PMT gain. A new procedure which combines studies of the time evolution of the global PMT responses and of the individual PMT gains was adopted to derive the evolution of the cathode quantum efficiency. The experimental setup of the Pisa facility is described and the first results obtained by testing about 30 PMTs Hamamatsu model R7877 (a special evolution f...

  5. The ATLAS Tile Calorimeter experience with 10,000 readout photomultipliers operating since the start of the p-p collisions at LHC

    CERN Document Server

    Lazar, Hadar; The ATLAS collaboration

    2017-01-01

    The channels of TileCal, the hadron calorimeter of the Atlas experiment at the LHC, is readout with 8-stage fine-mesh PhotoMulTipliers (PMTs), a special version of the Hamamatsu model R5900. About 10000 PMTs are operating in TileCal. The PMT response stability allows to calibrate accurately the calorimeter and to achieve high performance of the energy reconstruction of the cells. Currently, no PMT replacement is foreseen before completion of the High Luminosity program of the LHC collider in the next decade. In this perspective, a number of measurements and tests are in progress to qualify the PMT robustness in terms of lifetime and response stability. Data from the Tile calibration procedure for the detector PMTs and from laboratory tests of spare PMTs are being analysed. Results on PMT failures, gain loss and quantum efficiency loss are presented. Analysis is focused on the study of the observed down-drift with time of the PMT response as a function of the integrated anode charge, and depending on the indiv...

  6. Study of Various Photomultiplier Tubes for Window Events: Upgrade R\\&D for CMS Hadron Forward Calorimeters

    CERN Document Server

    Bilki, Burak

    2010-01-01

    The PMTs of the CMS Hadron Forward calorimeter were found to generate a large amount of signal when their windows were traversed by energetic charged particles. This signal, which is due to \\u{C}erenkov light production at the PMT window, could interfere with the calorimeter signal and mislead the measurements. In order to find a viable solution to this problem, the response of different types of PMTs to muons traversing their windows at different orientations is measured at the H2 beam-line at CERN. Certain kinds of PMTs with thinner windows show significantly lower response to direct muon incidence. For one specific type -the four anode PMT- a simple and powerful algorithm to identify such events and recover the PMT signal using the signals of the quadrants without window hits is also presented. For the measurement of PMT responses to \\u{C}erenkov light, the Hadron Forward calorimeter signal was mimicked by two different setups in electron beams and the PMT performances were compared with each other. Superi...

  7. The ATLAS Tile Calorimeter experience with 10,000 readout photomultipliers operating since the start of the $p-p$ collisions at LHC

    CERN Document Server

    AUTHOR|(SzGeCERN)802259; The ATLAS collaboration

    2017-01-01

    The channels of TileCal, the hadron calorimeter of the Atlas experiment at the LHC, is readout with 8-stage fine-mesh PhotoMulTipliers (PMTs), a special version of the Hamamatsu model R5900. About 10000 PMTs are operating in TileCal. The PMT response stability allows to calibrate accurately the calorimeter and to achieve high performance of the energy reconstruction of the cells. Currently, no PMT replacement is foreseen before completion of the High Luminosity program of the LHC collider in the next decade. In this perspective, a number of measurements and tests are in progress to qualify the PMT robustness in terms of lifetime and response stability. Data from the Tile calibration procedure for the detector PMTs and from laboratory tests of spare PMTs are being analysed. Results on PMT failures, gain loss and quantum efficiency loss are presented. Analysis is focused on the study of the observed down-drift with time of the PMT response as a function of the integrated anode charge, and depending on the indiv...

  8. Laboratory tests of the response stability of the ATLAS Tile Calorimeter photomultipliers

    CERN Document Server

    Kazanin, Vassili; The ATLAS collaboration; Scuri, Fabrizio

    2017-01-01

    High performance of the ATLAS Tile Calorimeter response is achieved with a multi-stage calibration. One step of the calibration is based on measurements of the response to laser pulse excitation of the PMTs used to read out the calorimeter cells. A facility to study the PMT stability response is operating in the PISA-INFN laboratories since 2015. Goals of the tests are to study the time evolution of the PMT response as a function of the integrated anode charge and to compare test bench results with the observed response drifts of the Tile Calorimeter PMTs during LHC Run I and Run II. A new statistical approach was used to measure the drift of the absolute PMT gain. A new procedure which combines studies of the time evolution of the global PMT responses and of the individual PMT gains was adopted to derive the evolution of the cathode quantum efficiency. The experimental setup of the Pisa facility is described and the first results obtained by testing about 30 PMTs Hamamatsu model R7877 (a special evolution fo...

  9. Protection motivation theory and social distancing behaviour in response to a simulated infectious disease epidemic.

    Science.gov (United States)

    Williams, Lynn; Rasmussen, Susan; Kleczkowski, Adam; Maharaj, Savi; Cairns, Nicole

    2015-01-01

    Epidemics of respiratory infectious disease remain one of the most serious health risks facing the population. Non-pharmaceutical interventions (e.g. hand-washing or wearing face masks) can have a significant impact on the course of an infectious disease epidemic. The current study investigated whether protection motivation theory (PMT) is a useful framework for understanding social distancing behaviour (i.e. the tendency to reduce social contacts) in response to a simulated infectious disease epidemic. There were 230 participants (109 males, 121 females, mean age 32.4 years) from the general population who completed self-report measures assessing the components of PMT. In addition, participants completed a computer game which simulated an infectious disease epidemic in order to provide a measure of social distancing behaviour. The regression analyses revealed that none of the PMT variables were significant predictors of social distancing behaviour during the simulation task. However, fear (β = .218, p < .001), response efficacy (β = .175, p < .01) and self-efficacy (β = .251, p < .001) were all significant predictors of intention to engage in social distancing behaviour. Overall, the PMT variables (and demographic factors) explain 21.2% of the variance in intention. The findings demonstrated that PMT was a useful framework for understanding intention to engage in social distancing behaviour, but not actual behaviour during the simulated epidemic. These findings may reflect an intention-behaviour gap in relation to social distancing behaviour.

  10. SPE analysis of high efficiency PMTs for the DEAP-3600 dark matter detector

    International Nuclear Information System (INIS)

    Olsen, Kevin; Hallin, Aksel

    2011-01-01

    The Dark matter Experiment using Argon Pulse-shape discrimination is a collaborative effort to develop a next-generation, tonne-scale dark matter detector at SNOLAB. The detector will feature a single-phase liquid argon (LAr) target surrounded by an array of 266 photomultiplier tubes (PMTs). A new high-efficiency Hamamatsu R877-100 PMT has been delivered to the University of Alberta for evaluation by the DEAP collaboration. The increase in efficiency could lead to a much greater light yield, but other experiments have reported a slower rise time. We have placed the PMT in a small dark box and had a base and preamplifier designed to be used with either an oscilloscope or a multi-channel analyzer. With this setup we have demonstrated the PMT's ability to distinguish single photo-electrons (SPE) and characterized the PMT by measuring the SPE pulse height spectrum, the peak-to-valley ratio, the dark pulse rate, the baseline, time resolution and SPE efficiency for varying the high voltage supplied to the PMT.

  11. Plastic-film mulching and urea types affect soil CO2 emissions and grain yield in spring maize on the Loess Plateau, China.

    Science.gov (United States)

    Liu, Qiaofei; Chen, Yu; Li, Weiwei; Liu, Yang; Han, Juan; Wen, Xiaoxia; Liao, Yuncheng

    2016-06-22

    A 2-year field experiment was conducted on maize (Zea mays L.) to explore effective ways to decrease soil CO2 emissions and increase grain yield. Treatments established were: (1) no mulching with urea, (2) no mulching with controlled release fertiliser (CRF), (3) transparent plastic-film mulching (PMt) with urea, (4) PMt with CRF, (5) black plastic-film mulching (PMb) with urea, and (6) PMb with CRF. During the early growth stages, soil CO2 emissions were noted as PMt > PMb > no mulching, and this order was reversed in the late growth stages. This trend was the result of topsoil temperature dynamics. There were no significant correlations noted between soil CO2 emissions and soil temperature and moisture. Cumulative soil CO2 emissions were higher for the PMt than for the PMb, and grain yield was higher for the PMb treatments than for the PMt or no mulching treatments. The CRF produced higher grain yield and inhibited soil CO2 emissions. Soil CO2 emissions per unit grain yield were lower for the BC treatment than for the other treatments. In conclusion, the use of black plastic-film mulching and controlled release fertiliser not only increased maize yield, but also reduced soil CO2 emissions.

  12. Determinants of Skin Cancer Preventive Behaviors Among Rural Farmers in Iran: an Application of Protection Motivation Theory.

    Science.gov (United States)

    Babazadeh, Towhid; Nadrian, Haidar; Banayejeddi, Morteza; Rezapour, Baratali

    2017-09-01

    Skin cancer is one of the most prevalent cancers, worldwide, which happens more among those with more sunlight exposure like farmers. The aim of this study was to explore the determinants of skin cancer preventive behaviors (SCPBs) among rural farmers using Protection Motivation Theory (PMT). In this cross-sectional study, multistage random sampling was employed to enroll 238 farmers referring to rural health houses (HH) in Chaldoran County, Iran. A valid and reliable instrument based on PMT variables was used. Significant correlations were found between all PMT variables with SCPBs (p Protection Motivation and SCPBs as outcome variables. Predictors for these two outcome variables were classified in two different blocks according to their natures. Demographic characteristics (p > 0.05) and PMT constructs (p Protection Motivation, respectively. Also, no significant effect was found on SCPBs by demographic variables, in the first block (∆R 2  = 0.025); however, in the second block, Perceived Susceptibility (p = 0.000), Rewards (p = 0.022), Self-efficacy (p = 0.000), and Response Cost (p = 0.001) were significant predictors of SCPBs (∆R 2  = 0.432). Health care providers may consider PMT as a framework for developing educational interventions aiming at improving SCPBs among rural farmers.

  13. HIV/STD risk behaviors and perceptions among rural-to-urban migrants in China.

    Science.gov (United States)

    Li, Xiaoming; Fang, Xiaoyi; Lin, Danhua; Mao, Rong; Wang, Jing; Cottrell, Lesley; Harris, Carole; Stanton, Bonita

    2004-12-01

    Data from 2,153 sexually active rural-to-urban migrants in China were analyzed to examine the relationship between the movement of rural-to-urban migration and increased HIV/STD (sexually transmitted disease) risk and the applicability of constructs of a Western-based theory of behavioral change to the study population. Measurements included migrant mobility, sexual risk, and the seven constructs of the protection motivation theory (PMT). Data in the current study suggest that high mobility among rural-to-urban migrants was associated with increased sexual risk. The PMT constructs are applicable in identifying perceptions and attitudes associated with sexual risk behaviors in this culturally distinct population. Increased sexual risk was associated with increased perceptions of extrinsic rewards, intrinsic rewards, and response cost. Also consistent with PMT, increased sexual risk was associated with perceptions of decreased severity, vulnerability, response efficacy, and self-efficacy. After controlling for a number of key confounding factors, all seven PMT constructs were associated with sexual risk in the manner posited by the theory. The association between mobility and sexual risk underscores the importance of effective HIV/STD prevention efforts among this vulnerable population. The social cognitive theories including the PMT may form a logical base for prevention intervention programs targeting rural-to-urban migrants in China.

  14. Monte Carlo simulation of simultaneous radiation detection in the hybrid tomography system ClearPET-XPAD3/CT

    Energy Technology Data Exchange (ETDEWEB)

    Dávila, H. Olaya, E-mail: hernan.olaya@uptc.edu.co; Martínez, S. A. [Physics Department, Universidad Pedagógica y Tecnológica de Colombia, Tunja-Colombia (Colombia); Sevilla, A. C., E-mail: acsevillam@unal.edu.co; Castro, H. F. [Physics Department, Universidad Nacional de Colombia, Bogotá D.C - Colombia (Colombia)

    2016-07-07

    Using the Geant4 based simulation framework SciFW1, a detailed simulation was performed for a detector array in the hybrid tomography prototype for small animals called ClearPET / XPAD, which was built in the Centre de Physique des Particules de Marseille. The detector system consists of an array of phoswich scintillation detectors: LSO (Lutetium Oxy-ortosilicate doped with cerium Lu{sub 2}SiO{sub 5}:Ce) and LuYAP (Lutetium Ortoaluminate of Yttrium doped with cerium Lu{sub 0.7}Y{sub 0.3}AlO{sub 3}:Ce) for Positron Emission Tomography (PET) and hybrid pixel detector XPAD for Computed Tomography (CT). Simultaneous acquisition of deposited energy and the corresponding time - position for each recorded event were analyzed, independently, for both detectors. interference between detection modules for PET and CT. Information about amount of radiation reaching each phoswich crystal and XPAD detector using a phantom in order to study the effectiveness by radiation attenuation and influence the positioning of the radioactive source {sup 22}Na was obtained. The simulation proposed will improve distribution of detectors rings and interference values will be taken into account in the new versions of detectors.

  15. PET-COMPTON System. Comparative evaluation with PET System using Monte Carlo Simulation

    International Nuclear Information System (INIS)

    Diaz Garcia, Angelina; Arista Romeu, Eduardo; Abreu Alfonso, Yamiel; Leyva Fabelo, Antonio; Pinnera HernAndez, Ibrahin; Bolannos Perez, Lourdes; Rubio Rodriguez, Juan A.; Perez Morales, Jose M.; Arce Dubois, Pedro; Vela Morales, Oscar; Willmott Zappacosta, Carlos

    2012-01-01

    Positron Emission Tomography (PET) in small animals has actually achieved spatial resolution round about 1 mm and currently there are under study different approaches to improve this spatial resolution. One of them combines PET technology with Compton Cameras. This paper presents the idea of the so called PET-Compton systems and has included comparative evaluation of spatial resolution and global efficiency in both PET and PET-Compton system by means of Monte Carlo simulations using Geant4 code. Simulation was done on a PET-Compton system made-up of LYSO-LuYAP scintillating detectors of particular small animal PET scanner named Clear-PET and for Compton detectors based on CdZnTe semiconductor. A group of radionuclides that emits a positron (e+) and quantum almost simultaneously and fulfills some selection criteria for their possible use in PET-Compton systems for medical and biological applications were studied under simulation conditions. By means of analytical reconstruction using SSRB (Single Slide Rebinning) method were obtained superior spatial resolution in PET-Compton system for all tested radionuclides (reaching sub-millimeter values of for 22Na source). However this analysis done by simulation have shown limited global efficiency values in PET-Compton system (in the order of 10 -5 -10 -6 %) instead of values around 5*10 -1 % that have been achieved in PET system. (author)

  16. Monte Carlo simulation of simultaneous radiation detection in the hybrid tomography system ClearPET-XPAD3/CT

    Science.gov (United States)

    Dávila, H. Olaya; Sevilla, A. C.; Castro, H. F.; Martínez, S. A.

    2016-07-01

    Using the Geant4 based simulation framework SciFW1, a detailed simulation was performed for a detector array in the hybrid tomography prototype for small animals called ClearPET / XPAD, which was built in the Centre de Physique des Particules de Marseille. The detector system consists of an array of phoswich scintillation detectors: LSO (Lutetium Oxy-ortosilicate doped with cerium Lu2SiO5:Ce) and LuYAP (Lutetium Ortoaluminate of Yttrium doped with cerium Lu0.7Y0.3AlO3:Ce) for Positron Emission Tomography (PET) and hybrid pixel detector XPAD for Computed Tomography (CT). Simultaneous acquisition of deposited energy and the corresponding time - position for each recorded event were analyzed, independently, for both detectors. interference between detection modules for PET and CT. Information about amount of radiation reaching each phoswich crystal and XPAD detector using a phantom in order to study the effectiveness by radiation attenuation and influence the positioning of the radioactive source 22Na was obtained. The simulation proposed will improve distribution of detectors rings and interference values will be taken into account in the new versions of detectors.

  17. Laser calibration of the ATLAS Tile Calorimeter

    CERN Document Server

    Di Gregorio, Giulia; The ATLAS collaboration

    2017-01-01

    High performance stability of the ATLAS Tile calorimeter is achieved with a set of calibration procedures. One step of the calibrtion procedure is based on measurements of the response stability to laser excitation of the photomultipliers (PMTs) that are used to readout the calorimeter cells. A facility to study in lab the PMT stability response is operating in the PISA-INFN laboratories since 2015. Goals of the test in lab are to study the time evolution of the PMT response to reproduce and to understand the origin of the resonse drifts seen with the PMT mounted on the Tile calorimeter in its normal operation during LHC run I and run II. A new statistical approach was developed to measure the drift of the absolute gain. This approach was applied to both the ATLAS laser calibration data and to the data collected in the Pisa local laboratory. The preliminary results from these two studies are shown.

  18. Concentration of sup(99m)Tc-Sn-N-pyridoxyl-5-methyltryptophan, a biliary agent, in distant metastases of hepatomas

    Energy Technology Data Exchange (ETDEWEB)

    Hasegawa, Y; Nakano, S; Ibuka, K; Hashizume, T; Sasaki, Y; Imaoka, S; Ishiguro, S; Tanaka, S; Kasugai, H; Okano, Y

    1985-03-01

    During the last 2 years, eight patients with hepatocellular carcinoma who were suspected of having distant metastases have been studied to determine whether a new biliary agent, sup(99m)Tc-Sn-N-pyridoxyl-5-methyl-tryptophan (sup(99m)Tc-PMT), is taken up by extrahepatic tumors. In all eight patients, scintigrams showed a clearly increased uptake of sup(99m)Tc-PMT radioactivity by the extrahepatic tumors. In contrast, an increased uptake by the tumors of gallium citrate Ga 67 was only detected in four of the seven patients examined. The results obtained in this study suggest that sup(99m)Tc-PMT is useful both for characterizing the nature of extrahepatic tumors in patients with hepatoma and for detecting the metastases.

  19. PERANAN PEMBERIAN MAKANAN TAMBAHAN PADA ANAK UMUR 6 – 23 BULAN PADA SAAT KRISIS EKONOMI

    Directory of Open Access Journals (Sweden)

    Sandjaja -

    2014-09-01

    Full Text Available THE IMPACT OF FOOD SUPPLEMENTATION FOR CHILDREN AGED 6-23 MONTHS DURING ECONOMIC CRISIS Supplementary feeding program (PMT for children aged 6-23 months of poor families (Gakin is a sub-component of Social Safety Net – Health Sector (SSN-HS following economic crisis that hit Indonesia the end of 1997. It is intended to provide additional food and prevent deteriorating impact of nutritional status of the target. The main objective of the study was to determine the impact of PMT for children on malnutrition and growth as compared with that for children not receiving PMT. The design of the study is case control. Case was children of poor family who had or ever had received PMT for three months provided by SSN-HS in the last six months. Control was children of near poor families but who had never received PMT. Matching criteria for case and control were age, sex, and residence of the family. The study was conducted in West Java, Central Java, South Kalimantan covering 1014 cases and 1014 controls and their families. Data on child collected were current weight and height, and retrospective weight in the last 10 months. Other data collected were characteristics of chlidren and therir families including socioeconomic status, clinical examination, dietary intake including food suplement. Program implementation of PMT varied among study areas on selection criteria for child beneficiaries in addition to poor families, duration of PMT, method of distribution, type of food. There were similar characteristics between case and control in age, sex, breastfeeding, morbidity except for socioeconomic status of the family, age of father, educational attainment of parents. Foods distributed for 6-11 month old samples included supplementary food, foodstuff, cooked (rice/flour porridge+egg. Foods for 12-23 month old samples more varied than food suplement for 6-11 months old children. Nutrient content of food distributed was 268 Kcal for energy and 9.2 grams

  20. Failure Investigation & Design Optimization of a Photo-Multiplier Tube Assembly Under Thermal Loading

    Science.gov (United States)

    Dahya, Kevin

    2004-01-01

    Analysis of GLAST ACD Photo-Multiplier Tube (PMT) assembly under thermal loading demonstrates that the glass tube experiences high stresses due to Coefficient of Thermal Expansion mismatch, as well as increased stress due to high stiffness and incompressibility of potting compound. Further investigation shows adverse loading effects due to the magnetic shield, a thin piece of steel wrapped around the PMT. This steel, Mu Metal, contained an overlap region that directly attributed to crack propagation in the outside surface of the tube. Sensitivities to different configurations were studied to reduce the stress and provide a more uniform loading throughout the PMT to ensure mission success. Studies indicate substituting a softer and more compressible potting compound and moving the Mu metal from the glass tube to the outside wall of the aluminum housing yields lower stress.

  1. Characterization of photomultiplier tubes with a realistic model through GPU-boosted simulation

    Science.gov (United States)

    Anthony, M.; Aprile, E.; Grandi, L.; Lin, Q.; Saldanha, R.

    2018-02-01

    The accurate characterization of a photomultiplier tube (PMT) is crucial in a wide-variety of applications. However, current methods do not give fully accurate representations of the response of a PMT, especially at very low light levels. In this work, we present a new and more realistic model of the response of a PMT, called the cascade model, and use it to characterize two different PMTs at various voltages and light levels. The cascade model is shown to outperform the more common Gaussian model in almost all circumstances and to agree well with a newly introduced model independent approach. The technical and computational challenges of this model are also presented along with the employed solution of developing a robust GPU-based analysis framework for this and other non-analytical models.

  2. Reducing skin cancer risk: an intervention based on protection motivation theory.

    Science.gov (United States)

    McClendon, B T; Prentice-Dunn, S

    2001-05-01

    Caucasian college students who intentionally tanned participated in a brief skin cancer intervention based on protection motivation theory (PMT). This intervention targeted skin appearance and consisted of brief lectures, a comprehensive essay, video clips about a young man who died of melanoma, and short discussions. Compared to a waitlist control group, the intervention group showed increases on PMT variables and intentions at post-test. The waitlist group later received the intervention and showed similar increases. Additionally, all but one PMT variable maintained post-test levels at a one-month follow-up. Photographs taken at post-test and at the one-month follow-up were judged by raters blind to the hypothesis. Seventy-two percent of participants were judged to have lighter skin whereas only 16 percent had darker skin. These results provide additional support for theory-based methods for changing maladaptive attitudes and behaviors associated with skin cancer risk.

  3. Protection motivation theory and adolescent drug trafficking: relationship between health motivation and longitudinal risk involvement.

    Science.gov (United States)

    Wu, Ying; Stanton, Bonita F; Li, Xiaoming; Galbraith, Jennifer; Cole, Matthew L

    2005-03-01

    To assess health protection motivation as explained by the constructs of protection motivation theory (PMT) and its association with drug trafficking over 2 years. The sample included 817 African American youth (13-16 years old) participating in an adolescent risk-reduction program. We developed an instrument measuring the level of health protection motivation (LHPM) using factor analysis. Changes in LHPM over time were examined among drug traffickers, abstainers, initiators, and nonrisk youths. In sum, 151 participants reported selling and/or delivering drugs during the study period. The significant inverse correlation between drug-trafficking intention and health protection motivation was consistent with PMT. Changes in LHPM were strongly associated with the dynamics of behavior over 2 years. Adolescent drug trafficking can be predicted by an overall level of health protection motivation. PMT and related theories should be considered in the design of drug-trafficking prevention intervention.

  4. A superconducting supercollider calorimeter photomultiplier tube preamplifier circuit

    Energy Technology Data Exchange (ETDEWEB)

    Panescu, D; Lackey, J; Robl, P; Smith, W H [Wisconsin Univ., Madison, WI (United States). Physics Dept.

    1992-07-15

    This study presents the design of the front end amplifier for a scintillator calorimeter with photomultiplier tube (PMT) readout. The design is based on analytical computations and SPICE simulations, and is checked against tests performed on a prototyped circuit. We were looking to achieve (1) a very low droop within the 4 ns after the integration of the photomultiplier tube (PMT) signal was completed, (2) a very low noise figure for the whole amplifier in a 100 MHz bandwidth, (3) an input impedance optimized for the PMT which is actually used, (4) baseline restoration as quick as possible at the output of the clip amps, (5) no loss of information due to the saturation at intermediary stages (e.g. integrator), and (6) an output driving 100 {Omega} twisted pair cables, or 50 {Omega} coaxial cables, in order to transmit the signal to switched capacitor arrays for analog storage. (orig.).

  5. Development of the LBNL positron emission mammography camera

    International Nuclear Information System (INIS)

    Huber, Jennifer S.; Choong, Woon-Seng; Wang, Jimmy; Maltz, Jonathon S.; Qi, Jinyi; Mandelli, Emanuele; Moses, William W.

    2002-01-01

    We present the construction status of the LBNL Positron Emission Mammography (PEM) camera, which utilizes a PET detector module with depth of interaction measurement consisting of 64 LSO crystals (3x3x30 mm3) coupled on one end to a single photomultiplier tube (PMT) and on the opposite end to a 64 pixel array of silicon photodiodes (PDs). The PMT provides an accurate timing pulse, the PDs identify the crystal of interaction, the sum provides a total energy signal, and the PD/(PD+PMT) ratio determines the depth of interaction. We have completed construction of all 42 PEM detector modules. All data acquisition electronics have been completed, fully tested and loaded onto the gantry. We have demonstrated that all functions of the custom IC work using the production rigid-flex boards and data acquisition system. Preliminary detector module characterization and coincidence data have been taken using the production system, including initial images

  6. Laser Calibration of the ATLAS Tile Calorimeter

    CERN Document Server

    Di Gregorio, Giulia; The ATLAS collaboration

    2017-01-01

    High performance stability of the ATLAS Tile Calorimeter is achieved with a set of calibration procedures. One step of the calibration procedure is based on measurements of the response stability to laser excitation of the PMTs that are used to readout the calorimeter cells. A facility to study in lab the PMT stability response is operating in the PISA-INFN laboratories since 2015. Goals of the tests in lab are to study the time evolution of the PMT response to reproduce and to understand the origin of the response drifts seen with the PMT mounted on the Tile calorimeter in its normal operating during LHC run I and run II. A new statistical approach was developed to measure drift of the absolute gain. This approach was applied to both the ATLAS laser calibration data and to data collected in the Pisa local laboratory. The preliminary results from these two studies are shown.

  7. Energy resolution measurements of LaBr3:Ce scintillating crystals with an ultra-high quantum efficiency photomultiplier tube

    International Nuclear Information System (INIS)

    Pani, R.; Cinti, M.N.; Scafe, R.; Pellegrini, R.; Vittorini, F.; Bennati, P.; Ridolfi, S.; Lo Meo, S.; Mattioli, M.; Baldazzi, G.; Pisacane, F.; Navarria, F.; Moschini, G.; Boccaccio, P.; Orsolini Cencelli, V.; Sacco, D.

    2009-01-01

    The performance of the new prototype of high quantum efficiency PMT (43% at 380 nm), Hamamatsu R7600U-200, was studied coupled to a LaBr 3 :Ce crystal with the size of o12.5 mmx12.5 mm. The energy resolution results were compared with ones from two PMTs, Hamamatsu R7600U and R6231MOD, with 22% and 30% quantum efficiency (QE), respectively. Moreover, the photodetectors were equipped with tapered and un-tapered voltage dividers to study the non-linearity effects on pulse height distribution, due to very high peak currents induced in the PMT by the fast and intense light pulse of LaBr 3 :Ce. The results show an energy resolution improvement with UBA PMT of about 20%, in the energy range of 80-662 keV, with respect to the BA one.

  8. The performance of a high speed pipelined photomultiplier readout system in the Fermilab KTe V experiment

    International Nuclear Information System (INIS)

    Whitmore, J.

    1997-08-01

    The KTeV fixed target experiment at Fermilab is using an innovative scheme for reading out its 3100 channel CsI electromagnetic calorimeter. This pipelined readout system digitizes photomultiplier tube (PMT) signals over a 16-bit dynamic range with 8-bits of resolution at 53 MHz. The crucial element of the system is a custom Bi-CMOS integrated circuit which, in conjunction with an 8-bit Flash ADC, integrates and digitizes the PMT signal charge over each 18.9 nsec clock cycle (53 MHz) in a deadtimeless fashion.The digitizer circuit is local to the PMT base, and has an in-situ charge integration noise figure of 3 fC/sample. In this article, the readout system will be described and its performance including noise, cross-talk, linearity, stability, and reliability will be discussed

  9. Volcanic eruptions and the increases in the stratospheric aerosol content: Lidar measurements from 1982 to 1986

    Science.gov (United States)

    Hayashida, S.; Iikura, Y.; Shimizu, H.; Sasano, Y.; Nakane, H.; Sugimoto, N.; Matsui, I.; Takeuchi, N.

    1986-01-01

    The results of the observation for stratospheric aerosols which were carried out since the autumn of 1982 by using the NIES large lidar are described. Specifications of the lidar system are shown. The lidar has two wavelenghts of 1.06 and 0.53 micrometers. The 0.53 micrometer is mainly used for the stratospheric aerosols, because the PMT for 0.53 micrometers has higher sensitivity that that for 1.06 micrometers and the total efficiency is higher in the former. A switching circuit is used to control the PMT gain for avoiding signal induced noise in PMT. For the last four years, the stratospheric aerosol layer which was significantly perturbed by the El Chichon volcanic eruption was observed. The scattering ratio profiles observed from 1982 through 1983 are given.

  10. Preparation of Three-Dimensional Graphene Foams Using Powder Metallurgy Templates.

    Science.gov (United States)

    Sha, Junwei; Gao, Caitian; Lee, Seoung-Ki; Li, Yilun; Zhao, Naiqin; Tour, James M

    2016-01-26

    A simple and scalable method which combines traditional powder metallurgy and chemical vapor deposition is developed for the synthesis of mesoporous free-standing 3D graphene foams. The powder metallurgy templates for 3D graphene foams (PMT-GFs) consist of particle-like carbon shells which are connected by multilayered graphene that shows high specific surface area (1080 m(2) g(-1)), good crystallization, good electrical conductivity (13.8 S cm(-1)), and a mechanically robust structure. The PMT-GFs did not break under direct flushing with DI water, and they were able to recover after being compressed. These properties indicate promising applications of PMT-GFs for fields requiring 3D carbon frameworks such as in energy-based electrodes and mechanical dampening.

  11. Vaccination with Recombinant Non-transmembrane Domain of Protein Mannosyltransferase 4 Improves Survival during Murine Disseminated Candidiasis.

    Science.gov (United States)

    Wang, Li; Yan, Lan; Li, Xing Xing; Xu, Guo Tong; An, Mao Mao; Jiang, Yuan Ying

    2015-01-01

    Candida albicans is the most common cause of invasive fungal infections in humans. The C. albicans cell wall proteins play an important role in crucial host-fungus interactions and might be ideal vaccine targets to induce protective immune response in host. Meanwhile, protein that is specific to C. albicans is also an ideal target of vaccine. In this study, 11 proteins involving cell wall biosynthesis, yeast-to-hypha formation, or specific to C. albicans were chosen and were successfully cloned, purified and verified. The immune protection of vaccination with each recombinant protein respectively in preventing systemic candidiasis in BALB/c mice was assessed. The injection of rPmt4p vaccination significantly increased survival rate, decreased fungal burdens in the heart, liver, brain, and kidneys, and increased serum levels of both immunoglobulin G (IgG) and IgM against rPmt4p in the immunized mice. Histopathological assessment demonstrated that rPmt4p vaccination protected the tissue structure, and decreased the infiltration of inflammatory cells. Passive transfer of the rPmt4p immunized serum increased survival rate against murine systemic candidiasis and significantly reduced organ fungal burden. The immune serum enhanced mouse neutrophil killing activity by directly neutralizing rPmt4p effects in vitro. Levels of interleukin (IL)-4, IL-10, IL-12p70, IL-17A and tumor necrosis factor (TNF)-α in serum were higher in the immunized mice compared to those in the adjuvant control group. In conclusion, our results suggested that rPmt4p vaccination may be considered as a potential vaccine candidate against systemic candidiasis.

  12. Risk of Porphyromonas gingivalis recolonization during the early period of periodontal maintenance in initially severe periodontitis sites.

    Science.gov (United States)

    Fujise, Osamu; Miura, Mayumi; Hamachi, Takafumi; Maeda, Katsumasa

    2006-08-01

    Porphyromonas gingivalis is considered a critical pathogen of periodontal diseases including recurrent periodontitis. The profound effects of active periodontal treatment (APT) on P. gingivalis elimination were previously demonstrated and revealed that the subsequent P. gingivalis-free or -suppressed status seems to be maintained during early periodontal maintenance (PMT). The aim of the present study was to show the occurrence of microbial recolonization during this early PMT period. In total, 128 sites from 11 generalized chronic periodontitis patients and one generalized aggressive periodontitis patient underwent clinical and microbiologic examination at baseline (Exam-I), after APT (Exam-II), and in PMT (Exam-III). Exam-III was carried out an average of 4.5 +/- 3.5 months after Exam-II. Detection and quantification of putative pathogens were performed using a polymerase chain reaction-based method. The PMT used was effective in maintaining the clinical conditions improved by APT. However, in microbiological examinations, Exam-III showed higher detection frequency and levels of P. gingivalis than Exam-II. This suggests that a P. gingivalis recolonization started in the early PMT period. P. gingivalis-increased sites then showed significantly more severe signs of periodontitis in Exam-I than P. gingivalis-stable sites (bleeding on probing frequency: 76.7% versus 56.5%; suppuration frequency: 41.9% versus 12.9%). On the other hand, in Exam-II, no significant differences of clinical parameters were noted between P. gingivalis-increased and -stable sites. Severe periodontitis sites before APT seemed to place them at risk of P. gingivalis recolonization in the early PMT period, and this microbial restoration could be a cause of recurrent periodontitis.

  13. Pharmacomechanical Thrombectomy in Paget–Schroetter Syndrome

    Energy Technology Data Exchange (ETDEWEB)

    Kärkkäinen, Jussi M., E-mail: jkarkkai@gmail.com [Kuopio University Hospital, Heart Center (Finland); Nuutinen, Henrik [Kuopio University Hospital, Department of Surgery (Finland); Riekkinen, Teemu [Kuopio University Hospital, Heart Center (Finland); Sihvo, Eero [Central Finland Central Hospital, Department of Surgery (Finland); Turtiainen, Johanna [North Karelia Central Hospital, Department of Surgery (Finland); Saari, Petri [Kuopio University Hospital, Department of Clinical Radiology (Finland); Mäkinen, Kimmo [Kuopio University Hospital, Heart Center (Finland); Manninen, Hannu [Kuopio University Hospital, Department of Clinical Radiology (Finland)

    2016-09-15

    PurposeThe purpose of the study was to evaluate feasibility of pharmacomechanical thrombectomy (PMT) in the treatment of Paget–Schroetter syndrome (PSS) followed by thoracoscopic or open surgical decompression of the subclavian vein.MethodsTwenty-two out of 27 consecutive patients with PSS received PMT using the Trellis-8 peripheral infusion system (Covidien) between 2010 and 2014. Subsequent surgery was performed in 18 of those patients, 9 patients were treated with thoracoscopic, 7 patients with subclavicular, and 2 patients with transaxillary first rib resection, 4 patients were treated with PMT and anticoagulation alone. Technical success, complications, and patency were registered.ResultsPMT was successful in 21 (95 %) patients; 1 patient with unsatisfactory lysis received further catheter-directed thrombolysis, which, however, did not improve the result. The mean endovascular procedure time was 105 ± 33 min (range 70–200 min), and the required median amount of thrombolytic agent was 500,000 international unit (IU; range 250,000–1,000,000 IU). Adjunctive balloon venoplasty and aspiration were used in 18 (82 %) and 7 (32 %) cases, respectively. One patient had an intimal tear of the subclavian vein that was discovered and repaired during surgery. There were no other complications related to the endovascular procedure. At follow-up, 18 of 21 patients (86 %) with follow-up imaging available had patent subclavian vein, and all except 1 of the 22 patients were asymptomatic. The mean follow-up time was 25 ± 17 months.ConclusionsIn experienced hands, PMT is effective for early thrombus removal in PSS. Surgical decompression must be considered after PMT.

  14. Was the Scanner Calibration Slide used for its intended purpose?

    Directory of Open Access Journals (Sweden)

    Zong Yaping

    2011-04-01

    Full Text Available Abstract In the article, Scanner calibration revisited, BMC Bioinformatics 2010, 11:361, Dr. Pozhitkov used the Scanner Calibration Slide, a key product of Full Moon BioSystems to generate data in his study of microarray scanner PMT response and proposed a mathematic model for PMT response 1. In the end, the author concluded that "Full Moon BioSystems calibration slides are inadequate for performing calibration," and recommended "against using these slides." We found these conclusions are seriously flawed and misleading, and his recommendation against using the Scanner Calibration Slide was not properly supported.

  15. Scintillating optical fibers for fine-grained hodoscopes

    International Nuclear Information System (INIS)

    Borenstein, S.R.; Strand, R.C.

    1981-01-01

    Fast detectors with fine spatial resolution will be needed to exploit high event rates at ISABELLE. Scintillating optical fibers for fine grained hodoscopes have been developed by the authors. A commercial manufacturer of optical fibers has drawn and clad PVT scintillator. Detection efficiencies greater than 99% have been achieved for a 1 mm fiber with a PMT over lengths up to 60 cm. Small diameter PMT's and avalanche photodiodes have been tested with the fibers. Further improvements are sought for the fiber and for the APD's sensitivity and coupling efficiency with the fiber

  16. Characterization of the Hamamatsu R11265-103-M64 multi-anode photomultiplier tube for the LHCb RICH Upgrade

    CERN Document Server

    Matteuzzi, C; Carniti, P; Cassina, L; Giachero, A; Gotti, C; Khanji, B; Maino, M; Pessina, G

    2014-01-01

    The Hamamatsu R11265-103-M64 MaPMT is the baseline photon sensor to be used for the LHCb RICH Upgrade detector. This choice has been supported by a large number of tests of this device. This note summarizes the measurements performed by the INFN Milano Bicocca group to characterize the photon detector. A description is provided of the unpublished outcomes and particularly of the more recent developments about the aging of the R11265-103-M64 MaPMT and the test of a whole photon detector RICH Elementary Cell.

  17. Actively-stabilized photomultiplier tube base for vacuum operation

    International Nuclear Information System (INIS)

    Bryan, M.A; Morris, C.L.; Idzorek, G.C.

    1992-01-01

    An actively stabilized photomultiplier tube (PMT) base design for an Amperex XP-2262B PMT is described. Positive-negative-positive transistors are used as low-impedance current sources to maintain constant voltages on the last three dynodes. This technique results in a highly stable, low-power tube base ideal for use with low-duty-factor beams, such as those found at the Clinton P. Anderson Meson Physics Facility. Furthermore, because of the low power usage of this large design, these bases can be sealed in a heat-conductive, electrically insulating material and used in a vacuum

  18. Protection motivation theory and stages of change in sun protective behavior.

    Science.gov (United States)

    Prentice-Dunn, Steven; McMath, Ben F; Cramer, Robert J

    2009-03-01

    This study examined the usefulness of the stage of change model and protection motivation theory (PMT) in creating brief persuasive appeals to promote healthy sun-behavior. College women (N = 254) read one of four essays that manipulated the level of threat and coping appraisal. The transition from the precontemplation to contemplation stage was promoted by threat appraisal information, but transition from contemplation to the preparation stage occurred only when individuals were provided with both high threat and high coping information. Thus, brief communications based on PMT may create attitudes leading to behavior change when later, more intensive, interventions are introduced.

  19. Performance of the hybrid photomultiplier tube (HPMT)

    Energy Technology Data Exchange (ETDEWEB)

    Schomaker, R.J. [B.V. Delft Electronische Producten, Roden (Netherlands)

    1995-12-31

    The HPMT, which may be an alternative for PhotoMultiplier Tubes (PMT`s) in many applications, is a vacuum tube in which the latest technologies of photocathodes and photodiodes are combined. Photo-electrons are accelerated and bombarding a reversely biased PIN diode, where they create many electron-hole-pairs. The resulting charge pulse can be amplified and further processed. The HPMT shows many superior characteristics compared to regular PMT`s, because it does not suffer the statistical fluctuations common for electron multiplication processes. An energy resolution of up to 14 photo-electrons will be presented, together with striking figures for dynamic range and timing behavior.

  20. A simple method to improve the spatial uniformity of venetian-blind photomultiplier tubes

    International Nuclear Information System (INIS)

    Santos, J.M.F. dos; Veloso, J.F.C.A.; Morgado, R.E.

    1996-01-01

    An improvement in the uniformity of venetian-blind photomultiplier tubes has been achieved by reducing the voltage difference between the first and second dynodes. The method has been applied to a gas proportional scintillation counter (GPSC) instrumented with a venetian-blind photomultiplier (PMT). When exposed to a 20-mm collimated 5.9-keV x-ray beam, an overall improvement in energy resolution for the GPSC/PMT combination from 20% to 11.5% was achieved. An alternative method that reduces the photocathode-to-first-dynode voltage was less effective and resulted in a severe degradation of detector energy resolution

  1. High spatial resolution gamma imaging detector based on a 5 inch diameter R3292 Hamamatsu PSPMT

    International Nuclear Information System (INIS)

    Wojcik, R.; Majewski, S.; Kross, B.; Weisenberger, A.G.; Steinbach, D.

    1998-01-01

    High resolution imaging gamma-ray detectors were developed using Hamamatsu's 5 inch diameter R3292 position sensitive PMT (PSPMT) and a variety of crystal scintillator arrays. Special readout techniques were used to maximize the active imaging area while reducing the number of readout channels. Spatial resolutions approaching 1 mm were obtained in a broad energy range from 20 to 511 keV. Results are also presented of coupling the scintillator arrays to the PMT via imaging light guides consisting of acrylic optical fibers

  2. Robustness studies of the photomultipliers reading out TileCal, the central hadron calorimeter of the ATLAS experiment

    CERN Document Server

    Di Gregorio, Giulia; The ATLAS collaboration

    2018-01-01

    TileCal, the hadron calorimeter of the ATLAS experiment in LHC, is a 10000 channel detector readout by photomultipliers (PMTs). A challenging goal is to understand whether the full sample of PMTs installed at the beginning of the ATLAS detector operation can be used until completion of the High-Luminosity Large Hadron Collider (HL-LHC) program or not. For this reason, a reliable study of the PMT robustness against ageing is required. Detailed studies modelling the PMT response variation as a function of the integrated anode charge were done.

  3. Recent measurements on the Hamamatsu 13 in., R8055, PhotoMultiplier Tubes

    International Nuclear Information System (INIS)

    Tsagli, S.; Aggouras, G.; Anassontzis, E.G.; Ball, A.E.; Chinowsky, W.; Fahrun, E.; Grammatikakis, G.; Green, C.; Grieder, P.; Katrivanos, P.; Koske, P.; Ludvig, J.; Markopoulos, E.; Minkowsky, P.; Nygren, D.; Papageorgiou, K.; Przybylski, G.; Resvanis, L.K.; Siotis, I.; Sopher, J.; Staveris, T.; Tsagli, V.; Zhukov, V.A.

    2006-01-01

    The key component of NESTOR, the deep-sea Cherenkov neutrino telescope, built in the Mediterranean, NW of Greece, is the optical module. The NESTOR Optical Module employs a PhotoMultiplier Tube (PMT) in a transparent glass pressure housing. The Hamamatsu PMT R8055-01, 13 in. photomultiplier was selected for NESTOR to replace the old 15'' Hamamatsu PMTs (R2018-03). Extensive tests have been made on the sensitivity, uniformity, time resolution and noise rates of 162 R8055-01 13 in. PMTs

  4. Quantitative whole body scintigraphy - a simplified approach

    International Nuclear Information System (INIS)

    Marienhagen, J.; Maenner, P.; Bock, E.; Schoenberger, J.; Eilles, C.

    1996-01-01

    In this paper we present investigations on a simplified method of quantitative whole body scintigraphy by using a dual head LFOV-gamma camera and a calibration algorithm without the need of additional attenuation or scatter correction. Validation of this approach to the anthropomorphic phantom as well as in patient studies showed a high accuracy concerning quantification of whole body activity (102.8% and 97.72%, resp.), by contrast organ activities were recovered with an error range up to 12%. The described method can be easily performed using commercially available software packages and is recommendable especially for quantitative whole body scintigraphy in a clinical setting. (orig.) [de

  5. UV Observations of Atomic Oxygen in the Cusp Region

    Science.gov (United States)

    Fritz, B.; Lessard, M.; Dymond, K.; Kenward, D. R.; Lynch, K. A.; Clemmons, J. H.; Hecht, J. H.; Hysell, D. L.; Crowley, G.

    2017-12-01

    The Rocket Experiment for Neutral Upwelling (RENU) 2 launched into the dayside cusp on 13 December, 2015. The sounding rocket payload carried a comprehensive suite of particle, field, and remote sensing instruments to characterize the thermosphere in a region where pockets of enhanced neutral density have been detected [Lühr et al, 2004]. An ultraviolet photomultiplier tube (UV PMT) was oriented to look along the magnetic field line and remotely detect neutral atomic oxygen (OI) above the payload. The UV PMT measured a clear enhancement as the payload descended through a poleward moving auroral form, an indicator of structure in both altitude and latitude. Context for the UV PMT measurement is provided by the Special Sensor Ultraviolet Imager (SSULI) instrument on the Defense Meteorological Space Program (DMSP) satellite, which also measured OI as it passed through the cusp. UV tomography of SSULI observations produces a two-dimensional cross-section of volumetric emission rates in the high-latitude thermosphere prior to the RENU 2 flight. The volume emission rate may then be inverted to produce a profile of neutral density in the thermosphere. A similar technique is used to interpret the UV PMT measurement and determine structure in the thermosphere as RENU 2 descended through the cusp.

  6. Political micro-targeting: a Manchurian candidate or just a dark horse?

    NARCIS (Netherlands)

    Bodó, B.; Helberger, N.; de Vreese, C.H.

    2017-01-01

    Political micro-targeting (PMT) has become a popular topic both in academia and in the public discussions after the surprise results of the 2016 US presidential election, the UK vote on leaving the European Union, and a number of general elections in Europe in 2017. Yet, we still know little about

  7. Versatile laser microfabrication techniques for lab-on-chip devices in ...

    Indian Academy of Sciences (India)

    2014-02-06

    Feb 6, 2014 ... integrated into a small module complete with an LED as excitation source and PMT in photon counting mode ... matching holes for sample/SPS reservoirs using UV-ozone surface activation of bonds under 172 nm DUV lamp.

  8. Phase1 upgrade of the CMS-HF Calorimeter

    CERN Document Server

    Gulmez, Erhan

    2016-01-01

    In this presentation, results of the Phase I upgrade of the CMS Hadron Forward Calorimeter (HF) are discussed. The CMS-HF Calorimeter was using regular PMTs. Cherenkov light produced in the quartz fibers embedded in the iron absorber was read out with the PMTs. However, occasionally, stray muons hitting the PMT windows cause Cherenkov radiation in the PMT itself and produce large signals. These large signals mimic a very high-energy particle and are tagged as important by the trigger. To reduce this problem, PMTs had to be replaced. The four-anode PMTs that were chosen have thinner windows; thereby reducing the Cherenkov radiation in the PMT window. As part of the upgrade, the read-out electronics is to be replaced so that the PMTs are read out in two channels by connecting each pair of anodes to a single channel. Information provided by these two channels will help us reject the false signals due to the stray muons since the Cherenkov radiation in the PMT window is more likely to produce a signal only in one...

  9. An anti-Cherenkov photomultiplier tube

    International Nuclear Information System (INIS)

    Selove, W.; Cormell, L.R.; Dris, M.; Kononenko, W.; Robinson, B.; Yost, B.T.

    1982-01-01

    We have designed a special photomultiplier tube (PMT), with very much reduced sensitivity to Cherenkov light produced in the end window. These PMTs have been produced for us by EMI, and have been used in a modular calorimeter array. The design eliminates a 'hot-spot' problem which was of intolerable magnitude in our application. (orig.)

  10. A remotely triggered fast neutron detection instrument based on a plastic organic scintillator

    Science.gov (United States)

    Jones, A. R.; Aspinall, M. D.; Joyce, M. J.

    2018-02-01

    A detector system for the characterization of radiation fields of both fast neutrons and γ rays is described comprising of a gated photomultiplier tube (PMT), an EJ299-33 solid organic scintillator detector, and an external trigger circuit. The objective of this development was to conceive a means by which the PMT in such a system can be actuated remotely during the high-intensity bursts of pulsed γ-ray contamination that can arise during active interrogation procedures. The system is used to detect neutrons and γ rays using established pulse-shape discrimination (PSD) techniques. The gating circuit enables the PMT to be switched off remotely. This is compatible with use during intense radiation transients to avoid saturation and the disruption of the operation of the PMT during the burst. Data are presented in the form of pulse-height spectra and PSD scatter plots for the system triggered with a strobed light source. These confirm that the gain of the system and the throughput for both triggered and un-triggered scenarios are as expected, given the duty cycle of the stimulating radiation. This demonstrates that the triggering function does not perturb the system response of the detector.

  11. Extension of photomultiplier tube dynamic range for the LHAASO-KM2A electromagnetic particle detectors

    Energy Technology Data Exchange (ETDEWEB)

    Lv, Hongkui, E-mail: lvhk@ihep.ac.cn [Key Laboratory of Particle Astrophysics, Institute of High Energy Physics, Chinese Academy of Sciences, Beijing 100049 (China); University of Chinese Academy of Sciences, Beijing 100049 (China); Sheng, Xiangdong; He, Huihai; Liu, Jia [Key Laboratory of Particle Astrophysics, Institute of High Energy Physics, Chinese Academy of Sciences, Beijing 100049 (China); Zhang, Zhongquan [Shandong University, Jinan 250100 (China); Hou, Chao; Zhao, Jing [Key Laboratory of Particle Astrophysics, Institute of High Energy Physics, Chinese Academy of Sciences, Beijing 100049 (China)

    2015-05-01

    In the Large High Altitude Air Shower Observatory (LHAASO), the 1 km{sup 2} array (KM2A) requires linear measurement of optical intensity with a wide dynamic range. Over 5000 photomultiplier tubes (PMTs) are employed in this experiment and developed as “two outputs” device (anode and dynode) to meet the relevant requirements. In this study, the linearity of the anode and the eighth dynode (DY8), which is limited by space charge effects and mainly related to the relative dynode voltage ratios of the PMT divider, is examined. A voltage divider for the Hamamatsu R11102 PMT is designed and a dramatically enhanced linearity is demonstrated. Test results show that this design can cover a wide dynamic range from 20 to 2×10{sup 5} photoelectrons and achieve a peak anode current of 380 mA at a PMT gain of 10{sup 5}, which satisfies the requirements of KM2A electromagnetic particle detectors. The circuit design has been successfully simulated using the simulation software Multisim. The details of PMT performance tests and simulations are described.

  12. Extension of photomultiplier tube dynamic range for the LHAASO-KM2A electromagnetic particle detectors

    Science.gov (United States)

    Lv, Hongkui; Sheng, Xiangdong; He, Huihai; Liu, Jia; Zhang, Zhongquan; Hou, Chao; Zhao, Jing

    2015-05-01

    In the Large High Altitude Air Shower Observatory (LHAASO), the 1 km2 array (KM2A) requires linear measurement of optical intensity with a wide dynamic range. Over 5000 photomultiplier tubes (PMTs) are employed in this experiment and developed as "two outputs" device (anode and dynode) to meet the relevant requirements. In this study, the linearity of the anode and the eighth dynode (DY8), which is limited by space charge effects and mainly related to the relative dynode voltage ratios of the PMT divider, is examined. A voltage divider for the Hamamatsu R11102 PMT is designed and a dramatically enhanced linearity is demonstrated. Test results show that this design can cover a wide dynamic range from 20 to 2×105 photoelectrons and achieve a peak anode current of 380 mA at a PMT gain of 105, which satisfies the requirements of KM2A electromagnetic particle detectors. The circuit design has been successfully simulated using the simulation software Multisim. The details of PMT performance tests and simulations are described.

  13. Extension of photomultiplier tube dynamic range for the LHAASO-KM2A electromagnetic particle detectors

    International Nuclear Information System (INIS)

    Lv, Hongkui; Sheng, Xiangdong; He, Huihai; Liu, Jia; Zhang, Zhongquan; Hou, Chao; Zhao, Jing

    2015-01-01

    In the Large High Altitude Air Shower Observatory (LHAASO), the 1 km 2 array (KM2A) requires linear measurement of optical intensity with a wide dynamic range. Over 5000 photomultiplier tubes (PMTs) are employed in this experiment and developed as “two outputs” device (anode and dynode) to meet the relevant requirements. In this study, the linearity of the anode and the eighth dynode (DY8), which is limited by space charge effects and mainly related to the relative dynode voltage ratios of the PMT divider, is examined. A voltage divider for the Hamamatsu R11102 PMT is designed and a dramatically enhanced linearity is demonstrated. Test results show that this design can cover a wide dynamic range from 20 to 2×10 5 photoelectrons and achieve a peak anode current of 380 mA at a PMT gain of 10 5 , which satisfies the requirements of KM2A electromagnetic particle detectors. The circuit design has been successfully simulated using the simulation software Multisim. The details of PMT performance tests and simulations are described

  14. Systematic Changes in Families Following Prevention Trials

    Science.gov (United States)

    Patterson, Gerald R.; DeGarmo, David; Forgatch, Marion S.

    2004-01-01

    A selective prevention design was applied to 238 recently separated families. Of these, 153 mothers randomly assigned to the experimental (E) group participated in 14 group sessions focused on Parent Management Treatment (PMT). Prior analyses showed that, over time, the group of families in the untreated group deteriorated in both parenting…

  15. Automatic test system of the photomultipliers

    International Nuclear Information System (INIS)

    Shiino, Kazuo; Kono, Koji; Ishii, Takanobu; Kasai, Seiji; Yamada, Sakue; Kitamura, Shoichi.

    1990-03-01

    A test system of R580 photomultipliers (PMTs) was constructed for the ZEUS experiment HERA. In this report, we will describe the general feature of the test system, each component of the setup, the procedure of the measurements, the data analyses and the results of the first 800 PMT measurements. (author)

  16. Characterization of O-mannosyltransferase family in Schizosaccharomyces pombe.

    Science.gov (United States)

    Tanaka, Naotaka; Fujita, Yasuko; Suzuki, Shotaro; Morishita, Masayo; Giga-Hama, Yuko; Shimoda, Chikashi; Takegawa, Kaoru

    2005-05-13

    Protein O-glycosylation is an essential protein modification in eukaryotic cells. In Saccharomyces cerevisiae, O-mannosylation is initiated in the lumen of the endoplasmic reticulum by O-mannosyltransferase gene products (Pmt1p-7p). A search of the Schizosaccharomyces pombe genome database revealed a total of three O-glycoside mannosyltransferase homologs (ogm1+, ogm2+, and ogm4+), closely related to Saccharomyces cerevisiae PMT1, PMT2, and PMT4. Although individual ogm genes were not found to be essential, ogm1Delta and ogm4Delta mutants exhibited aberrant morphology and failed to agglutinate during mating. The phenotypes of the ogm4Delta mutant were not complemented by overexpression of ogm1+ or ogm2+, suggesting that each of the Ogm proteins does not have overlapping functions. Heterologous expression of a chitinase from S. cerevisiae in the ogm mutants revealed that O-glycosylation of chitinase had decreased in ogm1Delta cells. A GFP-tagged Fus1p from S. cerevisiae was specifically not glycosylated and accumulated in the Golgi in ogm4Delta cells. These results indicate that O-glycosylation initiated by Ogm proteins plays crucial physiological roles and can serve as a sorting determinant for protein transport of membrane glycoproteins in S. pombe.

  17. High-Resolution Imaging System (HiRIS) based on H9500 PSPMT

    International Nuclear Information System (INIS)

    Trotta, C.; Massari, R.; Trinci, G.; Palermo, N.; Boccalini, S.; Scopinaro, F.; Soluri, A.

    2008-01-01

    The H8500 PhotoMultiplier Tube (PMT) from Hamamatsu has been used in the last years to assemble several scintigraphic devices in order to achieve high-resolution gamma cameras. If the detector is coupled to discrete scintillator with millimetric pixel size, the resulting charge distribution that emerges is not properly sampled by its anodes (6x6 mm 2 ). The new position sensitive PMT H9500, with its 3x3 mm 2 anodes, allows a better charge distribution sampling, improving both spatial resolution and linearity of the system. In this paper, we investigate the imaging performances of the H9500 PMT coupled with a CsI(Tl) array having 1 mm pixel size and compare the results with the same scintillator coupled with H8500 PMT. A portable imaging system named HiRIS (High-Resolution Imaging System) was then realized using a miniaturized readout electronic. Thanks to its lightness, it can be easily used in Medical Imaging. We used HiRIS, together with a rotating system, to carry out a tomographic reconstruction of the biodistribution of a radiopharmaceutical in rats

  18. Analysis of Information Requirements and Design of the Consolidated AFIT Database and Information System (CADIS) with an AFIT/CI Implementation Design.

    Science.gov (United States)

    1982-12-01

    STUDENT INVOICES STUDENT UEADER (DI) VOUCHER NUMBER VOUCHER AMOUNT PMT CODE INCLUSI \\ DATES DATE-POSTED AMOUNT REQUESTED TE-. TYPE RE, AKS LINE FUN tI i...CODE INCLUSI ’ . DATES DATE POSTED AOUN_ REQUESTED TERM TYPE RE ,1KS LINE FUN

  19. Teaching Students How To Read Fear Appeals Critically.

    Science.gov (United States)

    Lively, Malcolm

    Fear appeals are persuasive messages that emphasize harmful physical or social consequences of failing to comply with message recommendations. Protection Motivation Theory (PMT) emphasizes cognitive or rational reactions to fear appeals and identifies four message components which initiate corresponding cognitive mediating processes of appraising…

  20. Psychomotor therapy and aggression regulation in eating disorders

    NARCIS (Netherlands)

    Boerhout, Cees; van Busschbach, Jooske T.; Wiersma, Durk; Hoek, Hans W.

    2013-01-01

    Eating disorder behaviours can be seen as self-destructive behaviours to a great extent related to inhibited anger expression. However, a treatment protocol targeted at anger and aggression in these disorders is lacking. This paper describes a psychomotor therapy (PMT) model as a body-oriented

  1. Sensitivity of a multi-photomultiplier optical module for KM3NeT

    NARCIS (Netherlands)

    Löhner, H.; Mjos, A.

    2009-01-01

    For the KM3NeT neutrino telescope an optical module with a number of small photomultiplier tubes (multi-PMT optical module) will be advantageous for various reasons, e.g. reduced background rate, a larger number of coincidence hits, and sensitivity to ultra-high energy neutrinos. The properties of

  2. The sensitivity calibration of the ultra-fast quench plastic scintillation detector for D-T neutrons

    International Nuclear Information System (INIS)

    Tang Changhuan; Yan Meiqiong; Xie Chaomei

    1998-01-01

    The authors introduce some characteristics of ultra-fast quench plastic scintillation detectors. When the detectors are composed of different scintillators, light guides and microchannel plate photomultiplier tube (MCP-PMT), their sensitivities to D-T neutrons are calibrated by a pulse neutron tube with a neutron pulse width about 10 ns

  3. Determinants of Cancer Early Detection Behaviors:Application of Protection Motivation Theory

    Directory of Open Access Journals (Sweden)

    Zohreh Rahaei

    2015-07-01

    Conclusion: Considering the scarceness of CED behaviors and the applicability of PMT in predicting these behaviors, utilization of the PMT‟s constructs in any interventional programs to accelerate CED behaviors could be an alternate methodological choice in the cancer control initiatives.

  4. Effect of an Educational Intervention Based on Protection Motivation Theory on Preventing Cervical Cancer among

    Science.gov (United States)

    Malmir, Shabnam; Barati, Majid; Khani Jeihooni, Ali; Bashirian, Saeed; Hazavehei, Seyed Mohammad Mehdi

    2018-03-27

    Objective: This study aimed to determine the effectiveness of an educational intervention to prevent cervical cancer among marginalized Iranianwomen based on the Protection Motivation Theory (PMT) as a theoretical framework. Methods: This quasi-experimental study was carried out on 143 women of Kermanshah City in western Iran during 2017. Participants were recruited through cluster and simple random sampling and randomly divided into experimental (n=72) and control groups (n=71). All completed a self-administered questionnaire including PMT constructs and demographic variables. An intervention over six sessions was then applied to the experimental group. Reassessment was conducted three months after the intervention, with data was analyzed with SPSS-16 using chi-square, McNemar, paired T- and independent T-tests. Results: The mean scores for the constructs of PMT, and cervical cancer screening behavior showed no significant differences between the two groups before the intervention (P>0.05). The educational manipulation had significant effects on the experimental groups’ average response for perceived vulnerability, perceived severity, perceived reward, self-efficacy, response efficacy, response cost and protection motivation (all p health centers were significantly increased after 3 months in the experimental (P=0.048), but notthe control group (P>0.05). Conclusions: The results show that applying an educational intervention based on PMT might help prevent cervical cancer and improve regular Pap smear testing. Creative Commons Attribution License

  5. Adolescents' protection motivation and smoking behaviour.

    Science.gov (United States)

    Thrul, Johannes; Stemmler, Mark; Bühler, Anneke; Kuntsche, Emmanuel

    2013-08-01

    The protection motivation theory (PMT) is a well-known theory of behaviour change. This study tested the applicability of the sub-constructs of threat and coping appraisal in predicting adolescents' smoking-related behavioural intentions and smoking behaviour longitudinally. Adolescents (N = 494) aged 11-16 years and not currently smoking at baseline participated in the study. Predictive validity of PMT constructs was tested in a path analysis model. Self-efficacy significantly predicted behavioural intention at baseline, which significantly predicted behavioural intention at follow-up, which in turn predicted smoking behaviour at follow-up. The effect of self-efficacy on behavioural intention at follow-up was mediated by behavioural intention at baseline and the effect of self-efficacy on smoking behaviour was mediated by behavioural intention at baseline and follow-up. In conclusion, we found support for one part of the PMT, namely for the predictive validity of the coping appraisal construct self-efficacy in predicting adolescents' smoking-related behavioural intention and smoking behaviour. These results fail to support the appropriateness of the PMT's construct threat appraisal in longitudinally predicting adolescents' smoking as well as the applicability of communicating fear and negative information as preventive interventions for this target group.

  6. Adolescents' protection motivation and smoking behaviour

    NARCIS (Netherlands)

    Thrul, J.; Stemmler, M.; Bühler, A.; Kuntsche, E.N.

    2013-01-01

    The protection motivation theory (PMT) is a well-known theory of behaviour change. This study tested the applicability of the sub-constructs of threat and coping appraisal in predicting adolescents' smoking-related behavioural intentions and smoking behaviour longitudinally. Adolescents (N = 494)

  7. Botrytis cinerea protein O-mannosyltransferases play critical roles in morphogenesis, growth, and virulence.

    Directory of Open Access Journals (Sweden)

    Mario González

    Full Text Available Protein O-glycosylation is crucial in determining the structure and function of numerous secreted and membrane-bound proteins. In fungi, this process begins with the addition of a mannose residue by protein O-mannosyltransferases (PMTs in the lumen side of the ER membrane. We have generated mutants of the three Botrytis cinerea pmt genes to study their role in the virulence of this wide-range plant pathogen. B. cinerea PMTs, especially PMT2, are critical for the stability of the cell wall and are necessary for sporulation and for the generation of the extracellular matrix. PMTs are also individually required for full virulence in a variety of hosts, with a special role in the penetration of intact plant leaves. The most significant case is that of grapevine leaves, whose penetration requires the three functional PMTs. Furthermore, PMT2 also contributes significantly to fungal adherence on grapevine and tobacco leaves. Analysis of extracellular and membrane proteins showed significant changes in the pattern of protein secretion and glycosylation by the pmt mutants, and allowed the identification of new protein substrates putatively glycosylated by specific PMTs. Since plants do no possess these enzymes, PMTs constitute a promising target in the development of novel control strategies against B. cinerea.

  8. Exploring the Impact of Parental Psychopathology and Emotion Regulation on Evidence-Based Parenting Interventions: A Transdiagnostic Approach to Improving Treatment Effectiveness

    Science.gov (United States)

    Maliken, Ashley C.; Katz, Lynn Fainsilber

    2013-01-01

    Parenting interventions, particularly those categorized as parent management training (PMT), have a large evidence base supporting their effectiveness with most families who present for treatment of childhood behavior problems. However, data suggest that PMTs are not effective at treating all families who seek services. Parental psychopathology…

  9. Collection of scintillation light from small BGO crystals

    International Nuclear Information System (INIS)

    Cherry, S.R.; Shao, Y.; Tornai, M.P.; Siegel, S.; Ricci, A.R.; Phelps, M.E.

    1995-01-01

    The authors propose to develop a high resolution positron emission tomography (PET) detector designed for animal imaging. The detector consists of a 2-D array of small bismuth germanate (BGO) crystals coupled via optical fibers to a multi-channel photomultiplier tube (MC-PMT). Though this approach offers several advantages over the conventional BGO block design, it does require that a sufficient number of scintillation photons be transported from the crystal, down the fiber and into the PMT. In this study the authors use simulations and experimental data to determine how to maximize the signal reaching the PMT. This involves investigating factors such as crystal geometry, crystal surface treatment, the use of reflectors, choice of optical fiber, coupling of crystals to the optical fiber and optical fiber properties. Their results indicate that using 2 x 2 x 10 mm BGO crystals coupled to 30 cm of clad optical fiber, roughly 50 photoelectrons are produced at the PMT photocathode for a 511 keV interaction. This is sufficient to clearly visualize the photopeak and provide adequate timing resolution for PET. Based on these encouraging results, a prototype detector will now be constructed

  10. NMS Prototype development final report

    International Nuclear Information System (INIS)

    Lepetich, J.E.

    1993-01-01

    Program for development of NMS prototype for LAMPF consisted of 5 tasks: crystal procurement specification, inspection/evaluation of CsI crystals, design/fabrication of crystal housing, design/fabrication of PMT shields, and packaging of crystals in the housing

  11. Factors of influence on flood damage mitigation behaviour by households - Literature review and results from a French survey.

    NARCIS (Netherlands)

    Poussin, J.K.; Botzen, W.J.W.; Aerts, J.C.J.H.

    2014-01-01

    Based on a literature review, this paper proposes and empirically tests an extended version of the Protection Motivation Theory (PMT) of individual disaster preparedness. A survey was completed by 885 households in three flood-prone regions in France. Regression models provide insights into the

  12. Postmortem time estimation using body temperature and a finite-element computer model

    NARCIS (Netherlands)

    Hartog, E.A. den; Lotens, W.A.

    2004-01-01

    In the Netherlands most murder victims are found 2-24 h after the crime. During this period, body temperature decrease is the most reliable method to estimate the postmortem time (PMT). Recently, two murder cases were analysed in which currently available methods did not provide a su.ciently

  13. Multiple cis-regulatory elements are involved in the complex regulation of the sieve element-specific MtSEO-F1 promoter from Medicago truncatula.

    Science.gov (United States)

    Bucsenez, M; Rüping, B; Behrens, S; Twyman, R M; Noll, G A; Prüfer, D

    2012-09-01

    The sieve element occlusion (SEO) gene family includes several members that are expressed specifically in immature sieve elements (SEs) in the developing phloem of dicotyledonous plants. To determine how this restricted expression profile is achieved, we analysed the SE-specific Medicago truncatula SEO-F1 promoter (PMtSEO-F1) by constructing deletion, substitution and hybrid constructs and testing them in transgenic tobacco plants using green fluorescent protein as a reporter. This revealed four promoter regions, each containing cis-regulatory elements that activate transcription in SEs. One of these segments also contained sufficient information to suppress PMtSEO-F1 transcription in the phloem companion cells (CCs). Subsequent in silico analysis revealed several candidate cis-regulatory elements that PMtSEO-F1 shares with other SEO promoters. These putative sieve element boxes (PSE boxes) are promising candidates for cis-regulatory elements controlling the SE-specific expression of PMtSEO-F1. © 2012 German Botanical Society and The Royal Botanical Society of the Netherlands.

  14. Using a combined protection motivation theory and health action process approach intervention to promote exercise during pregnancy.

    Science.gov (United States)

    Gaston, Anca; Prapavessis, Harry

    2014-04-01

    Despite the benefits of exercise during pregnancy, many expectant mothers are inactive. This study examined whether augmenting a protection motivation theory (PMT) intervention with a Health Action Process Approach can enhance exercise behavior change among pregnant women. Sixty inactive pregnant women were randomly assigned to one of three treatment groups: PMT-only, PMT + action-planning, and PMT + action-and-coping-planning. Week-long objective (accelerometer) and subjective (self-report) exercise measures were collected at baseline, and at 1- and 4-weeks post-intervention. Repeated-measures ANOVAs demonstrated that while all participants reported increased exercise from baseline to 1-week post-intervention, participants in both planning groups were significantly more active (p < .001) than those in the PMT-only group by 4-weeks post-intervention (η (2) = .13 and .15 for accelerometer and self-report data, respectively). In conclusion, augmenting a PMT intervention with action or action-and-coping-planning can enhance exercise behavior change in pregnant women.

  15. Construction of an expression vector for Lactococcus lactis based on ...

    African Journals Online (AJOL)

    To construct an expression vector for Lactococcus lactis, the EmPMT fragment which contained the erythromycin resistance gene, P32 promoter, multiple cloning site (MCS) and terminator (T) was subcloned into the small cryptic plasmid pAR141. The resulting vector, designated as pAR1411, was found to be stably ...

  16. CT and MR imaging features in phosphaturic mesenchymal tumor-mixed connective tissue: A case report.

    Science.gov (United States)

    Shi, Zhenshan; Deng, Yiqiong; Li, Xiumei; Li, Yueming; Cao, Dairong; Coossa, Vikash Sahadeo

    2018-04-01

    Phosphaturic mesenchymal tumor-mixed connective tissue (PMT-MCT) is rare and usually benign and slow-growing. The majority of these tumors is associated with sporadic tumor-induced osteomalacia (TIO) or rickets, affect middle-aged individuals and are located in the extremities. Previous imaging studies often focused on seeking the causative tumors of TIO, not on the radiological features of these tumors, especially magnetic resonance imaging (MRI) features. PMT-MCT remains a largely misdiagnosed, ignored or unknown entity by most radiologists and clinicians. In the present case report, a review of the known literature of PMT-MCT was conducted and the CT and MRI findings from three patient cases were described for diagnosing the small subcutaneous tumor. Typical MRI appearances of PMT-MCT were isointense relative to the muscles on T1-weighted imaging, and markedly hyperintense on T2-weighted imaging containing variably flow voids, with markedly heterogeneous/homogenous enhancement on post contrast T1-weighted fat-suppression imaging. Short time inversion recovery was demonstrated to be the optimal sequence in localizing the tumor.

  17. Costs, equity, efficiency and feasibility of identifying the poor in Ghana's National Health Insurance Scheme: empirical analysis of various strategies.

    NARCIS (Netherlands)

    Aryeetey, G.C.N.O.; Jehu-Appiah, C.; Spaan, E.; Agyepong, I.; Baltussen, R.M.

    2012-01-01

    Objectives To analyse the costs and evaluate the equity, efficiency and feasibility of four strategies to identify poor households for premium exemptions in Ghana's National Health Insurance Scheme (NHIS): means testing (MT), proxy means testing (PMT), participatory wealth ranking (PWR) and

  18. Photocount statistics of ultra-weak photon emission from germinating mung bean

    Czech Academy of Sciences Publication Activity Database

    Rafieiolhosseini, N.; Poplová, Michaela; Sasanpour, P.; Rafii-Tabar, H.; Alhossaini, M.R.; Cifra, Michal

    2016-01-01

    Roč. 162, September (2016), s. 50-55 ISSN 1011-1344 R&D Projects: GA ČR GA13-29294S Institutional support: RVO:67985882 Keywords : Mung bean * PMT photomultiplier tube * Abbreviations UPE ultra-weak photon emission Subject RIV: JA - Electronics ; Optoelectronics, Electrical Engineering Impact factor: 2.673, year: 2016

  19. Upconversion detector for range-resolved DIAL measurement of atmospheric CH4

    DEFF Research Database (Denmark)

    Meng, Lichun; Fix, Andreas; Wirth, Martin

    2018-01-01

    backscatter signal at 1646 nm in a 25-mm long periodically poled lithium niobate crystal. The upconverted signal at 646 nm is detected by a photomultiplier tube (PMT). The UCD with a noise equivalent power around 127 fW/Hz1/2 outperforms a conventional InGaAs based avalanche photodetector when both are used...

  20. Optical fibers and avalanche photodiodes for scintillator counters

    International Nuclear Information System (INIS)

    Borenstein, S.R.; Palmer, R.B.; Strand, R.C.

    1980-01-01

    Fine hodoscopes can be made of new scintillating optical fibers and one half inch end-on PMT's. An avalanche photodiode with small size and immunity to magnetic fields remains as a tempting new device to be proven as a photodetector for the fibers

  1. Internet Journal of Medical Update

    African Journals Online (AJOL)

    Arun Agnihotri

    Rural Medical College, PMT, Loni-413736, Dt-. Ahmednagar, Maharashtra, India; Email: dskdrkulkarni@gmail.com then, efforts are being made to develop optimum ultrasound contrast agents. MECHANISMS INVOLVED. The enhanced difference in acoustic impedance on grey scale imaging, between the contrast agent ...

  2. A Design of a PET Detector Using Micro-Channel Plate Photomultipliers with Transmission-Line Readout.

    Science.gov (United States)

    Kim, H; Frisch, H; Chen, C-T; Genat, J-F; Tang, F; Moses, W W; Choong, W S; Kao, C-M

    2010-01-01

    A computer simulation study has been conducted to investigate the feasibility of a positron emission tomography (PET) detector design by using micro-channel plate (MCP) photomultiplier tubes (PMT) with transmission-line (TL) read-out and waveform sampling. The detector unit consisted of a 24×24 array of pixelated LSO crystals, each of which was 4×4×25 mm(3) in size, and two 102×102 mm(2) MCP-PMTs coupled to both sides of the scintillator array. The crystal (and TL) pitch was 4.25 mm and reflective medium was inserted between the crystals. The transport of the optical photons inside the scintillator were simulated by using the Geant4 package. The output pulses of the MCP-PMT/TL unit were formed by applying the measured single photo-electron response of the MCP-PMT/TL unit to each individual photon that interacts with the photo-cathode of the MCP-PMT. The waveforms of the pulses at both ends of the TL strips were measured and analyzed to produce energy and timing information for the detected event. An experimental setup was developed by employing a Photonis Planacon MCP-PMT (XP85022) and a prototype TL board for measuring the single photo-electron response of the MCP-PMT/TL. The simulation was validated by comparing the predicted output pulses to measurements obtained with a single MCP-PMT/TL coupled to an LSO crystal exposed to 511 keV gamma rays. The validated simulation was then used to investigate the performance of the proposed new detector design. Our simulation result indicates an energy resolution of ~11% at 511 keV. When using a 400-600 keV energy window, we obtain a coincidence timing resolution of ~323 ps FWHM and a coincidence detection efficiency of ~40% for normally-incident 511keV photons. For the positioning accuracy, it is determined by the pitch of the TLs (and crystals) in the direction normal to the TLs and measured to be ~2.5 mm in the direction parallel to the TLs. The energy and timing obtained at the front- and back-end of the scintillator

  3. The pipe model theory half a century on: a review.

    Science.gov (United States)

    Lehnebach, Romain; Beyer, Robert; Letort, Véronique; Heuret, Patrick

    2018-01-23

    More than a half century ago, Shinozaki et al. (Shinozaki K, Yoda K, Hozumi K, Kira T. 1964b. A quantitative analysis of plant form - the pipe model theory. II. Further evidence of the theory and its application in forest ecology. Japanese Journal of Ecology14: 133-139) proposed an elegant conceptual framework, the pipe model theory (PMT), to interpret the observed linear relationship between the amount of stem tissue and corresponding supported leaves. The PMT brought a satisfactory answer to two vividly debated problems that were unresolved at the moment of its publication: (1) What determines tree form and which rules drive biomass allocation to the foliar versus stem compartments in plants? (2) How can foliar area or mass in an individual plant, in a stand or at even larger scales be estimated? Since its initial formulation, the PMT has been reinterpreted and used in applications, and has undoubtedly become an important milestone in the mathematical interpretation of plant form and functioning. This article aims to review the PMT by going back to its initial formulation, stating its explicit and implicit properties and discussing them in the light of current biological knowledge and experimental evidence in order to identify the validity and range of applicability of the theory. We also discuss the use of the theory in tree biomechanics and hydraulics as well as in functional-structural plant modelling. Scrutinizing the PMT in the light of modern biological knowledge revealed that most of its properties are not valid as a general rule. The hydraulic framework derived from the PMT has attracted much more attention than its mechanical counterpart and implies that only the conductive portion of a stem cross-section should be proportional to the supported foliage amount rather than the whole of it. The facts that this conductive portion is experimentally difficult to measure and varies with environmental conditions and tree ontogeny might cause the commonly

  4. Ionic liquid-assisted electrochemical determination of pyrimethanil using reduced graphene oxide conjugated to flower-like NiCo{sub 2}O{sub 4}

    Energy Technology Data Exchange (ETDEWEB)

    Yang, Lijun; Hu, Yandong; Wang, Qiong; Dong, Yuanyuan; Zhang, Lei, E-mail: zhanglei63@126.com

    2016-09-07

    The novel hierarchical flower-like superstructure NiCo{sub 2}O{sub 4}/reduced graphene oxide (rGO) hybrids have been successfully synthesized with a facile one-step hydrothermal process for the determination of fungicide pyrimethanil (PMT). For comparison, various structures of NiCo{sub 2}O{sub 4}/rGO including hexagonal nanoplates and nanorods were also synthesized. Among them, three-dimensional (3D) flower-like NiCo{sub 2}O{sub 4}/rGO exhibited the highest electrocatalytic activity for the oxidation of PMT. With the synergistic effect of [OMIM]PF{sub 6} ionic liquid (IL), the electrochemical sensor film (NiCo{sub 2}O{sub 4}/rGO/IL) further facilitated interfacial electron transfer and enhanced electrocatalytic activity for the oxidation of PMT. Under the optimum conditions, the electrochemical sensor exhibited two linear ranges of 0.1–10.0 μmol/L and 20.0–140 μmol/L for PMT with a low detection concentration of 11.0 nmol/L. Besides, the interference, repeatability, reproducibility and stability measurements were also evaluated. The proposed method was successfully applied to the detection of PMT in water, seawater, fruits and vegetables with good recovery ranging from 93% to 105%, and possessed potential applications in the analysis of real samples. - Highlights: • A novel sensor based on layered flower-like NiCo{sub 2}O{sub 4}/rGO/IL hybrid was fabricated. • Various structures of NiCo{sub 2}O{sub 4}/rGO were synthesized for electrocatalytic comparison. • 3D structure NiCo{sub 2}O{sub 4}/rGO/IL/GCE displayed superior electrocatalytic activity for PMT. • The sensor showed a much wider linear range and a lower detection limit than others. • The method was satisfactorily applied to detection of PMT in real samples.

  5. Evaluating the fall risk among elderly population by choice step reaction test

    Directory of Open Access Journals (Sweden)

    Wang D

    2016-08-01

    Full Text Available Donghai Wang,1 Jian Zhang,1 Yuliang Sun,2 Wenfei Zhu,2 Shiliu Tian,1 Yu Liu1 1Key Laboratory of Exercise and Health Sciences of the Ministry of Education, Shanghai University of Sport, Shanghai, People’s Republic of China; 2School of Physical Education, Shaanxi Normal University, Xian, People’s Republic of China Abstract: Falls during daily activities are often associated with injuries and physical disabilities, thereby affecting quality of life among elder adults. Balance control, which is crucial in avoiding falls, is composed of two elements: muscle strength and central nervous system (CNS control. A number of studies have reported that reduced muscle strength raises the risk of falling. However, to date there has been only limited research focused on the relationship between fall risk and the CNS. This study aimed to investigate the relationship between CNS and risk of falling among the elderly. A total of 140 elderly people (92 females and 48 males were divided into faller and nonfaller groups based on questionnaire responses concerning falls in their daily life. Participants undertook a choice step reaction test in which they were required to respond to random visual stimuli using foot movements as fast as possible in the left or right directions. Response time was quantified as premotor time (PMT and motor time (MT. In addition, the participants’ electromyography data were recorded during the choice step reaction test. A maximal isokinetic torque test was also performed. PMT was greater in the fallers than in the nonfallers group. There was a significant difference between fall status and direction on PMT. PMT of the left limb in nonfallers was faster than the right, but in fallers there was no difference between left and right limbs. A similar phenomenon was also observed for MT. There were significant differences between fallers and nonfallers in maximum isokinetic torque at knee and ankle joints. The correct rate of PMT was

  6. The manifestation of 18F-FDG imaging of coincidence SPECT in benign pulmonary diseases

    International Nuclear Information System (INIS)

    Miao Jisheng; Liu Jinjun; Wu Jiyong; Pan Huizhong; Wang Huoqiang; Shen Yi; Shi Degang

    2001-01-01

    Objective: To study the uptake of the 18 F-FDG in the benign pulmonary diseases with dual head SPECT coincidence detection system. Methods: Scanning were performed with dual head SPECT coincidence detection system for patients with pulmonary diseases,the uptake and the imaging characteristic of the diseases were analysed. Results: 1) In 28 tuberculosis (TB) patients, 19 cases with a negative imaging (68%, 19/28), whereas 9 cases with a positive result (32%, 9/28). The T/N value of the TB is 1.7 +- 1.2, but the T/N of the lung cancer is 4.1 +- 2.4, significantly different from them. In the skin PPD test, 9 cases with positive scans showed a 16.2 (12 - 22) mm diameter red spot, but 7 cases of negative scans with a 8.6 (0 - 15) mm diameter, both also have a significant difference. 2) Out of the 8 patients suffered from sarcoidosis, among them 5 active stage with positive scans, whereas another 3 remission cases with negative results. 3) In 18 inflammation cases, positive imagings were showed in 6 patients with cryptococcosis, mycoplasma pneumonia, mycosis, organized pneumonia, lung abscess and bacteria pneumonia. Conclusions: In some benign pulmonary diseases, 18 F-FDG imaging can be positive also. Analysing the characteristic of the imaging could rise specificity in lung cancer and also give some new clues to treatment of these benign pulmonary diseases

  7. Molecular breast imaging: First results from Italian-National-Institute-of-Health clinical trials

    Energy Technology Data Exchange (ETDEWEB)

    Cusanno, F. [Istituto Superiore di Sanita' and INFN gruppo Sanita, Viale Regina Elena 299, 00161 Rome (Italy)]. E-mail: francesco.cusanno@iss.infn.it; Cisbani, E. [Istituto Superiore di Sanita' and INFN gruppo Sanita, Viale Regina Elena 299, 00161 Rome (Italy); Colilli, S. [Istituto Superiore di Sanita' and INFN gruppo Sanita, Viale Regina Elena 299, 00161 Rome (Italy); Fratoni, R. [Istituto Superiore di Sanita' and INFN gruppo Sanita, Viale Regina Elena 299, 00161 Rome (Italy); Garibaldi, F. [Istituto Superiore di Sanita' and INFN gruppo Sanita, Viale Regina Elena 299, 00161 Rome (Italy); Giuliani, F. [Istituto Superiore di Sanita' and INFN gruppo Sanita, Viale Regina Elena 299, 00161 Rome (Italy); Gricia, M. [Istituto Superiore di Sanita' and INFN gruppo Sanita, Viale Regina Elena 299, 00161 Rome (Italy); Lucentini, M. [Istituto Superiore di Sanita' and INFN gruppo Sanita, Viale Regina Elena 299, 00161 Rome (Italy); Magliozzi, M.L. [Istituto Superiore di Sanita' and INFN gruppo Sanita, Viale Regina Elena 299, 00161 Rome (Italy); Santanvenere, F. [Istituto Superiore di Sanita' and INFN gruppo Sanita, Viale Regina Elena 299, 00161 Rome (Italy); Torrioli, S. [Istituto Superiore di Sanita' and INFN gruppo Sanita, Viale Regina Elena 299, 00161 Rome (Italy); Cinti, M.N. [University La Sapienza, Rome (Italy); Pani, R. [University La Sapienza, Rome (Italy); Pellegrini, R. [University La Sapienza, Rome (Italy); Simonetti, G. [University Tor Vergata, Rome (Italy); Schillaci, O. [University Tor Vergata, Rome (Italy); Del Vecchio, S. [CNR Napoli, Naples (Italy); Salvatore, M. [CNR Napoli, Naples (Italy); Majewski, S. [Jefferson Lab, Newport News (United States); De Vincentis, G. [University La Sapienza, Rome (Italy); Scopinaro, F. [University La Sapienza, Rome (Italy)

    2007-02-01

    Dedicated high resolution detectors are needed for detection of small tumors by molecular imaging with radionuclides. Absorptive collimation are typically used for imaging single photon emitters, but it results in a strong reduction in efficiency. Systems based on electronic collimation offer higher efficiency but they are complex and expensive. In case of scintimammography, dual-head detectors increase sensitivity and cancel out the dependence of the lesion depth. In the system presented here, pixellated scintillator arrays (NaI:Tl) were coupled to arrays of PSPMT's, HPK H8500 Flat Panel. A dual-head detector having field of view of 100x100 mm{sup 2} and 150x200 mm{sup 2} were designed and built. The electronic system allows readout of all the anode pad signals. First clinical trials, performed in the framework of the Scintimammography project of Italian National Institute of Health and University of Tor Vergata in Rome, and University of Naples, are presented.

  8. Experience with dedicated ultra fast solid state cardiac gamma camera: technologist perspective

    International Nuclear Information System (INIS)

    Parab, Anil; Gaikar, Anil; Patil, Kashinath; Lele, V.

    2010-01-01

    Full text: To describe technologist perspective of working with ultra fast solid state gamma camera and comparison with conventional dual head gamma camera. Material and Methods: 900 Myocardial Perfusion scan were carried out on dedicated solid state detector cardiac camera between 1st February 2010 till 29th August 2010. 27 studies were done back to back on a conventional dual head gamma camera. In 2 cases dual head isotope imaging was done (Thallium+ 99m Tc-tetrofosmin). Rest stress protocol was used in 600 patients and stress - rest protocol was used in 300. 1:3 ratio of injected activity was maintained for both protocols (5 mCi for 1st study and 15 mCi for second study). For Rest - Stress protocol, 5 mCi of 99m Tc - Tetrofosmin was injected at rest, 40 minutes later, 5 min image was acquired on the solid state detector. Patient was then stressed. 15 mCi 99m Tc - Tetrofosmin was injected at peak stress. Images were acquired 20 minutes later for 3 minutes (total duration of study 90-100 min). For stress rest protocol, 5 mCi 99m Tc - Tetrofosmin was injected at peak stress. 5 mCi images were acquired 20 minutes later. Rest injection of 15 mCi was given 1 hour post stress injection. Rest images were acquired 40 minutes after rest injection (total duration of study 110-120 min). Results: We observed even with lesser amount activity and acquisition time of 5 min/cardiac scan it showed high sensitivity count rate over 2.2-4.7 kcps (10 times more counts than standard gamma camera). System gives better energy resolution < 7%. Better image contrast. Dual isotope imaging can be possible. Spatial resolution 4.3-4.9 mm. Excellent quality images were obtained using low activities (5 mCi/15 mCi) using 1/3rd the acquisition time compared to conventional dual head gamma camera Even in obese patients 7 mCi/21 mCi activity yielded excellent images at 1/3 rd acquisition time Quick acquisition resulted in greater patient comfort and no motion artifact also due to non rotation of

  9. Comparison of Low-Dose Catheter-Directed Thrombolysis with and without Pharmacomechanical Thrombectomy for Acute Lower Extremity Ischemia.

    Science.gov (United States)

    Gandhi, Sagar S; Ewing, Joseph A; Cooper, Emily; Chaves, Jose Mauro; Gray, Bruce H

    2018-01-01

    Catheter-directed thrombolysis (CDT) and/or pharmacomechanical thrombectomy (PMT) can dissolve/remove thrombus; PMT alone, however, may require the adjunctive use of CDT. The aim of this study was to compare the use of CDT with and without PMT for the treatment of acute lower extremity ischemia (ALI). We retrospectively reviewed all patients with ALI who underwent CDT with or without PMT between January 2008 and April 2014 (n = 99). Patients with incomplete medical charts were excluded (n = 16). Remaining patients were divided into 2 cohorts: group 1 included patients who underwent PMT + CDT (n = 54); group 2 included those who underwent CDT alone (n = 29). Lesions were further characterized by anatomic location: iliac disease (n = 14), femoropopliteal disease (n = 53), tibial disease (n = 2), and multilevel disease (n = 14). Data collection included patient and limb characteristics, duration of treatment, complications, clinical outcomes, adjunctive interventions, and follow-up. No significant differences were seen between treatment groups in terms of patient characteristics, occlusion length and location, Rutherford class, median duration of ischemia time (P = 0.22), or mean lysis time (P = 0.58). Treatment groups were also similar with regard to outcomes, including periprocedure complications, patency, reintervention, limb salvage, and amputation-free survival. There was no different between PMT + CDT and CDT alone in terms of periprocedural complications or outcomes. In the quest to resolve ALI, initial thrombus extraction with PMT may not reduce the need, duration, or efficacy of CDT. Copyright © 2017 Elsevier Inc. All rights reserved.

  10. Identification of Pectin Degrading Enzymes Secreted by Xanthomonas oryzae pv. oryzae and Determination of Their Role in Virulence on Rice.

    Science.gov (United States)

    Tayi, Lavanya; Maku, Roshan V; Patel, Hitendra Kumar; Sonti, Ramesh V

    2016-01-01

    Xanthomonas oryzae pv.oryzae (Xoo) causes the serious bacterial blight disease of rice. Xoo secretes a repertoire of plant cell wall degrading enzymes (CWDEs) like cellulases, xylanases, esterases etc., which act on various components of the rice cell wall. The major cellulases and xylanases secreted by Xoo have been identified and their role in virulence has been determined. In this study, we have identified some of the pectin degrading enzymes of Xoo and assessed their role in virulence. Bioinformatics analysis indicated the presence of four pectin homogalacturonan (HG) degrading genes in the genome of Xoo. The four HG degrading genes include one polygalacturonase (pglA), one pectin methyl esterase (pmt) and two pectate lyases (pel and pelL). There was no difference in the expression of pglA, pmt and pel genes by laboratory wild type Xoo strain (BXO43) grown in either nutrient rich PS medium or in plant mimic XOM2 medium whereas the expression of pelL gene was induced in XOM2 medium as indicated by qRT-PCR experiments. Gene disruption mutations were generated in each of these four genes. The polygalacturonase mutant pglA- was completely deficient in degrading the substrate Na-polygalacturonicacid (PGA). Strains carrying mutations in the pmt, pel and pelL genes were as efficient as wild type Xoo (BXO43) in cleaving PGA. These observations clearly indicate that PglA is the major pectin degrading enzyme produced by Xoo. The pectin methyl esterase, Pmt, is the pectin de-esterifying enzyme secreted by Xoo as evident from the enzymatic activity assay performed using pectin as the substrate. Mutations in the pglA, pmt, pel and pelL genes have minimal effects on virulence. This suggests that, as compared to cellulases and xylanases, the HG degrading enzymes may not have a major role in the pathogenicity of Xoo.

  11. Effect of compliance during periodontal maintenance therapy on levels of bacteria associated with periodontitis: A 6-year prospective study.

    Science.gov (United States)

    Costa, Fernando Oliveira; Vieira, Thaís Riberal; Cortelli, Sheila Cavalca; Cota, Luís Otávio Miranda; Costa, José Eustáquio; Aguiar, Maria Cássia Ferreira; Cortelli, José Roberto

    2018-05-01

    It is well established that regular compliance during periodontal maintenance therapy (PMT) maintains the stability of periodontal clinical parameters obtained after active periodontal therapy (APT). However, compliance during PMT has not yet been related to subgingival bacterial levels. Thus, this study followed individuals in PMT over 6 years and longitudinally evaluated the effects of compliance on periodontitis-associated bacterial levels and its relation to periodontal status. From a 6-year prospective cohort study with 212 individuals in PMT, 91 were determined to be eligible. From this total, 28 regular compliers (RC) were randomly selected and matched for age and sex with 28 irregular compliers (IC). Complete periodontal examination and microbiological samples were obtained 5 times: T1 (prior to APT), T2 (after APT), T3 (2 years), T4 (4 years), and T5 (6 years). Total bacteria counts and levels of Actinomyces naeslundii, Porphyromonas gingivalis, Tannerella forsythia, and Treponema denticola were evaluated through quantitative polymerase chain reaction. RC had less tooth loss and better clinical and microbiological conditions over time when compared with IC. IC had higher total bacterial counts and higher levels of T. denticola. Moreover, among IC, total bacterial counts were positively associated with plaque index and bleeding on probing, while levels of A. naeslundii, T. forsythia, and T. denticola were negatively associated with clinical attachment loss (4 to 5 mm) among RC. Compliance positively influenced subgingival microbiota and contributed to stability of periodontal clinical status. Regular visits during PMT sustained microbiological benefits provided by APT over a 6-year period. © 2018 American Academy of Periodontology.

  12. Identification of Pectin Degrading Enzymes Secreted by Xanthomonas oryzae pv. oryzae and Determination of Their Role in Virulence on Rice.

    Directory of Open Access Journals (Sweden)

    Lavanya Tayi

    Full Text Available Xanthomonas oryzae pv.oryzae (Xoo causes the serious bacterial blight disease of rice. Xoo secretes a repertoire of plant cell wall degrading enzymes (CWDEs like cellulases, xylanases, esterases etc., which act on various components of the rice cell wall. The major cellulases and xylanases secreted by Xoo have been identified and their role in virulence has been determined. In this study, we have identified some of the pectin degrading enzymes of Xoo and assessed their role in virulence. Bioinformatics analysis indicated the presence of four pectin homogalacturonan (HG degrading genes in the genome of Xoo. The four HG degrading genes include one polygalacturonase (pglA, one pectin methyl esterase (pmt and two pectate lyases (pel and pelL. There was no difference in the expression of pglA, pmt and pel genes by laboratory wild type Xoo strain (BXO43 grown in either nutrient rich PS medium or in plant mimic XOM2 medium whereas the expression of pelL gene was induced in XOM2 medium as indicated by qRT-PCR experiments. Gene disruption mutations were generated in each of these four genes. The polygalacturonase mutant pglA- was completely deficient in degrading the substrate Na-polygalacturonicacid (PGA. Strains carrying mutations in the pmt, pel and pelL genes were as efficient as wild type Xoo (BXO43 in cleaving PGA. These observations clearly indicate that PglA is the major pectin degrading enzyme produced by Xoo. The pectin methyl esterase, Pmt, is the pectin de-esterifying enzyme secreted by Xoo as evident from the enzymatic activity assay performed using pectin as the substrate. Mutations in the pglA, pmt, pel and pelL genes have minimal effects on virulence. This suggests that, as compared to cellulases and xylanases, the HG degrading enzymes may not have a major role in the pathogenicity of Xoo.

  13. Investigation of the Role of Training Health Volunteers in Promoting Pap Smear Test Use among Iranian Women Based on the Protection Motivation Theory.

    Science.gov (United States)

    Ghahremani, Leila; Harami, Zahra Khiyali; Kaveh, Mohammad Hossein; Keshavarzi, Sareh

    2016-01-01

    Cervical cancer is known as one of the most prevalent types of cancers and a major public health problem in developing countries which can be detected by Pap test, prevented, and treated. Despite the effective role of Pap test in decreasing the incidence and mortality due to cervical cancer, it is still one the most common causes of cancer-related deaths among women, especially in developing countries. Thus, this study aimed to examine the effect of educational interventions implemented by health volunteers based on protection motivation theory (PMT) on promoting Pap test use among women. This quasi-experimental study was conducted on 60 health volunteers and 420 women. The study participants were divided into an intervention and a control group. Data were collected using a valid self-reported questionnaire including demographic variables and PMT constructs which was completed by both groups before and 2 months after the intervention. Then, the data were entered into the SPSS statistical software, version 19 and were analyzed using Chi-square test, independent T-test, and descriptive statistical methods. P<0.05 was considered as statistically significant. The findings of this study showed that the mean scores of PMT constructs (i.e. perceived vulnerability, perceived severity, fear, response-costs, self-efficacy, and intention) increased in the intervention group after the intervention (P<0.001). However, no significant difference was found between the two groups regarding response efficacy after the intervention (P=0.06). The rate of Pap test use also increased by about 62.9% among the study women. This study showed a significant positive relationship between PMT-based training and Pap test use. The results also revealed the successful contribution of health volunteers to training cervical cancer screening. Thus, training interventions based on PMT are suggested to be designed and implemented and health volunteers are recommended to be employed for educational

  14. Prevalence and predictors of complementary and alternative medicine use among people with coronary heart disease or at risk for this in the sixth Tromsø study: a comparative analysis using protection motivation theory.

    Science.gov (United States)

    Kristoffersen, Agnete E; Sirois, Fuschia M; Stub, Trine; Hansen, Anne Helen

    2017-06-19

    Engagement in healthy lifestyle behaviors, such as healthy diet and regular physical activity, are known to reduce the risk of developing coronary heart disease (CHD). Complementary and alternative medicine (CAM) is known to be associated with having a healthy lifestyle. The primary aim of this study was to examine the prevalence and predictors of CAM use in CHD patients, and in those without CHD but at risk for developing CHD, using Protection Motivation Theory (PMT) as a guiding conceptual framework. Questionnaire data were collected from 12,981 adult participants in the cross-sectional sixth Tromsø Study (2007-8). Eligible for analyses were 11,103 participants who reported whether they had used CAM or not. Of those, 830 participants reported to have or have had CHD (CHD group), 4830 reported to have parents, children or siblings with CHD (no CHD but family risk), while 5443 reported no CHD nor family risk of CHD. We first compared the patterns of CAM use in each group, and then examined the PMT predictors of CAM use. Health vulnerability from the threat appraisal process of PMT was assessed by self-rated health and expectations for future health. Response efficacy from the coping appraisal process of PMT was assessed as preventive health beliefs and health behavior frequency. Use of CAM was most commonly seen in people with no CHD themselves, but family risk of developing CHD (35.8%), compared to people already diagnosed with CHD (30.2%) and people with no CHD nor family risk (32.1%). All four of the PMT factors; self-rated health, expectations for future health, preventive health beliefs, and the health behavior index - were predictors for CAM use in the no CHD but family risk group. These findings suggest that people use CAM in response to a perceived risk of developing CHD, and to prevent disease and to maintain health.

  15. Characterizing ICF Neutron Scintillation Diagnostics on the nTOF line at SUNY Geneseo

    Science.gov (United States)

    Lawson-Keister, Pat; Padawar-Curry, Jonah; Visca, Hannah; Fletcher, Kurt; Padalino, Stephen; Sangster, T. Craig; Regan, Sean

    2015-11-01

    Neutron scintillator diagnostics for ICF and HEDP can be characterized using the neutron time-of-flight (nTOF) line on Geneseo's 1.7 MV tandem Pelletron accelerator. Neutron signals can be differentiated from gamma signals by employing coincidence methods. A 1.8-MeV beam of deuterons incident on a deuterated polyethylene target produces neutrons via the 2H(d,n)3He reaction. Neutrons emerging at a lab angle of 88° have an energy of 2.96 MeV; the 3He ions associated with these neutrons are detected at a scattering angle of 43° using a surface barrier detector. The time of flight of the neutron can be measured by using the 3He detection as a ``start'' signal and the scintillation detection as a ``stop'' signal. This time of flight requirement is used to identify the 2.96-MeV neutron signals in the scintillator. To measure the light curve produced by these monoenergetic neutrons, two photomultiplier (PMT) tubes are attached to the scintillator. The full aperture PMT establishes the nTOF coincidence. The other PMT is fitted with a pinhole to collect single events. The time between the full aperture PMT signal and the arrival of the signal in the pinhole PMT is used to determine the light curve for the scintillator. This system will enable the neutron response of various scintillators to be compared. Supported in part by the Department of Energy National Nuclear Security Administration under Award Number DE-NA0001944.

  16. Related factors to workers' use of hearing protection device in knitting & ppinning factories of Yazd city based on Protection Motivation Theory

    Directory of Open Access Journals (Sweden)

    A. Barkhordi

    2009-10-01

    Full Text Available Background and aimsNoise-Induced Hearing Loss (NIHL is an important occupational disorder. High percentage of workers in occupational environments did not use the hearing protection device against harmful noise. This study was carried out to study factors related to workers' use of Hearing protection Device in Knitting & spinning factories of Yazd city based on protection motivation theory.MethodsIn this cross-sectional analytical study 280 workers of the knitting & spinning factories of Yazd City who exposed to harmful noise (over 85dB selected among the three factories by cluster sampling. The data gathered via exclusive interviews with selected workers  using the questionnaire designed based on protection motivation theory and were analyzedResults42/5 percent of workers permanently used hearing protection devices, and 20/7 percent of workers never use.There was a significant correlation between the age of workers and the mean score components of PMT; perceived severity, perceived vulnerability, perceived response efficacy and protection motivation. There was also a significant correlation between the work experience and the mean score of PMT factors; perceived severity, perceived response efficacy and perceived vulnerability. Also there was a significant correlation between workers' education level and the mean score of perceived response efficacy and there was a significant correlation between protection motivation and the mean score components of PMT; perceived vulnerability, perceived self-efficacy, perceived response efficacy, perceived costs and behaviorConclusionRegarding the significant correlations between the more constructs of PMT and protection motivation of workers for using hearing protective device, designing educational program based on PMT to increase hearing protection devices usage among workers is recommended.

  17. Effect of cyclic, low dose pyrimethamine treatment in patients with Late Onset Tay Sachs: an open label, extended pilot study.

    Science.gov (United States)

    Osher, Etty; Fattal-Valevski, Aviva; Sagie, Liora; Urshanski, Nataly; Sagiv, Nadav; Peleg, Leah; Lerman-Sagie, Tally; Zimran, Ari; Elstein, Deborah; Navon, Ruth; Valevski, Avi; Stern, Naftali

    2015-04-17

    Late Onset Tay- Sachs disease (LOTS) is a rare neurodegenerative lysosomal storage disease which results from mutations in the gene encoding the α subunit (HEXA) of β-hexosaminidase enzyme (HexA). At the present time, no effective treatment exists for LOTS and other neurodegenerative diseases involving the central nerve system (CNS). Pyrimethamine (PMT) was previously shown to act as a HexA chaperone in human fibroblasts in vitro carrying some (e.g., αG269S), but not all LOTS-related mutations. The present study assessed the effect of cyclic, low dose and long term pyrimethamine treatment on HexA in subjects with LOTS. In an open label trial in 4 LOTS patients, PMT was initiated at an average daily dose of ~2.7 mg and administered cyclically guided by blood lymphocyte HexA activity for a mean duration of 82.8 (±22.5; SD) weeks (~1.5 year). HexA activity rose in all subjects, with a mean peak increase of 2.24 folds (±0.52; SD) over baseline activity (range 1.87-3). The mean treatment time required to attain this peak was of 15.7 (±4.8; SD) weeks. Following increase in activity, HexA gradually declined with the continued use of PMT, which was then stopped, resulting in the return of HexA activity to baseline. A second cycle of PMT treatment was then initiated, resulting again in an increase in HexA activity. Three of the patients experienced a measurable neuropsychiatric deterioration whereas one subject remained entirely stable. Cyclic low dose of PMT can increase HexA activity in LOTS patients. However, the observed increase is repeatedly transient and not associated with discernible beneficial neurological or psychiatric effects.

  18. Insights into Flood-Coping Appraisals of Protection Motivation Theory: Empirical Evidence from Germany and France.

    Science.gov (United States)

    Bubeck, Philip; Wouter Botzen, W J; Laudan, Jonas; Aerts, Jeroen C J H; Thieken, Annegret H

    2017-11-17

    Protection motivation theory (PMT) has become a popular theory to explain the risk-reducing behavior of residents against natural hazards. PMT captures the two main cognitive processes that individuals undergo when faced with a threat, namely, threat appraisal and coping appraisal. The latter describes the evaluation of possible response measures that may reduce or avert the perceived threat. Although the coping appraisal component of PMT was found to be a better predictor of protective intentions and behavior, little is known about the factors that influence individuals' coping appraisals of natural hazards. More insight into flood-coping appraisals of PMT, therefore, are needed to better understand the decision-making process of individuals and to develop effective risk communication strategies. This study presents the results of two surveys among more than 1,600 flood-prone households in Germany and France. Five hypotheses were tested using multivariate statistics regarding factors related to flood-coping appraisals, which were derived from the PMT framework, related literature, and the literature on social vulnerability. We found that socioeconomic characteristics alone are not sufficient to explain flood-coping appraisals. Particularly, observational learning from the social environment, such as friends and neighbors, is positively related to flood-coping appraisals. This suggests that social norms and networks play an important role in flood-preparedness decisions. Providing risk and coping information can also have a positive effect. Given the strong positive influence of the social environment on flood-coping appraisals, future research should investigate how risk communication can be enhanced by making use of the observed social norms and network effects. © 2017 Society for Risk Analysis.

  19. Monte Carlo simulations of GeoPET experiments: 3D images of tracer distributions (18F, 124I and 58Co) in Opalinus clay, anhydrite and quartz

    Science.gov (United States)

    Zakhnini, Abdelhamid; Kulenkampff, Johannes; Sauerzapf, Sophie; Pietrzyk, Uwe; Lippmann-Pipke, Johanna

    2013-08-01

    Understanding conservative fluid flow and reactive tracer transport in soils and rock formations requires quantitative transport visualization methods in 3D+t. After a decade of research and development we established the GeoPET as a non-destructive method with unrivalled sensitivity and selectivity, with due spatial and temporal resolution by applying Positron Emission Tomography (PET), a nuclear medicine imaging method, to dense rock material. Requirements for reaching the physical limit of image resolution of nearly 1 mm are (a) a high-resolution PET-camera, like our ClearPET scanner (Raytest), and (b) appropriate correction methods for scatter and attenuation of 511 keV—photons in the dense geological material. The latter are by far more significant in dense geological material than in human and small animal body tissue (water). Here we present data from Monte Carlo simulations (MCS) reflecting selected GeoPET experiments. The MCS consider all involved nuclear physical processes of the measurement with the ClearPET-system and allow us to quantify the sensitivity of the method and the scatter fractions in geological media as function of material (quartz, Opalinus clay and anhydrite compared to water), PET isotope (18F, 58Co and 124I), and geometric system parameters. The synthetic data sets obtained by MCS are the basis for detailed performance assessment studies allowing for image quality improvements. A scatter correction method is applied exemplarily by subtracting projections of simulated scattered coincidences from experimental data sets prior to image reconstruction with an iterative reconstruction process.

  20. Expanding protection motivation theory: investigating an application to animal owners and emergency responders in bushfire emergencies.

    Science.gov (United States)

    Westcott, Rachel; Ronan, Kevin; Bambrick, Hilary; Taylor, Melanie

    2017-04-26

    Protection Motivation Theory (PMT) was developed by Rogers in 1975, to describe how individuals are motivated to react in a self-protective way towards a perceived health threat. Rogers expected the use of PMT to diversify over time, which has proved true over four decades. The purpose of this paper is to explore how PMT can be used and expanded to inform and improve public safety strategies in natural hazards. As global climate change impacts on the Australian environment, natural hazards seem to be increasing in scale and frequency, and Emergency Services' public education campaigns have necessarily escalated to keep pace with perceived public threat. Of concern, is that the awareness-preparedness gap in residents' survival plans is narrowing disproportionately slowly compared to the magnitude of resources applied to rectify this trend. Practical applications of adaptable social theory could be used to help resolve this dilemma. PMT has been used to describe human behaviour in individuals, families, and the parent-child unit. It has been applied to floods in Europe and wildfire and earthquake in the United States. This paper seeks to determine if an application of PMT can be useful for achieving other-directed human protection across a novel demographic spectrum in natural hazards, specifically, animal owners and emergency responders in bushfire emergencies. These groups could benefit from such an approach: owners to build and fortify their response- and self-efficacy, and to help translate knowledge into safer behaviour, and responders to gain a better understanding of a diverse demographic with animal ownership as its common denominator, and with whom they will be likely to engage in contemporary natural hazard management. Mutual collaboration between these groups could lead to a synergy of reciprocated response efficacy, and safer, less traumatic outcomes. Emergency services' community education programs have made significant progress over the last decade, but

  1. Development of a PET/Cerenkov-light hybrid imaging system

    International Nuclear Information System (INIS)

    Yamamoto, Seiichi; Hamamura, Fuka; Kato, Katsuhiko; Ogata, Yoshimune; Watabe, Tadashi; Ikeda, Hayato; Kanai, Yasukazu; Hatazawa, Jun; Watabe, Hiroshi

    2014-01-01

    Purpose: Cerenkov-light imaging is a new molecular imaging technology that detects visible photons from high-speed electrons using a high sensitivity optical camera. However, the merit of Cerenkov-light imaging remains unclear. If a PET/Cerenkov-light hybrid imaging system were developed, the merit of Cerenkov-light imaging would be clarified by directly comparing these two imaging modalities. Methods: The authors developed and tested a PET/Cerenkov-light hybrid imaging system that consists of a dual-head PET system, a reflection mirror located above the subject, and a high sensitivity charge coupled device (CCD) camera. The authors installed these systems inside a black box for imaging the Cerenkov-light. The dual-head PET system employed a 1.2 × 1.2 × 10 mm 3 GSO arranged in a 33 × 33 matrix that was optically coupled to a position sensitive photomultiplier tube to form a GSO block detector. The authors arranged two GSO block detectors 10 cm apart and positioned the subject between them. The Cerenkov-light above the subject is reflected by the mirror and changes its direction to the side of the PET system and is imaged by the high sensitivity CCD camera. Results: The dual-head PET system had a spatial resolution of ∼1.2 mm FWHM and sensitivity of ∼0.31% at the center of the FOV. The Cerenkov-light imaging system's spatial resolution was ∼275μm for a 22 Na point source. Using the combined PET/Cerenkov-light hybrid imaging system, the authors successfully obtained fused images from simultaneously acquired images. The image distributions are sometimes different due to the light transmission and absorption in the body of the subject in the Cerenkov-light images. In simultaneous imaging of rat, the authors found that 18 F-FDG accumulation was observed mainly in the Harderian gland on the PET image, while the distribution of Cerenkov-light was observed in the eyes. Conclusions: The authors conclude that their developed PET/Cerenkov-light hybrid imaging

  2. Brain SPECT with short focal-length cone-beam collimation

    International Nuclear Information System (INIS)

    Park, Mi-Ae; Moore, Stephen C.; Kijewski, Marie Foley

    2005-01-01

    Single-photon emission-computed tomography (SPECT) imaging of deep brain structures is compromised by loss of photons due to attenuation. We have previously shown that a centrally peaked collimator sensitivity function can compensate for this phenomenon, increasing sensitivity over most of the brain. For dual-head instruments, parallel-hole collimators cannot provide variable sensitivity without simultaneously degrading spatial resolution near the center of the brain; this suggests the use of converging collimators. We have designed collimator pairs for dual-head SPECT systems to increase sensitivity, particularly in the center of the brain, and compared the new collimation approach to existing approaches on the basis of performance in estimating activity concentration of small structures at various locations in the brain. The collimator pairs we evaluated included a cone-beam collimator, for increased sensitivity, and a fan-beam collimator, for data sufficiency. We calculated projections of an ellipsoidal uniform background, with 0.9-cm-radius spherical lesions at several locations in the background. From these, we determined ideal signal-to-noise ratios (SNR CRB ) for estimation of activity concentration within the spheres, based on the Cramer-Rao lower bound on variance. We also reconstructed, by an ordered-subset expectation-maximization (OS-EM) procedure, images of this phantom, as well as of the Zubal brain phantom, to allow visual assessment and to ensure that they were free of artifacts. The best of the collimator pairs evaluated comprised a cone-beam collimator with 20 cm focal length, for which the focal point is inside the brain, and a fan-beam collimator with 40 cm focal length. This pair yielded increased SNR CRB , compared to the parallel-parallel pair, throughout the imaging volume. The factor by which SNR CRB increased ranged from 1.1 at the most axially extreme location to 3.5 at the center. The gains in SNR CRB were relatively robust to mismatches

  3. Photon-counting-based diffraction phase microscopy combined with single-pixel imaging

    Science.gov (United States)

    Shibuya, Kyuki; Araki, Hiroyuki; Iwata, Tetsuo

    2018-04-01

    We propose a photon-counting (PC)-based quantitative-phase imaging (QPI) method for use in diffraction phase microscopy (DPM) that is combined with a single-pixel imaging (SPI) scheme (PC-SPI-DPM). This combination of DPM with the SPI scheme overcomes a low optical throughput problem that has occasionally prevented us from obtaining quantitative-phase images in DPM through use of a high-sensitivity single-channel photodetector such as a photomultiplier tube (PMT). The introduction of a PMT allowed us to perform PC with ease and thus solved a dynamic range problem that was inherent to SPI. As a proof-of-principle experiment, we performed a comparison study of analogue-based SPI-DPM and PC-SPI-DPM for a 125-nm-thick indium tin oxide (ITO) layer coated on a silica glass substrate. We discuss the basic performance of the method and potential future modifications of the proposed system.

  4. Electronics and Calibration system for the CMS Beam Halo Monitor

    CERN Document Server

    Tosi, Nicolò; Fabbri, Franco L; Finkel, Alexey; Orfanelli, Stella; Loos, R; Montanari, Alessandro; Rusack, R; Stickland, David P

    2014-01-01

    In the context of increasing luminosity of LHC, it will be important to accurately measure the Machine Induced Background. A new monitoring system will be installed in the cavern of the Compact Muon Solenoid (CMS) experiment for measuring the beam background at high radius. This detector is composed of synthetic quartz Cherenkov radiators, coupled to fast photomultiplier tubes (PMT). The readout chain of this detector will make use of many components developed for the Phase 1 upgrade to the CMS Hadron Calorimeter electronics, with a dedicated firmware and readout adapted to the beam monitoring requirements. The PMT signal will be digitized by a charge integrating ASIC (QIE10), providing both the signal rise time and the charge integrated over one bunch crossing. The backend electronics will record bunch-by-bunch histograms, which will be published to CMS and the LHC using the newly designed CMS beam instrumentation specific DAQ. A calibration monitoring system has been designed to generate triggered pulses of...

  5. Wavelength shifting reflector foils for liquid Ar scintillation light

    Energy Technology Data Exchange (ETDEWEB)

    Walter, Manuel [Physik Institut, Universitaet Zuerich (Switzerland); Collaboration: GERDA-Collaboration

    2013-07-01

    Liquid argon is used as a scintillator in several present and upcoming experiments. In Gerda it is used as a coolant, shielding and will be instrumented to become an active veto in Phase II. Its scintillation light has a wavelength of 128 nm, that gets absorbed by quartz. In order to measure the light using photo multiplier tubes (PMT) for cryogenic temperatures which have a quartz window, it is converted to longer wavelength by coated reflector foils. The conversion efficiency and stability of several such coatings was optimized using VM2000 and Tetratex separately as reflector foils. The efficiency has been measured in a liquid Ar set up build especially for this purpose. It employs a 3'' low radioactivity PMT of type R11065-10 from Hamamatsu, the favorite photo sensor candidate to be used in Gerda.

  6. Large TileCal magnetic field simulation

    International Nuclear Information System (INIS)

    Nessi, M.; Bergsma, F.; Vorozhtsov, S.B.; Borisov, O.N.; Lomakina, O.V.; Karamysheva, G.A.; Budagov, Yu.A.

    1994-01-01

    The ATLAS magnetic field map has been estimated in the presence of the hadron tile calorimeter. This is an important issue in order to quantify the needs for individual PMT shielding, the effect on the scintillator light yield and its implications on the calibration. The field source is based on a central solenoid and 8 superconducting air-core toroidal coils. The maximum induction value in the scintillating tiles does not exceed 6 mT. When an iron plate is used to close the open drawer window the field inside the PMT near to the extended barrel edge does not exceed 0.6 mT. Estimation of ponder motive force distribution, acting on individual units of the system was performed. VF electromagnetic software OPERA-TOSCA and CERN POISCR code were used for the field simulation of the system. 10 refs., 4 figs

  7. The performance of a prototype array of water Cherenkov detectors for the LHAASO project

    Science.gov (United States)

    An, Q.; Bai, Y. X.; Bi, X. J.; Cao, Z.; Chang, J. F.; Chen, G.; Chen, M. J.; Chen, S. M.; Chen, S. Z.; Chen, T. L.; Chen, X.; Chen, Y. T.; Cui, S. W.; Dai, B. Z.; Du, Q.; Danzengluobu; Feng, C. F.; Feng, S. H.; Gao, B.; Gao, S. Q.; Ge, M. M.; Gu, M. H.; Hao, X. J.; He, H. H.; Hou, C.; Hu, H. B.; Hu, X. B.; Huang, J.; Huang, W. P.; Jia, H. Y.; Jiang, K.; Liu, J.; Liu, J. L.; Liu, J. S.; Liu, S. B.; Liu, Y.; Liu, Y. N.; Li, Q. J.; Li, C.; Li, F.; Li, H. C.; Li, X. R.; Lu, H.; Lv, H. K.; Mao, Y. J.; Ma, L. L.; Ma, X. H.; Shao, J.; Shao, M.; Sheng, X. D.; Sun, G. X.; Sun, Z. B.; Tang, Z. B.; Wu, C. Y.; Wu, H. R.; Wu, Q.; Xiao, G.; Xu, Y.; Yang, Q. Y.; Yang, R.; Yao, Z. G.; You, X. H.; Yuan, A. F.; Zhang, B. K.; Zhang, H. M.; Zhang, S. R.; Zhang, S. S.; Zhang, X. Y.; Zhang, Y.; Zhang, L.; Zhai, L. M.; Zhao, J.; Zhao, L.; Zhao, Z. G.; Zha, M.; Zhou, B.; Zhu, F. R.; Zhu, K. J.; Zhuang, J.; Zuo, X.

    2013-10-01

    A large high-altitude air-shower observatory (LHAASO) is to be built at Shangri-La, Yunnan Province, China. This observatory is intended to conduct sub-TeV gamma astronomy, and as an important component of the LHAASO project, a water Cherenkov detector array (WCDA) is proposed. To investigate engineering issues and fully understand the water Cherenkov technique for detecting air showers, a prototype array at 1% scale of the LHAASO-WCDA has been built at Yang-Ba-Jing, Tibet, China. This paper introduces the prototype array setup and studies its performance by counting rate of each photomultiplier tube (PMT), trigger rates at different PMT multiplicities, and responses to air showers. Finally, the reconstructed shower directions and angular resolutions of the detected showers for the prototype array are given.

  8. Measurement of the dynamic response of low-gain solid-state photodetector under weak pulse illumination

    CERN Document Server

    Clément, D; Morel, Christian

    2000-01-01

    This paper presents the development of a Tunable Light Pulse Generator built to measure the quantum efficiency of photodetectors under continuous or pulsed (20 ns FWHM) illumination as a function of wavelength in the Visible-UV region. For this purpose, a miniature Hamamatsu R5600U-04 PMT with low cathode resistivity can be used as reference detector. Dedicated electronics was developed in order to measure simultaneously the cathode and anode currents. This should allow to determine precisely the gain as a function of the high voltage applied to the PMT. Preliminary measurements using the TLPG do not demonstrate significant differences between the dynamic (approx 10 000 photons) and DC responses of PIN photodiodes down to 300 nm.

  9. The Immediate Effect of Neuromuscular Joint Facilitation (NJF) Treatment on Electromechanical Reaction Times of Hip Flexion.

    Science.gov (United States)

    Huo, Ming; Wang, Hongzhao; Ge, Meng; Huang, Qiuchen; Li, Desheng; Maruyama, Hitoshi

    2013-11-01

    [Purpose] The aim of this study was to investigate the change in electromechanical reaction times (EMG-RT) of hip flexion of younger persons after neuromuscular joint facilitation (NJF) treatment. [Subjects] The subjects were 39 healthy young people, who were divided into two groups: a NJF group and a proprioceptive neuromuscular facilitation (PNF) group. The NJF group consisted of 16 subjects (7 males, 9 females), and the PNF group consisted of 23 subjects (10 males, 13 females). [Methods] Participants in the NJF group received NJF treatment. We measured the EMG-RT, the premotor time (PMT) and the motor time (MT) during hip flexion movement before and after the intervention in both groups. [Results] There were no significant differences among the results of the PNF group. For the NJF group, there were significant differences in PMT and EMG-RT after NJF treatment. [Conclusion] These results suggest that there is an immediate effect of NJF intervention on electromechanical reaction times of hip flexion.

  10. Ground-based Fabry-Perot interferometry of the terrestrial nightglow with a bare charge-coupled device; Remote field site deployment

    International Nuclear Information System (INIS)

    Niciejewski, R.; Killeen, T.L.; Turnbull, M.

    1994-01-01

    The application of Fabry-Perot interferometers (FPIs) to the study of upper atmosphere thermodynamics has largely been restricted by the very low light levels in the terrestrial airglow as well as the limited range in wavelength of photomultiplier tube (PMT) technology. During the past decade, the development of the scientific grade charge-coupled device (CCD) has progressed to the stage in which the detector has become the logical replacement for the PMT. Small fast microcomputers have made it possible to ''upgrade'' the remote field sites which bare CCDs and not only retain the previous capabilities of the existing FPIs but expand the data coverage in both temporal and wavelength domains. The problems encountered and the solutions applied to the deployment of a bare CCD, with data acquisition and image reduction techniques, are discussed. Sample geophysical data determined from the FPI fringe profiles are shown for stations at Peach Mountain, Michigan, and Watson Lake, Yukon Territory

  11. A Cross-sectional Study for Determinations of Prevention Behaviors of Domestic Accidents in Mothers with Children Less than 5- year

    Directory of Open Access Journals (Sweden)

    Farbod Ebadi Fardazar

    2016-05-01

    Full Text Available Background: Accidents are the first cause of death in children under 5- year, especially in low- and middle-income countries. The aim of this study was to identify the determinants of prevention behavior of domestic accidents in mothers of children fewer than 5 years old based on protection motivation theory PMT(. Materials and Methods: In this cross-sectional descriptive-analytic study, 190 mothers were randomly selected. The data collection tool was researcher made questionnaire about prevention behaviors of home accidents in children less than five years based on the structures of protection motivation theory.then collected data entered in the software SPSS-22 and were analyzed using descriptive and analytical statistical tests. Results: Mean of perceived response efficacy was in good level and mean of other structures of PMT were in moderate level. There was a significant correlations between the scores of perceived vulnerability (r=.39, P

  12. Anatomic and functional outcomes of pharmacomechanical and catheter-directed thrombolysis of iliofemoral deep venous thrombosis.

    Science.gov (United States)

    Hager, Eric; Yuo, Theodore; Avgerinos, Efthymios; Naddaf, Abdullah; Jeyabalan, Geetha; Marone, Luke; Chaer, Rabih

    2014-07-01

    Pharmacomechanical thrombolysis (PMT) and catheter-directed thrombolysis (CDT) are commonly used for the treatment of iliofemoral deep venous thrombosis (DVT). The purpose of this study was to examine the short- and long-term venous patency and venous valvular function as well as clinical outcomes of patients treated for iliofemoral DVT by PMT and CDT. A retrospective review of all patients with symptomatic DVT treated between 2006 and 2011 with PMT or CDT was performed. All patients were treated by local tissue plasminogen activator delivered with PMT or CDT. Patients were divided into two groups on the basis of initial treatment modality: patients treated by PMT alone (group 1), and those who underwent PMT and CDT or CDT alone (group 2). Group comorbidities, initial presenting symptoms, and Clinical, Etiologic, Anatomic, and Pathologic (CEAP) classification scores were compared. Postprocedural duplex ultrasound was used to assess valve function and treated vein patency rates. At all visits, Villalta and CEAP scores were recorded and compared. Group demographic and procedural results were analyzed by Fisher exact test for dichotomous variables and Kruskal-Wallis equality-of-populations rank test for the ordinal and continuous data. Kaplan-Meier survival estimates were used to assess preserved valve function as well as primary and secondary patency rates. There were 79 patients with 102 limbs treated for extensive iliofemoral DVT (median age, 51.5 years; range, 16.6-83.8 years). There were 18 patients in group 1 and 61 patients in group 2 (PMT + CDT [n = 54] or CDT alone [n = 7]). There were no differences in demographics or comorbidities between groups aside from malignant disease, which was more common in group 1 (35.3% vs 11.5%; P = .03). A total of 102 limbs were analyzed, 24 in group 1 and 78 in group 2. Patients in group 1 had a shorter symptom duration compared with group 2 (7 days vs 16 days; P = .011). The median number of procedures in group 1

  13. Effects of an educational intervention based on the protection motivation theory and implementation intentions on first and second pap test practice in Iran.

    Science.gov (United States)

    Dehdari, Tahereh; Hassani, Laleh; Hajizadeh, Ebrahim; Shojaeizadeh, Davoud; Nedjat, Saharnaz; Abedini, Mehrandokht

    2014-01-01

    Few Iranian women take the Papanicolaou test despite its important role in preventing cervical cancer. This study aimed to determine the effectiveness of an educational intervention based on the protection motivation theory (PMT) variables and implementation intentions in the first and second Pap test practice among Iranian women. In this quasi-randomized controlled trial, 200 women who were referred to 30 primary health care clinics in Tehran were randomly selected. PMT variables and Pap test practice were measured at baseline and again after 3 and 15 months. The 4-week educational intervention program was conducted for the intervention group. Following the intervention, the mean scores of self-efficacy, perceived vulnerability, and behavior intention variables were significantly higher in the intervention group when compared to the control group (ptheory-based framework for developing educational interventions regarding Pap test practice in Iran.

  14. Using protection motivation theory and formative research to guide an injury prevention intervention: increasing adherence to the North American Guidelines for Children's Agricultural Tasks.

    Science.gov (United States)

    Ashida, Sato; Heaney, Catherine A; Kmet, Jennifer M; Wilkins, J R

    2011-05-01

    The North American Guidelines for Children's Agricultural Tasks (NAGCAT) were developed to reduce childhood agricultural injuries by assisting adults in assigning appropriate chores and providing needed supervision and training. To develop an effective intervention to increase adherence to NAGCAT among farm parents, formative research (focus groups and pilot-testing) was conducted. Protection motivation theory (PMT) was used to guide this research and inform intervention development. Focus group results suggested how PMT constructs might be addressed to increase adherence. A home visit intervention, using a standardized presentation in POWERPoint™, was developed to (a) introduce NAGCAT, (b) increase motivation to use NAGCAT and enhance safe work behaviors, and (c) ultimately reduce agricultural work-related injuries among youth. Process evaluation data suggests that the intervention was well received by farm parents. Conducting theory-guided formative research identified motivational barriers and strategies for overcoming these barriers that might not have been otherwise apparent.

  15. Monte Carlo calculations of the optical coupling between bismuth germanate crystals and photomultiplier tubes

    International Nuclear Information System (INIS)

    Derenzo, S.E.; Riles, J.K.

    1981-10-01

    The high density and atomic number of bismuth germanate (Bi 4 Ge 3 O 12 or BGO) make it a very useful detector for positron emission tomography. Modern tomograph designs use large numbers of small, closely-packed crystals for high spatial resolution and high sensitivity. However, the low light output, the high refractive index (n=2.15), and the need for accurate timing make it important to optimize the transfer of light to the photomultiplier tube (PMT). We describe the results of a Monte Carlo computer program developed to study the effect of crystal shape, reflector type, and the refractive index of the PMT window on coupling efficiency. The program simulates total internal, external, and Fresnel reflection as well as internal absorption and scattering by bubbles

  16. Quality Assurance on Undoped CsI Crystals for the Mu2e Experiment

    Science.gov (United States)

    Atanov, N.; Baranov, V.; Budagov, J.; Davydov, Yu. I.; Glagolev, V.; Tereshchenko, V.; Usubov, Z.; Cervelli, F.; Di Falco, S.; Donati, S.; Morescalchi, L.; Pedreschi, E.; Pezzullo, G.; Raffaelli, F.; Spinella, F.; Colao, F.; Cordelli, M.; Corradi, G.; Diociaiuti, E.; Donghia, R.; Giovannella, S.; Happacher, F.; Martini, M.; Miscetti, S.; Ricci, M.; Saputi, A.; Sarra, I.; Echenard, B.; Hitlin, D. G.; Hu, C.; Miyashita, T.; Porter, F.; Zhang, L.; Zhu, R.-Y.; Grancagnolo, F.; Tassielli, G.; Murat, P.

    2018-02-01

    The Mu2e experiment is constructing a calorimeter consisting of 1,348 undoped CsI crystals in two disks. Each crystal has a dimension of 34 x 34 x 200 mm, and is readout by a large area silicon PMT array. A series of technical specifications was defined according to physics requirements. Preproduction CsI crystals were procured from three firms: Amcrys, Saint-Gobain and Shanghai Institute of Ceramics. We report the quality assurance on crystal's scintillation properties and their radiation hardness against ionization dose and neutrons. With a fast decay time of 30 ns and a light output of more than 100 p.e./MeV measured with a bi-alkali PMT, undoped CsI crystals provide a cost-effective solution for the Mu2e experiment.

  17. The atmospheric nightglow in the 300-400 nm wavelength Results by the balloon-borne experiment 'BABY'

    International Nuclear Information System (INIS)

    Catalano, O.; Agnetta, G.; Biondo, B.; Celi, F.; Di Raffaele, R.; Giarrusso, S.; Linsley, J.; La Rosa, G.; Lo Bue, A.; Mangano, A.; Russo, F.

    2002-01-01

    The balloon-borne experiment, named BAckground BYpass (BABY) belongs to a wider program that has as its final goal the detection and study of high-energy cosmic rays from space (satellite, Space Station). An information of fundamental importance for this class of projects concerns the nighttime background light. The instrument designed to detect fluorescence photons is basically composed of two collimated photomultipliers: a single photon-counting PMT and a charge integration PMT. We briefly report the details of the design, operation and performance of the detector, which was designed and completely built at the IFCAI-CNR Institute in Palermo. Preliminary analysis and results of the nocturnal background in the range of 300-400 nm are presented for the whole duration of the flight during the 1998 Mediterranean balloon flight campaign. A substantial part of the flight was at night over the sea

  18. The atmospheric nightglow in the 300-400 nm wavelength Results by the balloon-borne experiment 'BABY'

    CERN Document Server

    Catalano, O; Biondo, B; Celi, F; Di Raffaele, R; Giarrusso, S; Linsley, J; Lo Bue, A; Mangano, A; Russo, F

    2002-01-01

    The balloon-borne experiment, named BAckground BYpass (BABY) belongs to a wider program that has as its final goal the detection and study of high-energy cosmic rays from space (satellite, Space Station). An information of fundamental importance for this class of projects concerns the nighttime background light. The instrument designed to detect fluorescence photons is basically composed of two collimated photomultipliers: a single photon-counting PMT and a charge integration PMT. We briefly report the details of the design, operation and performance of the detector, which was designed and completely built at the IFCAI-CNR Institute in Palermo. Preliminary analysis and results of the nocturnal background in the range of 300-400 nm are presented for the whole duration of the flight during the 1998 Mediterranean balloon flight campaign. A substantial part of the flight was at night over the sea.

  19. Performance of an electromagnetic calorimeter with lead-tungstate crystals

    International Nuclear Information System (INIS)

    Kohara, R.; Sugitate, T.; Sugita, N.; Tsuchimoto, Y.; Toyoda, D.; Homma, K.; Yamazaki, H.

    2003-01-01

    The performance of an electromagnetic calorimeter with lead-tungstate (PWO) crystals was tested by using 1 GeV photons. The calorimeter consisted of nine crystals of 20 x 20 x 200 mm in size arranged in a 3 x 3 array. The energy resolution was obtained to be σ E /E = (2.50 ± 0.75%) / √E + (1.25 ± 0.34%) with a photomultiplier tube (PMT) reading all signals. Another setup, reading the central cell with an avalanche photo diode (APD) and the surrounding 8 cells with the PMT, was also studied, however, its energy resolution was not scaled with the stochastic function and we found the resolution of about 10% around 1 GeV. (author)

  20. Effects of 60 MeV C5+ ion irradiation on PmT-PVC and p-TSA doped PoT-PVC blends

    International Nuclear Information System (INIS)

    Lakshmi, G.B.V.S.; Siddiqui, Azher M.; Ali, Vazid; Kulriya, Pawan K.; Zulfequar, M.

    2008-01-01

    Poly(m-toluidine) (PmT) and Poly(o-toluidine) (PoT) have been synthesized from derivatives of aniline (m-toluidine), (o-toluidine) monomers by chemical oxidative polymerization method. After polymerization, PoT powder was doped with p-toluene sulphonic acid (p-TSA) and the polymer powders were blended with poly vinyl chloride (PVC) to achieve PmT and p-TSA doped PoT dispersed films. XRD, FTIR and UV-visible studies were carried out to get their structural changes and optical information. These blends were irradiated by 60 MeV C 5+ ions with different fluences. Post Irradiation XRD, FTIR and UV-visible spectroscopy were also performed on all films. On p-TSA doped PoT-PVC blends dc-conductivity measurements are also carried out before and after irradiation. The results show structural modifications which lead to changes in optical and electrical properties

  1. Design of a cathodoluminescence image generator using a Raspberry Pi coupled to a scanning electron microscope

    Science.gov (United States)

    Benítez, Alfredo; Santiago, Ulises; Sanchez, John E.; Ponce, Arturo

    2018-01-01

    In this work, an innovative cathodoluminescence (CL) system is coupled to a scanning electron microscope and synchronized with a Raspberry Pi computer integrated with an innovative processing signal. The post-processing signal is based on a Python algorithm that correlates the CL and secondary electron (SE) images with a precise dwell time correction. For CL imaging, the emission signal is collected through an optical fiber and transduced to an electrical signal via a photomultiplier tube (PMT). CL Images are registered in a panchromatic mode and can be filtered using a monochromator connected between the optical fiber and the PMT to produce monochromatic CL images. The designed system has been employed to study ZnO samples prepared by electrical arc discharge and microwave methods. CL images are compared with SE images and chemical elemental mapping images to correlate the emission regions of the sample.

  2. First photoelectron timing error evaluation of a new scintillation detector model

    International Nuclear Information System (INIS)

    Petrick, N.; Clinthorne, N.H.; Rogers, W.L.; Hero, A.O. III

    1991-01-01

    In this paper, a general timing system model for a scintillation detector developed is experimentally evaluated. The detector consists of a scintillator and a photodetector such as a photomultiplier tube or an avalanche photodiode. The model uses a Poisson point process to characterize the light output from the scintillator. This timing model was used to simulate a BGO scintillator with a Burle 8575 PMT using first photoelectron timing detection. Evaluation of the model consisted of comparing the RMS error from the simulations with the error from the actual detector system. The authors find that the general model compares well with the actual error results for the BGO/8575 PMT detector. In addition, the optimal threshold is found to be dependent upon the energy of the scintillation. In the low energy part of the spectrum, the authors find a low threshold is optimal while for higher energy pulses the optimal threshold increases

  3. First photoelectron timing error evaluation of a new scintillation detector model

    International Nuclear Information System (INIS)

    Petrick, N.; Clinthorne, N.H.; Rogers, W.L.; Hero, A.O. III

    1990-01-01

    In this paper, a general timing system model for a scintillation detector that was developed, is experimentally evaluated. The detector consists of a scintillator and a photodetector such as a photomultiplier tube or an avalanche photodiode. The model uses a Poisson point process to characterize the light output from the scintillator. This timing model was used to simulated a BGO scintillator with a Burle 8575 PMT using first photoelectron timing detection. Evaluation of the model consisted of comparing the RMS error from the simulations with the error from the actual detector system. We find that the general model compares well with the actual error results for the BGO/8575 PMT detector. In addition, the optimal threshold is found to be dependent upon the energy of the scintillation. In the low energy part of the spectrum, we find a low threshold is optimal while for higher energy pulses the optimal threshold increases

  4. Spectroscopic measurement of ion temperature and ion velocity distributions in the flux-coil generated FRC

    International Nuclear Information System (INIS)

    Gupta, D.; Gota, H.; Hayashi, R.; Kiyashko, V.; Morehouse, M.; Primavera, S.; Bolte, N.; Marsili, P.; Roche, T.; Wessel, F.

    2010-01-01

    One aim of the flux-coil generated field reversed configuration at Tri Alpha Energy (TAE) is to establish the plasma where the ion rotational energy is greater than the ion thermal energy. To verify this, an optical diagnostic was developed to simultaneously measure the Doppler velocity-shift and line-broadening using a 0.75 m, 1800 groves/mm, spectrometer. The output spectrum is magnified and imaged onto a 16-channel photomultiplier tube (PMT) array. The individual PMT outputs are coupled to high-gain, high-frequency, transimpedance amplifiers, providing fast-time response. The Doppler spectroscopy measurements, along with a survey spectrometer and photodiode-light detector, form a suite of diagnostics that provide insights into the time evolution of the plasma-ion distribution and current when accelerated by an azimuthal-electric field.

  5. A single photon sensor employing wavelength-shifting and light-guiding technology

    Energy Technology Data Exchange (ETDEWEB)

    Schulte, Lukas; Voge, Markus; Boeser, Sebastian; Kowalski, Marek [Physikalisches Institut, Universitaet Bonn (Germany)

    2013-07-01

    In this work we describe a feasibility study of a novel type of single photon sensor that employs organic wavelength shifting materials (WLS) to capture photons and guide them to a PMT readout. Two different WLS materials, Saint Gobain BC-480 and BC-482A, have been tested as candidates for use in such a sensor. We address the photon detection efficiency, noise properties, time and spatial resolution, PMT readout, as well as some practical aspects relevant for the development and construction of a prototype sensor. Calculating the overall photon detection efficiency, we show that the effective photosensitive area of a prototype built with existing technology could easily exceed that of modules currently used e. g. in IceCube while having a dark noise rate up to two orders of magnitude smaller.

  6. A high speed digitizing photomultiplier tube base for the KTeV CsI calorimeter

    International Nuclear Information System (INIS)

    Whitmore, J.

    1994-11-01

    A circuit has been designed to digitize PMT signals over an 18-bit dynamic range with 8-bits of resolution. The crucial element of the circuit is the custom charge integrating and encoding (QIE) ASIC. This chip is designed to operate at rates up to 53 MHz, and, in conjunction with an 8-bit FADC, generates 12-bit floating point output. Bench tests of a 17-bit version of the digital base demonstrated excellent noise performance, linearity and pedestal and gain stability. Twenty-five channels of digitizing PMT bases have been built and used for readout of a CsI array in a test beam at CERN. Performance of these devices in a beam environment is discussed

  7. The electronics system for the LBNL positron emission mammography (PEM) camera

    CERN Document Server

    Moses, W W; Baker, K; Jones, W; Lenox, M; Ho, M H; Weng, M

    2001-01-01

    Describes the electronics for a high-performance positron emission mammography (PEM) camera. It is based on the electronics for a human brain positron emission tomography (PET) camera (the Siemens/CTI HRRT), modified to use a detector module that incorporates a photodiode (PD) array. An application-specified integrated circuit (ASIC) services the photodetector (PD) array, amplifying its signal and identifying the crystal of interaction. Another ASIC services the photomultiplier tube (PMT), measuring its output and providing a timing signal. Field-programmable gate arrays (FPGAs) and lookup RAMs are used to apply crystal-by-crystal correction factors and measure the energy deposit and the interaction depth (based on the PD/PMT ratio). Additional FPGAs provide event multiplexing, derandomization, coincidence detection, and real-time rebinning. Embedded PC/104 microprocessors provide communication, real-time control, and configure the system. Extensive use of FPGAs make the overall design extremely flexible, all...

  8. Characterization of the Hamamatsu 8" R5912-MOD Photomultiplier tube

    Science.gov (United States)

    Kaptanoglu, Tanner

    2018-05-01

    Current and future neutrino and direct detection dark matter experiments hope to take advantage of improving technologies in photon detection. Many of these detectors are large, monolithic optical detectors that use relatively low-cost, large-area, and efficient photomultiplier tubes (PMTs). A candidate PMT for future experiments is a newly developed prototype Hamamatsu PMT, the R5912-MOD. In this paper we describe measurements made of the single photoelectron time and charge response of the R5912-MOD, as well as detail some direct comparisons to similar PMTs. Most of these measurements were performed on three R5912-MOD PMTs operating at gains close to 1 × 107. The transit time spread (σ) and the charge peak-to-valley were measured to be on average 680ps and 4.2 respectively. The results of this paper show the R5912-MOD is an excellent candidate for future experiments in several regards, particularly due to its narrow spread in timing.

  9. Silicon surface barrier detector and study of energy spectrum of alpha particles from radioactive source

    International Nuclear Information System (INIS)

    Verma, S.D.; Sinha, Vijaya

    1986-01-01

    The principles of working of three commonly used radiation detectors, namely ionization chambers, scintillation counters with photomultiplier tube (PMT) systems and semiconductor detectors are briefly discussed. Out of the semiconductor detectors, the silicon surface barrier (SSB) detector has distinct advantages for detection of radiations, alpha particles in particular. The experimental setup to obtain the energy spectrum of alpha particles from 241 Am source using SSB fabricated in the Physics Department of Gujarat University, Ahmedabad is described. Its performance is compared with scintillation counter using PMT. SSB detector shows a sharp peak of #approx # 3 per cent energy resolution. The factors affecting the peak, namely, electronic noise, source dependent factors and detector-dependent factors are discussed. A method of calibrating SSB detectors based on energy loss mechanism of alpha particles in thin absorbers is described. Applications of such detectors are indicated. (M.G.B.)

  10. Hostility and hearing protection behavior: the mediating role of personal beliefs and low frustration tolerance.

    Science.gov (United States)

    Rabinowitz, S; Melamed, S; Feiner, M; Weisberg, E; Ribak, J

    1996-10-01

    The authors examined whether hostility would negatively be associated with occupational health behavior, namely, the use of hearing protection devices (HPDs). Also examined as possible mediators were the protection motivation theory (PMT) components and low frustration tolerance (LFT). Participants were 226 male industrial workers, all exposed to potentially hearing-damaging noise. Hostility was negatively related to HPD use. It moderately correlated with the PMT components: negatively with perceived susceptibility, severity, effectiveness, and self-efficacy and positively with perceived barriers. Hostility correlated highly with LFT. Regression analyses confirmed the mediating role of perceived barriers, low self-efficacy, and LFT in the negative relationship between hostility and the use of HPDs. Thus, intrapsychic characteristics of hostile people may be significant for hearing protection behavior.

  11. The CMS Hadron Forward Calorimeter Upgrade during Phase I

    CERN Document Server

    Gulmez, Erhan

    2014-01-01

    The CMS Hadron Forward Calorimeter will be upgraded during phase 1. The upgrade will include the replacement of the current PMTs with the 4-anode ones and the readout electronics. Currently, stray muons hitting the PMT windows produce Cherenkov light causing erroneous signals. These signals are detrimental to the triggering and physic results, since such signals mimic very high energy events. The new 4-anode PMTs are selected because of their thin windows to reduce the Cherenkov light production. Additional anodes also provide information to eliminate such signals. These new PMTs have been tested extensively to understand their characteristics and to develop the algorithms to eliminate the unwanted signals. Eventually, the current read out will be replaced with two-channel readout electronics for each PMT. The overall expected improvement on the physics results will also be discussed.

  12. Timing characteristics of Ce doped Gd{sub 3}Ga{sub 3}Al{sub 2}O{sub 12} single crystals in comparison with CsI(Tl) scintillators

    Energy Technology Data Exchange (ETDEWEB)

    Tyagi, M.; Singh, A.K.; Singh, S.G.; Sen, S.; Gadkari, S.C. [Technical Physics Division, Bhabha Atomic Research Centre, Mumbai, 400085 (India); Desai, V.V.; Nayak, B.K. [Nuclear Physics Division, Bhabha Atomic Research Centre, Mumbai, 400085 (India)

    2015-10-15

    Single crystals of Gd{sub 3}Ga{sub 3}Al{sub 2}O{sub 12}:Ce with B codopants were successfully grown using the Czochralski technique. The timing characteristics of the crystal was measured by coupling the crystal to photomultiplier tubes (PMT) or silicon photodiodes [Si(PIN)]. The two prompt γ-rays emitted in a cascade from {sup 60}Co or {sup 22}Na source were detected in coincidence using Gd{sub 3}Ga{sub 3}Al{sub 2}O{sub 12}:Ce,B crystal detectors and a BaF{sub 2} detector. The time resolution of these crystals are observed to be better than that measured for CsI:Tl crystal coupled to PMT or Si(PIN) in an identical measurement setup. (copyright 2015 WILEY-VCH Verlag GmbH and Co. KGaA, Weinheim)

  13. Development and evaluation of a Gamma Camera tuning system

    International Nuclear Information System (INIS)

    Arista Romeu, E. J.; Diaz Garcia, A.; Osorio Deliz, J. F.

    2015-01-01

    Correct operation of conventional analogue Gamma Cameras implies a good conformation of the position signals that correspond to a specific photo-peak of the radionuclide of interest. In order to achieve this goal the energy spectrum from each photo multiplier tube (PMT) has to be set within the same energy window. For this reason a reliable tuning system is an important part of all gamma cameras processing systems. In this work is being tested and evaluated a new prototype of tuning card that was developed and setting up for this purpose. The hardware and software of the circuit allow the regulation if each PMT high voltage. By this means a proper gain control for each of them is accomplished. The Tuning Card prototype was simulated in a virtual model and its satisfactory operation was proven in a Siemens Orbiter Gamma Camera. (Author)

  14. Adaptive algorithms of position and energy reconstruction in Anger-camera type detectors: experimental data processing in ANTS

    Energy Technology Data Exchange (ETDEWEB)

    Morozov, A; Fraga, F A F; Fraga, M M F R; Margato, L M S; Pereira, L [LIP-Coimbra and Departamento de Física, Universidade de Coimbra, Rua Larga, Coimbra (Portugal); Defendi, I; Jurkovic, M [Forschungs-Neutronenquelle Heinz Maier-Leibnitz (FRM II), TUM, Lichtenbergstr. 1, Garching (Germany); Engels, R; Kemmerling, G [Zentralinstitut für Elektronik, Forschungszentrum Jülich GmbH, Wilhelm-Johnen-Straße, Jülich (Germany); Gongadze, A; Guerard, B; Manzin, G; Niko, H; Peyaud, A; Piscitelli, F [Institut Laue Langevin, 6 Rue Jules Horowitz, Grenoble (France); Petrillo, C; Sacchetti, F [Istituto Nazionale per la Fisica della Materia, Unità di Perugia, Via A. Pascoli, Perugia (Italy); Raspino, D; Rhodes, N J; Schooneveld, E M, E-mail: andrei@coimbra.lip.pt [Science and Technology Facilities Council, Rutherford Appleton Laboratory, Harwell Oxford, Didcot (United Kingdom); others, and

    2013-05-01

    The software package ANTS (Anger-camera type Neutron detector: Toolkit for Simulations), developed for simulation of Anger-type gaseous detectors for thermal neutron imaging was extended to include a module for experimental data processing. Data recorded with a sensor array containing up to 100 photomultiplier tubes (PMT) or silicon photomultipliers (SiPM) in a custom configuration can be loaded and the positions and energies of the events can be reconstructed using the Center-of-Gravity, Maximum Likelihood or Least Squares algorithm. A particular strength of the new module is the ability to reconstruct the light response functions and relative gains of the photomultipliers from flood field illumination data using adaptive algorithms. The performance of the module is demonstrated with simulated data generated in ANTS and experimental data recorded with a 19 PMT neutron detector. The package executables are publicly available at http://coimbra.lip.pt/∼andrei/.

  15. Development of gaseous photomultiplier

    International Nuclear Information System (INIS)

    Tokanai, F.; Sumiyoshi, T.; Sugiyama, H.; Okada, T.

    2014-01-01

    We have been developing gaseous photomultiplier tubes (PMTs) with alkali photocathode combined with micropattern gas detectors (MPGDs). The potential advantage of the gaseous PMT is that it can achieve a very large effective area with adequate position and timing resolutions. In addition, it will be easily operated under a very high magnetic field, compared with the conventional vacuum-based PMT. To evaluate the gaseous PMTs filled with Ne and Ar based gas mixture, we have developed gaseous PMTs with an alkali photocathode combined with MPGDs such as a glass capillary plate, GEM, and Micromegas detector. We describe the recent development of the gaseous PMTs, particularly the production of the photocathode, gas gain, ion and photon feedbacks, quantum efficiency, and the characteristics in the magnetic field environment. (author)

  16. Percutaneous Mechanical Thrombectomy Treatment of Acute Superior Mesenteric Artery Embolism

    Directory of Open Access Journals (Sweden)

    Z. Zhang

    Full Text Available : Objective/Background: This report presents a superior mesenteric artery (SMA embolism managed by percutaneous mechanical thrombectomy (PMT. Methods: A 61 year old woman diagnosed with SMA embolism was admitted. Emboli were found in the middle and distal segments of the SMA on abdominal computed tomography angiography. Under local anaesthesia, a 6 F Rotarex system was used to remove the emboli via left brachial artery access. Emboli were successfully removed and patency was restored to the SMA and its branches. Results: Post-operatively, the patient's symptoms were significantly relieved. No post-operative complications were observed and no discomfort was documented during follow-up. Conclusion: Endovascular treatment of SMA embolism using PMT is a feasible and alternative option. Keywords: Acute mesenteric ischaemia, Embolism, Endovascular treatment, Percutaneous mechanical thrombectomy, Superior mesenteric artery

  17. Automatic semi-quantification of [(123)I]FP-CIT SPECT scans in healthy volunteers using BasGan version 2

    DEFF Research Database (Denmark)

    Nobili, Flavio; Naseri, Mehrdad; De Carli, Fabrizio

    2013-01-01

    with partial volume effect correction. Multicentre camera inhomogeneity was taken into account by calibrating values on basal ganglia phantom data. SBR in each caudate nucleus (C) and putamen (P) were the dependent variables in a repeated measures general linear model analysis; age, gender, handedness and body...... Medicine). Brain single photon emission computed tomography (SPECT) was acquired by means of dual-head cameras 3 h after [(123)I]FP-CIT administration. Specific to nondisplaceable binding ratios (SBRs) in the basal ganglia were computed using the 'BasGan' software, allowing automatic value extraction...... mass index (BMI) were the independent variables. RESULTS: SBR values in C and P were significantly associated with age (mean rate decrease with age: 0.0306 per year, or 0.57 % of the general mean; p ...

  18. Gamma camera performance: technical assessment protocol

    International Nuclear Information System (INIS)

    Bolster, A.A.; Waddington, W.A.

    1996-01-01

    This protocol addresses the performance assessment of single and dual headed gamma cameras. No attempt is made to assess the performance of any associated computing systems. Evaluations are usually performed on a gamma camera commercially available within the United Kingdom and recently installed at a clinical site. In consultation with the manufacturer, GCAT selects the site and liaises with local staff to arrange a mutually convenient time for assessment. The manufacturer is encouraged to have a representative present during the evaluation. Three to four days are typically required for the evaluation team to perform the necessary measurements. When access time is limited, the team will modify the protocol to test the camera as thoroughly as possible. Data are acquired on the camera's computer system and are subsequently transferred to the independent GCAT computer system for analysis. This transfer from site computer to the independent system is effected via a hardware interface and Interfile data transfer. (author)

  19. Production, quality control and initial imaging studies of [82mRb]RbCl for PET studies

    International Nuclear Information System (INIS)

    Rowshanfarzad, P.; Jalilian, A.R.; Kiyomarsi, M.; Sabet, M.; Karimian, A.R.; Moradkhani, S.; Mirzaii, M.

    2006-01-01

    Rubidium-82m was prepared via 15.4 MeV proton irradiation of a krypton-82 gaseous target (30% enrichment). Washing the target chamber with hot water yielded a Rb-82m containing solution, which was further purified using short column chromatography in order to remove organic/inorganic impurities. The flowthrough was formulated in normal saline for injection. Radionuclide, radiochemical and chemical purity tests were performed prior to administration to rats for imaging (radiochemical yield: 95-97%, radiochemical purity > 97%). Preliminary dual-head coincidence studies were performed to determine the distribution of [ 82m Rb]Rb in normal rats. For biodistribution studies, Rb-81 was injected to rats and tracer accumulation in heart, GI and bladder was determined after sacrification in time intervals. A yield of 1.3 GBq at EOB, 235.7 MBq/μAh was obtained. (authors)

  20. Qualitative evaluation of Chang method of attenuation correction on heart SPECT by using custom made heart phantom

    International Nuclear Information System (INIS)

    Takavar, A.; Eftekhari, M.; Beiki, D.; Saghari, M.; Mostaghim, N.; Sohrabi, M.

    2003-01-01

    SPECT detects γ- rays from administrated radiopharmaceutical within the patient body. γ-rays pass through different tissues before reaching detectors and are attenuated. Attenuation can cause artifacts; therefore different and used to minimize attenuation effects. In our study efficacy of Chang method was evaluated for attenuation purpose, using a custom made heart phantom. Due to different tissues surrounding heart, evaluation is not uniform more over activity distribution around heart is also non- uniform. In Chang method distribution of radioactivity and attenuation due to the surrounding tissue is considered uniform. Our phantom is a piece of plastic producing similar SPECT image as left ventricle. A dual head, ADAC system was used in our study. Images were taken by 180 d ig C (limited angle) and 360 d ig C (total rotation). Images are compared with and without attenuation correction. Our results indicate that Chang attenuation correction method is not capable of eliminating attenuation artifact completely in particular attenuation effects caused by breast

  1. Portable wireless power transmission system for video capsule endoscopy.

    Science.gov (United States)

    Zhiwei, Jia; Guozheng, Yan; Bingquan, Zhu

    2014-10-01

    Wireless power transmission is considered a practical way of overcoming the power shortage of wireless capsule endoscopy (VCE). However, most patients cannot tolerate the long hours of lying in a fixed transmitting coil during diagnosis. To develop a portable wireless power transmission system for VCE, a compact transmitting coil and a portable inverter circuit driven by rechargeable batteries are proposed. The couple coils, optimized considering the stability and safety conditions, are 28 turns of transmitting coil and six strands of receiving coil. The driven circuit is designed according to the portable principle. Experiments show that the integrated system could continuously supply power to a dual-head VCE for more than 8 h at a frame rate of 30 frames per second with resolution of 320 × 240. The portable VCE exhibits potential for clinical applications, but requires further improvement and tests.

  2. Alternative positron emission tomography with non-conventional positron emitters: effects of their physical properties on image quality and potential clinical applications

    International Nuclear Information System (INIS)

    Pagani, M.; Stone-Elander, S.; Larsson, S.A.

    1997-01-01

    The increasing amount of clinically relevant information obtained by positron emission tomography (PET), primarily with fluorine-18 labelled 2-deoxy-2-fluoro-d-glucose, has generated a demand for new routes for the widespread and cost-efficient use of positron-emitting radiopharmaceuticals. New dual-head single-photon emission tomography (SPET) cameras are being developed which offer coincidence detection with camera heads lacking a collimator or SPET imaging with specially designed collimators and additional photon shielding. Thus, not only satellite PET imaging units but also nuclear medicine units investing in these new SPET/PET systems need to examine all available alternatives for rational radionuclide supplies from host cyclotrons. This article examines 25 ''alternative'' positron-emitting radionuclides, discusses the impact of their decay properties on image quality and reviews methods for their production as well as for their application in imaging techniques. (orig.)

  3. Striatal uptake of I-123-β-CIT and I-123-IBZM in patients with extrapyramidal symptoms

    International Nuclear Information System (INIS)

    Bettin, S.; Kaempfer, I.; Seese, A.; Schaefer, A.; Reuter, M.; Loessner, J.; Dietrich, J.; Wagner, A.; Knapp, W.H.

    1997-01-01

    Aim: This pilot study deals with the question whether characteristic changes in local cerebral dopamine transporter function and D 2 -receptor binding capacity can be shown with SPET, in idiopathic Parkinson syndrome (IPS) and secondary Parkinson syndrome (SPS). Methods: In 16 patients (6 with IPS, 6 with SPS except Wilsons's disease, and 4 with Wilson's disease) SPET studies were performed using I-123-β-CIT and I-123-IBZM and a dual-head gamma camera. Images were obtained 20-24 h and 2 h post injection, respectively. For semiquantitative analysis count density ratios of basal ganglia (BG) and cerebellum (CER) were determined for I-123-β-CIT and ratios between BG and medial frontal cortex (MFC) for I-123-IBZM. Results: The BG/CER ratio in the I-123-β-CIT studies averaged 3.04±0.83 in IPS and 7.73±3.28 in SPS (p [de

  4. Advantage of fan beam collimators for contrast recovery of hyperfixation in clinical SPECT

    International Nuclear Information System (INIS)

    Vera, P.

    1997-01-01

    The influence of the collimator on the contrast recovery of hyperfixation was studied using a dual-headed single photon emission computer tomography (SPECT) system with standard clinical acquisition parameters. Three parallel collimator sets and two fan beam collimator sets were tested with a Jaszczak phantom. The six spheres of the phantom were filled with 99m Tc, and four background levels were progressively obtained by adding radioactivity to the cylinder of the phantom, providing four hyperfixation levels. The effects of angular sampling and reconstruction filters have been tested. The statistical analysis was performed with analysis of variance (ANOVA). This study demonstrates the advantage of ultra-high resolution fan beam collimators for contrast recovery of hyperfixation with SPECT when using 64 projections over 360 degree, in particular when the contrast is low. The authors also demonstrate that fan beam collimators permit smaller size hyperfixation detection

  5. Comparison of SPET brain perfusion and 18F-FDG brain metabolism in patients with chronic fatigue syndrome.

    Science.gov (United States)

    Abu-Judeh, H H; Levine, S; Kumar, M; el-Zeftawy, H; Naddaf, S; Lou, J Q; Abdel-Dayem, H M

    1998-11-01

    Chronic fatigue syndrome is a clinically defined condition of uncertain aetiology. We compared 99Tcm-HMPAO single photon emission tomography (SPET) brain perfusion with dual-head 18F-FDG brain metabolism in patients with chronic fatigue syndrome. Eighteen patients (14 females, 4 males), who fulfilled the diagnostic criteria of the Centers for Disease Control for chronic fatigue syndrome, were investigated. Thirteen patients had abnormal SPET brain perfusion scans and five had normal scans. Fifteen patients had normal glucose brain metabolism scans and three had abnormal scans. We conclude that, in chronic fatigue syndrome patients, there is discordance between SPET brain perfusion and 18F-FDG brain uptake. It is possible to have brain perfusion abnormalities without corresponding changes in glucose uptake.

  6. Automatic welding and cladding in heavy fabrication

    International Nuclear Information System (INIS)

    Altamer, A. de

    1980-01-01

    A description is given of the automatic welding processes used by an Italian fabricator of pressure vessels for petrochemical and nuclear plant. The automatic submerged arc welding, submerged arc strip cladding, pulsed TIG, hot wire TIG and MIG welding processes have proved satisfactory in terms of process reliability, metal deposition rate, and cost effectiveness for low alloy and carbon steels. An example shows sequences required during automatic butt welding, including heat treatments. Factors which govern satisfactory automatic welding include automatic anti-drift rotator device, electrode guidance and bead programming system, the capability of single and dual head operation, flux recovery and slag removal systems, operator environment and controls, maintaining continuity of welding and automatic reverse side grinding. Automatic welding is used for: joining vessel sections; joining tubes to tubeplate; cladding of vessel rings and tubes, dished ends and extruded nozzles; nozzle to shell and butt welds, including narrow gap welding. (author)

  7. Multi-pinhole collimator design for small-object imaging with SiliSPECT: a high-resolution SPECT

    International Nuclear Information System (INIS)

    Shokouhi, S; Peterson, T E; Metzler, S D; Wilson, D W

    2009-01-01

    We have designed a multi-pinhole collimator for a dual-headed, stationary SPECT system that incorporates high-resolution silicon double-sided strip detectors. The compact camera design of our system enables imaging at source-collimator distances between 20 and 30 mm. Our analytical calculations show that using knife-edge pinholes with small-opening angles or cylindrically shaped pinholes in a focused, multi-pinhole configuration in combination with this camera geometry can generate narrow sensitivity profiles across the field of view that can be useful for imaging small objects at high sensitivity and resolution. The current prototype system uses two collimators each containing 127 cylindrically shaped pinholes that are focused toward a target volume. Our goal is imaging objects such as a mouse brain, which could find potential applications in molecular imaging.

  8. Gamma camera performance: technical assessment protocol

    Energy Technology Data Exchange (ETDEWEB)

    Bolster, A.A. [West Glasgow Hospitals NHS Trust, London (United Kingdom). Dept. of Clinical Physics; Waddington, W.A. [University College London Hospitals NHS Trust, London (United Kingdom). Inst. of Nuclear Medicine

    1996-12-31

    This protocol addresses the performance assessment of single and dual headed gamma cameras. No attempt is made to assess the performance of any associated computing systems. Evaluations are usually performed on a gamma camera commercially available within the United Kingdom and recently installed at a clinical site. In consultation with the manufacturer, GCAT selects the site and liaises with local staff to arrange a mutually convenient time for assessment. The manufacturer is encouraged to have a representative present during the evaluation. Three to four days are typically required for the evaluation team to perform the necessary measurements. When access time is limited, the team will modify the protocol to test the camera as thoroughly as possible. Data are acquired on the camera`s computer system and are subsequently transferred to the independent GCAT computer system for analysis. This transfer from site computer to the independent system is effected via a hardware interface and Interfile data transfer. (author).

  9. Breast Imaging Utilizing Dedicated Gamma Camera and (99m)Tc-MIBI: Experience at the Tel Aviv Medical Center and Review of the Literature Breast Imaging.

    Science.gov (United States)

    Even-Sapir, Einat; Golan, Orit; Menes, Tehillah; Weinstein, Yuliana; Lerman, Hedva

    2016-07-01

    The scope of the current article is the clinical role of gamma cameras dedicated for breast imaging and (99m)Tc-MIBI tumor-seeking tracer, as both a screening modality among a healthy population and as a diagnostic modality in patients with breast cancer. Such cameras are now commercially available. The technology utilizing a camera composed of a NaI (Tl) detector is termed breast-specific gamma imaging. The technology of dual-headed camera composed of semiconductor cadmium zinc telluride detectors that directly converts gamma-ray energy into electronic signals is termed molecular breast imaging. Molecular breast imaging system has been installed at the Department of Nuclear medicine at the Tel Aviv Sourasky Medical Center, Tel Aviv in 2009. The article reviews the literature well as our own experience. Copyright © 2016 Elsevier Inc. All rights reserved.

  10. An Experimental Comparison of Two Different Methods in Astronomy Teaching

    OpenAIRE

    TÜRK, Cumhur; KALKAN, Hüseyin

    2017-01-01

    In this study, the efficiency of teaching with virtual reality programs (VRT) and teaching with physicalmodels (PMT), which are widely used in astronomy teaching, have been compared experimentally.The study has a quasi-experimental design and it was conducted with 106pre-service science teachers studying in the educational faculty of OndokuzMayıs University. The groups were determined by using simple random samplingmethod. As data collection tool Astronomy Achievement Test (AAT) was used. Ino...

  11. Protection motivation theory in predicting intention to engage in protective behaviors against schistosomiasis among middle school students in rural China.

    Science.gov (United States)

    Xiao, Han; Li, Shiyue; Chen, Xinguang; Yu, Bin; Gao, Mengting; Yan, Hong; Okafor, Chukwuemeka N

    2014-10-01

    Among millions of people who suffer from schistosomiasis in China, adolescents are at increased risk to be infected. However, there is a lack of theory-guided behavioral prevention intervention programs to protect these adolescents. This study attempted to apply the Protection Motivation Theory (PMT) in predicting intentions to engage in protective behaviors against schistosomiasis infection. The participants were selected using the stratified cluster sampling method. Survey data were collected using anonymous self-reported questionnaire. The advanced structural equation modeling (SEM) method was utilized to assess the complex relationship among schistosomiasis knowledge, previous risk exposure and protective measures in predicting intentions to engage in protective behavior through the PMT constructs. Approximately 70% of participants reported they were always aware of schistosomiasis before exposure to water with endemic schistosomiasis, 6% of the participants reported frequency of weekly or monthly prior exposure to snail-conditioned water. 74% of participants reported having always engaged in protective behaviors in the past three months. Approximately 7% were unlikely or very unlikely to avoid contact with snail-conditioned water, and to use protective behaviors before exposure. Results from SEM analysis indicated that both schistosomiasis knowledge and prior exposure to schistosomiasis were indirectly related to behavior intentions through intrinsic rewards and self-efficacy; prior protective behaviors were indirectly related to behavior intentions through severity, intrinsic rewards and self-efficacy, while awareness had an indirect relationship with behavior intentions through self-efficacy. Among the seven PMT constructs, severity, intrinsic rewards and self-efficacy were significantly associated with behavior intentions. The PMT can be used to predict the intention to engage in protective behaviors against schistosomiasis. Schistosomiasis intervention

  12. An Evaluation of Performance-Based Tests Designed to Improve Naval Aviation Selection.

    Science.gov (United States)

    1991-08-01

    Qualification Test AQT/FAR 8z Flight Aptitude Rating 3 Complex Visual CVT Information Processing 3 Risk RISK 3 Absolute Difference ADHT & Horizontal...01329* .01852 1077 6 CVT .03752* .05064 557 3 ADHT .03432* .03289 499 8 RISK .03369* .05028 337 2 MB .01814 .02479 544 5 PMT/DLT .00987 .01037 641 7 *p...to differences in age, sex, accession source, college major, prior flight hours, or intelligence. From Table 2 we see that the CVT, ADHT , and the RISK

  13. Top Performing PMs: How DAU Develops Them

    Science.gov (United States)

    2015-12-01

    online, while intermediate courses feature a combination of online prerequisites followed by classroom training. Advanced PM courses use teams of...hours of online instruction and 27.5 classroom days. For major acquisition PMs, 70 additional classroom days of specialized training (PMT 401 and...training and experience is that creative , informed thought is necessary to optimize the structure of a program. DAU embeds principles of critical

  14. Estimating the ROI on Implementation of RFID at the Ammunition Storage Warehouse and the 40th Supply Depot: KVA as a Methodology

    Science.gov (United States)

    2009-12-01

    Balanced Scorecard CAPM Capital Asset Pricing Model DIS Defense Information System DoD Department of...Measurement Tool (PMT) is the Balanced Scorecard (BSC) based on critical success factors and key performance indicators. The MND has referred to Jung’s...authors can replicate the methodology for multiple projects to generate a portfolio of projects. Similar to the Capital Asset Pricing Model ( CAPM ) or

  15. Study of influence with fourier transform on long cable in measurement of fall time of DPF neutron profile

    International Nuclear Information System (INIS)

    Guo Hongsheng; Li Rurong; Tang Dengpan; Yang Gaozhao; Hu Qingyuan; Si Fenni; Zhang Jianhua; Peng Taiping

    2011-01-01

    The influence of the Fourier Transform on long cable in the measurement of fall time of DPF neutron profile is discussed by mathematical methods. The application of anti-convolution function with the Fourier Transform on long cable is analysed. The time interval between the peak time and the time that the height falls 3 orders of magnitude after peak is measured with gated-detector array system which consists of PMT (photomultiplier tube) and organic scintillation crystal. (authors)

  16. Protection motivation theory and cigarette smoking among vocational high school students in China: a cusp catastrophe modeling analysis.

    Science.gov (United States)

    Xu, Yunan; Chen, Xinguang

    2016-01-01

    Tobacco use is one of the greatest public health problems worldwide and the hazards of cigarette smoking to public health call for better recognition of cigarette smoking behaviors to guide evidence-based policy. Protection motivation theory (PMT) provides a conceptual framework to investigate tobacco use. Evidence from diverse sources implies that the dynamics of smoking behavior may be quantum in nature, consisting of an intuition and an analytical process, challenging the traditional linear continuous analytical approach. In this study, we used cusp catastrophe, a nonlinear analytical approach to test the dual-process hypothesis of cigarette smoking. Data were collected from a random sample of vocational high school students in China ( n = 528). The multivariate stochastic cusp modeling was used and executed with the Cusp Package in R. The PMT-based Threat Appraisal and Coping Appraisal were used as the two control variables and the frequency of cigarette smoking (daily, weekly, occasional, and never) in the past month was used as the outcome variable. Consistent with PMT, the Threat Appraisal (asymmetry, α 1 = 0.1987, p < 0.001) and Coping Appraisal (bifurcation, β 2 = 0.1760, p < 0.05) significantly predicted the smoking behavior after controlling for covariates. Furthermore, the cusp model performed better than the alternative linear and logistic regression models with regard to higher R 2 (0.82 for cusp, but 0.21 for linear and 0.25 for logistic) and smaller AIC and BIC. Study findings support the conclusion that cigarette smoking in adolescents is a quantum process and PMT is relevant to guide studies to understand smoking behavior for smoking prevention and cessation.

  17. Determination of preventive behaviors for pandemic influenza A/H1N1 based on protection motivation theory among female high school students in Isfahan, Iran

    OpenAIRE

    Sharifirad, Gholamreza; Yarmohammadi, Parastoo; Sharifabad, Mohammad Ali Morowati; Rahaei, Zohreh

    2014-01-01

    Introduction: Influenza A/H1N1 pandemic has recently threatened the health of world's population more than ever. Non-pharmaceutical measures are important to prevent the spread of influenza A/H1N1 and to prevent a pandemic. Effective influenza pandemic management requires understanding of the factors influencing preventive behavioral. This study reports on predictors of students’ preventive behaviors for pandemic influenza A/H1N1 using variables based on the protection motivation theory (PMT)...

  18. Protection Motivation Theory in Predicting Intention to Engage in Protective Behaviors against Schistosomiasis among Middle School Students in Rural China

    Science.gov (United States)

    Chen, Xinguang; Yu, Bin; Gao, Mengting; Yan, Hong; Okafor, Chukwuemeka N.

    2014-01-01

    Background Among millions of people who suffer from schistosomiasis in China, adolescents are at increased risk to be infected. However, there is a lack of theory-guided behavioral prevention intervention programs to protect these adolescents. This study attempted to apply the Protection Motivation Theory (PMT) in predicting intentions to engage in protective behaviors against schistosomiasis infection. Methods The participants were selected using the stratified cluster sampling method. Survey data were collected using anonymous self-reported questionnaire. The advanced structural equation modeling (SEM) method was utilized to assess the complex relationship among schistosomiasis knowledge, previous risk exposure and protective measures in predicting intentions to engage in protective behavior through the PMT constructs. Principal Findings Approximately 70% of participants reported they were always aware of schistosomiasis before exposure to water with endemic schistosomiasis, 6% of the participants reported frequency of weekly or monthly prior exposure to snail-conditioned water. 74% of participants reported having always engaged in protective behaviors in the past three months. Approximately 7% were unlikely or very unlikely to avoid contact with snail-conditioned water, and to use protective behaviors before exposure. Results from SEM analysis indicated that both schistosomiasis knowledge and prior exposure to schistosomiasis were indirectly related to behavior intentions through intrinsic rewards and self-efficacy; prior protective behaviors were indirectly related to behavior intentions through severity, intrinsic rewards and self-efficacy, while awareness had an indirect relationship with behavior intentions through self-efficacy. Among the seven PMT constructs, severity, intrinsic rewards and self-efficacy were significantly associated with behavior intentions. Conclusions The PMT can be used to predict the intention to engage in protective behaviors against

  19. Managing iliofemoral deep venous thrombosis of pregnancy with a strategy of thrombus removal is safe and avoids post-thrombotic morbidity.

    Science.gov (United States)

    Herrera, Santiago; Comerota, Anthony J; Thakur, Subhash; Sunderji, Shiraz; DiSalle, Robert; Kazanjian, Sahira N; Assi, Zakaria

    2014-02-01

    Extensive deep venous thrombosis (DVT) during pregnancy is usually treated with anticoagulation alone, risking significant post-thrombotic syndrome (PTS) in young patients. Catheter-directed thrombolysis (CDT) and operative venous thrombectomy have been safely and effectively used in nonpregnant patients, demonstrating significant reduction in post-thrombotic morbidity. This report reviews short- and long-term outcomes of 13 patients with extensive DVT of pregnancy treated with a strategy of thrombus removal. From 1999 to 2013, 13 patients with iliofemoral DVT during pregnancy were offered CDT, pharmacomechanical thrombolysis (PMT), and/or venous thrombectomy. Gestational age ranged from 8 to 34 weeks. Fetal monitoring was performed throughout hospitalization. Radiation exposure was minimized with pelvic lead shields, focal fluoroscopy, and limited angiographic runs. Follow-up included objective vein evaluation using venous duplex and PTS assessment using the Villalta scale. CDT and/or PMT were used in 11 patients. Two patients underwent venous thrombectomy alone, and one patient had operative thrombectomy as an adjunct to CDT and PMT. Each patient had complete or near-complete thrombus resolution and rapid improvement in clinical symptoms. Eight of 11 having CDT or PMT underwent venoplasty and stenting of the involved iliac veins. Twelve of the 13 delivered healthy infants at term. One patient opted for termination of her pregnancy. Mean patient and gestational ages were 26 years and 26 weeks, respectively. Mean follow-up was 1.3 years, with only one recurrence. Duplex ultrasonography demonstrated patent veins in all but one patient and normal valve function in 10 patients. Eleven patients had Villalta scores thrombus removal, resulting in a patent venous system, normal valve function in many, prevention of PTS, and reduction in recurrence. Copyright © 2014. Published by Mosby, Inc.

  20. Batch production of microchannel plate photo-multipliers

    Energy Technology Data Exchange (ETDEWEB)

    Frisch, Henry J.; Wetstein, Matthew; Elagin, Andrey

    2018-03-06

    In-situ methods for the batch fabrication of flat-panel micro-channel plate (MCP) photomultiplier tube (PMT) detectors (MCP-PMTs), without transporting either the window or the detector assembly inside a vacuum vessel are provided. The method allows for the synthesis of a reflection-mode photocathode on the entrance to the pores of a first MCP or the synthesis of a transmission-mode photocathode on the vacuum side of a photodetector entrance window.

  1. The AMANDA Neutrino Detector - Status report

    International Nuclear Information System (INIS)

    Wischnewski, R.; Andres, E.; Bai, X.; Barouch, G.; Barwick, S.; Bay, R.; Becker, K.; Bergstroem, L.; Bertrand, D.; Besson, D.; Biron, A.; Booth, J.; Botner, O.; Bouchta, A.; Carius, S.; Carlson, M.; Chinowsky, W.; Chirkin, D.; Conrad, J.; Cowen, D.F.; Costa, C.; Dalberg, E.; Desiati, P.; Dewulf, J.; Deyoung, T.; Doksus, P.; Edsjoe, J.; Ekstroem, P.; Feser, T.; Frichter, G.; Gaisser, T.; Goldschmidt, A.; Goobar, A.; Hallgren, A.; Halzen, F.; Hardtke, R.; Hellwig, M.; Hill, G.; Hulth, P.; Hundertmark, S.; Jacobsen, J.; Karle, A.; Kim, J.; Koepke, L.; Kowalski, M.; Kravchenko, I.; Lamoureux, J.; Leich, H.; Leuthold, M.; Lindahl, P.; Liss, T.; Loaiza, P.; Lowder, D.; Ludvig, J.; Marciniewski, P.; Matis, H.; Miller, T.; Miocinovic, P.; Mock, P.; Morse, R.; Neunhoeffer, T.; Newcomer, M.; Niessen, P.; Nygren, D.; Perez de los Heros, C.; Porrata, R.; Price, P.; Przybylski, G.; Rawlins, K.; Rhode, W.; Richter, S.; Rodriguez, J.; Romenesko, P.; Ross, D.; Rubinstein, H.; Sander, H.; Schaefer, U.; Schmidt, T.; Schneider, E.; Schwarz, R.; Schwendicke, U.; Silvestri, A.; Smoot, G.; Solarz, M.; Spiczak, G.; Spiering, C.; Starinski, N.; Steffen, P.; Stokstad, R.; Streicher, O.; Taboada, I.; Thollander, L.; Thon, T.; Tilav, S.; Vander Donckt, M.; Walck, C.; Wiebusch, C.; Woschnagg, K.; Wu, W.; Yodh, G.; Young, S.

    2000-01-01

    The first stage of the AMANDA High Energy Neutrino Detector at the South Pole, the 302 PMT array AMANDA-B10, is taking data since 1997. We describe results on atmospheric neutrinos, limits on indirect WIMP detection, seasonal muon flux variation, relativistic monopole flux limits, a search for gravitational collapse neutrinos, and a depth scan of the optical ice properties. The next stage 19-string detector AMANDA-II with ∼650 PMTs will be completed in spring 2000

  2. A novel compensation method for the anode gain non-uniformity of multi-anode photomultiplier tubes.

    Science.gov (United States)

    Lee, Chan Mi; Il Kwon, Sun; Ko, Guen Bae; Ito, Mikiko; Yoon, Hyun Suk; Lee, Dong Soo; Hong, Seong Jong; Lee, Jae Sung

    2012-01-07

    The position-sensitive multi-anode photomultiplier tube (MA-PMT) is widely used in high-resolution scintillation detectors. However, the anode gain nonuniformity of this device is a limiting factor that degrades the intrinsic performance of the detector module. The aim of this work was to develop a gain compensation method for the MA-PMT and evaluate the resulting enhancement in the performance of the detector. The method employs a circuit that is composed only of resistors and is placed between the MA-PMT and a resistive charge division network (RCN) used for position encoding. The goal of the circuit is to divide the output current from each anode, so the same current flows into the RCN regardless of the anode gain. The current division is controlled by the combination of a fixed-value series resistor with an output impedance that is much larger than the input impedance of the RCN, and a parallel resistor, which detours part of the current to ground. PSpice simulations of the compensation circuit and the RCN were performed to determine optimal values for the compensation resistors when used with Hamamatsu H8500 MAPMTs. The intrinsic characteristics of a detector module consisting of this MA-PMT and a lutetium-gadolinium-oxyorthosilicate (LGSO) crystal array were tested with and without the gain compensation method. In simulation, the average coefficient of variation and max/min ratio decreased from 15.7% to 2.7% and 2.0 to 1.2, respectively. In the flood map of the LGSO-H8500 detector, the uniformity of the photopeak position for individual crystals and the energy resolution were much improved. The feasibility of the method was shown by applying it to an octagonal prototype positron emission tomography scanner.

  3. Ultraviolet Communication for Medical Applications

    Science.gov (United States)

    2012-06-01

    plasma discharges every 100 μs. The location of each discharge can be modulated to produce M-ary pulse position modulation (PPM), which encodes...counting compound semiconductor avalanche photodiodes (APD) are not yet commercially available, and no component manufacturer has stated that one is...short optical pulses with either an LED or Plasma-shell source, and receives scattered photons with a photon-counting PMT and data-logs the received

  4. Sub-aquatic response of a scintillator, fibre optic and silicon photomultiplier based radiation sensor

    Energy Technology Data Exchange (ETDEWEB)

    Jackson, Sarah F., E-mail: s.f.jackson@lancaster.ac.uk [Engineering Department, Lancaster University, Lancaster (United Kingdom); Monk, Stephen D., E-mail: s.monk@lancaster.ac.uk [Engineering Department, Lancaster University, Lancaster (United Kingdom); Stanley, Steven J., E-mail: steven.j.stanley@nnl.co.uk [National Nuclear Laboratory, A709 Springfields, Preston (United Kingdom); Lennox, Kathryn, E-mail: kathryn.lennox@nnl.co.uk [National Nuclear Laboratory, A709 Springfields, Preston (United Kingdom)

    2014-07-01

    We describe an attempt at the utilisation of two low level light sensors to improve on the design of a dose monitoring system, specifically for underwater applications with consideration for the effects of water attenuation. The gamma radiation ‘RadLine{sup ®}’ detector consists of an inorganic scintillating crystal coupled to a fibre optic cable which transports scintillation photons, up to hundreds of metres, to an optical sensor. Analysed here are two contemporary technologies; SensL's MiniSL a silicon photomultiplier (SiPM) and a Sens-Tech photon counting photomultiplier tube (PMT). A clinical radiotherapy linear accelerator (linac) is implemented as test beam, subjecting the RadLine{sup ®} to a highly controlled dose rate (ranging from 0 Sv h{sup −1} to 320 Sv h{sup −1}), averaging at 2 MeV in energy. The RadLine's underwater dose monitoring capabilities are tested with the aid of epoxy resin ‘solid water’ phantom blocks, used as a substitute for water. Our results show that the MiniSL SiPM is unsuitable for this application due to extremely high background noise levels, however the Sens-Tech PMT performs satisfactorily and the detected dose rate due to the effects of water attenuation compares strongly with MCNP simulation data and NIST database values. We conclude that the PMT shows promise for its ultimate use in the First Generation Magnox Storage Pond (FGMSP) on the Sellafield site. - Highlights: • RadLine{sup ®} consists of a scintillating crystal coupled to a fibre optic cable and photon detector. • Here the dose monitoring system is trialled with SiPM and PMT type photon detectors. • A clinical linear accelerator (linac) is used as a test beam. • Sub-aquatic response is compared to Monte Carlo simulations and the NIST database.

  5. The system SnTe-InSe

    International Nuclear Information System (INIS)

    Gurshumov, A.P.; Alidzhanov, M.A.; Aliev, A.S.; Gadzhiev, T.G.; Mamedov, N.A.

    1986-01-01

    This paper discusses the nature of the interaction and physicochemical properties of the alloys of the system SnTe-InSe. The DTA was performed on an NTR-74 pyrometer, XPA on a Dron-2.0 diffractometer and MSA on an MIM-7 metallographic microscope. The microhardness of the samples was determined on a PMT-3 microhardness tester. The congruently melting compound SnInTeSe and solid solutions based on the starting components are formed in the system

  6. Transposition of Tn5096 from a temperature-sensitive transducible plasmid in Streptomyces spp.

    OpenAIRE

    McHenney, M A; Baltz, R H

    1991-01-01

    Transposon Tn5096 was inserted into a derivative of the temperature-sensitive plasmid pMT660 containing the bacteriophage FP43 pac site. The resulting plasmid, pRHB126, was transduced by FP43 into several Streptomyces species. Tn5096 transposed from pRHB126 into different sites in the genomes of Streptomyces ambofaciens, Streptomyces cinnamonensis, Streptomyces coelicolor A3(2), Streptomyces fradiae, Streptomyces griseofuscus, and Streptomyces thermotolerans.

  7. Measurement of Photomultipier Plateau Curves and Single MIP response in the AD detector at ALICE

    CERN Document Server

    Sanchez Falero, Sebastian De Jesus

    2015-01-01

    The Alice Diffractive (AD) detector is a forward detector in the ALICE experiment at CERN. It is aimed to the triggering on diffractive events and extends the pseudorapidity coverage to about 4.9 < /n/ < 6.3. In this work, a PMT's efficiency plateau and single MIP response are measured using a replica of the detector's scintillator modules, electronic and data acquisition system and cosmic rays as particle source.

  8. Detecting and Characterizing Nighttime Lighting Using Multispectral and Hyperspectral Imaging

    Science.gov (United States)

    2012-12-01

    are a wide variety of statistically based methods for analysis of MSI data, but they can also be analyzed to some degree using MSI spectral signatures...the received signal for the detection of clouds at night using moonlight . The implementation of the PMT system allowed for an unintentional ability...been known since the 1970s, the early night-time mapping products were derived from analog data ( film ). Elvidge et al. (1997) presented the first

  9. Electrical conductivity study on polythiophenes films

    International Nuclear Information System (INIS)

    Youm, I.; Cadene, M.

    1994-10-01

    The electrical conduction mechanism of two classes of polythiophenes: polythiophene (PT) and poly(3-methylthiophene) (PMT) films containing various levels of doping counter-ions was investigated. The temperature dependence of electrical conductivity obeys the Mott equation based on variable range hopping. The dimension of the variable range hopping is correlated with the structure of the conducting polymer. It seems for these polymers that carrier transport via mobile conjugational defects does not play a detectable role. (author). 17 refs, 3 figs, 1 tab

  10. Nuclear criticality safety: 300 Area

    International Nuclear Information System (INIS)

    1991-01-01

    This Standard applies to the receipt, processing, storage, and shipment of fissionable material in the 300 Area and in any other facility under the control of the Reactor Materials Project Management Team (PMT). The objective is to establish practices and process conditions for the storage and handling of fissionable material that prevent the accidental assembly of a critical mass and that comply with DOE Orders as well as accepted industry practice

  11. Proposta de bioremediació de l'estany Olla del Rei de Castelldefels

    OpenAIRE

    Vidiella Martin, Maria

    2017-01-01

    The UPC campus and the Mediterranean Technology Park (PMT) is an educational and research site that includes a naturalized area that sets it apart: the lake called "Olla del Rei", included in the inventory of wetlands in Catalonia. The evolution of the system and the effects caused by the network of drainage channels connected to the lagoon, have generated huge problems that threaten the existence of the lake as a natural area: eutrophication and loss of quality of the water, the exponential ...

  12. New regulations regarding Postgraduate Medical Training in Spain: perception of the tutor's role in the Murcia Region

    Directory of Open Access Journals (Sweden)

    Saura-Llamas José

    2010-06-01

    Full Text Available Abstract Background Recently introduced regulatory changes have expanded the Tutor role to include their primary responsibility for Postgraduate Medical Training (PMT. However, accreditation and recognition of that role has been devolved to the autonomic regions. The opinions of the RT may be relevant to future decisions; Methods A comprehensive questionnaire, including demographic characteristics, academic and research achievement and personal views about their role, was sent to 201 RTs in the Murcia Region of Spain. The responses are described using median and interquartile ranges (IQR; Results There were 147 replies (response rate 73%, 69% male, mean age 45 ± 7 yrs. RTs perception of the residents' initial knowledge and commitment throughout the program was 5 (IQR 4-6 and 7 (IQR 5-8, respectively. As regards their impact on the PMT program, RTs considered that their own contribution was similar to that of senior residents. RTs perception of how their role was recognised was 5 (IQR 3-6. Only 16% did not encounter difficulties in accessing specific RT training programs. Regarding the RTs view of their various duties, supervision of patient care was accorded the greatest importance (64% while the satisfactory completion of the PMT program and supervision of day-to-day activities were also considered important (61% and 59% respectively. The main RT requirements were: a greater professional recognition (97%, protected time (95%, specific RT training programs (95% and financial recognition (86%; Conclusions This comprehensive study, reflecting the feelings of our RTs, provides a useful insight into the reality of their work and the findings ought to be taken into consideration in the imminent definitive regulatory document on PMT.

  13. Protection motivation theory in predicting intention to engage in protective behaviors against schistosomiasis among middle school students in rural China.

    Directory of Open Access Journals (Sweden)

    Han Xiao

    2014-10-01

    Full Text Available Among millions of people who suffer from schistosomiasis in China, adolescents are at increased risk to be infected. However, there is a lack of theory-guided behavioral prevention intervention programs to protect these adolescents. This study attempted to apply the Protection Motivation Theory (PMT in predicting intentions to engage in protective behaviors against schistosomiasis infection.The participants were selected using the stratified cluster sampling method. Survey data were collected using anonymous self-reported questionnaire. The advanced structural equation modeling (SEM method was utilized to assess the complex relationship among schistosomiasis knowledge, previous risk exposure and protective measures in predicting intentions to engage in protective behavior through the PMT constructs.Approximately 70% of participants reported they were always aware of schistosomiasis before exposure to water with endemic schistosomiasis, 6% of the participants reported frequency of weekly or monthly prior exposure to snail-conditioned water. 74% of participants reported having always engaged in protective behaviors in the past three months. Approximately 7% were unlikely or very unlikely to avoid contact with snail-conditioned water, and to use protective behaviors before exposure. Results from SEM analysis indicated that both schistosomiasis knowledge and prior exposure to schistosomiasis were indirectly related to behavior intentions through intrinsic rewards and self-efficacy; prior protective behaviors were indirectly related to behavior intentions through severity, intrinsic rewards and self-efficacy, while awareness had an indirect relationship with behavior intentions through self-efficacy. Among the seven PMT constructs, severity, intrinsic rewards and self-efficacy were significantly associated with behavior intentions.The PMT can be used to predict the intention to engage in protective behaviors against schistosomiasis. Schistosomiasis

  14. A novel portable system for detecting and measuring tritium

    International Nuclear Information System (INIS)

    Barillari, Domenico

    2007-01-01

    A novel tritium detector configuration is described based on the anthracene scintillation method. Tritium-bearing samples are applied to a plate-bearing finely sublimed anthracene crystals and viewed in a field-able PMT-based reader against a standard plate. A microprocessor-based control and signal analysis system delivers a reading with a sensitivity of better than 5 nCi 3 H in approximately 3 min, and 2.3 nCi in 10 min of counting

  15. Beer-Lambert-Law Parametric Model of Reflectance Spectra for Dyed Fabrics

    Science.gov (United States)

    2016-06-06

    reflections from layered systems (i.e., scattering matrix formulations) [12,13,14], the Kubelka-Munk theory of diffuse reflectance (and formulations...mode. The Lambda 1050 incorporated a double beam, 150 mm integrating sphere housing a photomultiplier tube (PMT) detector for the UV-Vis (175 – 860 nm...of the combined system of dye and fabric. This relation follows from the Beer-Lambert law and formalism of the scattering- matrix [20]. In particular

  16. Automatic detection of patient position for incorporation in exact 3D reconstruction for emission tomography

    International Nuclear Information System (INIS)

    Kyme, A.; Hutton, B.; Hatton, R.; Skerrett, D.

    2000-01-01

    Full text: SPECT involves acquiring a set of projection images using one or more rotating gamma cameras. The projections are then reconstructed to create transverse slices. Patient motion during the scan can introduce inconsistencies into the data leading to artifacts. There remains a need for robust and effective motion correction. One approach uses the (corrupt) data itself to derive the patient position at each projection angle. Corrected data is periodically incorporated into a 3-D reconstruction. Fundamental aspects of the algorithm mechanics, particularly performance in the presence of Poisson noise, have been examined. Brain SPECT studies were simulated using a digital version of the Huffman brain phantom. Projection datasets with Poisson noise imposed, generated for different positions of the phantom, were combined and reconstructed to produce motion-corrupted reconstructions. To examine the behaviour of the cost function as the object position was changed, the corrupted re-construction was forward projected and the mean square difference (MSD) between the resulting re-projections and corresponding original projections was calculated. The ability to detect mis-positioned projections for different degrees of freedom, the importance of using dual-head camera geometry, and the effect of smoothing the original projections prior to the MSD calculation were assessed. Re-projection of the corrupt reconstruction was able to correctly identify mis-positioned projection data. The degree of movement as defined by MSD was more easily identified for translations than for rotations. Noise resulted in an increasing bias that made it difficult to distinguish the minimum MSD, particularly for z-axis rotations. This was improved by median filtering of projections. Right-angled dual-head geometry is necessary to provide stability to the algorithm and to better identify motion in all 6 degrees of freedom. These findings will assist the optimisation of a fully automated motion

  17. Evaluation of pulmonary lesions with 18FDG CoDo PET: comparison with CT, MRI and clinical findings

    International Nuclear Information System (INIS)

    Kim, Su Zy; Park, Chan Hee; Han, Myung Ho; Hwang, Sung Chul; Lee, Chul Joo; Pai, Moon Sun

    1998-01-01

    Dual-head gamma camera coincidence (PET) is one of the recent approaches to overcome the problems of the dedicated PET scans such as high cost and limited availability. The purpose of this study was to evaluate the accuracy of 18 FDG coincidence detection (CoDe) PET in differentiating benign from malignant lesions and staging malignancy. Thirty-one patients with pulmonary lesions underwent 18 FDG CoDe PET. Patients were prepared for the study by overnight fasting. The images were acquired at about 1 hr postinjection of 3-10 mCi 18 FDG intravenously using dual head gamma camera (Elscint, Varicam) equipped with 5/8 inch thick NaI crystal. The images were analyzed visually. Pathologic proof of diagnosis was obtained by aspiration biopsy in 24 patients and by operation in 7 patients. Among 25 patients with pathologically proven malignant lesions ( 11 adenocarcinoma, 3 non-small cell lung cancer, 5 squamous cell cancer, 4 small cell lung cancer, 1 invasive thymoma and 1 adenosquamous cell cancer), 18 FDG CoDe PET could not detect only 1 lesion which was adenocarcinoma of less than 1 cm in size. In seven patients underwent lobectomy, 6 CoDe PET studies agreed with pathologic results. Whereas only 3 of 7 patients CT findings agreed with pathologic findings. However, 6 patients with benign lesions also showed positive FDG uptake. The false positive pathologies were due to tuberculosis, pneumonia, and granulomatous changes due to silicosis. 18 FDG CoDe PET was sensitive in the evaluation of lung lesions but was not specific for malignancy. 18 FDG CoDe PET was more sensitive than CT in nodal staging in limited number of patients studied thus far

  18. Evaluation of pulmonary lesions with {sup 18}FDG CoDo PET: comparison with CT, MRI and clinical findings

    Energy Technology Data Exchange (ETDEWEB)

    Kim, Su Zy; Park, Chan Hee; Han, Myung Ho; Hwang, Sung Chul; Lee, Chul Joo; Pai, Moon Sun [College of Medicine, Ajou Univ., Suwon (Korea, Republic of)

    1998-07-01

    Dual-head gamma camera coincidence (PET) is one of the recent approaches to overcome the problems of the dedicated PET scans such as high cost and limited availability. The purpose of this study was to evaluate the accuracy of {sup 18}FDG coincidence detection (CoDe) PET in differentiating benign from malignant lesions and staging malignancy. Thirty-one patients with pulmonary lesions underwent {sup 18}FDG CoDe PET. Patients were prepared for the study by overnight fasting. The images were acquired at about 1 hr postinjection of 3-10 mCi {sup 18}FDG intravenously using dual head gamma camera (Elscint, Varicam) equipped with 5/8 inch thick NaI crystal. The images were analyzed visually. Pathologic proof of diagnosis was obtained by aspiration biopsy in 24 patients and by operation in 7 patients. Among 25 patients with pathologically proven malignant lesions ( 11 adenocarcinoma, 3 non-small cell lung cancer, 5 squamous cell cancer, 4 small cell lung cancer, 1 invasive thymoma and 1 adenosquamous cell cancer), {sup 18}FDG CoDe PET could not detect only 1 lesion which was adenocarcinoma of less than 1 cm in size. In seven patients underwent lobectomy, 6 CoDe PET studies agreed with pathologic results. Whereas only 3 of 7 patients CT findings agreed with pathologic findings. However, 6 patients with benign lesions also showed positive FDG uptake. The false positive pathologies were due to tuberculosis, pneumonia, and granulomatous changes due to silicosis. {sup 18}FDG CoDe PET was sensitive in the evaluation of lung lesions but was not specific for malignancy. {sup 18}FDG CoDe PET was more sensitive than CT in nodal staging in limited number of patients studied thus far.

  19. The findings of F-18 FDG camera-based coincidence PET in acute leukemia

    Energy Technology Data Exchange (ETDEWEB)

    Yoon, S. N.; Joh, C. W.; Lee, M. H. [Ajou University School of Medicine, Suwon (Korea, Republic of)

    2002-07-01

    We evaluated the usefulness of F-18 FDG coincidence PET (CoDe-PET) using a dual-head gamma camera in the assessment of patients with acute leukemia. F-18 FDG CoDE-PET studies were performed in 5 patients with acute leukemia (6 ALL and 2 AML) before or after treatment. CoDe-PET was performed utilizing a dual-head gamma camera equipped with 5/8 inch NaI(Tl) crystal. Image acquisition began 60 minutes after the injection of F-18 FDG in the fasting state. A whole trunk from cervical to inguinal regions or selected region were scanned. No attenuation correction was made and image reconstruction was done using filtered back-projection. CoDe-PET studies were evaluated visually. F-18 FDG image performed in 5 patients with ALL before therapy depicted multiple lymph node involvement and diffuse increased uptake involving axial skeleton, pelvis and femurs. F-18 FDG image done in 2 AML after chemotherapy showed only diffuse increased uptake in sternum, ribs, spine, pelvis and proximal femur and these may be due to G-CSF stimulation effect in view of drug history. But bone marrow histology showed scattered blast cell suggesting incomplete remission in one and completer remission in another. F-18 image done in 1 ALL after therapy showed no abnormal uptake. CoDe-PET with F-18 FDG in acute lymphoblastic lymphoma showed multiple lymphnode and bone marrow involvement in whole body. Therefore we conclude that CoDe-PET with F-18 FDG usefulness for evaluation of extent in acute lymphoblastic leukemia. But there was a limitation to assess therapy effectiveness during therapy due to reactive bone marrow.

  20. Limited role of I-123 IPT SPECT in differentiating essential tremor from early stage of Parkinson's disease

    International Nuclear Information System (INIS)

    Yoo, Y. H.; Yoon, M. J.; Lee, J. D.; Kim, J. H.; Lee, E.; Kim, H. S.; Choi, T. H.

    2002-01-01

    The study was to assess clinically applicable cut-off value in differential diagnosis among early stage of Parkinson's disease(PD) and essential tremor(ET) and normal control(NL) groups on I-123 IPT SPECT using dual head gamma camera both quantitatively and qualitatively. 50 NL (mean age 27.9), 20 early PD patients (mean age 58.2), 30 advanced PD patients (mean age 63.1) and 20 ET patients (mean age 39.9) were included and performed brain SPECT 2 hours after administration of I-123 IPT using dual head gamma camera. Recostructed SPECT data were assessed for specific/nonspecific binding ratio of striatum using (RBG-OCC/OCC, LBG-OCC/OCC) ratio. RBG-OCC/OCC and LBG-OCC/OCC ratio was decreased with increasing grade of H-Y stage in PD. Mean value of specific/nonspecific binding ratio was significantly different between advanced PD group and NL group. However, significant overlap of striatal specific/nonspecific bonding ratio were observed between early PD group and ET group. Suggested cut-off value of striatal binding ratio which can diagnose PD would be 2.1. Although I-123 IPT SPECT may be a useful method for the diagnosis of advanced PD and objective evaluation of progress of clinical stages, care should be made in the differential diagnosis of subclinical and early stage of PD and other motor distubances mimicking PD such as ET in view of significant overlap in striatal I-123 IPT specific/nonspecific binding ratio

  1. I-123 labeled F (ab.)2 fragments of monoclonal anti-CEA antibodies for the localization of colon carcinoma by single photon emission computed tomography

    International Nuclear Information System (INIS)

    Delaloye, B.; Bichof-Delaloye, A.; Pettavel, J.; Besson, A.; Mosimann, F.; Barrelet, L.; Grob, J.Ph.; Buchegger, F.; Carrel, S.; Haskell, C.M.; Halpern, S.E.; Fliedner, V.von; Mach, J.P.

    1984-01-01

    I-123 iodo-amphetamine (123-I-N-isopropyl-p-iodoamphetamine-EIR) seems a useful agent for the investigation of cerebral blood flow. As the indications on the time of cerebral equilibrium - i.e. the adequate moment of scanning varied according to several authors we realized a preliminary kinetic study in 6 and a brain ECT in 12 patients (11 males, 1 female). 2 patients were studied twice. 9 patients had vascular lesions, 3 brain metastases. Patients were studied after informed consent. After overnight fasting short catheters (venflon) were put in a vein of each forearm, one for the injection of the tracer, the other for blood sampling. Then the patients were allowed to rest in a dark room with a bandage over the eyes. 10 minutes later, the tracer (5 mCi) was injected and blood samples were taken at 5, 10, 15, 30, 45, 60, 90 and 120 minutes post injection. Whole body tracer distribution was measured with a dual head scintillation camera between 30 and 60 minutes as well as after 90 minutes post injection in 4 patients, in 2 patients only the second measurement was performed. Brain ECT was realized with a dual head rotating scintillation camera during the 50-90 minutes following injection at an angular increment of 6 0 and a counting time of 40-50 seconds per view (40000-60000 counts), this means about 30-35 minutes immobilization for the patient. The plasma diappearance curve presented two components in all (n=5) patients studied, the T 1/2 of the first being 45 +- 11.7 minutes, the second being a plateau or slightly ascending. All lesions on CT were visualized by ECT with iodoamphetmine, but they appeared larger on ECT. These findings have still to be verified in a group of patients with more discrete lesions as all patients of the group studied first had quite extensive lesions of the brain. (Author)

  2. Characterization of Magnetic Field Immersed Photomultipliers from Double Chooz Experiment. Design and Construction of their Magnetic Shields; Caracterizacion de los fotomultiplicadores del experimento Double Chooz bajo campo magnetico y diseno y construccion de sus blindajes magneticos

    Energy Technology Data Exchange (ETDEWEB)

    Valdivia Valero, F. J.

    2007-12-28

    Flavour oscillations of neutrinos are a quantum-mechanical effect widely demonstrated. It is explained through interferences of their mass eigenstates, therefore, belonging to the physical area beyond the Standard Model. This work deals with the CIEMAT collaboration in the neutrino experiment Double Chooz. Such an experiment aims to measure the mixture angle {theta}{sub 1}3, one of the PMNS leptonic mixture matrix, with a un reached-before sensibility by decrease of systematic errors. For this, two identical scintillator detectors, equipped with PMT's, will be sited at different distances from two reactors located in the nuclear power plant CHOOZ B (France). The electronic neutrino flux from these reactors will be compared, explaining its deficit by flavour oscillations of these particles. The identity of both detectors will be diminished by the magnetic field effects on the PMT's response. Therefore, this study serves as for quantifying such an effects as for fitting the magnetic shields design that minimize them. Shielding measurements and final design of magnetic shields as much as the effect these ones cause in the PMT's response immersed in a monitored magnetic field are presented. (Author) 85 refs.

  3. Characterization of Magnetic Field Immersed Photomultipliers from Double Chooz Experiment. Design and Construction of their Magnetic Shields; Caracterizacion de los fotomultiplicadores del experimento Double Chooz bajo campo magnetico y diseno y construccion de sus blindajes magneticos

    Energy Technology Data Exchange (ETDEWEB)

    Valdivia Valero, F J

    2007-12-28

    Flavour oscillations of neutrinos are a quantum-mechanical effect widely demonstrated. It is explained through interferences of their mass eigenstates, therefore, belonging to the physical area beyond the Standard Model. This work deals with the CIEMAT collaboration in the neutrino experiment Double Chooz. Such an experiment aims to measure the mixture angle {theta}{sub 1}3, one of the PMNS leptonic mixture matrix, with a un reached-before sensibility by decrease of systematic errors. For this, two identical scintillator detectors, equipped with PMT's, will be sited at different distances from two reactors located in the nuclear power plant CHOOZ B (France). The electronic neutrino flux from these reactors will be compared, explaining its deficit by flavour oscillations of these particles. The identity of both detectors will be diminished by the magnetic field effects on the PMT's response. Therefore, this study serves as for quantifying such an effects as for fitting the magnetic shields design that minimize them. Shielding measurements and final design of magnetic shields as much as the effect these ones cause in the PMT's response immersed in a monitored magnetic field are presented. (Author) 85 refs.

  4. High-speed charge-to-time converter ASIC for the Super-Kamiokande detector

    Energy Technology Data Exchange (ETDEWEB)

    Nishino, H., E-mail: nishino@post.kek.j [Institute for Cosmic Ray Research, University of Tokyo, Chiba 277-8582 (Japan); Awai, K.; Hayato, Y.; Nakayama, S.; Okumura, K.; Shiozawa, M.; Takeda, A. [Institute for Cosmic Ray Research, University of Tokyo, Chiba 277-8582 (Japan); Ishikawa, K.; Minegishi, A. [Iwatsu Test Instruments Corporation, Tokyo 168-8511 (Japan); Arai, Y. [The Institute of Particle and Nuclear Studies, KEK, Ibaraki 305-0801 (Japan)

    2009-11-11

    A new application-specific integrated circuit (ASIC), the high-speed charge-to-time converter (QTC) IWATSU CLC101, provides three channels, each consisting of preamplifier, discriminator, low-pass filter, and charge integration circuitry, optimized for the waveform of a photomultiplier tube (PMT). This ASIC detects PMT signals using individual built-in discriminators and drives output timing signals whose width represents the integrated charge of the PMT signal. Combined with external input circuits composed of passive elements, the QTC provides full analog signal processing for the detector's PMTs, ready for further processing by time-to-digital converters (TDCs). High-rate (>1MHz) signal processing is achieved by short-charge-conversion-time and baseline-restoration circuits. Wide-range charge measurements are enabled by offering three gain ranges while maintaining a short cycle time. QTC chip test results show good analog performance, with efficient detection for a single photoelectron signal, four orders of magnitude dynamic range (0.3mVapprox3V; 0.2approx2500pC), 1% charge linearity, 0.2 pC charge resolution, and 0.1 ns timing resolution. Test results on ambient temperature dependence, channel isolation, and rate dependence also meet specifications.

  5. A Peer Mentor Tutor Program in Physics

    Science.gov (United States)

    Nossal, S. M.; Jacob, A. T.; Buehlman, J. D.; Middlecamp, C. H.

    2001-05-01

    The Peer Mentor Tutor (PMT) program in the University of Wisconsin-Madison's Physics Department matches upper level undergraduate physics majors in small groups with students potentially at-risk for having academic trouble with their gateway introductory non-calculus physics course or for feeling isolated at the University. The program enhances students'learning and confidence by providing an emphasis on problem solving, a supportive environment for asking questions, and opportunities for acquiring missing math skills. The students assisted include, among others, returning adults, students of color,students with English as a second language, and students who have never taken physics in high school. The tutors acquire teaching and leadership experience with ongoing training throughout the year. The Physics PMT program is run in collaboration with a similar program in Chemistry. The peer model is also being applied to other science courses at the University of Wisconsin. We will describe the structure of the Physics PMT program and our current efforts to expand the program into a broader Physics Learning Center that may serve multiple purposes and courses.

  6. Performance comparison of scintillators for alpha particle detectors

    Energy Technology Data Exchange (ETDEWEB)

    Morishita, Yuki [Graduate School of Medicine, Nagoya University, 1-1-20 Daiko-Minami, Higashi-ku, Nagoya, Aichi 461-8673 (Japan); Japan Atomic Energy Agency, Muramatsu 4-33, Tokai-mura, Ibaraki 319-1194 (Japan); Yamamoto, Seiichi [Graduate School of Medicine, Nagoya University, 1-1-20 Daiko-Minami, Higashi-ku, Nagoya, Aichi 461-8673 (Japan); Izaki, Kenji [Japan Atomic Energy Agency, Muramatsu 4-33, Tokai-mura, Ibaraki 319-1194 (Japan); Kaneko, Junichi H.; Toui, Kohei; Tsubota, Youichi; Higuchi, Mikio [Graduate School of Engineering, Hokkaido University, Kita 13, Nishi 8, Kita-ku, Sapporo, Hokkaido 060-8628 (Japan)

    2014-11-11

    Scintillation detectors for alpha particles are often used in nuclear fuel facilities. Alpha particle detectors have also become important in the research field of radionuclide therapy using alpha emitters. ZnS(Ag) is the most often used scintillator for alpha particle detectors because its light output is high. However, the energy resolution of ZnS(Ag)-based scintillation detectors is poor because they are not transparent. A new ceramic sample, namely the cerium doped Gd{sub 2}Si{sub 2}O{sub 7} (GPS) scintillator, has been tested as alpha particle detector and its performances have been compared to that one of three different scintillating materials: ZnS(Ag), GAGG and a standard plastic scintillator. The different scintillating materials have been coupled to two different photodetectors, namely a photomultiplier tube (PMT) and a Silicon Photo-multiplier (Si-PM): the performances of each detection system have been compared. Promising results as far as the energy resolution performances (10% with PMT and 14% with Si-PM) have been obtained in the case of GPS and GAGG samples. Considering the quantum efficiencies of the photodetectors under test and their relation to the emission wavelength of the different scintillators, the best results were achieved coupling the GPS with the PMT and the GAGG with the Si-PM.

  7. Upgrade of the ATLAS hadronic Tile Calorimeter for the High luminosity LHC

    CERN Document Server

    Rodriguez Bosca, Sergi; The ATLAS collaboration

    2017-01-01

    The Tile Calorimeter is the hadronic calorimeter covering the central region of the ATLAS detector at the Large Hadron Collider. It is a scintillator-steel sampling calorimeter read out via wavelength shifting fibers coupled to photomultiplier tubes (PMT). The PMT signals are digitized and stored on detector until a trigger is received. The High-Luminosity phase of LHC (HL-LHC) expected to begin in year 2026 requires new electronics to meet the requirements of a 1 MHz trigger, higher ambient radiation, and for better performance under higher pileup. All the TileCal on- and off-detector electronics will be replaced during the shutdown of 2024-2025. PMT signals from every TileCal cell will be digitized and sent directly to the back-end electronics, where the signals are reconstructed, stored, and sent to the first level of trigger at a rate of 40 MHz. This will provide better precision of the calorimeter signals used by the trigger system and will allow the development of more complex trigger algorithms. Change...

  8. Upgrade of the ATLAS hadronic Tile Calorimeter for the High luminosity LHC

    CERN Document Server

    Rodriguez Bosca, Sergi; The ATLAS collaboration

    2017-01-01

    The Tile Calorimeter is the hadronic calorimeter covering the central region of the ATLAS detector at the Large Hadron Collider. It is a scintillator-steel sampling calorimeter read out via wavelength shifting fibers coupled to photomultiplier tubes (PMT). The PMT signals are digitized and stored on detector until a trigger is received. The High-Luminosity phase of LHC (HL-LHC)expected to begin in year 2026 requires new electronics to meet the requirements of a 1 MHz trigger, higher ambient radiation, and for better performance under higher pileup. All the TileCal on- and off-detector electronics will be replaced during the shutdown of 2024-2025. PMT signals from every TileCal cell will be digitized and sent directly to the back-end electronics, where the signals are reconstructed, stored, and sent to the first level of trigger at a rate of 40 MHz. This will provide better precision of the calorimeter signals used by the trigger system and will allow the development of more complex trigger algorithms. Changes...

  9. Photocopia-A Unibody Mono-material Compact and Scalable Photomultiplier

    Energy Technology Data Exchange (ETDEWEB)

    Mulhollan, Gregory [Saxet Surface Science

    2014-12-01

    The Photocopia photomultiplier tube (PMT) takes advantage of two of the many unique properties of the hydrogenated amorphous silicon-germanium (a-SiGe) photoemitter material: its mechanical flexibility and mostly substrate-independent properties. The a-SiGe photoemitter has high secondary electron (SE) yield. It can be used both as the photocathode and as the gain medium. The active material can be grown on a flat, thin unibody substrate, formed and then “rolled up” ex situ. The completed structure would then be activated and sealed within a tube. The Ge component can be increased to enhance red-sensitivity. Compact sizes are possible, minimizing magnetic field effects. The Photocopia PMT will be a low cost alternative to MCPs for TOF detectors and provide better timing discrimination for Cherenkov detectors. Retention of the ability to activate to a normal photoyield state upon flexing (bending) the substrate of the a-SiGe material after growth, but prior to activation has been shown. The SE coefficient of the activated material has been characterized over the voltage range suitable for utilization as the gain material. The time response of the material is suited to PMT use.

  10. Behavioral Interventions for Anger, Irritability, and Aggression in Children and Adolescents.

    Science.gov (United States)

    Sukhodolsky, Denis G; Smith, Stephanie D; McCauley, Spencer A; Ibrahim, Karim; Piasecka, Justyna B

    2016-02-01

    Anger, irritability, and aggression are among the most common reasons for child mental health referrals. This review is focused on two forms of behavioral interventions for these behavioral problems: Parent management training (PMT) and cognitive-behavioral therapy (CBT). First, we provide an overview of anger/irritability and aggression as the treatment targets of behavioral interventions, followed by a discussion of the general principles and techniques of these treatment modalities. Then we discuss our current work concerning the transdiagnostic approach to CBT for anger, irritability, and aggression. PMT is aimed at improving aversive patterns of family interactions that engender children's disruptive behavior. CBT targets deficits in emotion regulation and social problem-solving that are associated with aggressive behavior. Both forms of treatment have received extensive support in randomized controlled trials. Given that anger/irritability and aggressive behavior are common in children with a variety of psychiatric diagnoses, a transdiagnostic approach to CBT for anger and aggression is described in detail. PMT and CBT have been well studied in randomized controlled trials in children with disruptive behavior disorders, and studies of transdiagnostic approaches to CBT for anger and aggression are currently underway. More work is needed to develop treatments for other types of aggressive behavior (e.g., relational aggression) that have been relatively neglected in clinical research. The role of callous-unemotional traits in response to behavioral interventions and treatment of irritability in children with anxiety and mood disorders also warrants further investigation.

  11. Determinants of Cancer Early Detection Behaviors:Application of Protection Motivation Theory.

    Science.gov (United States)

    Rahaei, Zohreh; Ghofranipour, Fazlollah; Morowatisharifabad, Mohammad Ali; Mohammadi, Eesa

    2015-01-01

    Cancer is account for 13% of all deaths around the world and is the third cause of mortality in Iran. More than one third of these cases are pre-ventable and about 33% are curable with early detection. The aim of this study was to determine the predictors of cancer early detection (CED) behaviors applying Protection Motivation Theory (PMT). In this cross-sectional study, cluster sampling method was employed to recruit 260 individuals of above 20 years old in Yazd, Iran and a researcher designed questionnaire was completed through interviews for each of the respondents. PMT theoretical variables and CED behaviors were the basis of data collection procedure. Participants acquired 64.47% of the protection motivation, 30.97% of the passive and 45.64% of the active behaviors‟ possible scores. Theory constructs predicted 19.8%, 15.6% and 9.6% of the variations for protection motivation, passive and active behavior respectively. Protection motivation was responsible for 3.6% of passive and 8% of active behaviors‟ variations. Considering the scarceness of CED behaviors and the applicability of PMT in predicting these behaviors, utilization of the PMT‟s constructs in any interventional programs to accelerate CED behaviors could be an alternate methodological choice in the cancer control initiatives.

  12. Development and featuring of hemispherical photomultipliers for cosmic ray detection - calibration of surface detectors and analysis of horizontal showers at the Pierre Auger Observatory; Developpement et caracterisation de photomultiplicateurs hemispheriques pour les experiences d'astroparticules - etalonnage des detecteurs de surface et analyse des gerbes horizontales de l'Observatoire Pierre Auger

    Energy Technology Data Exchange (ETDEWEB)

    Dornic, D

    2006-09-15

    The large photomultipliers (PMT) are currently used in astro-particle and neutrino experiments where they have to detect low levels of light. We have studied and characterised large PMTs developed by the PHOTONIS Group Company. The first part of this thesis is dedicated to the full characterization of two types of multipliers currently used in large PMTs. Then, we present results of a new photocathode process, applied on the XPI805 (PMT used in the Pierre Auger Observatory) in order to improve the quantum efficiency. Finally, we study the PMT diameter influence on main parameters (5, 8 and 10 inches). The second part is devoted to the study of the water Cerenkov tank (WCD) response to the shower particles and the horizontal air showers analysis with the Pierre Auger Observatory. The main parameters of a WCD simulation developed in the Auger IPN group were calibrated with several measurements on vertical and inclined muons, performed on dedicated test tanks. The kind of detector used in the surface detector allows detecting very inclined events with a good sensitivity (zenith angle superior to 70 degrees). We have established specific methods to analyze these events (selection and reconstruction). These methods were applied to the Auger data in order to obtain the energy spectrum of the horizontal events. Finally, we detailed two methods to test directly the hadronic models predictions by studying the air showers muonic component. (author)

  13. Skin cancer preventive behaviors among rural farmers: An intervention based on protection motivation theory.

    Science.gov (United States)

    Babazadeh, Towhid; Kamran, Aziz; Dargahi, Abdollah; Moradi, Fatemeh; Shariat, Fariba; Rezakhani Moghaddam, Hamed

    2016-01-01

    Background: Skin cancer is a serious public health problem in the world. Its prevalence in many countries has been increased in recent years. This study aimed to assess the effects of a theory-based educational intervention to promote skin cancer preventive behaviors (SCPBs) among rural farmers in Chalderan County, Iran. Methods: This was a quasi-randomized controlled field trial study conducted on 238 rural farmers. The data were collected by a questionnaire containing the constructs of the Protection Motivation Theory (PMT) as well as the items of SCPBs. The differences between the groups before and 3 months after the intervention were determined by independent t-test, paired t-test, and chi-square applying SPSS software. Results: Before the intervention, no significant difference was found in the scores of the PMT constructs between the two groups (p>0.05). However, significant differences were found between the scores of all the variables, as well as SCPBs, in the two groups after the intervention (p<0.05). Conclusion: The PMT was found to be an appropriate framework for designing educational interventions aiming at promoting SCPBs among rural farmers. It was concluded that designing an educational program with a focus on promoting perceived susceptibility increased the level of performing SCPBs among the rural farmers.

  14. Effect of Motivational Interviewing on Physical Activity Intention among Obese and Overweight Women Using Protection Motivation Theory: A Randomized Clinical Trial

    Directory of Open Access Journals (Sweden)

    K. Mirkarimi

    2016-09-01

    Full Text Available Aims: As a growing problem, obesity is one of the most important worldwide health problems. One of the major factors leading to obesity is the sedentary lifestyle. The aim of this study was to investigate the effects of motivational interviewing on the physical activity intention in the obese or overweight women, using the protection motivation theory (PMT. Materials & Methods: In the clinical trial study, 60 obese or overweight women referred to the health centers of Gorgan were studied in 2015. The subjects, selected via non-probable and available sampling method, were randomly divided into two groups including control and motivational interviewing groups. Data was collected using a researcher-made questionnaire before the intervention and 2 and 6 months after in both groups. Data was analyzed by SPSS 18 software using independent T, Chi-square, repeated measures ANOVA, LSD, and one-variable and multivariable linear regression tests. Findings: The scores of all the constructs of PMT in motivational interviewing group significantly increased 2 and 6 months after he intervention (p0.05. The most powerful constructs predicting the intention towards the physical activities 2 months after the intervention were perceived-reply efficiency, self-efficiency, and perceived intensity, successively. In addition, such factors 6 months after the intervention were attitude and perceived intensity, successively. Conclusion: The motivational interviewing increases the scores of all the constructs of PMT, which leads to an increase in the physical activity intention in the obese or overweight women.

  15. Use of protection motivation theory, affect, and barriers to understand and predict adherence to outpatient rehabilitation.

    Science.gov (United States)

    Grindley, Emma J; Zizzi, Samuel J; Nasypany, Alan M

    2008-12-01

    Protection motivation theory (PMT) has been used in more than 20 different health-related fields to study intentions and behavior, albeit primarily outside the area of injury rehabilitation. In order to examine and predict patient adherence behavior, this study was carried out to explore the use of PMT as a screening tool in a general sample of people with orthopedic conditions. New patients who were more than 18 years old and who were prescribed 4 to 8 weeks of physical therapy treatment (n=229) were administered a screening tool (Sports Injury Rehabilitation Beliefs Scale, Positive and Negative Affect Schedule, and a barriers checklist) prior to treatment. Participants' adherence was assessed with several attendance measures and an in-clinic assessment of behavior. Statistical analyses included correlation, chi-square, multiple regression, and discriminant function analyses. A variety of relationships among affect, barriers, and PMT components were evident. In-clinic behavior and attendance were influenced by affect, whereas dropout status was predicted by affect, severity, self-efficacy, and age. The screening tool used in this study may assist in identifying patients who are at risk for poor adherence and provide valuable information to enhance provider-patient relationships and foster patient adherence. However, it is recommended that more research be conducted to further understand the impact of variables on patient adherence and that the screening tool be enhanced to increase its predictive ability.

  16. Combining motivational and volitional interventions to promote exercise participation: protection motivation theory and implementation intentions.

    Science.gov (United States)

    Milne, Sarah; Orbell, Sheina; Sheeran, Paschal

    2002-05-01

    This study compared a motivational intervention based on protection motivation theory (PMT, Rogers, 1975, 1983) with the same motivational intervention augmented by a volitional intervention based on implementation intentions (Gollwitzer, 1993). The study had a longitudinal design, involving three waves of data collection over a 2-week period, incorporating an experimental manipulation of PMT variables at Time 1 and a volitional, implementation intention intervention at Time 2. Participants (N=248) were randomly allocated to a control group or one of two intervention groups. Cognitions and exercise behaviour were measured at three time-points over a 2-week period. The motivational intervention significantly increased threat and coping appraisal and intentions to engage in exercise but did not bring about a significant increase in subsequent exercise behaviour. In contrast, the combined protection motivation theory/implementation intention intervention had a dramatic effect on subsequent exercise behaviour. This volitional intervention did not influence behavioural intention or any other motivational variables. It is concluded that supplementing PMT with implementation intentions strengthens the ability of the model to explain behaviour. This has implications for health education programmes, which should aim to increase both participants' motivation and their volition.

  17. A low-power high dynamic range front-end ASIC for imaging calorimeters

    CERN Document Server

    Bagliesi, M G; Marrocchesi, P S; Meucci, M; Millucci, V; Morsani, F; Paoletti, R; Pilo, F; Scribano, A; Turini, N; Valle, G D

    2002-01-01

    High granularity calorimeters with shower imaging capabilities require dedicated front-end electronics. The ICON 4CH and VA4 PMT chip-set is suitable for very high dynamic range systems with strict noise requirements. The ICON 4CH is a 4 channel input, 12 channel output ASIC designed for use in a multi-anode photomultiplier system with very large dynamic range and low-noise requirements. Each of the four input signals to the ASIC is split equally into three branches by a current conveyor. Each of the three branches is scaled differently: 1:1, 1:8 and 1:80. The signal is read out by a 12 channel low noise/low power high dynamic range charge sensitive preamplifier-shaper circuit (VA4-PMT chip), with simultaneous sample- and-hold, multiplexed analog read-out, calibration facilities. Tests performed in our lab with a PMT are reported in terms of linearity, dynamic range and cross-talk of the system. (5 refs).

  18. Characterization of porcine eyes based on autofluorescence lifetime imaging

    Science.gov (United States)

    Batista, Ana; Breunig, Hans Georg; Uchugonova, Aisada; Morgado, António Miguel; König, Karsten

    2015-03-01

    Multiphoton microscopy is a non-invasive imaging technique with ideal characteristics for biological applications. In this study, we propose to characterize three major structures of the porcine eye, the cornea, crystalline lens, and retina using two-photon excitation fluorescence lifetime imaging microscopy (2PE-FLIM). Samples were imaged using a laser-scanning microscope, consisting of a broadband sub-15 femtosecond (fs) near-infrared laser. Signal detection was performed using a 16-channel photomultiplier tube (PMT) detector (PML-16PMT). Therefore, spectral analysis of the fluorescence lifetime data was possible. To ensure a correct spectral analysis of the autofluorescence lifetime data, the spectra of the individual endogenous fluorophores were acquired with the 16-channel PMT and with a spectrometer. All experiments were performed within 12h of the porcine eye enucleation. We were able to image the cornea, crystalline lens, and retina at multiple depths. Discrimination of each structure based on their autofluorescence intensity and lifetimes was possible. Furthermore, discrimination between different layers of the same structure was also possible. To the best of our knowledge, this was the first time that 2PE-FLIM was used for porcine lens imaging and layer discrimination. With this study we further demonstrated the feasibility of 2PE-FLIM to image and differentiate three of the main components of the eye and its potential as an ophthalmologic technique.

  19. A LSO scintillator array for a PET detector module with depth of interaction measurement

    International Nuclear Information System (INIS)

    Huber, J.S.; Moses, W.W.; Andreaco, M.S.; Petterson, O.

    2000-01-01

    We present construction methods and performance results for a production scintillator array of 64 optically isolated, 3 mm x 3 mm x 30 mm sized LSO crystals. This scintillator array has been developed for a PET detector module consisting of the 8x8 LSO array coupled on one end to a single photomultiplier tube (PMT) and on the opposite end to a 64 pixel array of silicon photodiodes (PD). The PMT provides an accurate timing pulse and initial energy discrimination, the PD identifies the crystal of interaction, the sum provides a total energy signal, and the PD/(PD+PMT) ratio determines the depth of interaction (DOI). Unlike the previous LSO array prototypes, we now glue Lumirror reflector material directly onto 4 sides of each crystal to obtain an easily manufactured, mechanically rugged array with our desired depth dependence. With 511 keV excitation, we obtain a total energy signal of 3600 electrons, pulse-height resolution of 25% fwhm, and 6-15 mm fwhm DOI resolution

  20. Robustness studies of the photomultipliers reading out TileCal, the central hadron calorimeter of the ATLAS experiment

    CERN Document Server

    Di Gregorio, Giulia; The ATLAS collaboration

    2018-01-01

    The ATLAS Tile Calorimeter (TileCal) is the central section of the hadronic calorimeter of the ATLAS experiment. This sampling calorimeter uses steel plates as absorber and scintillating tiles as active medium. The light produced by the passage of charged particles is transmitted by wavelength shifting fibres to photo-multiplier tubes (PMTs), located in the outer part of the calorimeter. The readout is segmented into about 5000 cells, each one being read out by two PMTs in parallel. The detector readout geometry will not be changed for the Phase II of the High Luminosity Large Hadron Collider (HL-LHC) operation. A challenging goal is to understand whether the full sample of PMTs installed at the beginning of the ATLAS detector operation can be used until completion of the HL-LHC program or not. For this reason, a reliable study of the PMT robustness against ageing is required. Detailed studies modelling the PMT response variation as a function of the integrated anode charge were done. The PMT response evoluti...

  1. A system for the characterization of the HAWC PMTs sensitivity

    Science.gov (United States)

    Langarica, R.; Lara, G.; Martinez, L. A.; Tinoco, S.; Alfaro, R.; Iriarte, A.; Sandoval, A.; Vanegas, P.

    2012-07-01

    The HAWC Project is a very high-energy gamma-ray observatory under construction at the Sierra Negra volcano (4100 meters above sea level) in the Pico de Orizaba National Park located in central Mexico. HAWC will reuse the 900 Hamamatsu R5912 photomultipliers (PMTs) from Milagro Observatory for the 300 Water Cherenkov Detectors. In order to characterize their present performance it is necessary to scan the active area of the photocathode by measuring its efficiency and gain. A characterization system was designed and manufactured to achieve an automated measurement of over 100 points distributed on the PMT active spherical surface. Preliminary results show the variation of QE of PMTs with respect of the position of incoming photons, as well as the changes in the PMTs response due to the Earth's magnetic field and gain vs. high voltage. The system allows automated PMT characterization improving its performance, reliability, precision and repeatability. In this work we present the characterization system and preliminary results on the PMT efficiency.

  2. Women's preferences for contralateral prophylactic mastectomy: An investigation using protection motivation theory.

    Science.gov (United States)

    Tesson, Stephanie; Richards, Imogen; Porter, David; Phillips, Kelly-Anne; Rankin, Nicole; Musiello, Toni; Marven, Michelle; Butow, Phyllis

    2016-05-01

    Most women diagnosed with unilateral breast cancer without BRCA1 or BRCA2 mutations are at low risk of contralateral breast cancer. Contralateral Prophylactic Mastectomy (CPM) decreases the relative risk of contralateral breast cancer, but may not increase life expectancy; yet international uptake is increasing. This study applied protection motivation theory (PMT) to determine factors associated with women's intentions to undergo CPM. Three hundred eighty-eight women previously diagnosed with unilateral breast cancer and of negative or unknown BRCA1 or BRCA2 status were recruited from an advocacy group's research database. Participants completed measures of PMT constructs based on a common hypothetical CPM decision-making scenario. PMT constructs explained 16% of variance in intentions to undergo CPM. Response efficacy (CPM's advantages) and response costs (CPM's disadvantages) were unique individual predictors of intentions. Decision-making appears driven by considerations of the psychological, cosmetic and emotional advantages and disadvantages of CPM. Overestimations of threat to life from contralateral breast cancer and survival benefit from CPM also appear influential factors. Patients require balanced and medically accurate information regarding the pros and cons of CPM, survival rates, and recurrence risks to ensure realistic and informed decision-making.

  3. Women's preferences for selective estrogen reuptake modulators: an investigation using protection motivation theory.

    Science.gov (United States)

    Ralph, Angelique F; Ager, Brittany; Bell, Melanie L; Collins, Ian M; Andrews, Lesley; Tucker, Kathy; Phillips, Kelly-Anne; Butow, Phyllis

    2014-07-01

    Selective estrogen receptor modulators (SERMs) reduce breast cancer risk by 38%. However, uptake is low and the reasons are not well understood. This study applied protection motivation theory (PMT) to determine factors associated with intention to take SERMs. Women at increased risk of breast cancer (N=107), recruited from two familial cancer clinics in Australia, completed a questionnaire containing measures of PMT constructs. Hierarchical multiple linear regression analysis was used to analyze the data. Forty-five percent of women said they would be likely or very likely to take SERMs in the future. PMT components accounted for 40% of variance in intention to take SERMs. Perceived vulnerability, severity and response efficacy appeared the most influential in women's decisions to take or not take SERMs. Many women are interested in SERMs as a risk management option. Accurate risk estimation and an understanding of the benefits of SERMs are critical to women's decision making. Health professionals need to explore women's perceptions of their risk and its consequences, as well as providing clear evidence-based information about the efficacy of SERMs. Exploring the source and strength of beliefs about SERMs may allow more effective, tailored counseling. Copyright © 2014 Elsevier Ireland Ltd. All rights reserved.

  4. The central pixel of the MAGIC telescope for optical observations

    Science.gov (United States)

    Lucarelli, F.; Barrio, J. A.; Antoranz, P.; Asensio, M.; Camara, M.; Contreras, J. L.; Fonseca, M. V.; Lopez, M.; Miranda, J. M.; Oya, I.; Reyes, R. De Los; Firpo, R.; Sidro, N.; Goebel, F.; Lorenz, E.; Otte, N.

    2008-05-01

    The MAGIC telescope has been designed for the observation of Cherenkov light generated in Extensive Air Showers initiated by cosmic particles. However, its 17 m diameter mirror and optical design makes the telescope suitable for direct optical observations as well. In this paper, we report about the development of a system based on the use of a dedicated photo-multiplier (PMT) for optical observations. This PMT is installed in the centre of the MAGIC camera (the so-called central pixel). An electro-to-optical system has been developed in order to transmit the PMT output signal by an optical fibre to the counting room, where it is digitized and stored for off-line analysis. The performance of the system using the optical pulsation of the Crab nebula as calibration source is presented. The time required for a 5σ detection of the Crab pulsar in the optical band is less than 20 s. The central pixel will be mainly used to perform simultaneous observations of the Crab pulsar both in the optical and γ-ray regimes. It will also allow for periodic testing of the precision of the MAGIC timing system using the Crab rotational optical pulses as a very precise timing reference.

  5. Influence of Piezosurgery on Bone Healing around Titanium Implants: A Histological Study in Rats.

    Science.gov (United States)

    Sirolli, Marcelo; Mafra, Carlos Eduardo Secco; Santos, Rodrigo Albuquerque Basílio Dos; Saraiva, Luciana; Holzhausen, Marinella; César, João Batista

    2016-01-01

    The aim of this study was to evaluate histomorphometrically the influence of two techniques of dental implant site preparation on bone healing around titanium implants. Fifteen male Wistar rats (±300 g) were used in the study. Each tibia was randomly assigned to receive the implant site preparation either with a conventional drilling technique (control - DRILL group) or with a piezoelectric device (PIEZO group). The animals were sacrificed after 30 days and then the following histomorphometric parameters were evaluated (percentage) separately for cortical and cancellous regions: proportion of mineralized tissue (PMT) adjacent to implant threads (500 μm adjacent); bone area within the threads (BA) and bone-implant contact (BIC). The results demonstrated that there were no statistically significant differences between both groups for cancellous BIC (p>0.05) and cortical PMT (p>0.05). On the other hand, a higher percentage of BA was observed in the PIEZO group in the cortical (71.50±6.91 and 78.28±4.38 for DRILL and PIEZO groups, respectively; ppiezosurgery also showed higher PMT values in the cancellous zone (9.35±5.54 and 18.72±13.21 for DRILL and PIEZO groups, respectively; ppiezosurgery was beneficial to bone healing rates in the cancellous bone region, while the drill technique produced better results in the cortical bone.

  6. High-speed charge-to-time converter ASIC for the Super-Kamiokande detector

    International Nuclear Information System (INIS)

    Nishino, H.; Awai, K.; Hayato, Y.; Nakayama, S.; Okumura, K.; Shiozawa, M.; Takeda, A.; Ishikawa, K.; Minegishi, A.; Arai, Y.

    2009-01-01

    A new application-specific integrated circuit (ASIC), the high-speed charge-to-time converter (QTC) IWATSU CLC101, provides three channels, each consisting of preamplifier, discriminator, low-pass filter, and charge integration circuitry, optimized for the waveform of a photomultiplier tube (PMT). This ASIC detects PMT signals using individual built-in discriminators and drives output timing signals whose width represents the integrated charge of the PMT signal. Combined with external input circuits composed of passive elements, the QTC provides full analog signal processing for the detector's PMTs, ready for further processing by time-to-digital converters (TDCs). High-rate (>1MHz) signal processing is achieved by short-charge-conversion-time and baseline-restoration circuits. Wide-range charge measurements are enabled by offering three gain ranges while maintaining a short cycle time. QTC chip test results show good analog performance, with efficient detection for a single photoelectron signal, four orders of magnitude dynamic range (0.3mV∼3V; 0.2∼2500pC), 1% charge linearity, 0.2 pC charge resolution, and 0.1 ns timing resolution. Test results on ambient temperature dependence, channel isolation, and rate dependence also meet specifications.

  7. Occulting Light Concentrators in Liquid Scintillator Neutrino Detectors

    Science.gov (United States)

    Buizza Avanzini, Margherita; Cabrera, Anatael; Dusini, Stefano; Grassi, Marco; He, Miao; Wu, Wenjie

    2017-09-01

    The experimental efforts characterizing the era of precision neutrino physics revolve around collecting high-statistics neutrino samples and attaining an excellent energy and position resolution. Next generation liquid-based neutrino detectors, such as JUNO, HyperKamiokande, etc, share the use of a large target mass, and the need of pushing light collection to the edge for maximal calorimetric information. Achieving high light collection implies considerable costs, especially when considering detector masses of several kt. A traditional strategy to maximize the effective photo-coverage with the minimum number of PMTs relies on Light Concentrators (LC), such as Winston Cones. In this paper, the authors introduce a novel concept called Occulting Light Concentrators (OLC), whereby a traditional LC gets tailored to a conventional PMT, by taking into account its single-photoelectron collection efficiency profile and thus occulting the worst performing portion of the photocathode. Thus, the OLC shape optimization takes into account not only the optical interface of the PMT, but also the maximization of the PMT detection performances. The light collection uniformity across the detector is another advantage of the OLC system. By considering the case of JUNO, we will show OLC capabilities in terms of light collection and energy resolution.

  8. Antimalarial agents against both sexual and asexual parasites stages: structure-activity relationships and biological studies of the Malaria Box compound 1-[5-(4-bromo-2-chlorophenyl)furan-2-yl]-N-[(piperidin-4-yl)methyl]methanamine (MMV019918) and analogues.

    Science.gov (United States)

    Vallone, Alessandra; D'Alessandro, Sarah; Brogi, Simone; Brindisi, Margherita; Chemi, Giulia; Alfano, Gloria; Lamponi, Stefania; Lee, Soon Goo; Jez, Joseph M; Koolen, Karin J M; Dechering, Koen J; Saponara, Simona; Fusi, Fabio; Gorelli, Beatrice; Taramelli, Donatella; Parapini, Silvia; Caldelari, Reto; Campiani, Giuseppe; Gemma, Sandra; Butini, Stefania

    2018-04-25

    Therapies addressing multiple stages of Plasmodium falciparum life cycle are highly desirable for implementing malaria elimination strategies. MMV019918 (1, 1-[5-(4-bromo-2-chlorophenyl)furan-2-yl]-N-[(piperidin-4-yl)methyl]methanamine) was selected from the MMV Malaria Box for its dual activity against both asexual stages and gametocytes. In-depth structure-activity relationship studies and cytotoxicity evaluation led to the selection of 25 for further biological investigation. The potential transmission blocking activity of 25 versus P. falciparum was confirmed through the standard membrane-feeding assay. Both 1 and 25 significantly prolonged atrioventricular conduction time in Langendorff-isolated rat hearts, and showed inhibitory activity of Ba 2+ current through Ca v 1.2 channels. An in silico target-fishing study suggested the enzyme phosphoethanolamine methyltransferase (PfPMT) as a potential target. However, compound activity against PfPMT did not track with the antiplasmodial activity, suggesting the latter activity relies on a different molecular target. Nevertheless, 25 showed interesting activity against PfPMT, which could be an important starting point for the identification of more potent inhibitors active against both sexual and asexual stages of the parasite. Copyright © 2018 Elsevier Masson SAS. All rights reserved.

  9. Efficacy of theory-based HIV behavioral prevention among rural-to-urban migrants in China: a randomized controlled trial.

    Science.gov (United States)

    Li, Xiaoming; Lin, Danhua; Wang, Bo; Du, Hongfei; Tam, Cheuk Chi; Stanton, Bonita

    2014-08-01

    Our objective was to evaluate the efficacy of a cultural adaptation of a social cognitive theory-based HIV behavioral prevention program among young rural-to-urban migrants in China. The intervention design and assessment were guided by the Protection Motivation Theory (PMT). The intervention was evaluated through a randomized controlled trial with 6-month and 12-month follow-ups. The primary behavioral outcome was the use of condoms. Other outcome measures include HIV knowledge, condom use knowledge, HIV-related perceptions (PMT constructs), and intention to use condom. The mixed-effects regression models for condom use with regular partners indicated that overall frequency of condom use, condom use in last three sexual acts and proper condom use increased over time for the participants but the increases were significantly greater among the intervention group than the control group at 6-month and 12-month follow-ups. The mixed-effects models for HIV-related perceptions indicated that extrinsic rewards, intrinsic rewards, and response costs decreased while vulnerability, severity, response efficacy, and self-efficacy increased over time for the intervention group. The increases in HIV knowledge, condom use knowledge, and intention to use condom were also significantly greater among the intervention group than the control group. The data in the current study suggested efficacy of a social cognitive theory-based behavioral intervention in increasing condom use among young migrants in China. The intervention also increased protective perceptions and decreased risk perception posited by the theory (i.e., PMT).

  10. Imaging technique of whole-body scintigram in the event of breakdown of the photomultiplier tube

    International Nuclear Information System (INIS)

    Inagaki, Syoichi; Tonami, Syuichi; Yasui, Masakazu; Sugishita, Kouki; Nakamura, Mamoru; Kuranishi, Makoto

    1997-01-01

    When the PMT and preamplifier are out of order, it is impossible to make a correct diagnosis because of defects on the scintigram. However, repair of the equipment may take a long time. In order to perform emergent whole-body scintigrams in the event of such breakdowns, we have developed a new approach named the lead-shield method. The major principles of this method involve placing a lead shield on the gamma camera such that it corresponds to the area of the abnormal PMT and making use of the normal area of the detector. The lead shield, 2 mm thick and 1.5 times as wide as the defect on a planar image, was situated perpendicular to the scan plane of the whole-body scintigram. The results showed that whole-body scintigrams obtained by the lead-shield method had the same quality as those obtained by the conventional method, and the spatial resolution and uniformity showed nearly no change despite some disadvantages such as lower sensitivity and shorter scan length. The lead-shield method can be a useful tool for the performance of whole-body scintigrams in cases of emergency when the PMT and preamplifier are out of order. (author)

  11. Innovative power management, attitude determination and control tile for CubeSat standard NanoSatellites

    Science.gov (United States)

    Ali, Anwar; Mughal, M. Rizwan; Ali, Haider; Reyneri, Leonardo

    2014-03-01

    Electric power supply (EPS) and attitude determination and control subsystem (ADCS) are the most essential elements of any aerospace mission. Efficient EPS and precise ADCS are the core of any spacecraft mission. So keeping in mind their importance, they have been integrated and developed on a single tile called CubePMT module. Modular power management tiles (PMTs) are already available in the market but they are less efficient, heavier in weight, consume more power and contain less number of subsystems. Commercial of the shelf (COTS) components have been used for CubePMT implementation which are low cost and easily available from the market. CubePMT is developed on the design approach of AraMiS architecture: a project developed at Politecnico di Torino that provides low cost and higher performance space missions with dimensions larger than CubeSats. The feature of AraMiS design approach is its modularity. These modules can be reused for multiple missions which helps in significant reduction of the overall budget, development and testing time. One has just to reassemble the required subsystems to achieve the targeted specific mission.

  12. Development and featuring of hemispherical photomultipliers for cosmic ray detection - calibration of surface detectors and analysis of horizontal showers at the Pierre Auger Observatory; Developpement et caracterisation de photomultiplicateurs hemispheriques pour les experiences d'astroparticules - etalonnage des detecteurs de surface et analyse des gerbes horizontales de l'Observatoire Pierre Auger

    Energy Technology Data Exchange (ETDEWEB)

    Dornic, D

    2006-09-15

    The large photomultipliers (PMT) are currently used in astro-particle and neutrino experiments where they have to detect low levels of light. We have studied and characterised large PMTs developed by the PHOTONIS Group Company. The first part of this thesis is dedicated to the full characterization of two types of multipliers currently used in large PMTs. Then, we present results of a new photocathode process, applied on the XPI805 (PMT used in the Pierre Auger Observatory) in order to improve the quantum efficiency. Finally, we study the PMT diameter influence on main parameters (5, 8 and 10 inches). The second part is devoted to the study of the water Cerenkov tank (WCD) response to the shower particles and the horizontal air showers analysis with the Pierre Auger Observatory. The main parameters of a WCD simulation developed in the Auger IPN group were calibrated with several measurements on vertical and inclined muons, performed on dedicated test tanks. The kind of detector used in the surface detector allows detecting very inclined events with a good sensitivity (zenith angle superior to 70 degrees). We have established specific methods to analyze these events (selection and reconstruction). These methods were applied to the Auger data in order to obtain the energy spectrum of the horizontal events. Finally, we detailed two methods to test directly the hadronic models predictions by studying the air showers muonic component. (author)

  13. Imaging technique of whole-body scintigram in the event of breakdown of the photomultiplier tube

    Energy Technology Data Exchange (ETDEWEB)

    Inagaki, Syoichi; Tonami, Syuichi; Yasui, Masakazu; Sugishita, Kouki; Nakamura, Mamoru; Kuranishi, Makoto [Toyama Medical and Pharmaceutical Univ. (Japan). Hospital

    1997-10-01

    When the PMT and preamplifier are out of order, it is impossible to make a correct diagnosis because of defects on the scintigram. However, repair of the equipment may take a long time. In order to perform emergent whole-body scintigrams in the event of such breakdowns, we have developed a new approach named the lead-shield method. The major principles of this method involve placing a lead shield on the gamma camera such that it corresponds to the area of the abnormal PMT and making use of the normal area of the detector. The lead shield, 2 mm thick and 1.5 times as wide as the defect on a planar image, was situated perpendicular to the scan plane of the whole-body scintigram. The results showed that whole-body scintigrams obtained by the lead-shield method had the same quality as those obtained by the conventional method, and the spatial resolution and uniformity showed nearly no change despite some disadvantages such as lower sensitivity and shorter scan length. The lead-shield method can be a useful tool for the performance of whole-body scintigrams in cases of emergency when the PMT and preamplifier are out of order. (author)

  14. Characterization of Magnetic Field Immersed Photomultipliers from Double Chooz Experiment. Design and Construction of their Magnetic Shields

    International Nuclear Information System (INIS)

    Valdivia Valero, F. J.

    2007-01-01

    Flavour oscillations of neutrinos are a quantum-mechanical effect widely demonstrated. It is explained through interferences of their mass eigenstates, therefore, belonging to the physical area beyond the Standard Model. This work deals with the CIEMAT collaboration in the neutrino experiment Double Chooz. Such an experiment aims to measure the mixture angle θ 1 3, one of the PMNS leptonic mixture matrix, with a un reached-before sensibility by decrease of systematic errors. For this, two identical scintillator detectors, equipped with PMT's, will be sited at different distances from two reactors located in the nuclear power plant CHOOZ B (France). The electronic neutrino flux from these reactors will be compared, explaining its deficit by flavour oscillations of these particles. The identity of both detectors will be diminished by the magnetic field effects on the PMT's response. Therefore, this study serves as for quantifying such an effects as for fitting the magnetic shields design that minimize them. Shielding measurements and final design of magnetic shields as much as the effect these ones cause in the PMT's response immersed in a monitored magnetic field are presented. (Author) 85 refs

  15. CBM RICH geometry optimization

    Energy Technology Data Exchange (ETDEWEB)

    Mahmoud, Tariq; Hoehne, Claudia [II. Physikalisches Institut, Giessen Univ. (Germany); Collaboration: CBM-Collaboration

    2016-07-01

    The Compressed Baryonic Matter (CBM) experiment at the future FAIR complex will investigate the phase diagram of strongly interacting matter at high baryon density and moderate temperatures in A+A collisions from 2-11 AGeV (SIS100) beam energy. The main electron identification detector in the CBM experiment will be a RICH detector with a CO{sub 2} gaseous-radiator, focusing spherical glass mirrors, and MAPMT photo-detectors being placed on a PMT-plane. The RICH detector is located directly behind the CBM dipole magnet. As the final magnet geometry is now available, some changes in the RICH geometry become necessary. In order to guarantee a magnetic field of 1 mT at maximum in the PMT plane for effective operation of the MAPMTs, two measures have to be taken: The PMT plane is moved outwards of the stray field by tilting the mirrors by 10 degrees and shielding boxes have been designed. In this contribution the results of the geometry optimization procedure are presented.

  16. The effects of Earth's magnetic field on 3-inch diameter photomultipliers used in KM3NeT neutrino telescope

    Directory of Open Access Journals (Sweden)

    Giordano V.

    2016-01-01

    Full Text Available The KM3NeT neutrino telescope will be the largest underwater neutrino telescope and will be located in the abyss of the Mediterranean Sea. In neutrino telescopes the key element of the detector is the optical module and for KM3NeT it consists of 31 PMTs stored inside a transparent pressure-resistant glass sphere of 17-inch that serves as mechanical protection while ensuring good light transmission. Since the PMTs installed into an underwater neutrino telescope can change their orientation because of movements of the detector structure due to sea currents, the influence of Earth's magnetic field has been investigated. Magnetic shielding by means of a mu-metal cage is used to reduce magnetic effects and to make the response of the PMT sufficiently orientation independent. In order to quantify the effect on magnetic field, we compared measurements on variation of gain, transit time spread and detection efficiency for a 3-inch PMT in shielded and unshielded condition at 3 PMT inclinations. Data shows that variations are sufficiently low especially for timing properties.

  17. A Resettable Keypad Lock with Visible Readout Based on Closed Bipolar Electrochemistry and Electrochromic Poly(3-methylthiophene) Films.

    Science.gov (United States)

    Wang, Lei; Lian, Wenjing; Liu, Hongyun

    2016-03-24

    A closed bipolar electrode (BPE) system was developed with electrochromic poly(3-methylthiophene) (PMT) films electropolymerized on the ITO/rGO electrode as one pole of BPE in the reporting reservoir and the bare ITO electrode as another pole of BPE in the analyte reservoir, in which rGO represents reduced graphene oxide. Under a suitable driving voltage (Vtot), the electrochemical reduction/oxidation of electroactive probes, such as H2O2/glutathione (Glu), in the analyte reservoir could induce the reversible color change of PMT films in the reporting reservoir between blue and red. Based on this, a keypad lock with H2O2 , Glu, and Vtot =-3.0 V as the three inputs and the color change of PMT films as the visible output was established. This system was easily operated and did not need to synthesize the complex compounds or DNA molecules. The security system was easy to reset and could be used repeatedly. © 2016 WILEY-VCH Verlag GmbH & Co. KGaA, Weinheim.

  18. Locally aggressive and multifocal phosphaturic mesenchymal tumors: two unusual cases of tumor-induced osteomalacia.

    Science.gov (United States)

    Higley, Meghan; Beckett, Brooke; Schmahmann, Sandra; Dacey, Elizabeth; Foss, Erik

    2015-12-01

    Tumor-induced osteomalacia (TIO) has long been recognized as a clinical paraneoplastic syndrome. The identification of a unique histopathologic entity, the phosphaturic mesenchymal tumor (PMT), as a distinct etiology for TIO has been a more recent discovery. The majority of published cases describe a solitary, non-aggressive appearing soft tissue or osseous lesions in patients with osteomalacia; aggressive appearing or multifocal lesions appear to be exceedingly rare. These tumors characteristically secrete fibroblast growth factor 23 (FGF23). Elevated serum levels of FGF23 result in phosphate wasting and osteomalacia. In the majority of cases, laboratory abnormalities and clinical signs and symptoms of osteomalacia precede identification of the causative lesion by years. Following diagnosis, complete resection with wide margins to prevent local recurrence is most often curative. Imaging characteristics of PMT are diverse and remain incompletely defined, as the majority of previous publications are outside of the radiologic literature. We present multiple imaging modalities in two cases of patients with debilitating osteomalacia and unusual appearing PMTs: one with a locally aggressive lesion leading to pathologic fracture, the second presenting with exceedingly rare multifocal PMT.

  19. Comparison of (31)P saturation and inversion magnetization transfer in human liver and skeletal muscle using a clinical MR system and surface coils.

    Science.gov (United States)

    Buehler, Tania; Kreis, Roland; Boesch, Chris

    2015-02-01

    (31)P MRS magnetization transfer ((31)P-MT) experiments allow the estimation of exchange rates of biochemical reactions, such as the creatine kinase equilibrium and adenosine triphosphate (ATP) synthesis. Although various (31)P-MT methods have been successfully used on isolated organs or animals, their application on humans in clinical scanners poses specific challenges. This study compared two major (31)P-MT methods on a clinical MR system using heteronuclear surface coils. Although saturation transfer (ST) is the most commonly used (31)P-MT method, sequences such as inversion transfer (IT) with short pulses might be better suited for the specific hardware and software limitations of a clinical scanner. In addition, small NMR-undetectable metabolite pools can transfer MT to NMR-visible pools during long saturation pulses, which is prevented with short pulses. (31)P-MT sequences were adapted for limited pulse length, for heteronuclear transmit-receive surface coils with inhomogeneous B1 , for the need for volume selection and for the inherently low signal-to-noise ratio (SNR) on a clinical 3-T MR system. The ST and IT sequences were applied to skeletal muscle and liver in 10 healthy volunteers. Monte-Carlo simulations were used to evaluate the behavior of the IT measurements with increasing imperfections. In skeletal muscle of the thigh, ATP synthesis resulted in forward reaction constants (k) of 0.074 ± 0.022 s(-1) (ST) and 0.137 ± 0.042 s(-1) (IT), whereas the creatine kinase reaction yielded 0.459 ± 0.089 s(-1) (IT). In the liver, ATP synthesis resulted in k = 0.267 ± 0.106 s(-1) (ST), whereas the IT experiment yielded no consistent results. ST results were close to literature values; however, the IT results were either much larger than the corresponding ST values and/or were widely scattered. To summarize, ST and IT experiments can both be implemented on a clinical body scanner with heteronuclear transmit-receive surface coils; however, ST results are

  20. The factors affecting cervical cancer screening among addicted women of Hamedan in 2015: On the basis of Protection Motivation Theory model

    Directory of Open Access Journals (Sweden)

    2017-01-01

    Full Text Available Background and Objectives:  Cervical cancer is one of the most common types of genital cancer among women in developing countries. Addicted women are among the high-risk group of patients who suffer from cervical cancer. Health Protection Motivation Theory (PMT is one of the theories that emphasizes on fear effects of health risks (such as diseases on attitudes and health behaviors. Thus, this study was performed to determine the factors associated with cervical cancer screening behavior using PMT on addicted women referring to addiction treatment center of Hamedan in 2015. Methods: The current study was conducted on 56 addicted women referring to Hannah's Methadone Therapy Counseling Center in June 2015. A researcher-made questionnaire which comprised of three sections (demographics, knowledge and assessment of the PMT constructs was used to collect data. The validity of questionnaire was evaluated using content validity method and test-retest test was used to measure reliability. Data were analyzed statistically by SPSS version 16 and using T-test, Chi-Square and ANOVA tests. Results: The mean age of all participants was 46.48±10.82 years. The average duration of addiction was 8.11±7.22 years. Of all samples, 53.6% had never done any Pap smear test. There was not a  significant relevance between test performance (screening method and the marital status, income or the last pregnancy method. However, there was a significant relationship between test performance and education (P=0.041, awareness level (P<0.001, structures of motivation (P<0.001, perceived costs (P=0.031, perceived rewards (P=0.001, self-efficacy (P<0.001 and efficient response (P<0.001. Conclusion: We showed that there was a significant relevance between test performance and the level of awareness and various domains of PMT. Thus, it is recommended that PMT could be used during educational interventions and counseling procedures.

  1. Impact of intense x-ray pulses on a NaI(Tl)-based gamma camera

    Science.gov (United States)

    Koppert, W. J. C.; van der Velden, S.; Steenbergen, J. H. L.; de Jong, H. W. A. M.

    2018-03-01

    In SPECT/CT systems x-ray and γ-ray imaging is performed sequentially. Simultaneous acquisition may have advantages, for instance in interventional settings. However, this may expose a gamma camera to relatively high x-ray doses and deteriorate its functioning. We studied the NaI(Tl) response to x-ray pulses with a photodiode, PMT and gamma camera, respectively. First, we exposed a NaI(Tl)-photodiode assembly to x-ray pulses to investigate potential crystal afterglow. Next, we exposed a NaI(Tl)-PMT assembly to 10 ms LED pulses (mimicking x-ray pulses) and measured the response to flashing LED probe-pulses (mimicking γ-pulses). We then exposed the assembly to x-ray pulses, with detector entrance doses of up to 9 nGy/pulse, and analysed the response for γ-pulse variations. Finally, we studied the response of a Siemens Diacam gamma camera to γ-rays while exposed to x-ray pulses. X-ray exposure of the crystal, read out with a photodiode, revealed 15% afterglow fraction after 3 ms. The NaI(Tl)-PMT assembly showed disturbances up to 10 ms after 10 ms LED exposure. After x-ray exposure however, responses showed elevated baselines, with 60 ms decay-time. Both for x-ray and LED exposure and after baseline subtraction, probe-pulse analysis revealed disturbed pulse height measurements shortly after exposure. X-ray exposure of the Diacam corroborated the elementary experiments. Up to 50 ms after an x-ray pulse, no events are registered, followed by apparent energy elevations up to 100 ms after exposure. Limiting the dose to 0.02 nGy/pulse prevents detrimental effects. Conventional gamma cameras exhibit substantial dead-time and mis-registration of photon energies up to 100 ms after intense x-ray pulses. This is due PMT limitations and due to afterglow in the crystal. Using PMTs with modified circuitry, we show that deteriorative afterglow effects can be reduced without noticeable effects on the PMT performance, up to x-ray pulse doses of 1 nGy.

  2. High spatial resolution measurement of depth-of-interaction of a PET LSO crystal

    International Nuclear Information System (INIS)

    Simon, A.; Kalinka, G.; Novak, D.; Sipos, A.; Vegh, J.; Molnar, J.

    2004-01-01

    Complete text of publication follows. A new type of experimental technique to investigate the depth-of-interaction (DOI) dependence in small scintillator elements designed for high-resolution animal PET [1] has been introduced at our institute, recently. A lutetium oxyorthosilicate (LSO) crystal (2x2x10 mm 3 ) was irradiated with a highly focused 2 MeV He + beam at the ATOMKI nuclear microprobe laboratory. Pulse height spectra from a photomultiplier (PMT) attached to one end of the LSO crystal were collected in list mode. Sequential scans of 1000x1000 μm 2 areas along the 10 mm long crystal were made to get high lateral resolution images of pulse height spectra at different distances from the window of the PMT. A mean pulse height algorithm was applied to each pixel to generate two dimensional intensity images and the corresponding spectra of 100 μmx1 mm areas. Representative pulse height spectra are shown in Fig. 1 for different distances between the position of irradiation and the PMT. The mean value of the pulse height spectrum describing the position of the full energy peak is a way to measure DOI effects. It is seen that the closer the DOI to the PMT-end of the crystal the higher the energy of the peak. The centre of the detected peak varies about 30 % along the lateral side of the crystal. This effect is due to the increasing number of reflections with associated loss of light when the distance between the DOI position and the light collecting PMT grows. Further these results, no difference in the light intensity was found depending on which position across (perpendicular to the length of) the crystal was irradiated with the microbeam. The obtained results of the overall DOI dependence confirm previous measurements on LSO crystals with similar geometry and wrapping but based on collimated gamma-ray irradiation. Since the present experimental setup allows obtaining data with several orders of magnitude better spatial resolution (from μm up to mm) than with

  3. New methods of data calibration for high power-aperture lidar.

    Science.gov (United States)

    Guan, Sai; Yang, Guotao; Chang, Qihai; Cheng, Xuewu; Yang, Yong; Gong, Shaohua; Wang, Jihong

    2013-03-25

    For high power-aperture lidar sounding of wide atmospheric dynamic ranges, as in middle-upper atmospheric probing, photomultiplier tubes' (PMT) pulse pile-up effects and signal-induced noise (SIN) complicates the extraction of information from lidar return signal, especially from metal layers' fluorescence signal. Pursuit for sophisticated description of metal layers' characteristics at far range (80~130km) with one PMT of high quantum efficiency (QE) and good SNR, contradicts the requirements for signals of wide linear dynamic range (i.e. from approximate 10(2) to 10(8) counts/s). In this article, Substantial improvements on experimental simulation of Lidar signals affected by PMT are reported to evaluate the PMTs' distortions in our High Power-Aperture Sodium LIDAR system. A new method for pile-up calibration is proposed by taking into account PMT and High Speed Data Acquisition Card as an Integrated Black-Box, as well as a new experimental method for identifying and removing SIN from the raw Lidar signals. Contradiction between the limited linear dynamic range of raw signal (55~80km) and requirements for wider acceptable linearity has been effectively solved, without complicating the current lidar system. Validity of these methods was demonstrated by applying calibrated data to retrieve atmospheric parameters (i.e. atmospheric density, temperature and sodium absolutely number density), in comparison with measurements of TIMED satellite and atmosphere model. Good agreements are obtained between results derived from calibrated signal and reference measurements where differences of atmosphere density, temperature are less than 5% in the stratosphere and less than 10K from 30km to mesosphere, respectively. Additionally, approximate 30% changes are shown in sodium concentration at its peak value. By means of the proposed methods to revert the true signal independent of detectors, authors approach a new balance between maintaining the linearity of adequate signal (20

  4. Study and realization of pixelated APD Geiger photodetectors of very high sensitivity for Very High Energy gamma astronomy

    International Nuclear Information System (INIS)

    Jradi, K.

    2010-07-01

    Very High Energy gamma ray astronomy uses till now exclusively as detector the Photomultiplier Tube (PMT) to collect weak light flux of atmospheric showers. But an alternative is now emerging: Avalanche Photodiodes polarized in Geiger mode called 'Geiger-APD'. The PMT is a detector designed in the 70's which presents many advantages but also suffers from several drawbacks: size, weight, cost, sensitivity to magnetic field but especially difficulty to realize its pixelation in matrix. Geiger-APDs are semi-conductor devices made of PN junction integrated in a special technology to detect very low light flux, thanks to the polarization beyond the avalanche voltage. Geiger-APD presents very high photoelectron gain (∼106) strongly dependant on the polarization voltage beyond avalanche. These photodiodes present many advantages with respect to PMT, mainly as concerns miniaturization for applications based on imaging, such as the detection of Cerenkov flashes in gamma ray astronomy. In this thesis, we present the study, the design and the realization of a technological structure, based on Silicon. This structure has shown reliability to detect weak luminous flux with breakdown voltage at 12 V and dark current below 10 pA at breakdown. We also developed several models, physical and electrical, necessary to the technological optimization, as well to the development of control and readout circuits, i.e. the basis of any imaging technology. The work presented here consists in the study, the design and the realization of a matrix of high sensitivity pixels. A project of a Cerenkov telescope based on this innovative technology is also presented. (author)

  5. Inter-crystal scatter identification for a depth-sensitive detector using support vector machine for small animal positron emission tomography

    International Nuclear Information System (INIS)

    Yoshida, Eiji; Kitamura, Keishi; Kimura, Yuichi; Nishikido, Fumihiko; Shibuya, Kengo; Yamaya, Taiga; Murayama, Hideo

    2007-01-01

    In a conventional positron emission tomography (PET) detector, detected events are projected onto a 2D position histogram by an Anger calculation for crystal identification. However, the measured histogram is affected by inter-crystal scatterings (ICS) which occur in the entire detector. Peaks which are projected for each crystal in the histogram are blurred, and this causes ICS mispositioning. A depth-of-interaction (DOI) detector has been developed for the small animal PET scanner jPET-RD. This DOI detector uses 32x32 crystals with four layers and a 256-channel multi-anode flat panel photomultiplier tube (FP-PMT) which was developed by Hamamatsu Photonics K.K. Each crystal element is 1.45x1.45x4.5 mm 3 . The FP-PMT has a large detective area (49x49 mm 2 ) and a small anode pitch (3.04 mm). Therefore, the FP-PMT can extensively trace the behavior of incident γ rays in the crystals including ICS event. We, therefore, propose a novel method for ICS estimation using a statistical pattern recognition algorithm based on a support vector machine (SVM). In this study, we applied the SVM for discriminating photoelectric events from ICS events generated from multiple-anode outputs. The SVM was trained by uniform irradiation events generated from a detector simulator using a Monte Carlo calculation. The success rate for ICS event identification is about 78% for non-training data. The SVM can achieve a true subtraction of ICS events from measured events, and it is also useful for random correction in PET

  6. Duration and mutual entrainment of changes in parenting practices engendered by behavioral parent training targeting recently separated mothers.

    Science.gov (United States)

    Reed, Andrea; Snyder, James; Staats, Sarah; Forgatch, Marion S; Degarmo, David S; Patterson, Gerald R; Low, Sabina; Sinclair, Ryan; Schmidt, Nicole

    2013-06-01

    Parent management training (PMT) has beneficial effects on child and parent adjustment that last for 5 to 10 years. Short-term changes in parenting practices have been shown to mediate these effects, but the manner in which changes in specific components of parenting are sequenced and become reciprocally reinforcing (or mutually entrained) to engender and sustain the cascade of long-term beneficial effects resulting from PMT has received modest empirical attention. Long-term changes in parenting resulting from the Oregon model of PMT (PMTO) over a 2-year period were examined using data from the Oregon Divorce Study-II in which 238 recently separated mothers and their 6- to 10-year-old sons were randomly assigned to PMTO or a no treatment control (NTC) group. Multiple indicators of observed parenting practices were used to define constructs for positive parenting, monitoring and discipline at baseline, and at 6-, 12-, 18- and 30-months postbaseline. PMTO relative to NTC resulted in increased positive parenting and prevented deterioration in discipline and monitoring over the 30-month period. There were reliable sequential, transactional relationships among parenting practices; positive parenting supported better subsequent monitoring, and positive parenting and better monitoring supported subsequent effective discipline. Small improvements in parenting resulting from PMTO and small deteriorations in parenting in the NTC group may be sustained and amplified by mutually entrained relationships among parenting practices. These data about the change processes engendered by PMTO may provide information needed to enhance the power, effectiveness, and efficiency of behavioral parent training interventions.

  7. Effect of Motivational Interviewing on a Weight Loss Program Based on the Protection Motivation Theory.

    Science.gov (United States)

    Mirkarimi, Kamal; Mostafavi, Firoozeh; Eshghinia, Samira; Vakili, Mohammad Ali; Ozouni-Davaji, Rahman Berdi; Aryaie, Mohammad

    2015-06-01

    The prevalence of overweight and obesity is on the increase the world over, which imposes an ever-increasing burden on societies and health care systems. This study sought to investigate the effect of motivational interviewing (MI) on a weight-loss program based on the protection motivation theory (PMT). This randomized clinical trial study, comprising pretest-posttest with a control group, was conducted on 150 overweight and obese women attending a private nutrition clinic for the first time. Samples were randomly selected using the clinic's records and then allocated to three groups (50 women in each group) receiving: 1) a standard weight-control program; 2) motivational interviewing; and 3) MI plus intention intervention. Data were collected using a researcher-made questionnaire through in-person interviews and were analyzed using SPSS (version 11) and statistical tests, including the Kruskal-Wallis test, one-way analysis of variance, paired t-test, and linear regression model. In the two intervention groups, the PMT construct scores, namely susceptibility (P = 0.001), severity (P = 0.001), rewards (P =0.004), self-efficacy (P = 0.001), response efficacy (P = 0.001), and costs (P = 0.014), were significantly increased compared to those in the control group. The anthropometric status was statistically significant in the MI group (P = 0.001) and the MI plus intention-intervention group (P = 0.001) at 2 months' follow-up, while in the control group, weight was meaningfully different after the intervention (P = 0.027). Weight was different between the groups after the intervention, with the Tukey test demonstrating that the differences were statistically significant between the control group and the MI group. Our results demonstrated that MI, combined with the implementation of intention intervention, increased weight loss and PMT construct scores in our study population.

  8. Inter-crystal scatter identification for a depth-sensitive detector using support vector machine for small animal positron emission tomography

    Energy Technology Data Exchange (ETDEWEB)

    Yoshida, Eiji [National Institute of Radiological Sciences, Anagawa 4-9-1 Inage-ku, Chiba-shi, Chiba 263-8555 (Japan)]. E-mail: rush@nirs.go.jp; Kitamura, Keishi [National Institute of Radiological Sciences, Anagawa 4-9-1 Inage-ku, Chiba-shi, Chiba 263-8555 (Japan); Shimadzu Corporation, Nishinokyo Kuwabaracho 1 Nakagyo-ku, Kyoto-shi, Kyoto 604-8511 (Japan); Kimura, Yuichi [Tokyo Metropolitan Institute of Gerontology, Nakamachi 1-1 Itabashi-ku, Tokyo 173-0022 (Japan); Nishikido, Fumihiko [National Institute of Radiological Sciences, Anagawa 4-9-1 Inage-ku, Chiba-shi, Chiba 263-8555 (Japan); Shibuya, Kengo [National Institute of Radiological Sciences, Anagawa 4-9-1 Inage-ku, Chiba-shi, Chiba 263-8555 (Japan); Yamaya, Taiga [National Institute of Radiological Sciences, Anagawa 4-9-1 Inage-ku, Chiba-shi, Chiba 263-8555 (Japan); Murayama, Hideo [National Institute of Radiological Sciences, Anagawa 4-9-1 Inage-ku, Chiba-shi, Chiba 263-8555 (Japan)

    2007-02-01

    In a conventional positron emission tomography (PET) detector, detected events are projected onto a 2D position histogram by an Anger calculation for crystal identification. However, the measured histogram is affected by inter-crystal scatterings (ICS) which occur in the entire detector. Peaks which are projected for each crystal in the histogram are blurred, and this causes ICS mispositioning. A depth-of-interaction (DOI) detector has been developed for the small animal PET scanner jPET-RD. This DOI detector uses 32x32 crystals with four layers and a 256-channel multi-anode flat panel photomultiplier tube (FP-PMT) which was developed by Hamamatsu Photonics K.K. Each crystal element is 1.45x1.45x4.5 mm{sup 3}. The FP-PMT has a large detective area (49x49 mm{sup 2}) and a small anode pitch (3.04 mm). Therefore, the FP-PMT can extensively trace the behavior of incident {gamma} rays in the crystals including ICS event. We, therefore, propose a novel method for ICS estimation using a statistical pattern recognition algorithm based on a support vector machine (SVM). In this study, we applied the SVM for discriminating photoelectric events from ICS events generated from multiple-anode outputs. The SVM was trained by uniform irradiation events generated from a detector simulator using a Monte Carlo calculation. The success rate for ICS event identification is about 78% for non-training data. The SVM can achieve a true subtraction of ICS events from measured events, and it is also useful for random correction in PET.

  9. The influence of knowledge and perception of the risk of cervical cancer on screening behavior in mainland Chinese women.

    Science.gov (United States)

    Gu, Can; Chan, Carmen W H; Twinn, Sheila; Choi, Kai Chow

    2012-12-01

    Theories of health behavior and empirical research highlight the risk perception as a significant factor for people adopting cancer screening. However, screening uptakes and risk perception of cervical cancer in mainland Chinese women remains unknown. This paper adopted the protection motivation theory (PMT) to examine Chinese women's knowledge and perceptions of cervical cancer risk and factors influencing utilization of cervical screening. A self-administered questionnaire was completed by 167 participants in mainland China (79 nonscreened and 88 screened women) in 2007 which consisted of four sections: background information, women's attendance pattern for cervical screening, perceptions related to body health and knowledge about cervical cancer and screening, and PMT measures. All women considered themselves at low risk of cervical cancer. No significant association was observed between previous screening uptake and PMT variables. Using multivariate analysis, having children, a perception that visiting doctors regularly is important to health, average and high levels of knowledge about cervical screening were significantly associated with having been received screening. Chinese women demonstrated an unrealistic optimism about their personal risk of cervical cancer. The findings do not support an association between risk perception and screening uptake. In spite of this, current findings revealed some possible factors influencing women's screening behavior. This study highlights the significance of knowledge and culturally-relevant health behavior and beliefs about cervical screening for Chinese women in determining whether or not they receive screening. The promotion of cervical cancer prevention and early detection should be integrated into public education about women's health. Copyright © 2011 John Wiley & Sons, Ltd.

  10. Recombinational micro-evolution of functionally different metallothionein promoter alleles from Orchesella cincta

    Directory of Open Access Journals (Sweden)

    van Straalen Nico M

    2007-06-01

    Full Text Available Abstract Background Metallothionein (mt transcription is elevated in heavy metal tolerant field populations of Orchesella cincta (Collembola. This suggests that natural selection acts on transcriptional regulation of mt in springtails at sites where cadmium (Cd levels in soil reach toxic values This study investigates the nature and the evolutionary origin of polymorphisms in the metallothionein promoter (pmt and their functional significance for mt expression. Results We sequenced approximately 1600 bp upstream the mt coding region by genome walking. Nine pmt alleles were discovered in NW-European populations. They differ in the number of some indels, consensus transcription factor binding sites and core promoter elements. Extensive recombination events between some of the alleles can be inferred from the alignment. A deviation from neutral expectations was detected in a cadmium tolerant population, pointing towards balancing selection on some promoter stretches. Luciferase constructs were made from the most abundant alleles, and responses to Cd, paraquat (oxidative stress inducer and moulting hormone were studied in cell lines. By using paraquat we were able to dissect the effect of oxidative stress from the Cd specific effect, and extensive differences in mt induction levels between these two stressors were observed. Conclusion The pmt alleles evolved by a number of recombination events, and exhibited differential inducibilities by Cd, paraquat and molting hormone. In a tolerant population from a metal contaminated site, promoter allele frequencies differed significantly from a reference site and nucleotide polymorphisms in some promoter stretches deviated from neutral expectations, revealing a signature of balancing selection. Our results suggest that the structural differences in the Orchesella cincta metallothionein promoter alleles contribute to the metallothionein -over-expresser phenotype in cadmium tolerant populations.

  11. A handy time alignment probe for timing calibration of PET scanners

    International Nuclear Information System (INIS)

    Bergeron, Melanie; Pepin, Catherine M.; Arpin, Louis; Leroux, Jean-Daniel; Tetrault, Marc-Andre; Viscogliosi, Nicolas; Fontaine, Rejean; Lecomte, Roger

    2009-01-01

    Accurate time alignment of detectors in PET scanners is required for improving overall coincidence timing resolution. This is mandatory to reduce the coincidence time window of the scanner and limit as much as possible the rate of random events in images. Several techniques have been proposed so far, but most have shortcomings relating to difficult use, collection of huge amount of data or long acquisition times, not to mention transport regulation of radioactive source embedded in time alignment probes. A handy liquid scintillation beta probe was developed to overcome these problems. It consists of a PMT coupled to a small glass container that can be filled with a liquid scintillation cocktail loaded with radioactivity (such as 18 F). The PMT signal is processed by an analog CFD and a digital TDC supplying an accurate timestamp on positron detection. When tested in coincidence with a fast PMT/plastic detector, a timing resolution of 1.1 ns FWHM was obtained using a standard off-the-shelf liquid cocktail having a scintillation decay time of 6.2 ns. For time alignment, coincidences are recorded between positron detected by the probe and one of the two 511 keV annihilation photons reaching detectors in the scanner. Using this simple probe, it is possible to determine the time offsets for individual LYSO and LGSO crystals in LabPET TM scanners in about 15 min. Due to its ease of use and short acquisition time, the proposed timing calibration method was found ideal for tuning the APD bias of individual detectors to reach optimal timing resolution on every channel.

  12. Lifetime of MCP-PMTs and other performance features

    Science.gov (United States)

    Lehmann, A.; Böhm, M.; Eyrich, W.; Miehling, D.; Pfaffinger, M.; Stelter, S.; Uhlig, F.; Ali, A.; Belias, A.; Dzhygadlo, R.; Gerhardt, A.; Götzen, K.; Kalicy, G.; Krebs, M.; Lehmann, D.; Nerling, F.; Patsyuk, M.; Peters, K.; Schepers, G.; Schmitt, L.; Schwarz, C.; Schwiening, J.; Traxler, M.; Düren, M.; Etzelmüller, E.; Föhl, K.; Hayrapetyan, A.; Kreutzfeld, K.; Merle, O.; Rieke, J.; Schmidt, M.; Wasem, T.; Achenbach, P.; Cardinali, M.; Hoek, M.; Lauth, W.; Schlimme, S.; Sfienti, C.; Thiel, M.

    2018-02-01

    The bar PANDA experiment at FAIR will use DIRC detectors for the separation of hadrons. The compactness of the bar PANDA detector requires the image planes of these detectors to be placed inside the magnetic field of the solenoid. Due to this and other boundary conditions MCP-PMTs were identified as the only suitable photon sensors. Until recently the major obstacle for an application of MCP-PMTs in high rate experiments like bar PANDA were serious aging problems which led to damage at the photo-cathode and a fast declining quantum efficiency as the integrated anode charge (IAC) increased. With new countermeasures against the aging, in particular due to the application of an atomic layer deposition (ALD) technique to coat the MCP pores, the lifetime of MCP-PMTs has meanwhile increased by a factor >50 which is fully sufficient for bar PANDA. The recent results of our long-term lifetime measurements are discussed. New 2-inch MCP-PMT prototypes from Hamamatsu show an encouraging behavior. However, the currently best performing MCP-PMT is a 2-inch PHOTONIS tube with two ALD-layers which reaches an IAC of >16 C/cm2 without any visible sign of aging. In the second part of these proceedings a new data acquisition system of the PADIWA/TRB type is presented which allows a quasi-parallel measurement of many MCP-PMT performance parameters. Especially unwanted effects like dark-count rate, crosstalk, ion after-pulsing, and recoil electrons can be studied in more detail than ever before. Exemplary results for these parameters are shown. The discussed DAQ system will be used for the comprehensive data quality checks of the MCP-PMTs being built into the DIRCs.

  13. Development and characterisation of a front-end ASIC for macro array of photo-detectors of large dimensions

    International Nuclear Information System (INIS)

    Conforti Di Lorenzo, S.

    2010-10-01

    The coverage of large areas of photo-detection is a crucial element of experiments studying high energy atmospheric cosmic showers and neutrinos from different sources. The objective of this project is to realize big detectors using thousands of photomultipliers (PMT). The project proposes to segment the large surface of photo-detection into macro pixels consisting of an array of 16 PMT of 12 inches (2*2 m 2 ), connected to an autonomous front-end electronics which works in without-trigger data acquisition mode placed near the array. This is possible thanks to the microelectronics progress that allows to integrate the readout and the signal processing, of all the multipliers, in the same circuit (ASIC) named PARISROC (Photomultiplier Array Integrated ins SiGe Read Out Chip). The ASIC must only send out the digital data by network to the surface central data storage. The PARISROC chip made in AM's Silicon Germanium (SiGe) 0.35 μm technology, integrates 16 independent channels for each PMT of the array, providing charge and time measurements. The first prototype of PARISROC chip has a total surface of 19 mm 2 . The ASIC measurements have led to the realization of a second prototype. Important measurements were performed in terms of noise, dynamic range, readout frequency (from 10 MHz to 40 MHz), time measurements (TDC improvements) and charge measurements (Slow shaper improvements). This new prototype of PARISROC-2 has been tested and the characterisation has shown a good overall behavior and the verification of the improvements. (author)

  14. TH-C-19A-10: Systematic Evaluation of Photodetectors Performances for Plastic Scintillation Dosimetry

    International Nuclear Information System (INIS)

    Boivin, J; Beaulieu, L; Beddar, S; Guillemette, M

    2014-01-01

    Purpose: To assess and compare the performance of different photodetectors likely to be used in a plastic scintillation detector (PSD). Methods: The PSD consists of a 1 mm diameter, 10 mm long plastic scintillation fiber (BCF-60) which is optically coupled to a clear 10 m long optical fiber of the same diameter. A light-tight plastic sheath covers both fibers and the scintillator end is sealed. The clear fiber end is connected to one of the following six studied photodetectors: two polychromatic cameras (one with an optical lens and one with a fiber optic taper replacing the lens); a monochromatic camera with the same optical lens; a PIN photodiode; an avalanche photodiode (APD); and a photomultiplier tube (PMT). Each PSD is exposed to both low energy beams (120, 180, and 220 kVp) from an orthovoltage unit, and high energy beams (6 MV and 23 MV) from a linear accelerator. Various dose rates are explored to identify the photodetectors operating ranges and accuracy. Results: For all photodetectors, the relative uncertainty remains under 5 % for dose rates over 3 mGy/s. The taper camera collects four times more signal than the optical lens camera, although its standard deviation is higher since it could not be cooled. The PIN, APD and PMT have higher sensitivity, suitable for low dose rate and out-of-field dose monitoring. PMT's relative uncertainty remains under 1 % at the lowest dose rate achievable (50 μGy/s), suggesting optimal use for live dosimetry. Conclusion: A set of 6 photodetectors have been studied over a broad dose rate range at various energies. For dose rate above 3 mGy/s, the PIN diode is the most effective photodetector in term of performance/cost ratio. For lower dose rate, such as those seen in interventional radiology, PMTs are the optimal choice. FQRNT Doctoral Research Scholarship

  15. Epistaxis after partial middle turbinectomy: the role of sphenopalatine artery ligation.

    Science.gov (United States)

    Cassano, Michele; Cassano, Pasquale

    2012-01-01

    Extensive nasal polyposis could involve the middle turbinate inducing the surgeon to partially remove it. We initiated this retrospective study to evaluate the effect of a partial middle turbinectomy (PMT) on postoperative epistaxis and if sphenopalatine artery ligation (SPAL) could reduce the risk of bleeding in patients without nasal packing. Twenty-seven patients with extended bilateral nasal polyposis and submitted to primary functional endoscopic sinus surgery (FESS) with PMT on 40 sides were retrospectively selected. Postoperative bleeding and other complications were evaluated and compared with those of a control group of 27 patients who underwent FESS with middle turbinate preservation on 40 sides. The study group was furthermore divided into 2 groups according to the execution of SPAL. The incidence of postoperative bleeding of both groups and of the 2 parts of the study group was compared using the Fisher exact test. A SPAL was necessary to stop intraoperative bleeding in 21 (52.5%) sides of the study group patients and in 7 (17.5%) of the control group patients. After surgery, epistaxis occurred in 8 cases (20%) in the PMT group (1 submitted to SPAL) and in 2 (5%) of the control group. The comparison with the Fisher exact test confirmed the major tendency of postoperative bleeding in the study group and in those not submitted to SPAL (P < .05). Partial middle turbinectomy causes a higher incidence of postoperative bleeding in patients who are not packed during the FESS operation. The execution of SPAL greatly reduces this risk. Copyright © 2012 Elsevier Inc. All rights reserved.

  16. Turbulent resistivity driven by the magnetorotational instability

    Science.gov (United States)

    Fromang, S.; Stone, J. M.

    2009-11-01

    Aims: We measure the turbulent resistivity in the nonlinear regime of the MRI, and evaluate the turbulent magnetic Prandtl number. Methods: We perform a set of numerical simulations with the Eulerian finite volume codes Athena and Ramses in the framework of the shearing box model. We consider models including explicit dissipation coefficients and magnetic field topologies such that the net magnetic flux threading the box in both the vertical and azimuthal directions vanishes. Results: We first demonstrate good agreement between the two codes by comparing the properties of the turbulent states in simulations having identical microscopic diffusion coefficients (viscosity and resistivity). We find the properties of the turbulence do not change when the box size is increased in the radial direction, provided it is elongated in the azimuthal direction. To measure the turbulent resistivity in the disk, we impose a fixed electromotive force on the flow and measure the amplitude of the saturated magnetic field that results. We obtain a turbulent resistivity that is in rough agreement with mean field theories like the Second Order Smoothing Approximation. The numerical value translates into a turbulent magnetic Prandtl number Pmt of order unity. Pmt appears to be an increasing function of the forcing we impose. It also becomes smaller as the box size is increased in the radial direction, in good agreement with previous results obtained in very large boxes. Conclusions: Our results are in general agreement with other recently published papers studying the same problem but using different methodology. Thus, our conclusion that Pmt is of order unity appears robust.

  17. Impact of straight, unconnected, radially-oriented, and tapered mesopores on column efficiency: A theoretical investigation.

    Science.gov (United States)

    Gritti, Fabrice

    2017-02-17

    Superficially porous particles (SPPs) can be prepared from a pseudomorphic transformation (PMT) which produces straight, unconnected, and radially-oriented mesopores (ROMs). ROMs can be either both ends open in fully porous particles (FPPs) or one-end-closed in SPPs. The impact of ROMs on the longitudinal diffusion (B/u), solid-liquid mass transfer resistance (C s u), and on the eddy dispersion (A(u)) height equivalent to a theoretical plate (HETP) of 3D randomly packed columns was investigated based on theoretical viewpoints. Torquato's theory of effective diffusion in packed beds (B term), Giddings' coupling theory of eddy dispersion (A term), and Giddings' generalized nonequilibrium theory (C s term) are applied to make predictions. First, it is found that the A term is nearly independent on the internal structure of the particle. Secondly, in the absence of flow, infinitely narrow and both ends open (no constriction effect) ROMs induce an internal hindrance factor of 23 regarding diffusion along the axial direction. Experimental data reveal that one-end-closed and 80Å wide ROMs in SPPs lead to a measurable internal hindrance factor of 27 regarding diffusion in the porous shell. Thirdly, above the optimum speed, the C s coefficient is dependent on the geometry (cylinders, cones, etc.) of the ROMs: when ROMs are conical in SPPs, C s is expected to decrease by 80% with respect to cylindrical ROMs. From an application perspective, PMT-SPPs prepared with narrow ROMs are well suited for the analysis of small molecules at or below optimum speed (lowest B term) while PMT-SPPs made of wide and conical ROMs are ideal for the analysis of large molecules above optimum speed (smallest C s term). Copyright © 2017. Published by Elsevier B.V.

  18. The effectiveness of parent management training in a Brazilian sample of patients with oppositional-defiant disorder A eficácia de treinamento de pais em grupo para pacientes com transtorno desafiador de oposição: um estudo piloto

    Directory of Open Access Journals (Sweden)

    Maria Antonia Serra-Pinheiro

    2005-01-01

    Full Text Available BACKGROUND: Oppositional-defiant disorder (ODD is considered a hard to treat condition. The aim of this study was to assess the effect of parent management training (PMT on the symptoms of ODD and conduct disorder (CD in Brazilian children with ODD. METHODS: We conducted a clinical evaluation in which data was analyzed from parents of five patients with ODD who participated in a PMT group. The ODD and CD symptoms were assessed before and at least a month after they started participating in the group. The outcome measures were rating scales based on the DSM-IV criteria for ODD and CD. RESULTS: Most patients continued to fulfill criteria for ODD, but the severity of their ODD symptoms was reduced 48,75%. The difference between the means on the severity scale of ODD symptoms was statistically significant (p= 0,031 The fulfillment of criteria for CD was largely diminished. CONCLUSIONS: PMT was effective for the reduction of ODD and CD symptoms in patients with ODD. PMT may represent a valuable therapeutic option for patients with ODD in different cultures.INTRODUÇÃO: O transtorno desafiador de oposição (TDO é considerado uma condição de difícil tratamento. O objetivo deste estudo foi avaliar a eficácia de um programa em grupo de treinamento de pais (TP na redução dos sintomas de TDO e transtorno de conduta (TC em crianças brasileiras com TDO. MÉTODO: conduziu-se um estudo naturalístico em que se analisou dados dos pais de cinco pacientes com TDO que participaram de um grupo de TP. Os sintomas de TDO e TC foram avaliados antes e pelo menos um mês depois de iniciarem a participação no grupo. As medidas utilizadas foram escalas baseadas nos critérios da DSM-IV para TDO e TC. RESULTADOS: A maioria dos pacientes continuou preenchendo critérios para TDO, mas a gravidade dos seus sintomas de TDO diminuiu 48,75%. A diferença entre as médias na escala de gravidade de sintomas desafiadores-opositivo foi estatisticamente significativa (p

  19. A novel framework for analysing stakeholder interest in healthy foods: A case study on iodine biofortification.

    Science.gov (United States)

    Mogendi, Joseph Birundu; De Steur, Hans; Gellynck, Xavier; Makokha, Anselimo

    2016-01-01

    Despite the availability of novel strategies to prevent micronutrient malnutrition, such as biofortification, limited understanding of stakeholders often hampers their success. We build upon the existing literature on protection motivations (PMT) and technology acceptance (TAM) to develop an integrated PMTAM model for analyzing stakeholders' reactions, on both the supply and demand sides. Regarding the latter, the case of the iodine biofortified food chain is used to evaluate African households' interest. All model constructs, and threat appraisal in particular, are decisive in determining the uptake of biofortification, while also social demographics and own nutrition status play an important role.

  20. Strongly Interacting Fermi Gases in Two Dimensions

    Science.gov (United States)

    2012-07-17

    strategy to determine the ther- modynamic properties of a given substance is to measure an equation of state (EoS), such as the pressure P(m,T ) as a...magnetically ordered phases. From the chemical potential m/EF andT=TF ¼ 4p ð3p2Þ2=3 1 ðnl3Þ2=3, we finally obtain the density EoS n(m,T ) ≡ 1 l3 fnðbmÞ...platinum market (14). The combi- nation of chemical, economic, and political chal- lenges inspires the exploration of inexpensive and Earth-abundant

  1. Forward Period Analysis Method of the Periodic Hamiltonian System.

    Directory of Open Access Journals (Sweden)

    Pengfei Wang

    Full Text Available Using the forward period analysis (FPA, we obtain the period of a Morse oscillator and mathematical pendulum system, with the accuracy of 100 significant digits. From these results, the long-term [0, 1060] (time unit solutions, ranging from the Planck time to the age of the universe, are computed reliably and quickly with a parallel multiple-precision Taylor series (PMT scheme. The application of FPA to periodic systems can greatly reduce the computation time of long-term reliable simulations. This scheme provides an efficient way to generate reference solutions, against which long-term simulations using other schemes can be tested.

  2. A digitalising board for the prototype array of LHAASO WCDA

    International Nuclear Information System (INIS)

    Hao Xinjun; Liu Shubin; Zhao Lei; An Qi

    2011-01-01

    In this paper, a digitalising board for readout of PMT signals in the prototype array of WCDA (water Cerenkov detector array) for LHAASO (Large high altitude air shower observatory)is designed. The prototype array is composed of 9 PMTs, including the pulse time and charge measurement from the PMTs, and clock generation and trigger decision. In the digitalising board, FPGA reconfiguration and data readout via VME bus are implemented. Test results show that the performances meet well with the requirements of readout electronics. It has been installed in Yangbajing and tests with the prototype array and DAQ is ongoing. (authors)

  3. Genomic organization of plant aminopropyl transferases.

    Science.gov (United States)

    Rodríguez-Kessler, Margarita; Delgado-Sánchez, Pablo; Rodríguez-Kessler, Gabriela Theresia; Moriguchi, Takaya; Jiménez-Bremont, Juan Francisco

    2010-07-01

    Aminopropyl transferases like spermidine synthase (SPDS; EC 2.5.1.16), spermine synthase and thermospermine synthase (SPMS, tSPMS; EC 2.5.1.22) belong to a class of widely distributed enzymes that use decarboxylated S-adenosylmethionine as an aminopropyl donor and putrescine or spermidine as an amino acceptor to form in that order spermidine, spermine or thermospermine. We describe the analysis of plant genomic sequences encoding SPDS, SPMS, tSPMS and PMT (putrescine N-methyltransferase; EC 2.1.1.53). Genome organization (including exon size, gain and loss, as well as intron number, size, loss, retention, placement and phase, and the presence of transposons) of plant aminopropyl transferase genes were compared between the genomic sequences of SPDS, SPMS and tSPMS from Zea mays, Oryza sativa, Malus x domestica, Populus trichocarpa, Arabidopsis thaliana and Physcomitrella patens. In addition, the genomic organization of plant PMT genes, proposed to be derived from SPDS during the evolution of alkaloid metabolism, is illustrated. Herein, a particular conservation and arrangement of exon and intron sequences between plant SPDS, SPMS and PMT genes that clearly differs with that of ACL5 genes, is shown. The possible acquisition of the plant SPMS exon II and, in particular exon XI in the monocot SPMS genes, is a remarkable feature that allows their differentiation from SPDS genes. In accordance with our in silico analysis, functional complementation experiments of the maize ZmSPMS1 enzyme (previously considered to be SPDS) in yeast demonstrated its spermine synthase activity. Another significant aspect is the conservation of intron sequences among SPDS and PMT paralogs. In addition the existence of microsynteny among some SPDS paralogs, especially in P. trichocarpa and A. thaliana, supports duplication events of plant SPDS genes. Based in our analysis, we hypothesize that SPMS genes appeared with the divergence of vascular plants by a processes of gene duplication and the

  4. Polyol-mediated thermolysis process for the synthesis of MgO nanoparticles and nanowires

    International Nuclear Information System (INIS)

    Subramania, A; Kumar, G Vijaya; Priya, A R Sathiya; Vasudevan, T

    2007-01-01

    The main aim of this work is to prepare MgO nanoparticles and nanowires by a novel polyol-mediated thermolysis (PMT) process. The influence of different mole concentration of magnesium acetate, polyvinyl pyrrolidone (PVP; capping agent) and ethylene glycol (EG; solvent as well as reducing agent) on the formation of nanoparticles and nanowires and the effect of calcination on the crystalline size of the samples were also examined. The resultant oxide structure, thermal behaviour, size and shape have been studied using x-ray diffraction (XRD) studies, thermal (TG/DTA) analysis and scanning electron microscopy (SEM)/transmission electron microscopy (TEM) respectively

  5. First observation of liquid-xenon proportional electroluminescence in THGEM holes

    International Nuclear Information System (INIS)

    Arazi, L; Itay, R; Landsman, H; Levinson, L; Pasmantirer, B; Rappaport, M L; Vartsky, D; Breskin, A; Coimbra, A E C

    2013-01-01

    Radiation-induced proportional-electroluminescence UV signals, emitted from the holes of a Thick Gas Electron Multiplier (THGEM) electrode immersed in liquid xenon, were recorded with a PMT for the first time. Significant photon yields were observed with gamma photons and alpha particles using a 0.4 mm thick electrode with 0.3 mm diameter holes; at 2 kV across the THGEM the photon yield was estimated to be ∼ 600 UV photons/electron over 4π. This may pave the way towards the realization of novel single-phase noble-liquid radiation detectors incorporating liquid hole-multipliers (LHM); their concept is presented

  6. 99mTc-PMTの集積を示した非肝細胞癌と考えられた2例

    OpenAIRE

    滝, 淳一; 一柳, 健次; 木水, 潔

    1986-01-01

    肝膿瘍および胆管細胞癌と考えられる症例にTc-99m-PMTによる肝胆道シンチグラフィを施行したところ異常集積を認めた。Tc-99m-PMT の異常集積を示す肝内病変の質的診断には肝細胞癌以外の病変も考慮すべきと思われた。

  7. Study of light detection and sensitivity for a ton-scale liquid xenon dark matter detector

    International Nuclear Information System (INIS)

    Wei, Y; Lin, Q; Xiao, X; Ni, K

    2013-01-01

    Ton-scale liquid xenon detectors operated in two-phase mode are proposed and being constructed recently to explore the favored parameter space for the Weakly Interacting Massive Particles (WIMPs) dark matter. To achieve a better light collection efficiency while limiting the number of electronics channels compared to the previous generation detectors, large-size photo-multiplier tubes (PMTs) such as the 3-inch-diameter R11410 from Hamamatsu are suggested to replace the 1-inch-square R8520 PMTs. In a two-phase xenon dark matter detector, two PMT arrays on the top and bottom are usually used. In this study, we compare the performance of two different ton-scale liquid xenon detector configurations with the same number of either R11410 (config.1) or R8520 (config.2) for the top PMT array, while both using R11410 PMTs for the bottom array. The self-shielding of liquid xenon suppresses the background from the PMTs and the dominant background is from the pp solar neutrinos in the central fiducial volume. The light collection efficiency for the primary scintillation light is largely affected by the xenon purity and the reflectivity of the reflectors. In the optimistic situation with a 10 m light absorption length and a 95% reflectivity, the light collection efficiency is 43%(34%) for config.1(config.2). In the conservative situation with a 2.5 m light absorption length and a 85% reflectivity, the value is only 18%(13%) for config.1(config.2). The difference between the two configurations is due to the larger PMT coverage on the top for config.1. The slightly different position resolutions for the two configurations have a negligible effect on the sensitivity. Based on the above considerations, we estimate the sensitivity reach of the two detector configurations. Both configurations can reach a sensitivity of 2 ∼ 3 × 10 −47 cm 2 for spin-independent WIMP-nucleon cross section for 100 GeV/c 2 WIMPs after two live-years of operation. The one with R8520 PMTs for the top

  8. A new type gamma-ray spectrum monitoring system

    CERN Document Server

    Cheng Bo; Zhou Jian Bin; Zhang Zhi Ming; Tong Yun Fu

    2002-01-01

    This new radiation monitoring system can be used to monitor the radiation of building materials and the radiation of atmosphere, to explore and evaluate rock for building in the field, and this system can be used to monitor the gamma irradiation near the nuclear establishments in the average situation and in the serious situation of the radiation incident have happened. The control core of this monitoring system is SCM-AT89C52, and gamma-ray sensing head consists of scintillator phi 50 mm x 50 mm NaI(Tl) and PMT GDB44. This system can be used to measure the whole gamma-ray spectrum of 256 channels

  9. [Development and evaluation of an improved high-resolution TOFPET camera: TOFPET II: Progress report, 1984-1985

    International Nuclear Information System (INIS)

    Mullani, N.A.

    1985-01-01

    We have been working to improve the quality of barium fluoride scintillators for the fast component and subsequently improve the coincidence timing. We are now able to obtain approximately 400 psec timing and less than 20% energy resolution for barium fluoride using quartz faced photomultiplier tubes. One major problem with the use of barium fluoride and quartz windows on the PMT's, the coupling of the scintillator to the photomultiplier tube. The best available coupling compound is viscasil from GE which is a silicon grease. It is highly efficient for transmitting the 220 nm uv light from the scintillator

  10. Determinants of Cancer Early Detection Behaviors:Application of Protection Motivation Theory

    OpenAIRE

    Rahaei, Zohreh; Ghofranipour, Fazlollah; Morowatisharifabad, Mohammad Ali; Mohammadi, Eesa

    2015-01-01

    Background: Cancer is account for 13% of all deaths around the world and is the third cause of mortality in Iran. More than one third of these cases are pre-ventable and about 33% are curable with early detection. The aim of this study was to determine the predictors of cancer early detection (CED) behaviors ap-plying Protection Motivation Theory (PMT). Methods: In this cross-sectional study, cluster sampling method was employed to recruit 260 individuals of above 20 years old in Yazd, Ira...

  11. Gas scintillation proportional counters for x-ray synchrotron applications

    International Nuclear Information System (INIS)

    Smith, A.; Bavdaz, M.

    1992-01-01

    Gas scintillation proportional counters (GSPCs) as x-ray detectors provide some advantages and disadvantages compared with proportional counters. In this paper the various configurations of xenon filled GSPC are described including both imaging and nonimaging devices. It is intended that this work be used to configure a GSPC for a particular application and predict its general performance characteristics. The general principles of operation are described and the performance characteristics are then separately considered. A high performance, imaging, driftless GSPC is described in which a single intermediate window is used between the PMT and gas cell

  12. CSIR NLC - South Africa - mobile LIDAR - system description

    CSIR Research Space (South Africa)

    Sivakumar, V

    2008-05-01

    Full Text Available to an altitude of 3 km with a ruby laser [4], and in 1970, Inaba and Kobayasi [5] and Kobayasi and Inaba [6][7], with the same laser, performed spectral analysis of nitrogen, oxygen and several pollutants. Since these pioneering attempts, laser remote... 532 nm) Beam Expander 3 x (optional) Pulse width 7 ns Pulse repetition rate 10 Hz Beam Divergence 0.2 mRad Receiver Telescope type Newtonian Diameter 404 mm Field of View 1 mRad PMT...

  13. Fluorescence detection system for microfluidic droplets

    Science.gov (United States)

    Chen, Binyu; Han, Xiaoming; Su, Zhen; Liu, Quanjun

    2018-05-01

    In microfluidic detection technology, because of the universality of optical methods in laboratory, optical detection is an attractive solution for microfluidic chip laboratory equipment. In addition, the equipment with high stability and low cost can be realized by integrating appropriate optical detection technology on the chip. This paper reports a detection system for microfluidic droplets. Photomultiplier tubes (PMT) is used as a detection device to improve the sensitivity of detection. This system improves the signal to noise ratio by software filtering and spatial filter. The fluorescence intensity is proportional to the concentration of the fluorescence and intensity of the laser. The fluorescence micro droplets of different concentrations can be distinguished by this system.

  14. Test of the photon detection system for the LHCb RICH Upgrade in a charged particle beam

    CERN Document Server

    Baszczyk, M.K.

    2017-01-16

    The LHCb detector will be upgraded to make more efficient use of the available luminosity at the LHC in Run III and extend its potential for discovery. The Ring Imaging Cherenkov detectors are key components of the LHCb detector for particle identification. In this paper we describe the setup and the results of tests in a charged particle beam, carried out to assess prototypes of the upgraded opto-electronic chain from the Multi-Anode PMT photosensor to the readout and data acquisition system.

  15. Cloning of Bacteroides fragilis plasmid genes affecting metronidazole resistance and ultraviolet survival in Escherichia coli

    International Nuclear Information System (INIS)

    Wehnert, G.U.; Abratt, V.R.; Goodman, H.J.; Woods, D.R.

    1990-01-01

    Since reduced metronidazole causes DNA damage, resistance to metronidazole was used as a selection method for the cloning of Bacteroides fragilis genes affecting DNA repair mechanisms in Escherichia coli. Genes from B. fragilis Bf-2 were cloned on a recombinant plasmid pMT100 which made E. coli AB1157 and uvrA, B, and C mutant strains more resistant to metronidazole, but more sensitive to far uv irradiation under aerobic conditions. The loci affecting metronidazole resistance and uv sensitivity were linked and located on a 5-kb DNA fragment which originated from the small 6-kb cryptic plasmid pBFC1 present in B. fragilis Bf-2 cells

  16. Application of position-sensitive detectors to positron imaging

    International Nuclear Information System (INIS)

    Yamashita, Takaji; Uchida, Hiroshi; Watanabe, Mitsuo; Omura, Tomohide

    1994-01-01

    Positron imaging including positron emission tomography (PET) is expected to be a promising tool for basic and clinical research, because it makes possible the study of regional chemistry within multiple organs of the body in living human beings and experimental animals. New schemes of high resolution block detectors have been developed to improve the performance of positron imaging systems, which employ small segments of bismuth germanate (BGO) arrays and position-sensitive photomultiplier tubes (PS-PMT). The coincidence detector resolution of less than 2.0 mm in full width at half maximum was achieved with the detectors, which is very close to the theoretical resolution limit in positron imaging. (author)

  17. Balloonborne lidar experiment

    Science.gov (United States)

    Shepherd, O.; Aurilio, G.; Bucknam, R. D.; Brooke, R. W.; Hurd, A. G.

    1980-12-01

    The object of this contract was to design a balloonborne lidar experiment capable of performing nightime atmospheric density measurements in the 10 to 40 km altitude domain with a resolution of 100 meters. The payload includes a frequency-tripled Nd:YAG laser with outputs at 353 and 1064 nm, a telescoped receiver with PMT detectors, a command-controlled optical pointing system, and support systems, including thermal control, telemetry, command, and power. Density measurements would be made using the back-scattered 353 nm radiation data with aerosol corrections obtained from 1064 nm radiation scatterings.

  18. Design and Demonstration of a Miniature Lidar System for Rover Applications

    Science.gov (United States)

    Robinson, Benjamin

    2010-01-01

    A basic small and portable lidar system for rover applications has been designed. It uses a 20 Hz Nd:YAG pulsed laser, a 4-inch diameter telescope receiver, a custom-built power distribution unit (PDU), and a custom-built 532 nm photomultiplier tube (PMT) to measure the lidar signal. The receiving optics have been designed, but not constructed yet. LabVIEW and MATLAB programs have also been written to control the system, acquire data, and analyze data. The proposed system design, along with some measurements, is described. Future work to be completed is also discussed.

  19. A high speed, wide dynamic range digitizer circuit for photomultiplier tubes

    International Nuclear Information System (INIS)

    Yarema, R.J.; Foster, G.W.; Knickerbocker, K.; Sarraj, M.; Tschirhart, R.; Whitmore, J.; Zimmerman, T.; Lindgren, M.

    1995-01-01

    A circuit has been designed for digitizing PMT signals over a wide dynamic range (17-18 bits) with 8 bits of resolution at rates up to 53 MHz. Output from the circuit is in a floating point format with a 4 bit exponent and an 8 bit mantissa. The heart of the circuit is a full custom integrated circuit called the QIE (Charge Integrator and Encoder). The design of the QIE and associated circuitry reported here permits operation over a 17 bit dynamic range. Test results of a multirange device are presented for the first time. (orig.)

  20. Polyol-mediated thermolysis process for the synthesis of MgO nanoparticles and nanowires

    Energy Technology Data Exchange (ETDEWEB)

    Subramania, A; Kumar, G Vijaya; Priya, A R Sathiya; Vasudevan, T [Advanced Materials Research Lab, Department of Industrial Chemistry, Alagappa University, Karaikudi-630 003 (India)

    2007-06-06

    The main aim of this work is to prepare MgO nanoparticles and nanowires by a novel polyol-mediated thermolysis (PMT) process. The influence of different mole concentration of magnesium acetate, polyvinyl pyrrolidone (PVP; capping agent) and ethylene glycol (EG; solvent as well as reducing agent) on the formation of nanoparticles and nanowires and the effect of calcination on the crystalline size of the samples were also examined. The resultant oxide structure, thermal behaviour, size and shape have been studied using x-ray diffraction (XRD) studies, thermal (TG/DTA) analysis and scanning electron microscopy (SEM)/transmission electron microscopy (TEM) respectively.

  1. Polyol-mediated thermolysis process for the synthesis of MgO nanoparticles and nanowires

    Science.gov (United States)

    Subramania, A.; Vijaya Kumar, G.; Sathiya Priya, A. R.; Vasudevan, T.

    2007-06-01

    The main aim of this work is to prepare MgO nanoparticles and nanowires by a novel polyol-mediated thermolysis (PMT) process. The influence of different mole concentration of magnesium acetate, polyvinyl pyrrolidone (PVP; capping agent) and ethylene glycol (EG; solvent as well as reducing agent) on the formation of nanoparticles and nanowires and the effect of calcination on the crystalline size of the samples were also examined. The resultant oxide structure, thermal behaviour, size and shape have been studied using x-ray diffraction (XRD) studies, thermal (TG/DTA) analysis and scanning electron microscopy (SEM)/transmission electron microscopy (TEM) respectively.

  2. Two-Photon Probes for Lysosomes and Mitochondria: Simultaneous Detection of Lysosomes and Mitochondria in Live Tissues by Dual-Color Two-Photon Microscopy Imaging.

    Science.gov (United States)

    Lim, Chang Su; Hong, Seung Taek; Ryu, Seong Shick; Kang, Dong Eun; Cho, Bong Rae

    2015-10-01

    Novel two-photon (TP) probes were developed for lysosomes (PLT-yellow) and mitochondria (BMT-blue and PMT-yellow). These probes emitted strong TP-excited fluorescence in cells at widely separated wavelength regions and displayed high organelle selectivity, good cell permeability, low cytotoxicity, and pH insensitivity. The BMT-blue and PLT-yellow probes could be utilized to detect lysosomes and mitochondria simultaneously in live tissues by using dual-color two-photon microscopy, with minimum interference from each other. © 2015 WILEY-VCH Verlag GmbH & Co. KGaA, Weinheim.

  3. Effect of refraction index and light sharing on detector element identification for 2D detector modules in Positron Emission Tomography

    International Nuclear Information System (INIS)

    Tornai, M.P.; Hoffman, E.J.; Cherry, S.R.

    1994-01-01

    Relationships among indices of refraction (n) of scintillation detectors, light sharing among discrete detector elements and accuracy of detector element identification in Positron Emission Tomography (PET) 2-D detector arrays were examined with theory and experiment. Mismatches between the index of refraction of scintillators and the glass of photomultipliers (PMT) were seen to lead to nonlinear relationships between crystal position and ratio (positioning) signals derived from PMTs. Insight is provided into the empirically derived use of light sharing among elements of the crystals in PET 2-D array detectors to compensate for this nonlinear response. ((orig.))

  4. Channel control ASIC for the CMS hadron calorimeter front end readout module

    International Nuclear Information System (INIS)

    Ray Yarema et al.

    2002-01-01

    The Channel Control ASIC (CCA) is used along with a custom Charge Integrator and Encoder (QIE) ASIC to digitize signals from the hybrid photo diodes (HPDs) and photomultiplier tubes (PMTs) in the CMS hadron calorimeter. The CCA sits between the QIE and the data acquisition system. All digital signals to and from the QIE pass through the CCA chip. One CCA chip interfaces with two QIE channels. The CCA provides individually delayed clocks to each of the QIE chips in addition to various control signals. The QIE sends digitized PMT or HPD signals and time slice information to the CCA, which sends the data to the data acquisition system through an optical link

  5. Study of the Light Emission Process from the Double Chooz Photomultipliers

    Energy Technology Data Exchange (ETDEWEB)

    Calvo, E.; Cerrada, M.; Crespo, J. I.; Gil-Botella, I.; Jimenez, S.; Lopez, M.; Novella, P.; Palomares, C.; Santorelli, R.; Verdugo, A.

    2012-09-13

    In this document we present a study of the light emitted by the base of a Hamamatsu R7081MOD-ASSY photomultiplier (PMT) of the same type used in the Double Chooz experiment. Several characteristic features of the light signal have been found in terms of amplitude, length and pulse shape. Additional investigations on the properties of the epoxy used to cover the photomultiplier base have been carried out. A possible explanation of the light emission process is discussed at the end of the study. (Author) 1 ref.

  6. Electronic trigger for the ASP experiment

    International Nuclear Information System (INIS)

    Wilson, R.J.

    1985-11-01

    The Anomalous Single Photon (ASP) electronic trigger is described. The experiments is based on an electromagnetic calorimeter composed of arrays of lead glass blocks, read out with photo-multiplier tubes, surrounding the interaction point at the PEP storage ring. The primary requirement of the trigger system is to be sensitive to low energy (approx. =0.5 GeV and above) photons whilst discriminating against high backgrounds at PEP. Analogue summing of the PMT signals and a sequence of programmable digital look-up tables produces a ''dead-timeless'' trigger for the beam collision rate of 408 kHz. 6 refs., 6 figs

  7. Depth-Resolved Cathodoluminescence of Thorium Dioxide

    Science.gov (United States)

    2013-03-01

    plutonium-239 (239Pu)-based nuclear weapons. Thorium also results in less highly radioactive waste in comparison to the uranium fuels. Thorium is four...diameters (1/4 – 3/8”) (Mann & Thompson, 2010). The 99.99% ThO2 powder was placed into the ampoule with a basic mineralizer such as cesium fluoride...conversion ranging from 1 pA/V to 1 mA/V. The electrical noise is further reduced by cooling the PMT housing unit with liquid nitrogen as seen in

  8. Complete tests of 2000 Hamamatsu R7525HA phototubes for the CMS-HF Forward Calorimeter

    International Nuclear Information System (INIS)

    Akgun, U.; Ayan, A.S.; Bruecken, P.; Duru, F.; Guelmez, E.; Mestvirishvilli, A.; Miller, M.; Olson, J.; Onel, Y.; Schmidt, I.

    2005-01-01

    Approximately 2000 PMTs will be used to detect the Cherenkov light generated in quartz fibers embedded in the CMS-HF Forward Calorimeter. The Hamamatsu R7525HA PMT was chosen for this purpose. We measured the transit time, transit time spread, pulse width, rise time, anode dark current, and relative gain for each tube in the test station at University of Iowa. Life-time, gain versus high voltage, and single photoelectron spectrum measurements were also done on a small sample of PMTs. All the tubes were tested to verify that they conform to the HF requirements

  9. Commissioning of CMS Forward Hadron Calorimeters with Upgraded Multi-anode PMTs and uTCA Readout

    CERN Document Server

    Tiras, Emrah; Onel, Yasar

    2016-01-01

    The high flux of charged particles interacting with the CMS Forward Hadron Calorimeter PMT windows introduced a significant background for the trigger and offline data analysis. During Long Shutdown 1, all of the original PMTs were replaced with multi-anode, thin window photomultiplier tubes. At the same time, the back-end electronic readout system was upgraded to uTCA readout. The experience with commissioning and calibration of the Forward Hadron Calorimeter is described as well as the uTCA system. The upgrade was successful and provided quality data for Run 2 data-analysis at 13 TeV.

  10. New nuclear medicine gamma camera systems

    International Nuclear Information System (INIS)

    Villacorta, Edmundo V.

    1997-01-01

    The acquisition of the Open E.CAM and DIACAM gamma cameras by Makati Medical Center is expected to enhance the capabilities of its nuclear medicine facilities. When used as an aid to diagnosis, nuclear medicine entails the introduction of a minute amount of radioactive material into the patient; thus, no reaction or side-effect is expected. When it reaches the particular target organ, depending on the radiopharmaceutical, a lesion will appear as a decrease (cold) area or increase (hot) area in the radioactive distribution as recorded byu the gamma cameras. Gamma camera images in slices or SPECT (Single Photon Emission Computer Tomography), increase the sensitivity and accuracy in detecting smaller and deeply seated lesions, which otherwise may not be detected in the regular single planar images. Due to the 'open' design of the equipment, claustrophobic patients will no longer feel enclosed during the procedure. These new gamma cameras yield improved resolution and superb image quality, and the higher photon sensitivity shortens imaging acquisition time. The E.CAM, which is the latest generation gamma camera, is featured by its variable angle dual-head system, the only one available in the Philipines, and the excellent choice for Myocardial Perfusion Imaging (MPI). From the usual 45 minutes, the acquisition time for gated SPECT imaging of the heart has now been remarkably reduced to 12 minutes. 'Gated' infers snap-shots of the heart in selected phases of its contraction and relaxation as triggered by ECG. The DIACAM is installed in a room with access outside the main entrance of the department, intended specially for bed-borne patients. Both systems are equipped with a network of high performance Macintosh ICOND acquisition and processing computers. Added to the hardware is the ICON processing software which allows total simultaneous acquisition and processing capabilities in the same operator's terminal. Video film and color printers are also provided. Together

  11. Segmented slant hole collimator for stationary cardiac SPECT: Monte Carlo simulations.

    Science.gov (United States)

    Mao, Yanfei; Yu, Zhicong; Zeng, Gengsheng L

    2015-09-01

    This work is a preliminary study of a stationary cardiac SPECT system. The goal of this research is to propose a stationary cardiac SPECT system using segmented slant-hole collimators and to perform computer simulations to test the feasibility. Compared to the rotational SPECT, a stationary system has a benefit of acquiring temporally consistent projections. The most challenging issue in building a stationary system is to provide sufficient projection view-angles. A GATE (GEANT4 application for tomographic emission) Monte Carlo model was developed to simulate a two-detector stationary cardiac SPECT that uses segmented slant-hole collimators. Each detector contains seven segmented slant-hole sections that slant to a common volume at the rotation center. Consequently, 14 view-angles over 180° were acquired without any gantry rotation. The NCAT phantom was used for data generation and a tailored maximum-likelihood expectation-maximization algorithm was used for image reconstruction. Effects of limited number of view-angles and data truncation were carefully evaluated in the paper. Simulation results indicated that the proposed segmented slant-hole stationary cardiac SPECT system is able to acquire sufficient data for cardiac imaging without a loss of image quality, even when the uptakes in the liver and kidneys are high. Seven views are acquired simultaneously at each detector, leading to 5-fold sensitivity gain over the conventional dual-head system at the same total acquisition time, which in turn increases the signal-to-noise ratio by 19%. The segmented slant-hole SPECT system also showed a good performance in lesion detection. In our prototype system, a short hole-length was used to reduce the dead zone between neighboring collimator segments. The measured sensitivity gain is about 17-fold over the conventional dual-head system. The gate Monte Carlo simulations confirm the feasibility of the proposed stationary cardiac SPECT system with segmented slant

  12. Quantitation of myocardial blood flow and myocardial flow reserve with {sup 99m}Tc-sestamibi dynamic SPECT/CT to enhance detection of coronary artery disease

    Energy Technology Data Exchange (ETDEWEB)

    Hsu, Bailing [University of Missouri-Columbia, Nuclear Science and Engineering Institute, Columbia, MO (United States); Chen, Fu-Chung; Chen, Chien-Cheng [Show Chwan Memorial Hospital, Section of Cardiology, Department of Internal Medicine, Changhua (China); Wu, Tao-Cheng [Taipei Veterans General Hospital, Section of Cardiology, Department of Internal Medicine, Taipei (China); Huang, Wen-Sheng [Changhua Christian Hospital, Department of Medical Research and Department of Nuclear Medicine, Changhua (China); Hou, Po-Nien [Chang Bing Show Chwan Memorial Hospital, Department of Nuclear Medicine, Lukong Town, Changhua Shien (China); Hung, Guang-Uei [Chang Bing Show Chwan Memorial Hospital, Department of Nuclear Medicine, Lukong Town, Changhua Shien (China); Central Taiwan University of Science and Technology, Department of Medical Imaging and Radiological Science, Taichung (China); China Medical University, Department of Biomedical Imaging and Radiological Science, Taichung (China)

    2014-12-15

    Conventional dual-head single photon emission computed tomography (SPECT)/CT systems capable of fast dynamic SPECT (DySPECT) imaging have a potential for flow quantitation. This study introduced a new method to quantify myocardial blood flow (MBF) and myocardial flow reserve (MFR) with DySPECT scan and evaluated the diagnostic performance of detecting coronary artery disease (CAD) compared with perfusion using invasive coronary angiography (CAG) as the reference standard. This study included 21 patients with suspected or known CAD who had received DySPECT, ECG-gated SPECT (GSPECT), and CAG (13 with ≥50 % stenosis in any vessel; non-CAD group: 8 with patent arteries or <50 % stenosis). DySPECT and GSPECT scans were performed on a widely used dual-head SPECT/CT scanner. The DySPECT imaging protocol utilized 12-min multiple back-and-forth gantry rotations during injections of {sup 99m}Tc-sestamibi (MIBI) tracer at rest or dipyridamole-stress stages. DySPECT images were reconstructed with full physical corrections and converted to the physical unit of becquerels per milliliter. Stress MBF (SMBF), rest MBF (RMBF), and MFR were quantified by a one-tissue compartment flow model using time-activity curves derived from DySPECT images. Perfusion images were processed for GSPECT scan and interpreted to obtain summed stress score (SSS) and summed difference score (SDS). Receiver-operating characteristic (ROC) analyses were conducted to evaluate the diagnostic performance of flow and perfusion. Using the criteria of ≥50 % stenosis as positive CAD, areas under the ROC curve (AUCs) of flow assessment were overall significantly greater than those of perfusion. For patient-based analysis, AUCs for MFR, SMBF, SSS, and SDS were 0.91 ± 0.07, 0.86 ± 0.09, 0.64 ± 0.12, and 0.59 ± 0.13. For vessel-based analysis, AUCs for MFR, SMBF, SSS, and SDS were 0.81 ± 0.05, 0.76 ± 0.06, 0.62 ± 0.07, and 0.56 ± 0.08, respectively. The preliminary data suggest that MBF quantitation with a

  13. Segmented slant hole collimator for stationary cardiac SPECT: Monte Carlo simulations

    Energy Technology Data Exchange (ETDEWEB)

    Mao, Yanfei, E-mail: ymao@ucair.med.utah.edu [Department of Radiology, Utah Center for Advanced Imaging Research (UCAIR), University of Utah, Salt Lake City, Utah 84108 and Department of Bioengineering, University of Utah, Salt Lake City, Utah 84112 (United States); Yu, Zhicong [Department of Radiology, Mayo Clinic, Rochester, Minnesota 55905 (United States); Zeng, Gengsheng L. [Department of Radiology, Utah Center for Advanced Imaging Research (UCAIR), University of Utah, Salt Lake City, Utah 84108 and Department of Engineering, Weber State University, Ogden, Utah 84408 (United States)

    2015-09-15

    Purpose: This work is a preliminary study of a stationary cardiac SPECT system. The goal of this research is to propose a stationary cardiac SPECT system using segmented slant-hole collimators and to perform computer simulations to test the feasibility. Compared to the rotational SPECT, a stationary system has a benefit of acquiring temporally consistent projections. The most challenging issue in building a stationary system is to provide sufficient projection view-angles. Methods: A GATE (GEANT4 application for tomographic emission) Monte Carlo model was developed to simulate a two-detector stationary cardiac SPECT that uses segmented slant-hole collimators. Each detector contains seven segmented slant-hole sections that slant to a common volume at the rotation center. Consequently, 14 view-angles over 180° were acquired without any gantry rotation. The NCAT phantom was used for data generation and a tailored maximum-likelihood expectation-maximization algorithm was used for image reconstruction. Effects of limited number of view-angles and data truncation were carefully evaluated in the paper. Results: Simulation results indicated that the proposed segmented slant-hole stationary cardiac SPECT system is able to acquire sufficient data for cardiac imaging without a loss of image quality, even when the uptakes in the liver and kidneys are high. Seven views are acquired simultaneously at each detector, leading to 5-fold sensitivity gain over the conventional dual-head system at the same total acquisition time, which in turn increases the signal-to-noise ratio by 19%. The segmented slant-hole SPECT system also showed a good performance in lesion detection. In our prototype system, a short hole-length was used to reduce the dead zone between neighboring collimator segments. The measured sensitivity gain is about 17-fold over the conventional dual-head system. Conclusions: The GATE Monte Carlo simulations confirm the feasibility of the proposed stationary cardiac

  14. Multislice CT of the liver. Effects of contrast material pushed with saline solution on hepatic enhancement

    International Nuclear Information System (INIS)

    Sekiguchi, Ryuzo; Hayashi, Takayuki; Tsukamoto, Tatsuaki; Kuroki, Yoshinori; Nasu, Katsuhiro; Murakami, Koji; Nawano, Shigeru

    2004-01-01

    The purpose of this study was to evaluate the usefulness of a method of power injection of contrast material pushed with saline solution for hepatic multislice CT using a dual-head power injector. One hundred twenty-one patients who underwent multislice CT to detect liver metastases were divided into two groups, depending on the protocol of contrast material administration: 100 mL of non-ionic contrast material (370 mgI/mL) or 100 mL of the same contrast material pushed with 30 mL of saline solution. Both contrast material and saline solution were administered at a rate of 2.5 mL/sec using a dual-head power injector. Attenuation values for the two protocols were obtained from the liver, portal vein, and descending aorta. Hepatic enhancement above 50 Hounsfield unit (HU), which is needed for the diagnosis of liver metastases, was achieved in 76.5% of patients given 100 mL of contrast material and 92.5% of those given 100 mL of contrast material pushed with a 30 mL saline solution. In contingency-table analysis, the CT attenuation value of liver categorized as less than 50 HU or more than 50 HU, showed a good relation between the categorized group and the protocol (p=0.0437). In patients with a body weight of 50 kg or more, 100 mL of contrast material pushed with saline solution provided significantly better CT attenuation values in the liver (p=0.0113), portal vein (p=0.0094), and descending aorta (p=0.0394) than those provided by the injection of 100 mL of contrast material alone. When contrast material pushed with saline solution was used, CT attenuation values in the liver were significantly increased, especially in patients with a body weight of 50 kg or more. This technique will provide a decrease in the volume of contrast material administered and a potential decrease in the side effects of contrast material. (author)

  15. Data acquisition architecture and online processing system for the HAWC gamma-ray observatory

    Science.gov (United States)

    Abeysekara, A. U.; Alfaro, R.; Alvarez, C.; Álvarez, J. D.; Arceo, R.; Arteaga-Velázquez, J. C.; Ayala Solares, H. A.; Barber, A. S.; Baughman, B. M.; Bautista-Elivar, N.; Becerra Gonzalez, J.; Belmont-Moreno, E.; BenZvi, S. Y.; Berley, D.; Bonilla Rosales, M.; Braun, J.; Caballero-Lopez, R. A.; Caballero-Mora, K. S.; Carramiñana, A.; Castillo, M.; Cotti, U.; Cotzomi, J.; de la Fuente, E.; De León, C.; DeYoung, T.; Diaz-Cruz, J.; Diaz Hernandez, R.; Díaz-Vélez, J. C.; Dingus, B. L.; DuVernois, M. A.; Ellsworth, R. W.; Fiorino, D. W.; Fraija, N.; Galindo, A.; Garfias, F.; González, M. M.; Goodman, J. A.; Grabski, V.; Gussert, M.; Hampel-Arias, Z.; Harding, J. P.; Hui, C. M.; Hüntemeyer, P.; Imran, A.; Iriarte, A.; Karn, P.; Kieda, D.; Kunde, G. J.; Lara, A.; Lauer, R. J.; Lee, W. H.; Lennarz, D.; León Vargas, H.; Linares, E. C.; Linnemann, J. T.; Longo Proper, M.; Luna-García, R.; Malone, K.; Marinelli, A.; Marinelli, S. S.; Martinez, O.; Martínez-Castro, J.; Martínez-Huerta, H.; Matthews, J. A. J.; McEnery, J.; Mendoza Torres, E.; Miranda-Romagnoli, P.; Moreno, E.; Mostafá, M.; Nellen, L.; Newbold, M.; Noriega-Papaqui, R.; Oceguera-Becerra, T.; Patricelli, B.; Pelayo, R.; Pérez-Pérez, E. G.; Pretz, J.; Rivière, C.; Rosa-González, D.; Ruiz-Velasco, E.; Ryan, J.; Salazar, H.; Salesa Greus, F.; Sanchez, F. E.; Sandoval, A.; Schneider, M.; Silich, S.; Sinnis, G.; Smith, A. J.; Sparks Woodle, K.; Springer, R. W.; Taboada, I.; Toale, P. A.; Tollefson, K.; Torres, I.; Ukwatta, T. N.; Villaseñor, L.; Weisgarber, T.; Westerhoff, S.; Wisher, I. G.; Wood, J.; Yapici, T.; Yodh, G. B.; Younk, P. W.; Zaborov, D.; Zepeda, A.; Zhou, H.

    2018-04-01

    The High Altitude Water Cherenkov observatory (HAWC) is an air shower array devised for TeV gamma-ray astronomy. HAWC is located at an altitude of 4100 m a.s.l. in Sierra Negra, Mexico. HAWC consists of 300 Water Cherenkov Detectors, each instrumented with 4 photomultiplier tubes (PMTs). HAWC re-uses the Front-End Boards from the Milagro experiment to receive the PMT signals. These boards are used in combination with Time to Digital Converters (TDCs) to record the time and the amount of light in each PMT hit (light flash). A set of VME TDC modules (128 channels each) is operated in a continuous (dead time free) mode. The TDCs are read out via the VME bus by Single-Board Computers (SBCs), which in turn are connected to a gigabit Ethernet network. The complete system produces ≈500 MB/s of raw data. A high-throughput data processing system has been designed and built to enable real-time data analysis. The system relies on off-the-shelf hardware components, an open-source software technology for data transfers (ZeroMQ) and a custom software framework for data analysis (AERIE). Multiple trigger and reconstruction algorithms can be combined and run on blocks of data in a parallel fashion, producing a set of output data streams which can be analyzed in real time with minimal latency (system and the real-time data processing system. The performance of these systems is also discussed.

  16. A method to increase optical timing spectra measurement rates using a multi-hit TDC

    International Nuclear Information System (INIS)

    Moses, W.W.

    1993-01-01

    A method is presented for using a modern time to digital converter (TDC) to increase the data collection rate for optical timing measurements such as scintillator decay times. It extends the conventional delayed coincidence method, where a synchronization signal ''starts'' a TDC and a photomultiplier tube (PMT) sampling the optical signal ''stops'' the TDC. Data acquisition rates are low with the conventional method because ε, the light collection efficiency of the ''stop'' PMT, is artificially limited to ε∼0.01 photons per ''start'' signal to reduce the probability of detecting more than one photon during the sampling period. With conventional TDCs, these multiple photon events bias the time spectrum since only the first ''stop'' pulse is digitized. The new method uses a modern TDC to detect whether additional ''stop'' signals occur during the sampling period, and actively reject these multiple photon events. This allows ε to be increased to almost 1 photon per ''start'' signal, which maximizes the data acquisition rate at a value nearly 20 times higher. Multi-hit TDCs can digitize the arrival times of n ''stop'' signals per ''start'' signal, which allows ε to be increased to ∼3n/4. While overlap of the ''stop'' signals prevents the full gain in data collection rate to be realized, significant improvements are possible for most applications. (orig.)

  17. Modelling a multi-crystal detector block for PET

    International Nuclear Information System (INIS)

    Carroll, L.R.; Nutt, R.; Casey, M.

    1985-01-01

    A simple mathematical model describes the performance of a modular detector ''block'' which is a key component in an advanced, high-resolution PET Scanner. Each block contains 32 small bismuth germanate (BGO) crystals coupled to four photomultiplier tubes (PMTs) through a coded light pipe. AT each PMT cathode the charge released for 511 keV coincidence events may be characterized as Poisson random variables in which the variance grows as the mean of the observed current. Given the light from BGO, one must; arrange the best coding - the distribution of light to the four PMTs, specify an optimum decoding scheme for choosing the correct crystal location from a noisy ensemble of PMT currents, and estimate the average probability of error. The statistical fluctuation or ''noise'' becomes decoupled from the ''signal'' and can be regarded as independent, additive components with zero mean and unit variance. Moreover, the envelope of the transformed noise distribution approximates very closely a normal (Gaussian) distribution with variance = 1. Specifying the coding and decoding strategy becomes a problem of signalling through a channel corrupted by additive, white, Gaussian noise; a classic problem long since solved within the context of Communication Engineering using geometry: i.e. distance, volume, angle, inner product, etc., in a linear space of higher dimension

  18. Bi-directional Reflectance of Icy Surface Analogs: A Dual Approach

    Science.gov (United States)

    Quinones, Juan Manuel; Vides, Christina; Nelson, Robert M.; Boryta, Mark; Mannat, Ken s.

    2018-01-01

    Bi-directional reflectance measurements of analogs for planetary regolith have provided insight into the surface properties of planetary satellites and small bodies. Because Aluminum Oxide (Al2O3) and water ice share a similar hexagonal crystalline structure, the former has been used in laboratory experiments to simulate the regolith of both icy and dusty planetary bodies. By measuring various sizes of well sorted size fractions of Al2O3, the reflectance phase curve and porosity of a planetary regolith can be determined. We have designed an experiment to test the laboratory measurements produced by Nelson et al. (2000). Additionally, we made reflectance measurements for other alkali-halide compounds that could be used for applications beyond astronomy and planetary science.In order to provide an independent check on the Nelson et al. data, we designed an instrument with a different configuration. While both instruments take bidirectional reflectance measurements, our instrument, the Rigid Photometric Goniometer (RPG), is fixed at a phase angle of 5° and detects the scattered light with a photomultiplier tube (PMT). The PMT current is then measured with an electrometer. Following the example of Nelson et al., we measured the bidirectional reflectance of Al2O3 particulate size fractions between 0.1sizes from 20size that provided optimal, or maximum, reflectance for each compound. Our conclusions bring confirmation and clarity to photometric sciences.

  19. Spatial resolution evaluation with a pair of two four-layer DOI detectors for small animal PET scanner: jPET-RD

    International Nuclear Information System (INIS)

    Nishikido, Fumihiko; Tsuda, Tomoaki; Yoshida, Eiji; Inadama, Naoko; Shibuya, Kengo; Yamaya, Taiga; Kitamura, Keishi; Takahashi, Kei; Ohmura, Atsushi; Murayama, Hideo

    2008-01-01

    We are developing a small animal PET scanner, 'jPET-RD' to achieve high sensitivity as well as high spatial resolution by using four-layer depth-of-interaction (DOI) detectors. The jPET-RD is designed with two detector rings. Each detector ring is composed of six DOI detectors arranged hexagonally. The diameter of the field-of-view (FOV) is 8.8 cm, which is smaller than typical small animal PET scanners on the market now. Each detector module consists of a crystal block and a 256-channel flat panel position-sensitive photomultiplier tube. The crystal block, consisting of 32x32x4 crystal (4096 crystals, each 1.46 mmx1.46 mmx4.5 mm) and a reflector, is mounted on the 256ch FP-PMT. In this study, we evaluated the spatial resolution of reconstructed images with the evaluation system of two four-layer DOI detectors which consist of 32x32x4 LYSO (Lu: 98%, Y: 2%) crystals coupled on the 256ch FP-PMT by using RTV rubber. The spatial resolution of 1.5 mm was obtained at the center of the FOV by the filtered back projection. The spatial resolution, better than 2 mm in the whole FOV, was also achieved with DOI while the spatial resolution without DOI was degraded to 3.3 mm

  20. Combined readout of a triple-GEM detector

    Science.gov (United States)

    Antochi, V. C.; Baracchini, E.; Cavoto, G.; Di Marco, E.; Marafini, M.; Mazzitelli, G.; Pinci, D.; Renga, F.; Tomassini, S.; Voena, C.

    2018-05-01

    Optical readout of GEM based devices by means of high granularity and low noise CMOS sensors allows to obtain very interesting tracking performance. Space resolution of the order of tens of μm were measured on the GEM plane along with an energy resolution of 20%÷30%. The main limitation of CMOS sensors is represented by their poor information about time structure of the event. In this paper, the use of a concurrent light readout by means of a suitable photomultiplier and the acquisition of the electric signal induced on the GEM electrode are exploited to provide the necessary timing informations. The analysis of the PMT waveform allows a 3D reconstruction of each single clusters with a resolution on z of 100 μm. Moreover, from the PMT signals it is possible to obtain a fast reconstruction of the energy released within the detector with a resolution of the order of 25% even in the tens of keV range useful, for example, for triggering purpose.

  1. Upgrade Analog Readout and Digitizing System for ATLAS TileCal Demonstrator

    CERN Document Server

    Tang, F; Anderson, K; Bohm, C; Hildebrand, K; Muschter, S; Oreglia, M

    2015-01-01

    The TileCal Demonstrator is a prototype for a future upgrade to the ATLAS hadron calorimeter when the Large Hadron Collider increases luminosity in year 2023 (HL-LHC). It will be used for functionality and performance tests. The Demonstrator has 48 channels of upgraded readout and digitizing electronics and a new digital trigger capability, but is backwards-compatible with the present detector system insofar as it also provides analog trigger signals. The Demonstrator is comprised of 4 identical mechanical mini-drawers, each equipped with up to 12 photomultipliers (PMTs). The on-detector electronics includes 45 Front-End Boards, each serving an individual PMT; 4 Main Boards, each to control and digitize up to 12 PMT signals, and 4 corresponding high-speed Daughter Boards serving as data hubs between on-detector and off-detector electronics. The Demonstrator is fully compatible with the present system, accepting ATLAS triggers, timing and slow control commands for the data acquisition, detector control, and de...

  2. Analog Readout and Digitizing System for ATLAS TileCal Demonstrator

    CERN Document Server

    Tang, F; The ATLAS collaboration

    2014-01-01

    The TileCal Demonstrator is a prototype for a future upgrade to the ATLAS hadron calorimeter when the Large Hadron Collider increases luminosity in year 2023 (HL-LHC). It will be used for functionality and performance tests. The Demonstrator has 48 channels of upgraded readout and digitizing electronics and a new digital trigger capability, but is backwards-compatible with the present detector system insofar as it also provides analog trigger signals. The Demonstrator is comprised of 4 identical mechanical mini-drawers, each equipped with up to 12 photomultipliers (PMTs). The on-detector electronics includes 45 Front-End Boards, each serving an individual PMT; 4 Main Boards, each to control and digitize up to 12 PMT signals, and 4 corresponding high-speed Daughter Boards serving as data hubs between on-detector and off-detector electronics. The Demonstrator is fully compatible with the present system, accepting ATLAS triggers, timing and slow control commands for the data acquisition, detector control, and de...

  3. Reliable and redundat FPGAbased read-out design in the ATLAS TileCal Demonstrator

    CERN Document Server

    Akerstedt, H; The ATLAS collaboration

    2014-01-01

    The TileCal Demonstrator is a prototype for a future upgrade to the ATLAS hadron calorimeter when the Large Hadron Collider increases its luminosity in year 2023 (HL-LHC). It will be used for functionality and performance tests. The Demonstrator has 48 channels of upgraded readout and digitizing electronics and a new digital trigger capability, but stays backwards compatible with the present detector system by providing analog trigger signals. The Demonstrator is comprised of 4 identical “mini-drawers”, each equipped with up to 12 photomultipliers (PMTs). The on-detector electronics includes 45 Front-End Boards, each serving an individual PMT; 4 Main Boards, each to control and digitize the 12 PMT signals, and 4 corresponding high-speed Daughter Boards serving as data hubs between on-detector and off-detector electronics. The Demonstrator is fully compatible with the present system, accepting ATLAS triggers, timing and slow control commands for the data acquisition, detector control, and detector operatio...

  4. Social media-based civic engagement solutions for dengue prevention in Sri Lanka: results of receptivity assessment.

    Science.gov (United States)

    Lwin, May O; Vijaykumar, Santosh; Foo, Schubert; Fernando, Owen Noel Newton; Lim, Gentatsu; Panchapakesan, Chitra; Wimalaratne, Prasad

    2016-02-01

    This article focuses on a novel social media-based system that addresses dengue prevention through an integration of three components: predictive surveillance, civic engagement and health education. The aim was to conduct a potential receptivity assessment of this system among smartphone users in the city of Colombo, the epicenter of the dengue epidemic in the island country of Sri Lanka. Grounded in Protection Motivation Theory (PMT) and using a convenience sampling approach, the cross-sectional survey assessed perceived severity (PSe), perceived susceptibility (PSu), perceived response efficacy (PRE), perceived self-efficacy (PSE) and intention-to-use (IU) among 513 individuals. The overall receptivity to the system was high with a score of >4.00 on a five-point scale. Participants belonging to younger, better educated and higher income groups reported significantly better perceptions of the efficaciousness of the system, were confident in their ability to use the system, and planned to use it in the future. PMT variables contributed significantly to regression models predicting IU. We concluded that a social media-based system for dengue prevention will be positively received among Colombo residents and a targeted, strategic health communication effort to raise dengue-related threat perceptions will be needed to encourage greater adoption and use of the system. © The Author 2015. Published by Oxford University Press. All rights reserved. For permissions, please email: journals.permissions@oup.com.

  5. Implementing a Java Based GUI for RICH Detector Analysis

    Science.gov (United States)

    Lendacky, Andrew; Voloshin, Andrew; Benmokhtar, Fatiha

    2016-09-01

    The CLAS12 detector at Thomas Jefferson National Accelerator Facility (TJNAF) is undergoing an upgrade. One of the improvements is the addition of a Ring Imaging Cherenkov (RICH) detector to improve particle identification in the 3-8 GeV/c momentum range. Approximately 400 multi anode photomultiplier tubes (MAPMTs) are going to be used to detect Cherenkov Radiation in the single photoelectron spectra (SPS). The SPS of each pixel of all MAPMTs have been fitted to a mathematical model of roughly 45 parameters for 4 HVs, 3 OD. Out of those parameters, 9 can be used to evaluate the PMTs performance and placement in the detector. To help analyze data when the RICH is operational, a GUI application was written in Java using Swing and detector packages from TJNAF. To store and retrieve the data, a MySQL database program was written in Java using the JDBC package. Using the database, the GUI pulls the values and produces histograms and graphs for a selected PMT at a specific HV and OD. The GUI will allow researchers to easily view a PMT's performance and efficiency to help with data analysis and ring reconstruction when the RICH is finished.

  6. Novel micropixel avalanche photodiodes (MAPD) with super high pixel density

    International Nuclear Information System (INIS)

    Anfimov, N.; Chirikov-Zorin, I.; Dovlatov, A.; Gavrishchuk, O.; Guskov, A.; Khovanskiy, N.; Krumshtein, Z.; Leitner, R.; Meshcheryakov, G.; Nagaytsev, A.; Olchevski, A.; Rezinko, T.; Sadovskiy, A.; Sadygov, Z.; Savin, I.; Tchalyshev, V.; Tyapkin, I.; Yarygin, G.; Zerrouk, F.

    2011-01-01

    In many detectors based on scintillators the photomultiplier tubes (PMTs) are used as photodetectors. At present photodiodes are finding wide application. Solid state photodetectors allow operation in strong magnetic fields that are often present in applications, e.g. some calorimeters operating near magnets, combined PET and MRT, etc. The photon detection efficiency (PDE) of photodiodes may reach values a few times higher than that of PMTs. Also, they are rigid, compact and have relatively low operating voltage. In the last few years Micropixel Avalanche PhotoDiodes (MAPD) have been developed and started to be used. The MAPD combines a lot of advantages of semiconductor photodetectors and has a high gain, which is close to that of the PMT. Yet, they have some disadvantages, and one of them is a limited dynamic range that corresponds to a total number of pixels. The novel deep microwell MAPD with high pixel density produced by the Zecotek Company partially avoids this disadvantage. In this paper characteristics of these photodetectors are presented in comparison with the PMT characteristics. The results refer to measurements of the gain, PDE, cross-talks, photon counting and applications: beam test results of two different 'Shashlyk' EM calorimeters for COMPASS (CERN) and NICA-MPD (JINR) with the MAPD readout and a possibility of using the MAPD in PET.

  7. Measurements of recent microchannel-plate photomultipliers with significantly increased lifetime

    Energy Technology Data Exchange (ETDEWEB)

    Uhlig, Fred; Eyrich, Wolfgang; Lehmann, Albert; Britting, Alexander [Universitaet Erlangen, Physikal. Institut IV (Germany); Collaboration: PANDA-Collaboration

    2015-07-01

    Microchannel-plate photomultipliers (MCP-PMTs) are the favored sensors for the DIRC detectors (Detection of Internally Reflected Cherenkov Light) of the PANDA experiment. They are usable in high magnetic fields of up to 2T and reach a time resolution of better than 50 ps (σ). The anticipated average luminosity of 2.10{sup 32} cm{sup -2} s{sup -1} in the detector requires a rate capability high enough to withstand a detected photon rate of about 200 kHz cm{sup -2} at the MCP-PMT surfaces. The major drawback until recently was the limited lifetime of MCP-PMTs, which appears to be solved for the latest generation of MCP-PMT prototype devices. The aging parameter is the quantum efficiency as a function of the integrated anode charge, which will be in the region of 5 C/cm{sup 2} for the Barrel- and the Disc-DIRC. We simultaneously measured the aging of several MCP-PMTs, which were treated with different methods to enhance the lifetime. Results of these measurements are presented.

  8. Upgrade of the ATLAS Hadronic Tile Calorimeter for the High Luminosity LHC

    CERN Document Server

    Hildebrand, Kevin; The ATLAS collaboration

    2017-01-01

    The Tile Calorimeter is the hadronic calorimeter covering the central region of the ATLAS detector at the Large Hadron Collider. It is a scintillator-steel sampling calorimeter read out via wavelength shifting fibers coupled to photomultiplier tubes (PMT). The PMT signals are digitized and stored on detector until a trigger is received. The Large Hadron Collider (LHC) has envisaged a series of upgrades towards a High Luminosity LHC (HL-LHC) delivering five times the LHC nominal instantaneous luminosity. The ATLAS Phase II upgrade (2024-2025) will accommodate the upgrade of the detector and data acquisition system for the HL-LHC. In particular, TileCal will undergo a major replacement of its on- and off-detector electronics. In the new architecture, all signals will be digitized and then transferred directly to the off-detector electronics, where the signals will be reconstructed, stored, and sent to the first level of trigger at the rate of 40 MHz. This will provide better precision of the calorimeter signals...

  9. The upgrade of the laser calibration system for the ATLAS hadron calorimeter TileCal

    CERN Document Server

    Spalla, Margherita; The ATLAS collaboration

    2014-01-01

    The Tile Calorimeter (TileCal), the central section of the hadronic calorimeter of the ATLAS experiment, is a key detector component to detect hadrons, jets and taus and to measure the missing transverse energy. TileCal is built of steel and scintillating tiles coupled to optical fibers and read‐out by photomultipliers (PMT). The performance of TileCal relies on a continuous, high resolution calibration of the individual response of the 10,000 channels forming the detector. The calibration is based on a three level architecture: a charge injection system used to monitor the full electronics chain including front-end amplifiers, digitizers and event builder blocks for each individual channel; a distributed optical system using laser pulses to excite all PMTs; and a mobile Cesium radiative source which is driven through the detector cell floating inside a pipe system. This architecture allows for a cascade calibration of the electronics, of the PMT and electronics, and of full chain including the active detec...

  10. Massive Pulmonary Embolism: Treatment with the Rotarex Thrombectomy System

    International Nuclear Information System (INIS)

    Liu Sheng; Shi Haibin; Gu Jianping; Yang Zhengqiang; Chen Liang; Lou Wensheng; He Xu; Zhou Weizhong; Zhou Chungao; Zhao Linbo; Xia Jinguo; Li Linsun

    2011-01-01

    This study was designed to evaluate the efficacy and safety of percutaneous mechanical thrombectomy (PMT) for acute massive pulmonary embolism (PE). Fourteen patients (8 men, 6 women) with a mean age of 55.4 (range, 38–71) years with acute massive PE were initially diagnosed by computed tomography (CT) and confirmed by pulmonary angiography. All patients presented with acute PE symptoms and hemodynamic compromise. Each patient was treated with Straub Rotarex thrombectomy device and five patients received additional thrombolysis. Technique success and clinical improvement were achieved in all patients without major complications. The mean pulmonary artery pressure (PAP) decreased from 37.6 ± 6.6 to 29 ± 6.4 mmHg (P 2 (PaO 2 ) increased from 61.1 ± 9.2 to 88 ± 5.1 mmHg (P < 0.01). The Miller index was 0.67 ± 0.11 and 0.37 ± 0.13 (P < 0.01), respectively, before and after PMT (P < 0.01). Eleven patients had no recurrence of PE on a mean follow-up of 28.3 months, whereas the other three patients were lost to follow-up. The preliminary experience in our series suggests that the Straub Rotarex thrombectomy device, which has been utilized in peripheral arteries, also is useful for the treatment of acute massive PE.

  11. Characterization of optical properties of the site of the ANTARES neutrino telescope

    International Nuclear Information System (INIS)

    Yepes-Ramírez, H.

    2013-01-01

    ANTARES is a neutrino detector based on a three-dimensional grid of photomultipliers tubes (PMT's) arranged in several detection lines anchored to the seabed at depth of 2.5 km in the Mediterranean Sea (40 km off the Toulon coast in France), its main physics goal is the reconstruction and identification of high energy neutrinos of extra-terrestrial origin. The PMT's register the Cherenkov light induced by relativistic charged leptons produced by the interaction of neutrinos with material in the detector surroundings. The propagation of Cherenkov light strongly depends on the optical properties of the sea water, the understanding of which is crucial in order to achieve the expected detector performance. To reach the ANTARES physics goals, good time and positioning calibration systems are required. The ANTARES optical beacon system consists of a set of pulsed light sources strategically located throughout the detector. The system is mainly used for time calibration but can also be used as a tool to study the water optical properties and their stability. In this contribution we will present the current status of our measurements of the group velocity and transmission length of light carried out between 2008 and 2011. A set of water models strategically defined will be discussed as well as some preliminary results concerning track reconstruction parameters

  12. Applications of High Speed Configurable Logic Devices in Modern Particle Physics Experiments

    CERN Document Server

    Giorgi, Filippo Maria

    Several activities were conducted during my PhD activity. For the NEMO experiment a collaboration between the INFN/University groups of Catania and Bologna led to the development and production of a mixed signal acquisition board for the Nemo Km3 telescope. The research concerned the feasibility study for a different acquisition technique quite far from that adopted in the NEMO Phase 1 telescope. The DAQ board that we realized exploits the LIRA06 front-end chip for the analog acquisition of anodic an dynodic sources of a PMT (Photo-Multiplier Tube). The low-power analog acquisition allows to sample contemporaneously multiple channels of the PMT at different gain factors in order to increase the signal response linearity over a wider dynamic range. Also the auto triggering and self-event-classification features help to improve the acquisition performance and the knowledge on the neutrino event. A fully functional interface towards the first level data concentrator, the Floor Control Module, has been integrated...

  13. Two dimensional spatial distortion correction algorithm for scintillation GAMMA cameras

    International Nuclear Information System (INIS)

    Chaney, R.; Gray, E.; Jih, F.; King, S.E.; Lim, C.B.

    1985-01-01

    Spatial distortion in an Anger gamma camera originates fundamentally from the discrete nature of scintillation light sampling with an array of PMT's. Historically digital distortion correction started with the method based on the distortion measurement by using 1-D slit pattern and the subsequent on-line bi-linear approximation with 64 x 64 look-up tables for X and Y. However, the X, Y distortions are inherently two-dimensional in nature, and thus the validity of this 1-D calibration method becomes questionable with the increasing distortion amplitude in association with the effort to get better spatial and energy resolutions. The authors have developed a new accurate 2-D correction algorithm. This method involves the steps of; data collection from 2-D orthogonal hole pattern, 2-D distortion vector measurement, 2-D Lagrangian polynomial interpolation, and transformation to X, Y ADC frame. The impact of numerical precision used in correction and the accuracy of bilinear approximation with varying look-up table size have been carefully examined through computer simulation by using measured single PMT light response function together with Anger positioning logic. Also the accuracy level of different order Lagrangian polynomial interpolations for correction table expansion from hole centroids were investigated. Detailed algorithm and computer simulation are presented along with camera test results

  14. The performance of a prototype array of water Cherenkov detectors for the LHAASO project

    Energy Technology Data Exchange (ETDEWEB)

    An, Q. [University of Science and Technology of China, Hefei 230026 (China); State Key Laboratory of Particle Detection and Electronics, Beijing 100049 (China); Bai, Y.X.; Bi, X.J.; Cao, Z. [Institute of High Energy Physics, Chinese Academy of Sciences, Beijing 100049 (China); Chang, J.F. [Institute of High Energy Physics, Chinese Academy of Sciences, Beijing 100049 (China); State Key Laboratory of Particle Detection and Electronics, Beijing 100049 (China); Chen, G.; Chen, M.J. [Institute of High Energy Physics, Chinese Academy of Sciences, Beijing 100049 (China); Chen, S.M. [Tsinghua University, Beijing 100084 (China); Chen, S.Z. [Institute of High Energy Physics, Chinese Academy of Sciences, Beijing 100049 (China); Chen, T.L. [University of Tibet, Lhasa 851600 (China); Chen, X. [Institute of High Energy Physics, Chinese Academy of Sciences, Beijing 100049 (China); Chen, Y.T. [University of Yunnan, Kunming 650091 (China); Cui, S.W. [Normal University of Hebei, Shijiazhuang 050016 (China); Dai, B.Z. [University of Yunnan, Kunming 650091 (China); Du, Q. [Tsinghua University, Beijing 100084 (China); Danzengluobu [University of Tibet, Lhasa 851600 (China); Feng, C.F. [University of Shandong, Jinan 250100 (China); Feng, S.H.; Gao, B. [Institute of High Energy Physics, Chinese Academy of Sciences, Beijing 100049 (China); Gao, S.Q. [National Space Science Center, Chinese Academy of Sciences, Beijing 100190 (China); and others

    2013-10-01

    A large high-altitude air-shower observatory (LHAASO) is to be built at Shangri-La, Yunnan Province, China. This observatory is intended to conduct sub-TeV gamma astronomy, and as an important component of the LHAASO project, a water Cherenkov detector array (WCDA) is proposed. To investigate engineering issues and fully understand the water Cherenkov technique for detecting air showers, a prototype array at 1% scale of the LHAASO-WCDA has been built at Yang-Ba-Jing, Tibet, China. This paper introduces the prototype array setup and studies its performance by counting rate of each photomultiplier tube (PMT), trigger rates at different PMT multiplicities, and responses to air showers. Finally, the reconstructed shower directions and angular resolutions of the detected showers for the prototype array are given. -- Highlights: • The technique of the water Cherenkov array is studied. • Engineering issues of the water Cherenkov array are investigated. • The PMTs and electronics of the water Cherenkov array are tested. • Some key parameters of the water Cherenkov array are measured.

  15. The performance of a prototype array of water Cherenkov detectors for the LHAASO project

    International Nuclear Information System (INIS)

    An, Q.; Bai, Y.X.; Bi, X.J.; Cao, Z.; Chang, J.F.; Chen, G.; Chen, M.J.; Chen, S.M.; Chen, S.Z.; Chen, T.L.; Chen, X.; Chen, Y.T.; Cui, S.W.; Dai, B.Z.; Du, Q.; Danzengluobu; Feng, C.F.; Feng, S.H.; Gao, B.; Gao, S.Q.

    2013-01-01

    A large high-altitude air-shower observatory (LHAASO) is to be built at Shangri-La, Yunnan Province, China. This observatory is intended to conduct sub-TeV gamma astronomy, and as an important component of the LHAASO project, a water Cherenkov detector array (WCDA) is proposed. To investigate engineering issues and fully understand the water Cherenkov technique for detecting air showers, a prototype array at 1% scale of the LHAASO-WCDA has been built at Yang-Ba-Jing, Tibet, China. This paper introduces the prototype array setup and studies its performance by counting rate of each photomultiplier tube (PMT), trigger rates at different PMT multiplicities, and responses to air showers. Finally, the reconstructed shower directions and angular resolutions of the detected showers for the prototype array are given. -- Highlights: • The technique of the water Cherenkov array is studied. • Engineering issues of the water Cherenkov array are investigated. • The PMTs and electronics of the water Cherenkov array are tested. • Some key parameters of the water Cherenkov array are measured

  16. CCDiode: an optimal detector for laser confocal microscopes

    Science.gov (United States)

    Pawley, James B.; Blouke, Morley M.; Janesick, James R.

    1996-04-01

    The laser confocal microscope (LCM) is now an established research tool in biology and materials science. In biological applications, it is usually employed to detect the location of fluorescent market molecules and, under these conditions, signal levels from bright areas are often digitizer. To maintain the desired +/- 3 e noise level at the relatively high data rate of 1 MHz, our new device utilizes 64 separate readout amplifier/digitizer systems, operating in sequence. The resulting detector is more compact, efficient and reliable than the PMT it replaces but as its sensitive area is smaller than that of a PMT, it will require auxiliary optics when used with any LCM having a large (mm) pinhole. As the signal light is parallel, a simple lens mounted axially and with the CCDiode at its focus would suffice. Future versions may use 3 X 3 or 5 X 5 arrays of sensors to `track' the confocal spot as it is deflected by inhomogeneities of the specimen, change its effective size or shape or detect system misalignment.

  17. Systematic study of new types of Hamamatsu MPPCs read out with the NINO ASIC

    CERN Document Server

    Doroud, K; Williams, M C S; Yamamoto, K; Zichichi, A; Zuyeuski, R

    2014-01-01

    Over the last decade there have been commercial TOF-PET scanners constructed using Photo-Multiplier Tubes (PMT) that have achieved View the MathML source~500ps FWHM Coincidence Time Resolution (CTR). A new device known as the Silicon PhotoMultiplier (SiPM) has the potential to overcome some of the limitations of the PMT. Therefore implementing a SiPM based TOF-PET scanner is of high interest. Recently Philips has introduced a TOF-PET scanner that uses digital Silicon PhotoMultipliers (d-SiPMs) which has a CTR of 350 ps. Here we will report on the timing performance of two Hamamatsu 3×3 mm2 analogue-SiPMs read out with the NINO ASIC: this is an ultra-fast amplifier/discriminator with a differential architecture. The differential architecture is very important since the single-ended readout uses the ground as the signal return; as the ground is also the reference level for the discriminators, the result is high crosstalk and degraded time resolution. However differential readout allows the scaling up from a si...

  18. The NASA Program Management Tool: A New Vision in Business Intelligence

    Science.gov (United States)

    Maluf, David A.; Swanson, Keith; Putz, Peter; Bell, David G.; Gawdiak, Yuri

    2006-01-01

    This paper describes a novel approach to business intelligence and program management for large technology enterprises like the U.S. National Aeronautics and Space Administration (NASA). Two key distinctions of the approach are that 1) standard business documents are the user interface, and 2) a "schema-less" XML database enables flexible integration of technology information for use by both humans and machines in a highly dynamic environment. The implementation utilizes patent-pending NASA software called the NASA Program Management Tool (PMT) and its underlying "schema-less" XML database called Netmark. Initial benefits of PMT include elimination of discrepancies between business documents that use the same information and "paperwork reduction" for program and project management in the form of reducing the effort required to understand standard reporting requirements and to comply with those reporting requirements. We project that the underlying approach to business intelligence will enable significant benefits in the timeliness, integrity and depth of business information available to decision makers on all organizational levels.

  19. Femtomolar detection of single mismatches by discriminant analysis of DNA hybridization events using gold nanoparticles.

    Science.gov (United States)

    Ma, Xingyi; Sim, Sang Jun

    2013-03-21

    Even though DNA-based nanosensors have been demonstrated for quantitative detection of analytes and diseases, hybridization events have never been numerically investigated for further understanding of DNA mediated interactions. Here, we developed a nanoscale platform with well-designed capture and detection gold nanoprobes to precisely evaluate the hybridization events. The capture gold nanoprobes were mono-laid on glass and the detection probes were fabricated via a novel competitive conjugation method. The two kinds of probes combined in a suitable orientation following the hybridization with the target. We found that hybridization efficiency was markedly dependent on electrostatic interactions between DNA strands, which can be tailored by adjusting the salt concentration of the incubation solution. Due to the much lower stability of the double helix formed by mismatches, the hybridization efficiencies of single mismatched (MMT) and perfectly matched DNA (PMT) were different. Therefore, we obtained an optimized salt concentration that allowed for discrimination of MMT from PMT without stringent control of temperature or pH. The results indicated this to be an ultrasensitive and precise nanosensor for the diagnosis of genetic diseases.

  20. Operation of ADITYA Thomson scattering system: measurement of temperature and density

    International Nuclear Information System (INIS)

    Thomas, Jinto; Pillai, Vishal; Singh, Neha; Patel, Kiran; Lingeshwari, G.; Hingrajiya, Zalak; Kumar, Ajai

    2015-01-01

    ADITYA Thomson scattering (TS) system is a single point measurement system operated using a 10 J ruby laser and a 1 meter grating spectrometer. Multi-slit optical fibers are arranged at the image plane of the spectrometer so that each fiber slit collects 2 nm band of scattered spectrum. Each slit of the fiber bundle is coupled to high gain Photomultiplier tubes (PMT). Standard white light source is used to calibrate the optical fiber transmission and the laser light itself is used to calibrate the relative gain of the PMT. Rayleigh scattering has been performed for the absolute calibration of the TS system. The temperature of ADITYA plasma has been calculated using the conventional method of estimation (calculated using the slope of logarithmic intensity vs the square of delta lambda). It has been observed that the core temperature of ADITYA Tokamak plasma is in the range of 300 to 600 eV for different plasma shots and the density 2-3 X 10 13 /cc. The time evolution of the plasma discharge has been studied by firing the laser at different times of the discharge assuming the shots are identical. In some of the discharges, the velocity distribution appears to be non Maxwellian. (author)