WorldWideScience

Sample records for dual-head pmt clearpet

  1. Validation of GEANT3 simulation studies with a dual-head PMT ClearPET TM prototype

    CERN Document Server

    Ziemons, K; Streun, M; Pietrzyk, U

    2004-01-01

    The ClearPET TM project is proposed by working groups of the Crystal Clear Collaboration (CCC) to develop a 2/sup nd/ generation high performance small animal positron emission tomograph (PET). High sensitivity and high spatial resolution is foreseen for the ClearPET TM camera by using a phoswich arrangement combining mixed lutetium yttrium aluminum perovskite (LuYAP:Ce) and lutetium oxyorthosilicate (LSO) scintillating crystals. Design optimizations for the first photomultiplier tube (PMT) based ClearPET camera are done with a Monte-Carlo simulation package implemented on GEANT3 (CERN, Geneva, Switzerland). A dual-head prototype has been built to test the frontend electronics and was used to validate the implementation of the GEANT3 simulation tool. Multiple simulations were performed following the experimental protocols to measure the intrinsic resolution and the sensitivity profile in axial and radial direction. Including a mean energy resolution of about 27.0% the simulated intrinsic resolution is about (...

  2. Count rate performance study of the Lausanne ClearPET scanner demonstrator

    Energy Technology Data Exchange (ETDEWEB)

    Rey, M. [LPHE, Ecole Polytechnique Federale de Lausanne, CH-1015 Lausanne (Switzerland)]. E-mail: martin.rey@epfl.ch; Jan, S. [Service Hospitalier Frederic Joliot, CEA, F-91401 Orsay (France); Vieira, J.-M. [LPHE, Ecole Polytechnique Federale de Lausanne, CH-1015 Lausanne (Switzerland); Mosset, J.-B. [LPHE, Ecole Polytechnique Federale de Lausanne, CH-1015 Lausanne (Switzerland); Krieguer, M. [IIHE, Vrije Universiteit Brussel, B-1050 Brussels (Belgium); Comtat, C. [Service Hospitalier Frederic Joliot, CEA, F-91401 Orsay (France); Morel, C. [CPPM, CNRS-IN2P3, Universite de la Mediterranee Aix-Marseille II, F-13288 Marseille (France)

    2007-02-01

    This paper presents the count rate measurements obtained with the Lausanne partial ring ClearPET scanner demonstrator and compares them against GATE Monte Carlo simulations. For the present detector setup, a maximum single event count rate of 1.1 Mcps is measured or a 250-750 keV energy window. This corresponds to a coincidence count rate of approximately 22 kcps. Good agreements are observed between measured and simulated data. Count rate performance, including Noise Equivalent Count (NEC) curves, are determined and extrapolated for a full ring ClearPET design using GATE Monte Carlo simulations. For a full ring design with three rings of detector modules, NEC is peaking at about 70 kcps for 20 MBq.

  3. PMT overshoot study for JUNO prototype detector

    CERN Document Server

    Luo, F J; Wang, Z M; Wang, P L; Qin, Z H; Xu, M H; Liao, D H; Zhang, H Q; Lei, X C; Qian, S; Liu, S L; Chen, Y B; Wang, Y F

    2016-01-01

    The quality of PMT signal is one of the key items for a large and high precision neutrino experiment, like Daya Bay, JUNO, while most of the experiments are affected by the PMT signal overshoot from its positive HV-single cable scheme. For JUNO prototype detector, we have a detailed study on the PMT overshoot and successfully reduced the ratio of overshoot amplitude to signal to ~1% from previous typical ~10%, with no affection to PMT other parameters. Furthermore, we calculated that the overshoot is a result of discharging of capacitors in the HV-signal splitter and the PMT voltage divider. The study result is extremely important for JUNO and other similar experiments.

  4. Monte Carlo Simulation and Experimental Characterization of a Dual Head Gamma Camera

    CERN Document Server

    Rodrigues, S; Abreu, M C; Santos, N; Rato-Mendes, P; Peralta, L

    2007-01-01

    The GEANT4 Monte Carlo simulation and experimental characterization of the Siemens E.Cam Dual Head gamma camera hosted in the Particular Hospital of Algarve have been done. Imaging tests of thyroid and other phantoms have been made "in situ" and compared with the results obtained with the Monte Carlo simulation.

  5. Perspectives about Family Meals from Single-Headed and Dual-Headed Households: A Qualitative Analysis

    Science.gov (United States)

    Berge, Jerica M.; Hoppmann, Caroline; Hanson, Carrie; Neumark-Sztainer, Dianne

    2013-01-01

    Cross-sectional and longitudinal research has shown that family meals are protective for adolescent healthful eating behaviors. However, little is known about what parents think of these findings and whether parents from single- versus dual-headed households have differing perspectives about the findings. Additionally, parents’ perspectives regarding barriers to applying the findings on family meals in their own homes and suggestions for more wide-spread adoption of the findings are unknown. The current study aimed to identify single- and dual-headed household parents’ perspectives regarding the research findings on family meals, barriers to applying the findings in their own homes and suggestions for helping families have more family meals. The current qualitative study included 59 parents who participated in sub-study of two linked multi-level studies—EAT 2010 (Eating and Activity in Teens) and Families and Eating and Activity in Teens (F-EAT). Parents (91.5% female) were racially/ethnically and socio-economically diverse. Data were analyzed using a grounded theory approach. Results from the current study suggest that parents from both single- and dual-headed households have similar perspectives regarding why family meals are protective for healthful eating habits for adolescents (e.g., provides structure/routine, opportunities for communication, connection), but provide similar and different reasons for barriers to family meals (e.g., single-headed=cost vs. dual-headed=lack of creativity) and ideas and suggestions for how to increase the frequency of family meals (e.g., single-headed=give fewer options vs. dual-headed=include children in the meal preparation). Findings may help inform public health intervention researchers and providers who work with adolescents and their families to understand how to approach discussions regarding reasons for having family meals, barriers to carrying out family meals and ways to increase family meals depending on family

  6. Perspectives about family meals from single-headed and dual-headed households: a qualitative analysis.

    Science.gov (United States)

    Berge, Jerica M; Hoppmann, Caroline; Hanson, Carrie; Neumark-Sztainer, Dianne

    2013-12-01

    Cross-sectional and longitudinal research has shown that family meals are protective for adolescent healthful eating behaviors. However, little is known about what parents think of these findings and whether parents from single- vs dual-headed households have differing perspectives about the findings. In addition, parents' perspectives regarding barriers to applying the findings on family meals in their own homes and suggestions for more widespread adoption of the findings are unknown. The current study aimed to identify single- and dual-headed household parents' perspectives regarding the research findings on family meals, barriers to applying the findings in their own homes, and suggestions for helping families have more family meals. The current qualitative study included 59 parents who participated in substudy of two linked multilevel studies-EAT 2010 (Eating and Activity in Teens) and Families and Eating and Activity in Teens (F-EAT). Parents (91.5% female) were racially/ethnically and socioeconomically diverse. Data were analyzed using a grounded theory approach. Results from the current study suggest that parents from both single- and dual-headed households have similar perspectives regarding why family meals are protective for healthful eating habits for adolescents (eg, provides structure/routine, opportunities for communication, connection), but provide similar and different reasons for barriers to family meals (eg, single-headed=cost vs dual-headed=lack of creativity) and ideas and suggestions for how to increase the frequency of family meals (eg, single-headed=give fewer options vs dual-headed=include children in the meal preparation). Findings can help inform public health intervention researchers and providers who work with adolescents and their families to understand how to approach discussions regarding reasons for having family meals, barriers to carrying out family meals, and ways to increase family meals depending on family structure.

  7. Analysis of time resolution in a dual head LSO+PSPMT PET system using low pass filter interpolation and digital constant fraction discriminator techniques

    Energy Technology Data Exchange (ETDEWEB)

    Monzo, Jose M. [Digital Systems Design (DSD) Group, ITACA Institute, Universidad Politecnica de Valencia, Camino de Vera s/n, 46022 Valencia (Spain)], E-mail: jmonfer@aaa.upv.es; Lerche, Christoph W.; Martinez, Jorge D.; Esteve, Raul; Toledo, Jose; Gadea, Rafael; Colom, Ricardo J.; Herrero, Vicente; Ferrando, Nestor; Aliaga, Ramon J.; Mateo, Fernando [Digital Systems Design (DSD) Group, ITACA Institute, Universidad Politecnica de Valencia, Camino de Vera s/n, 46022 Valencia (Spain); Sanchez, Filomeno [Nuclear Medical Physics Group, IFIC Institute, Consejo Superior de Investigaciones Cientificas (CSIC), 46980 Paterna (Spain); Mora, Francisco J. [Digital Systems Design (DSD) Group, ITACA Institute, Universidad Politecnica de Valencia, Camino de Vera s/n, 46022 Valencia (Spain); Benlloch, Jose M. [Nuclear Medical Physics Group, IFIC Institute, Consejo Superior de Investigaciones Cientificas (CSIC), 46980 Paterna (Spain); Sebastia, Angel [Digital Systems Design (DSD) Group, ITACA Institute, Universidad Politecnica de Valencia, Camino de Vera s/n, 46022 Valencia (Spain)

    2009-06-01

    PET systems need good time resolution to improve the true event rate, random event rejection, and pile-up rejection. In this study we propose a digital procedure for this task using a low pass filter interpolation plus a Digital Constant Fraction Discriminator (DCFD). We analyzed the best way to implement this algorithm on our dual head PET system and how varying the quality of the acquired signal and electronic noise analytically affects timing resolution. Our detector uses two continuous LSO crystals with a position sensitive PMT. Six signals per detector are acquired using an analog electronics front-end and these signals are processed using an in-house digital acquisition board. The test bench developed simulates the electronics and digital algorithms using Matlab. Results show that electronic noise and other undesired effects have a significant effect on the timing resolution of the system. Interpolated DCFD gives better results than non-interpolated DCFD. In high noise environments, differences are reduced. An optimum delay selection, based on the environment noise, improves time resolution.

  8. X-band Linac for a 6 MeV dual-head radiation therapy gantry

    Science.gov (United States)

    Lee, Seung Hyun; Shin, Seung-Wook; Lee, Jongchul; Kim, Hui-Su; Lee, Byeong-No; Lee, Byung-Chul; Park, Hyung-dal; Song, Ki-back; Song, Ho-seung; Mun, Sangchul; Ha, Donghyup; Chai, Jong-Seo

    2017-04-01

    We developed a design for a 6 MeV X-band linear accelerator for radiation therapy in a dual-head gantry layout. The dual-head gantry has two linacs that can be operated independently. Each X-band linac accelerates electron bunches using high-power RF and generates X-rays for radiation therapy. It requires a versatile RF system and pulse sequence to accomplish various radiation therapy procedures. The RF system consists of 9.3 GHz, 2 MW X-band magnetron and associated RF transmission components. A test linac was assembled and operated to characterize its RF performance without beam. This paper presents these results along with a description of the gantry linacs and their operational requirements.

  9. VSiPMT a new photon detector

    Science.gov (United States)

    Di Capua, F.; Barbarino, G.; Barbato, F. C. T.; Campajola, L.; de Asmundis, R.; De Rosa, G.; Migliozzi, P.; Mollo, C. M.; Vivolo, D.

    2016-04-01

    Photon detection is a key factor to study many physical processes in several areas of fundamental physics research. Focusing the attention on photodetectors for particle astrophysics, the future experiments aimed at the study of very high-energy or extremely rare phenomena (e.g. dark matter, proton decay, neutrinos from astrophysical sources) will require additional improvements in linearity, gain, quantum efficiency and single photon counting capability. To meet the requirements of these class of experiments, we propose a new design for a modern hybrid photodetector: the VSiPMT (Vacuum Silicon PhotoMultiplier Tube). The idea is to replace the classical dynode chain of a PMT with a SiPM, which therefore acts as an electron detector and amplifier. The aim is to match the large sensitive area of a photocathode with the performances of the SiPM technology.

  10. VSiPMT a new photon detector

    Directory of Open Access Journals (Sweden)

    Di Capua F.

    2016-01-01

    Full Text Available Photon detection is a key factor to study many physical processes in several areas of fundamental physics research. Focusing the attention on photodetectors for particle astrophysics, the future experiments aimed at the study of very high-energy or extremely rare phenomena (e.g. dark matter, proton decay, neutrinos from astrophysical sources will require additional improvements in linearity, gain, quantum efficiency and single photon counting capability. To meet the requirements of these class of experiments, we propose a new design for a modern hybrid photodetector: the VSiPMT (Vacuum Silicon PhotoMultiplier Tube. The idea is to replace the classical dynode chain of a PMT with a SiPM, which therefore acts as an electron detector and amplifier. The aim is to match the large sensitive area of a photocathode with the performances of the SiPM technology.

  11. Calculation of renal depth by conjugate-view method using dual-head gamma camera

    Energy Technology Data Exchange (ETDEWEB)

    Kim, Hyun Mi; Suh, Tae Suk; Choe, Bo Young; Chung, Yong An; Kim, Sung Hoon; Chung, Soo Kyo; Lee, Hyoung Koo [College of Medicine, The Catholic Univ. of Korea, Seoul (Korea, Republic of)

    2001-12-01

    In this study, we developed a new method for the determination of renal depth with anterior and posterior renal scintigrams in a dual-head gamma camera, considering the attenuation factor e{sup -{mu}}{sup x} of the conjugate-view method. We developed abdomen and kidney phantoms to perform experiments using Technetium-99m dimercaptosuccinic acid ({sup 99m}Tc-DMSA). The phantom images were obtained by dual-head gamma camera equipped with low-energy, high-resolution, parallel-hole collimators (ICONf, Siemens). The equation was derived from the linear integration of emission {gamma}-ray considering attenuation from the posterior abdomen to the anterior abdomen phantom surface. The program for measurement was developed by Microsoft Visual C++ 6.0. Renal depths of the phantoms were derived from the derived equations and compared with the exact geometrical values. Differences between the measured and the calculated values were the range of 0.1 to 0.7 cm (0.029{+-} 0.15 cm, mean {+-}S. D.). The present study showed that the use of the derived equations for renal depth measurement, combined with quantitative planar imaging using duel-head gamma camera, could provide more accurate results for individual variation than the conventional method.

  12. Influence of Rotation Increments on Imaging Performance for a Rotatory Dual-Head PET System

    Directory of Open Access Journals (Sweden)

    Fanzhen Meng

    2017-01-01

    Full Text Available For a rotatory dual-head positron emission tomography (PET system, how to determine the rotation increments is an open problem. In this study, we simulated the characteristics of a rotatory dual-head PET system. The influences of different rotation increments were compared and analyzed. Based on this simulation, the imaging performance of a prototype system was verified. A reconstruction flowchart was proposed based on a precalculated system response matrix (SRM. The SRM made the relationships between the voxels and lines of response (LORs fixed; therefore, we added the interpolation method into the flowchart. Five metrics, including spatial resolution, normalized mean squared error (NMSE, peak signal-to-noise ratio (PSNR, contrast-to-noise (CNR, and structure similarity (SSIM, were applied to assess the reconstructed image quality. The results indicated that the 60° rotation increments with the bilinear interpolation had advantages in resolution, PSNR, NMSE, and SSIM. In terms of CNR, the 90° rotation increments were better than other increments. In addition, the reconstructed images of 90° rotation increments were also flatter than that of 60° increments. Therefore, both the 60° and 90° rotation increments could be used in the real experiments, and which one to choose may depend on the application requirement.

  13. Cerenkov luminescence imaging guided selective-reconstruction for a flexible dual-head PET

    Science.gov (United States)

    Yang, D.; Chen, X.; Zhang, C.; Wan, L.; Meng, F.; Xie, Q.; Liang, J.

    2017-04-01

    Dual-head PET can simply and flexibilly adjust its architecture to fit the size of the imaging object, making it great potential for simultaneous multi-modality molecular imaging. In this paper, we proposed conceptally dual-modality imaging system of distance-adjustable dual-head PET and Cerenkov luminescence imaging (CLI), and implemented a CLI guided selective-reconstruction method. In the selective-reconstruction, we reconstructed the information inside a predefined region of interest using a fine voxel, whereas reconstructed other regions using a coarse voxel. We used CLI data as a priori information to outline the predefined region of interest. Simultaneously, for reducing the computaion burden, an attenuation map with a coarse voxel size was used for the attenuation correction. We demonstrated the feasibility and effectiveness of our proposed method with Monte Carlo based simulations by reconstructing phantom consisted of two hot rods. Experiment results show that an most improved efficiency over 70 times speedup with an MSE of 5.2235.

  14. VSiPMT for underwater neutrino telescopes

    Energy Technology Data Exchange (ETDEWEB)

    Barbarino, Giancarlo [Università di Napoli Federico II, Dipartimento di Scienze Fisiche, via Cintia 80126 Napoli (Italy); Asmundis, Riccardo de [Istituto Nazionale di fisica Nucleare, sezione di Napoli, Complesso di Monte S. Angelo Ed. 6, via Cintia 80126 Napoli (Italy); De Rosa, Gianfranca [Università di Napoli Federico II, Dipartimento di Scienze Fisiche, via Cintia 80126 Napoli (Italy); Maximiliano Mollo, Carlos [Istituto Nazionale di fisica Nucleare, sezione di Napoli, Complesso di Monte S. Angelo Ed. 6, via Cintia 80126 Napoli (Italy); Vivolo, Daniele, E-mail: vivolo@na.infn.it [Università di Napoli Federico II, Dipartimento di Scienze Fisiche, via Cintia 80126 Napoli (Italy); Istituto Nazionale di fisica Nucleare, sezione di Napoli, Complesso di Monte S. Angelo Ed. 6, via Cintia 80126 Napoli (Italy)

    2013-10-11

    Underwater neutrino telescopes are nowadays considered among the most important aims in the field of astroparticle physics. Their structure consists of a cubic-kilometer three-dimensional array of photosensitive devices aimed at the detection of the Cherenkov light emitted by charged particles produced by high energy neutrino interactions with the Earth. To date, a crucial role in this kind of experiments has been played by PhotoMultiplier Tubes (PMTs), however they suffer from many drawbacks such as linearity-to-gain relationship and difficulty in single photon counting. The next generation of experiments will require further improvements in photon detectors performances, therefore alternatives to PMTs are currently under study. In particular the most promising development in this field is represented by the rapidly emerging CMOS p-n Geiger-mode avalanche photodiode technology (G-APD or SiPM), that will allow the detection of high-speed single photons with high gain and linearity. In order to overcome the limit of small sensitive surfaces we suggest an innovative design for a modern hybrid, high gain, silicon based Vacuum Silicon Photomultiplier Tube (VSiPMT) based on the combination of a SiPM with a hemispherical vacuum glass PMT standard envelope. In this work we describe the full SiPM characterization realized by our group and we present the results of our Geant4-based simulations of electron backscattering over the SiPM surface.

  15. VSiPMT for underwater neutrino telescopes

    Science.gov (United States)

    Barbarino, Giancarlo; de Asmundis, Riccardo; De Rosa, Gianfranca; Maximiliano Mollo, Carlos; Vivolo, Daniele

    2013-10-01

    Underwater neutrino telescopes are nowadays considered among the most important aims in the field of astroparticle physics. Their structure consists of a cubic-kilometer three-dimensional array of photosensitive devices aimed at the detection of the Cherenkov light emitted by charged particles produced by high energy neutrino interactions with the Earth. To date, a crucial role in this kind of experiments has been played by PhotoMultiplier Tubes (PMTs), however they suffer from many drawbacks such as linearity-to-gain relationship and difficulty in single photon counting. The next generation of experiments will require further improvements in photon detectors performances, therefore alternatives to PMTs are currently under study. In particular the most promising development in this field is represented by the rapidly emerging CMOS p-n Geiger-mode avalanche photodiode technology (G-APD or SiPM), that will allow the detection of high-speed single photons with high gain and linearity. In order to overcome the limit of small sensitive surfaces we suggest an innovative design for a modern hybrid, high gain, silicon based Vacuum Silicon Photomultiplier Tube (VSiPMT) based on the combination of a SiPM with a hemispherical vacuum glass PMT standard envelope. In this work we describe the full SiPM characterization realized by our group and we present the results of our Geant4-based simulations of electron backscattering over the SiPM surface.

  16. Performance comparison of dual-head PEM scanner by Monte Carlo simulation

    Energy Technology Data Exchange (ETDEWEB)

    Wang, Mengdie; Hu, Guangshu; Zhang, Hui, E-mail: hzhang@mail.tsinghua.edu.cn

    2014-02-11

    To evaluate the effects of the flat panel dimension on the overall performance qualitatively and quantitatively, the performance of two dual-head Positron Emission Mammography (PEM) cameras with different configurations, the 3×3 modules system and the 1×3 modules system, has been compared, using Monte Carlo simulation based on the Geant4 Application for Tomographic Emission (GATE) open source software. Besides traditional evaluation methods, imaging capability in terms of spatial resolution and lesion detectability have been integrated into the evaluation. Compared with the 3×3 modules system, the 1×3 modules system produces higher spatial resolution along the direction of the 1-module side but lower resolution along the other direction. No significant difference in small and weak lesion visualization has been noted between two systems. In addition, the slight disadvantage in semi-quantification of the 1×3 modules system can be further compensated by other methods such as increasing the imaging time while still in a practically acceptable range.

  17. Design of a coincidence processing board for a dual-head PET scanner for breast imaging

    Energy Technology Data Exchange (ETDEWEB)

    Martinez, J.D. [Departamento de Ingenieria Electronica, University Politecnica de Valencia, Camino de Vera s/n 46022, Valencia (Spain)]. E-mail: jormarp1@doctor.upv.es; Toledo, J. [Departamento de Ingenieria Electronica, University Politecnica de Valencia, Camino de Vera s/n 46022, Valencia (Spain); Esteve, R. [Departamento de Ingenieria Electronica, University Politecnica de Valencia, Camino de Vera s/n 46022, Valencia (Spain); Sebastia, A. [Departamento de Ingenieria Electronica, University Politecnica de Valencia, Camino de Vera s/n 46022, Valencia (Spain); Mora, F.J. [Departamento de Ingenieria Electronica, University Politecnica de Valencia, Camino de Vera s/n 46022, Valencia (Spain); Benlloch, J.M. [Instituto de Fisica Corpuscular, CSIC-UV, Valencia (Spain); Fernandez, M.M. [Instituto de Fisica Corpuscular, CSIC-UV, Valencia (Spain); Gimenez, M. [Instituto de Fisica Corpuscular, CSIC-UV, Valencia (Spain); Gimenez, E.N. [Instituto de Fisica Corpuscular, CSIC-UV, Valencia (Spain); Lerche, Ch.W. [Instituto de Fisica Corpuscular, CSIC-UV, Valencia (Spain); Pavon, N. [Instituto de Fisica Corpuscular, CSIC-UV, Valencia (Spain); Sanchez, F. [Instituto de Fisica Corpuscular, CSIC-UV, Valencia (Spain)

    2005-07-01

    This paper describes the design of a coincidence processing board for a dual-head Positron Emission Tomography (PET) scanner for breast imaging. The proposed block-oriented data acquisition system relies on a high-speed DSP processor for fully digital trigger and on-line event processing that surpasses the performance of traditional analog coincidence detection systems. A mixed-signal board has been designed and manufactured. The analog section comprises 12 coaxial inputs (six per head) which are digitized by means of two 8-channel 12-bit 40-MHz ADCs in order to acquire the scintillation pulse, the charge division signals and the depth of interaction within the scintillator. At the digital section, a state-of-the-art FPGA is used as deserializer and also implements the DMA interface to the DSP processor by storing each digitized channel into a fast embedded FIFO memory. The system incorporates a high-speed USB 2.0 interface to the host computer.

  18. Accelerating image reconstruction in dual-head PET system by GPU and symmetry properties.

    Directory of Open Access Journals (Sweden)

    Cheng-Ying Chou

    Full Text Available Positron emission tomography (PET is an important imaging modality in both clinical usage and research studies. We have developed a compact high-sensitivity PET system that consisted of two large-area panel PET detector heads, which produce more than 224 million lines of response and thus request dramatic computational demands. In this work, we employed a state-of-the-art graphics processing unit (GPU, NVIDIA Tesla C2070, to yield an efficient reconstruction process. Our approaches ingeniously integrate the distinguished features of the symmetry properties of the imaging system and GPU architectures, including block/warp/thread assignments and effective memory usage, to accelerate the computations for ordered subset expectation maximization (OSEM image reconstruction. The OSEM reconstruction algorithms were implemented employing both CPU-based and GPU-based codes, and their computational performance was quantitatively analyzed and compared. The results showed that the GPU-accelerated scheme can drastically reduce the reconstruction time and thus can largely expand the applicability of the dual-head PET system.

  19. Multi-modality image reconstruction for dual-head small-animal PET

    Energy Technology Data Exchange (ETDEWEB)

    Huang, Chang-Han; Chou, Cheng-Ying [National Taiwan University, Taipei, Taiwan (China)

    2015-05-18

    The hybrid positron emission tomography/computed tomography (PET/CT) or positron emission tomography/magnetic resonance imaging (PET/MRI) has become routine practice in clinics. The applications of multi-modality imaging can also benefit research advances. Consequently, dedicated small-imaging system like dual-head small-animal PET (DHAPET) that possesses the advantages of high detection sensitivity and high resolution can exploit the structural information from CT or MRI. It should be noted that the special detector arrangement in DHAPET leads to severe data truncation, thereby degrading the image quality. We proposed to take advantage of anatomical priors and total variation (TV) minimization methods to reconstruct PET activity distribution form incomplete measurement data. The objective is to solve the penalized least-squares function consisted of data fidelity term, TV norm and medium root priors. In this work, we employed the splitting-based fast iterative shrinkage/thresholding algorithm to split smooth and non-smooth functions in the convex optimization problems. Our simulations studies validated that the images reconstructed by use of the proposed method can outperform those obtained by use of conventional expectation maximization algorithms or that without considering the anatomical prior information. Additionally, the convergence rate is also accelerated.

  20. Alcohol consumption patterns among Mexican American mothers and among children from single- and dual-headed households: findings from HHANES 1982-84.

    Science.gov (United States)

    Stroup-Benham, C A; Treviño, F M; Treviño, D B

    1990-01-01

    Data from the southwestern United States sample of the Hispanic Health and Nutrition Examination Survey were employed to compare the patterns of alcohol use among Mexican American mothers and children in female-headed households with use patterns among mothers and children in couple-headed households. Single female heads of household drank more alcoholic beverages on more days than females from dual-headed households. As a whole, the children of single heads of household still living at home did not demonstrate significantly different drinking patterns from their dual-headed household counterparts. While male children of single-headed households drank more days and total drinks than their dual-headed household counterparts, female children of dual-headed households drank more days and total drinks than female children from single-headed households. PMID:9187580

  1. PMT waveform modeling at the Daya Bay experiment

    Institute of Scientific and Technical Information of China (English)

    S(o)ren JETTER; Dan DWYER; JIANG Wen-Qi; LIU Da-Wei; WANG Yi-Fang; WANG Zhi-Min; WEN Liang-Jian

    2012-01-01

    Detailed measurements of Hamamatsu R5912 photomultiplier signals are presented,including the single photoelectron charge response,waveform shape,nonlinearity,saturation,overshoot,oscillation,prepulsing,and afterpulsing.The results were used to build a detailed model of the PMT signal characteristics over a wide range of light intensities.Including the PMT model in simulated Daya Bay particle interactions shows no significant systematic effects that are detrimental to the experimental sensitivity.

  2. An application specific integrated circuit for multi-anode PMT

    Energy Technology Data Exchange (ETDEWEB)

    Gaglione, Renaud [Laboratoire de Physique Corpusculaire, 24 avenue des Landais, 63177 Aubiere (France)]. E-mail: gaglione@clermont.in2p3.fr; Bohner, Gerard [Laboratoire de Physique Corpusculaire, 24 avenue des Landais, 63177 Aubiere (France); Lecoq, Jacques [Laboratoire de Physique Corpusculaire, 24 avenue des Landais, 63177 Aubiere (France); Montarou, Gerard [Laboratoire de Physique Corpusculaire, 24 avenue des Landais, 63177 Aubiere (France); Royer, Laurent [Laboratoire de Physique Corpusculaire, 24 avenue des Landais, 63177 Aubiere (France)

    2006-11-01

    The main purpose of this development is to design an 'intelligent sensor', composed of one multi-anode PMT (Hamamatsu H8500), four custom front-end analog chips with embedded analog-to-digital converter and a pre-processing logical unit. The idea of this design is to improve as far as possible the treatment speed of signals of the PMT. This design must be compact to fit the PMT dimensions, in order to combine them together to form an assembly which will be used in medical imaging research, especially for gamma-ray camera at 141keV (Tc99m) with NaI(Tl) crystal.

  3. PMT signal increase using a wavelength shifting paint

    CERN Document Server

    Allada, K; Ou, L; Schmookler, B; Shahinyan, A; Wojtsekhowski, B

    2015-01-01

    We report a 1.65 times increase of the PMT signal and a simple procedure of application of a new wavelength shifting (WLS) paint for PMTs with non-UV-transparent windows. Samples of four different WLS paints, made from hydrocarbon polymers and organic fluors, were tested on a 5-inch PMT (ET 9390KB) using Cherenkov radiation produced in fused silica disks by $^{106}$Ru electrons on a `table-top' setup. The best performing paint was employed on two different types of 5-inch PMTs (ET 9390KB and XP4572B), installed in atmospheric pressure CO$_2$ gas Cherenkov detectors, and tested using GeV electrons.

  4. An Ultra-Low Background PMT for Liquid Xenon Detectors

    CERN Document Server

    Akerib, D S; Bernard, E; Bernstein, A; Bradley, A; Byram, D; Cahn, S B; Carmona-Benitez, M C; Carr, D; Chapman, J J; Chan, Y-D; Clark, K; Coffey, T; deViveiros, L; Dragowsky, M; Druszkiewicz, E; Edwards, B; Faham, C H; Fiorucci, S; Gaitskell, R J; Gibson, K R; Hall, C; Hanhardt, M; Holbrook, B; Ihm, M; Jacobsen, R G; Kastens, L; Kazkaz, K; Larsen, N; Lee, C; Lesko, K; Lindote, A; Lopes, M I; Lyashenko, A; Malling, D C; Mannino, R; McKinsey, D; Mei, D; Mock, J; Morii, M; Nelson, H; Neves, F; Nikkel, J A; Pangilinan, M; Pech, K; Phelps, P; Shutt, T; Silva, C; Skulski, W; Solovov, V N; Sorensen, P; Spaans, J; Stiegler, T; Sweany, M; Szydagis, M; Taylor, D; Thomson, J; Tripathi, M; Uvarov, S; Verbus, J R; Walsh, N; Webb, R; White, J T; Wlasenko, M; Wolfs, F L H; Woods, M; Zhang, C

    2012-01-01

    Results are presented from radioactivity screening of two models of photomultiplier tubes designed for use in current and future liquid xenon experiments. The Hamamatsu 5.6 cm diameter R8778 PMT, used in the LUX dark matter experiment, has yielded a positive detection of four common radioactive isotopes: 238U, 232Th, 40K, and 60Co. Screening of LUX materials has rendered backgrounds from other detector materials subdominant to the R8778 contribution. A prototype Hamamatsu 7.6 cm diameter R11410 MOD PMT has also been screened, with benchmark isotope counts measured at <0.4 238 U / <0.3 232 Th / <8.3 40 K / 2.0+-0.2 60 Co mBq/PMT. This represents a large reduction, equal to a change of \\times 1/24 238U / \\times 1/9 232Th / \\times 1/8 40K per PMT, between R8778 and R11410 MOD, concurrent with a doubling of the photocathode surface area (4.5 cm to 6.4 cm diameter). 60Co measurements are comparable between the PMTs, but can be significantly reduced in future R11410 MOD units through further material selec...

  5. Electromagnetic Compatibility (EMC) and Noise Background Testing for Double Chooz PMT System

    Energy Technology Data Exchange (ETDEWEB)

    Cepero, J. R.; Encabo Fernandez, F. J.; Pepe, I.; Verdugo, A.

    2009-05-21

    The Double Chooz PMT system is a HV/signal splitter. In this report is presented an electromagnetic compatibility and background noise testing for the Double Chooz PMT system. It was possible to proceed the EMC testing on different grounding configurations of PMT splitter due to its special PCB design, endowed of jumping points and a metal box ground electrode. (Author)

  6. Development of an ultrahigh-resolution Si-PM-based dual-head GAGG coincidence imaging system

    Energy Technology Data Exchange (ETDEWEB)

    Yamamoto, Seiichi, E-mail: s-yama@met.nagoya-u.ac.jp [Department of Radiological and Medical Laboratory Sciences, Nagoya University Graduate School of Medicine (Japan); Watabe, Hiroshi; Kanai, Yasukazu [Department of Molecular Imaging in Medicine, Osaka University Graduate School of Medicine, Osaka (Japan); Kato, Katsuhiko [Department of Radiological and Medical Laboratory Sciences, Nagoya University Graduate School of Medicine (Japan); Hatazawa, Jun [Department of Molecular Imaging in Medicine, Osaka University Graduate School of Medicine, Osaka (Japan); Department of Nuclear Medicine and Tracer Kinetics, Osaka University Graduate School of Medicine, Osaka (Japan)

    2013-03-01

    A silicon photomultiplier (Si-PM) is a promising photodetector for high resolution PET systems due to its small channel size and high gain. Using Si-PMs, it will be possible to develop a high resolution imaging systems. For this purpose, we developed a small field-of-view (FOV) ultrahigh-resolution Si-PM-based dual-head coincidence imaging system for small animals and plant research. A new scintillator, Ce doped Gd{sub 3}Al{sub 12}Ga{sub 3}O{sub 12} (GAGG), was selected because of its high light output and its emission wavelength matched with the Si-PM arrays and contained no radioactivity. Each coincidence imaging block detector consists of 0.5×0.5×5 mm{sup 3} GAGG pixels combined with a 0.1-mm thick reflector to form a 20×17 matrix that was optically coupled to a Si-PM array (Hamamatsu MPPC S11064-050P) with a 1.5-mm thick light guide. The GAGG block size was 12.0×10.2 mm{sup 2}. Two GAGG block detectors were positioned face to face and set on a flexible arm based detector stand. All 0.5 mm GAGG pixels in the block detectors were clearly resolved in the 2-dimensional position histogram. The energy resolution was 14.4% FWHM for the Cs-137 gamma ray. The spatial resolution was 0.7 mm FWHM measured using a 0.25 mm diameter Na-22 point source. Small animal and plant images were successfully obtained. We conclude that our developed ultrahigh-resolution Si-PM-based dual-head coincidence imaging system is promising for small animal and plant imaging research.

  7. Development of an ultrahigh-resolution Si-PM-based dual-head GAGG coincidence imaging system

    Science.gov (United States)

    Yamamoto, Seiichi; Watabe, Hiroshi; Kanai, Yasukazu; Kato, Katsuhiko; Hatazawa, Jun

    2013-03-01

    A silicon photomultiplier (Si-PM) is a promising photodetector for high resolution PET systems due to its small channel size and high gain. Using Si-PMs, it will be possible to develop a high resolution imaging systems. For this purpose, we developed a small field-of-view (FOV) ultrahigh-resolution Si-PM-based dual-head coincidence imaging system for small animals and plant research. A new scintillator, Ce doped Gd3Al12Ga3O12 (GAGG), was selected because of its high light output and its emission wavelength matched with the Si-PM arrays and contained no radioactivity. Each coincidence imaging block detector consists of 0.5×0.5×5 mm3 GAGG pixels combined with a 0.1-mm thick reflector to form a 20×17 matrix that was optically coupled to a Si-PM array (Hamamatsu MPPC S11064-050P) with a 1.5-mm thick light guide. The GAGG block size was 12.0×10.2 mm2. Two GAGG block detectors were positioned face to face and set on a flexible arm based detector stand. All 0.5 mm GAGG pixels in the block detectors were clearly resolved in the 2-dimensional position histogram. The energy resolution was 14.4% FWHM for the Cs-137 gamma ray. The spatial resolution was 0.7 mm FWHM measured using a 0.25 mm diameter Na-22 point source. Small animal and plant images were successfully obtained. We conclude that our developed ultrahigh-resolution Si-PM-based dual-head coincidence imaging system is promising for small animal and plant imaging research.

  8. The study of the aging behavior on large area MCP-PMT

    CERN Document Server

    Wang, Wen-Wen; Qi, Ming; Xia, Jing-Kai; Cheng, Ya-Ping; Ning, Zhe; Luo, Feng-Jiao; Heng, Yue-Kun; Liu, Shu-Lin; Si, Shu-Guang; Sun, Jian-Ning; Li, Dong; Wang, Xing-Chao; Huang, Guo-Rui; Tian, Jing-Shou; Wei, Yong-Lin; Liu, Hu-Lin; Li, Wei-Hua; Wang, Xing; Xin, Li-Wei

    2015-01-01

    Aging experiments of a novel type of large area MCP-PMT made by JUNO collaboration were conducted.In these aging experiments, the multi-photoelectron spectrum and single photoelectron spectrum were measured daily,as well as the MCP resistance of the second PMT before and after the experiment. Two PMTs were aged successivelyfor cross check. The first PMT was aged for 52 days, while the other one was aged for 84 days. In order to study the mechanism of the aging process, the high voltage on the second PMT was increased to accelerate its aging process when the cumulative output of charge from its anode was about 4 C. From our study, it can be known that large area MCP-PMT aging had a strong relationship with the related MCPs. In accordance with the PMT aging curve,a PMT aging model was setup and a general aging formula was given.

  9. Use of dual-head gamma camera in radionuclide internal contamination monitoring on radiation workers from a nuclear medicine department

    Energy Technology Data Exchange (ETDEWEB)

    Rodriguez-Laguna, A.; Brandan, M.E., E-mail: alejandro.rodriguez.laguna@gmail.com [Universidad Nacional Autonoma de Mexico, Mexico D.F. (Mexico). Instituto de Fisica; Trujillo-Zamudio, F.E.; Estrada-Lobato, E. [Instituto Nacional de Cancerologia, Mexico D.F. (Mexico)

    2008-07-01

    As a part of an internal dosimetry program that is performed at the Mexican National Institute of Cancerology - Nuclear Medicine Department, in the present work we suggest a procedure for the routinely monitoring of internal contamination on radiation workers and nuclear medicine staff. The procedure is based on the identification and quantification of contaminating radionuclides in human body by using a dual-head whole-body gamma camera. The results have shown that the procedures described in this study can be used to implement a method to quantify minimal accumulated activity in the main human organs to evaluate internal contamination with radionuclides. The high sensitivity of the uncollimated gamma camera is advantageous for the routinely detection and identification of small activities of internal contamination. But, the null spatial resolution makes impossible the definition of contaminated region of interest. Then, the use of collimators is necessary to the quantification of incorporated radionuclides activities in the main human organs and for the internal doses assessment. (author)

  10. The high-speed after pulse measurement system for PMT

    CERN Document Server

    Cheng, Yaping; Ning, Zhe; Xia, Jingkai; Wang, Wenwen; Wang, Yifang; Cao, Jun; Jiang, Xiaoshan; Wang, Zheng; Li, Xiaonan; Qi, Ming; Heng, Yuekun; Liu, Shulin; Lei, Xiangcui; Wu, Zhi

    2014-01-01

    A system employing a desktop FADC has been developed to investigate the features of 8 inches Hamamatsu PMT. The system stands out for its high-speed and informative results as a consequence of adopting fast waveform sampling technology. Recording full waveforms allows us to perform digital signal processing, pulse shape analysis, and precision timing extraction. High precision after pulse time and charge distribution characteristics are presented in this manuscript. Other photomultipliers characteristics, such as dark rate and transit time spread, can also be obtained by exploiting waveform analysis using this system.

  11. Equalisation of the PMT response to charge particles for the LUCID detector of the ATLAS experiment

    CERN Document Server

    Vittori, Camilla

    2014-01-01

    With a view to the Run II of LHC, 44 Hamamatsu R760 PMTs have been calibrated with a 207Bi source. The working point of each PMT has been xed in order to equalise the PMT gain at a value smaller than $10^{5}$. Studies on the reproducibility and the stability in time of such calibration permitted to reach a 5% accuracy on PMT gain. In addition, an evaluation of the relative gain of 10 modied PMTs has been performed.

  12. Studies oriented to optimize the image quality of the small animal PET: Clear PET, modifying some of the parameters of the reconstruction algorithm IMF-OSEM 3D on the data acquisition simulated with GAMOS; Estudios para la optimizaciOn de la calidad de imagen en el escaner ClearPET, modifi cando parametros del algoritmo IMF-OSEM 3D sobre adquisiciones simuladas con GAMOS

    Energy Technology Data Exchange (ETDEWEB)

    Canadas, M.; Mendoza, J.; Embid, M.

    2007-09-27

    This report presents studies oriented to optimize the image quality of the small animal PET: Clear- PET. Certain figures of merit (FOM) were used to assess a quantitative value of the contrast and delectability of lesions. The optimization was carried out modifying some of the parameters in the reconstruction software of the scanner, imaging a mini-Derenzo phantom and a cylinder phantom with background activity and two hot spheres. Specifically, it was evaluated the incidence of the inter-update Metz filter (IMF) inside the iterative reconstruction algorithm 3D OSEM. The data acquisition was simulated using the GAMOS framework (Monte Carlo simulation). Integrating GAMOS output with the reconstruction software of the scanner was an additional novelty of this work, to achieve this, data sets were written with the list-mode format (LMF) of ClearPET. In order to verify the optimum values obtained, we foresee to make real acquisitions in the ClearPET of CIEMAT. (Author) 17 refs.

  13. A time-over-threshold technique for PMT signals processing

    Institute of Scientific and Technical Information of China (English)

    LIU Xuzong; LIU Shubin; AN Qi

    2007-01-01

    A novel front-end circuit designed for PMT signals processing considering the solution of "Time Walk"correction is discussed in this paper. We are trying to apply the TOT (Time over Threshold) technique to our research.Different from traditional ways, where amplitude is measured, time width is measured for slew correction here, which takes the advantage of TDC. Expensive fast ADCs are abandoned and the whole time measurement electronics design becomes more effective and economical. Test boards have been developed and a convenient method is introduced to evaluate our TOT technique. Results have shown that a 10ps slew correction resolution is achieved throughout the amplitude range from -108mV to -2000mV for negative signals of both 5 ns leading and trailing edge with 10 ns 50%-50% pulse width.

  14. Auranofin Inhibits the Enzyme Activity of Pasteurella multocida Toxin PMT in Human Cells and Protects Cells from Intoxication

    Science.gov (United States)

    Carle, Stefan; Brink, Thorsten; Orth, Joachim H. C.; Aktories, Klaus; Barth, Holger

    2017-01-01

    The AB-type protein toxin from Pasteurella multocida (PMT) contains a functionally important disulfide bond within its catalytic domain, which must be cleaved in the host cell cytosol to render the catalytic domain of PMT into its active conformation. Here, we found that the reductive potential of the cytosol of target cells, and more specifically, the activity of the thioredoxin reductase (TrxR) is crucial for this process. This was demonstrated by the strong inhibitory effect of the pharmacological TrxR inhibitor auranofin, which inhibited the intoxication of target cells with PMT, as determined by analyzing the PMT-catalyzed deamidation of GTP-binding proteins (G-proteins) in the cytosol of cells. The amount of endogenous substrate levels modified by PMT in cells pretreated with auranofin was reduced compared to cells treated with PMT alone. Auranofin had no inhibitory effect on the activity of the catalytic domain of constitutively active PMT in vitro, demonstrating that auranofin did not directly inhibit PMT activity, but interferes with the mode of action of PMT in cells. In conclusion, the results show that TrxR is crucial for the mode of action of PMT in mammalian cells, and that the drug auranofin can serve as an efficient inhibitor, which might be a starting point for novel therapeutic options against toxin-associated diseases. PMID:28098782

  15. Investigation about decoupling capacitors of PMT voltage divider effects on neutron-gamma discrimination

    Energy Technology Data Exchange (ETDEWEB)

    Divani, Nazila, E-mail: n-divani@birjand.ac.ir; Firoozabadi, Mohammad M. [Dep. Of Physics, Faculty of Science, University of Birjand, Birjand (Iran, Islamic Republic of); Bayat, Esmail [Nuclear Science and Technology Research Institute, Atomic Energy Organization of Iran (Iran, Islamic Republic of)

    2014-11-24

    Scintillators are almost used in any nuclear laboratory. These detectors combine of scintillation materials, PMT and a voltage divider. Voltage dividers are different in resistive ladder design. But the effect of decoupling capacitors and damping resistors haven’t discussed yet. In this paper at first a good equilibrium circuit designed for PMT, and it was used for investigating about capacitors and resistors in much manner. Results show that decoupling capacitors have great effect on PMT output pulses. In this research, it was tried to investigate the effect of Capacitor’s value and places on PMT voltage divider in Neutron-Gamma discrimination capability. Therefore, the voltage divider circuit for R329-02 Hamamatsu PMT was made and Zero Cross method used for neutron-gamma discrimination. The neutron source was a 20Ci Am-Be. Anode and Dynode pulses and discrimination spectrum were saved. The results showed that the pulse height and discrimination quality change with the value and setting of capacitors.

  16. A 30 ps Timing Resolution for Single Photons with Multi-pixel Burle MCP-PMT

    Energy Technology Data Exchange (ETDEWEB)

    Va' vra, J.; Benitez, J.; Coleman, J.; Leith, D.W.G.S.; Mazaheri, G.; Ratcliff, B.; Schwiening, J.; /SLAC

    2006-07-05

    We have achieved {approx}30 psec single-photoelectron and {approx}12ps for multi-photoelectron timing resolution with a new 64 pixel Burle MCP-PMT with 10 micron microchannel holes. We have also demonstrated that this detector works in a magnetic field of 15kG, and achieved a single-photoelectron timing resolution of better than 60 psec. The study is relevant for a new focusing DIRC RICH detector for particle identification at future Colliders such as the super B-factory or ILC, and for future TOF techniques. This study shows that a highly pixilated MCP-PMT can deliver excellent timing resolution.

  17. The multi-PMT optical module for KM3NeT

    NARCIS (Netherlands)

    Lohner, H.; Dorosti-Hasankiadeh, Q.; Heine, E.; Gajanana, D.; Kavatsyuk, O.; Kooijman, P.; Kopper, C.; Peek, H.; Steijger, J.; Timmer, P.; de Wolf, E.

    2013-01-01

    In the future neutrino telescope KM3NeT a novel type of optical module (OM) will be employed to optimize the sensitivity to Cherenkov photons and maximize the environmental background suppression. The multiPMT OM, a pressure-resistant glass sphere containing 31 photomultiplier tubes (PMTs) of 3-in.

  18. The multi-PMT optical module for KM3NeT

    NARCIS (Netherlands)

    Löhner, H.; Dorosti-Hasankiadeh, Q.; Heine, E.; Gajanana, D.; Kavatsyuk, O.; Kooijman, P.; Kopper, C.; Peek, H.; Steijger, J.; Timmer, P.; de Wolf, E.

    2013-01-01

    In the future neutrino telescope KM3NeT a novel type of optical module (OM) will be employed to optimize the sensitivity to Cherenkov photons and maximize the environmental background suppression. The multi-PMT OM, a pressure-resistant glass sphere containing 31 photomultiplier tubes (PMTs) of 3-in.

  19. HexPak and GradPak: variable-pitch dual-head IFUs for the WIYN 3.5m Telescope Bench Spectrograph

    CERN Document Server

    Wood, Corey M; Eigenbrot, Arthur D; Buckley, Scott A; Gallagher, John S; Hooper, Eric J; Sheinis, Andrew I; Smith, Michael P; Wolf, Marsha J

    2012-01-01

    We describe the design, construction, and expected performance of two new fiber integral field units (IFUs) --- HexPak and GradPak --- for the WIYN 3.5m Telescope Nasmyth focus and Bench Spectrograph. These are the first IFUs to provide formatted fiber integral field spectroscopy with simultaneous sampling of varying angular scales. HexPak and GradPak are in a single cable with a dual-head design, permitting easy switching between the two different IFU heads on the telescope without changing the spectrograph feed: the two heads feed a variable-width double-slit. Each IFU head is comprised of a fixed arrangement of fibers with a range of fiber diameters. The layout and diameters of the fibers within each array are scientifically-driven for observations of galaxies: HexPak is designed to observe face-on spiral or spheroidal galaxies while GradPak is optimized for edge-on studies of galaxy disks. HexPak is a hexagonal array of 2.9 arcsec fibers subtending a 40.9 arcsec diameter, with a high-resolution circular c...

  20. A position-sensitive detector with lithium glass and MaPMT

    Institute of Scientific and Technical Information of China (English)

    FU Zai-Wei; LIU Shu-Dong; LEI Xiang-Cui; HUANG Guo-Rui; JIA Ru; HENG Yue-Kun; QI Ming; HUANG Chang-Hao; LIU Shu-Lin; QIAN Sen; LI Shao-Li; CHEN Xiao-Hui

    2012-01-01

    A position-sensitive detector is designed for neutron detection.It uses a single continuous screen of a self-made lithium glass scintillator,rather than discrete crystal implementations,coupling with a multianode PMT (MaPMT).The scintillator is fast and efficient; with a decay time of 34 ns and thermal neutron detection efficiency of around 95.8% for the 3 mm thick screen,and its light yield is around 5670 photons per neutron and 3768 photons per MeV γrays deposition.The spatial resolution is around 1.6 mm (FWHM) with the energy resolution around 34.7% by using α (5.2 MeV) rays test.

  1. SCOTT: A time and amplitude digitizer ASIC for PMT signal processing

    Energy Technology Data Exchange (ETDEWEB)

    Ferry, S., E-mail: sophie.ferry@cea.fr [CEA/ Irfu/ SPP, Gif-sur-Yvette (France); Guilloux, F.; Anvar, S.; Chateau, F.; Delagnes, E.; Gautard, V.; Louis, F.; Monmarthe, E.; Le Provost, H. [CEA/ Irfu/ SEDI, Gif-sur-Yvette (France); Russo, S. [Dipartimento di Scienze Fisiche Università di Napoli, Napoli (Italy); Schuller, J-P.; Stolarczyk, Th.; Vallage, B. [CEA/ Irfu/ SPP, Gif-sur-Yvette (France); Zonca, E. [CEA/ Irfu/ SEDI, Gif-sur-Yvette (France)

    2013-10-11

    SCOTT is an ASIC designed for the readout electronics of photomultiplier tubes developed for KM3NeT, the cubic-kilometer scale neutrino telescope in Mediterranean Sea. To digitize the PMT signals, the multi-time-over-threshold technique is used with up to 16 adjustable thresholds. Digital outputs of discriminators feed a circular sampling memory and a “first in first out” digital memory. A specific study has shown that five specifically chosen thresholds are suited to reach the required timing accuracy. A dedicated method based on the duration of the signal over a given threshold allows an equivalent timing precision at any charge. To verify that the KM3NeT requirements are fulfilled, this method is applied on PMT signals digitized by SCOTT.

  2. The Vacuum Silicon Photomultiplier Tube (VSiPMT): A new version of a hybrid photon detector

    Energy Technology Data Exchange (ETDEWEB)

    Russo, Stefano, E-mail: srusso@na.infn.i [Universita di Napoli ' Federico II' , Dipartimento di Scienze fisiche, via Cintia 80126 Napoli (Italy); Barbarino, Giancarlo [Universita di Napoli ' Federico II' , Dipartimento di Scienze fisiche, via Cintia 80126 Napoli (Italy); Asmundis, Riccardo de; De Rosa, Gianfranca [Istituto Nazionale di fisica Nucleare, sezione di Napoli, Complesso di Monte S. Angelo Ed. 6, via Cintia 80126 Napoli (Italy)

    2010-11-01

    The future astroparticle experiments will study both energetic phenomena and extremely rare events from astrophysical sources. Since most of these families of experiments are carried out by using scintillation phenomena, Cherenkov or fluorescence radiation, the development of photosensitive detectors seems to be the right way to increase the experimental sensitivity. Therefore we propose an innovative design for a modern, high gain, silicon-based Vacuum Silicon Photomultiplier Tube (VSiPMT), which combines three fully established and well-understood technologies: the manufacture of hemispherical vacuum tubes with the possibility of very large active areas, the photocathode glass deposition and the novel Geiger-mode avalanche silicon photodiode (G-APD) for which a mass production is today available. This new design, based on G-APD as the electron multiplier, allows overcoming the limits of a classical PMT dynode chain.

  3. Correlates of Protective Motivation Theory (PMT) to adolescents' drug use intention.

    Science.gov (United States)

    Wu, Cynthia Sau Ting; Wong, Ho Ting; Chou, Lai Yan; To, Bobby Pak Wai; Lee, Wai Lok; Loke, Alice Yuen

    2014-01-03

    Early onset and increasing proliferation of illicit adolescent drug-use poses a global health concern. This study aimed to examine the correlation between Protective Motivation Theory (PMT) measures and the intention to use drugs among adolescents. An exploratory quantitative correlation design and convenience sampling were adopted. A total of 318 students completed a self-reported questionnaire that solicited information related to their demographics and activities, measures of threat appraisal and coping appraisal, and the intention to use drugs. Logistic regression analysis showed that intrinsic and extrinsic rewards were significant predictors of intention. The odds ratios were equal to 2.90 (p < 0.05) and 8.04 (p < 0.001), respectively. The logistic regression model analysis resulted in a high Nagelkerke R2 of 0.49, which suggests that PMT related measures could be used in predicting drug use intention among adolescents. Further research should be conducted with non-school adolescents to confirm the application.

  4. Characterisation and testing of a prototype $6 \\times 6$ cm$^2$ Argonne MCP-PMT

    CERN Document Server

    Cowan, Greig A; Needham, Matthew; Gambetta, Silvia; Eisenhardt, Stephan; McBlane, Neil; Malek, Matthew

    2016-01-01

    The Argonne micro-channel plate photomultiplier tube (MCP-PMT) is an offshoot of the Large Area Pico-second Photo Detector (LAPPD) project, wherein \\mbox{6 $\\times$ 6 cm$^2$} sized detectors are made at Argonne National Laboratory. Measurements of the properties of these detectors, including gain, time and spatial resolution, dark count rates, cross-talk and sensitivity to magnetic fields are reported. In addition, possible applications of these devices in future neutrino and collider physics experiments are discussed.

  5. PMT response drift of ATLAS Tile Laser II calibration system: an introduction of a new method

    CERN Document Server

    Di Gregorio, Giulia

    2016-01-01

    In this article I describe the performance of the monitoring diodes of the Laser II system, a new system for run II used to calibrate the gain variation of PMTs in between two cesium scan. I also show a new method to measure the PMT drift response that it is compared to the method used up to now (Clermont-Ferrant) corrected with the Pisa method. The agreement between the two method is within 0.2%.

  6. Recent development on the realization of a 1-inch VSiPMT prototype

    Science.gov (United States)

    Barbato, F. C. T.; Barbarino, G.; Campajola, L.; Di Capua, F.; Mollo, C. M.; Valentini, A.; Vivolo, D.

    2017-03-01

    The VSiPMT (Vacuum Silicon PhotoMultiplier Tube) is an innovative design for a revolutionary hybrid photodetector. The idea, born with the purpose to use a SiPM for large detection volumes, consists in replacing the classical dynode chain with a SiPM. In this configuration, we match the large sensitive area of a photocathode with the performances of the SiPM technology, which therefore acts like an electron detector and so like a current amplifier. The excellent photon counting capability, fast response, low power consumption and great stability are among the most attractive features of the VSiPMT. In order to realize such a device we first studied the feasibility of this detector both from theoretical and experimental point of view, by implementing a Geant4-based simulation and studying the response of a special non-windowed MPPC by Hamamatsu with an electron beam. Thanks to this result Hamamatsu realized two VSiPMT industrial prototypes with a photocathode of 3mm diameter. We present the progress on the realization of a 1-inch prototype and the preliminary tests we are performing on it.

  7. An Analogue Front-End ASIC Prototype Designed For PMT Signal Readout

    CERN Document Server

    Liu, Jianfeng; Yu, Li; Liang, Yu; Qin, Jiajun; Yang, Yunfang; Wu, Weihao; Liu, Shubin; An, Qi

    2015-01-01

    The Large High Altitude Air Shower Observatory (LHAASO) is designed for high energy gamma ray and cosmic ray detection. A Water Cherenkov Detector Array which is sensitive to gamma ray showers above a few hundred GeV is proposed to survey gamma ray sources. The WCDA consists of 3600 PhotoMultiplier Tubes (PMT) which collect the Cherenkov light produced by the shower particles in water. Both high precision time and charge measurement are required over a large dynamic range from 1 photo electron (P.E.) to 4000 P.E. Prototype of an analogue front-end Application Specific Integrated Circuit (ASIC) fabricated in Chartered 0.35 {\\mu}m CMOS technology is designed to read out PMT signal in the WCDA. This ASIC employs leading edge discrimination and RC4 shaping structure; combined with the following Time-to-Digital Converter (TDC) and Analog-to-Digital Converter (ADC), both the arrival time and charge of the PMT signal can be measured. Initial test results indicate that time resolution is better than 350 ps and charge...

  8. Cryogenic phonon-scintillation detectors with PMT readout for rare event search experiments

    Science.gov (United States)

    Zhang, X.; Lin, J.; Mikhailik, V. B.; Kraus, H.

    2016-06-01

    Cryogenic phonon-scintillation detectors (CPSD) for rare event search experiments require reliable, efficient and robust photon detectors that can resolve individual photons in a scintillation event. We report on a cryogenic detector containing a scintillating crystal, equipped with an NTD-Ge phonon sensor and a photon detector based on a low-temperature photomultiplier tube (PMT) that is powered by a Cockcroft-Walton generator. Here we present results from the characterisation of two detector modules, one with CaWO4, the other with CaMoO4 as scintillator. The energy resolutions (FWHM) at 122.1 keV for the scintillation/PMT channel are 19.9% and 29.7% respectively for CaWO4 and CaMoO4 while the energy resolutions (FWHM) for the phonon channels are 2.17 keV (1.8%) and 0.97 keV (0.79%). These characteristics compare favourably with other CPSDs currently used in cryogenic rare-event search experiments. The detection module with PMT readout benefits from the implementation of a well-understood, reliable, and commercially available component and improved time resolution, while retaining the major advantages of conventional CPSD, such as high sensitivity, resolving power and discrimination ability.

  9. Simple approach to predict APD/PMT lidar detector performance under sky background using dimensionless parametrization

    Science.gov (United States)

    Agishev, Ravil; Gross, Barry; Moshary, Fred; Gilerson, Alexander; Ahmed, Samir

    2006-08-01

    In this paper, we developed a simple approach to predict the APD/PMT (avalanche photodiode/photomultiplier) lidar detector performance in the presence of residual skylight background. By normalizing all relevant photodetector noise sources to the quantum noise, we obtain quantitative expressions for the degradation of the signal-to-noise ratio (SNR), the increasing threshold sensitivity of and decreasing lidar operation range. To apply the formalism to any lidar photodetectors operating in the ultra violet, visible and near-infrared spectral regions and to perform a comparative analysis of PMT and APD capabilities as the best photodetectors for ultra-violet (UV), visible (Vis) and near infra-red (NIR) lidar, we utilize a set of spectral characteristics that are built from an envelope of individual PMT and APD component responses. On this basis, the general analysis of system performance under intense background conditions is developed, and practical recommendations on detector use for each spectral region are given. The dimensionless formalism and the generalized detector spectral models used allows our analysis to be applied to nearly any lidar receiver operating over very different signal/background situations.

  10. Possible application of scintillation detectors with semiconductor PMT for cosmic-neutron and gamma-ray detection

    Science.gov (United States)

    Mokrousov, M. I.; Vostrukhin, A. A.; Karpushkina, N. E.; Malakhov, A. V.

    2016-09-01

    Solar system planets exploration and cosmic neutrons and gamma-ray flux research have been dynamically evolving for several decades. Different scintillation crystals are used for this purpose along with photo signal receivers, such as vacuum photomultiplier tubes (PMT). Many studies are being performed in order to provide alternative devices for photon signal capture: PIN-diodes,avalanche photodiodes, semiconductor silicon photomultipliers. We study the applicability of a silicon PMT in employing highresolution crystals in space applications.

  11. Possible application of scintillation detectors with semiconductor PMT for cosmic-neutron and gamma-ray detection

    Energy Technology Data Exchange (ETDEWEB)

    Mokrousov, M. I., E-mail: mokromax@iki.rssi.ru; Vostrukhin, A. A.; Karpushkina, N. E.; Malakhov, A. V. [Russian Academy of Sciences, Space Research Institute (IKI) (Russian Federation)

    2016-09-15

    Solar system planets exploration and cosmic neutrons and gamma-ray flux research have been dynamically evolving for several decades. Different scintillation crystals are used for this purpose along with photo signal receivers, such as vacuum photomultiplier tubes (PMT). Many studies are being performed in order to provide alternative devices for photon signal capture: PIN-diodes,avalanche photodiodes, semiconductor silicon photomultipliers. We study the applicability of a silicon PMT in employing highresolution crystals in space applications.

  12. Hansenula polymorpha Pmt4p Plays Critical Roles in O-Mannosylation of Surface Membrane Proteins and Participates in Heteromeric Complex Formation.

    Directory of Open Access Journals (Sweden)

    Hyunah Kim

    Full Text Available O-mannosylation, the addition of mannose to serine and threonine residues of secretory proteins, is a highly conserved post-translational modification found in organisms ranging from bacteria to humans. Here, we report the functional and molecular characterization of the HpPMT4 gene encoding a protein O-mannosyltransferase in the thermotolerant methylotrophic yeast Hansenula polymorpha, an emerging host for the production of therapeutic recombinant proteins. Compared to the deletion of HpPMT1, deletion of another major PMT gene, HpPMT4, resulted in more increased sensitivity to the antibiotic hygromycin B, caffeine, and osmotic stresses, but did not affect the thermotolerance of H. polymorpha. Notably, the deletion of HpPMT4 generated severe defects in glycosylation of the surface sensor proteins HpWsc1p and HpMid2p, with marginal effects on secreted glycoproteins such as chitinase and HpYps1p lacking a GPI anchor. However, despite the severely impaired mannosylation of surface sensor proteins in the Hppmt4∆ mutant, the phosphorylation of HpMpk1p and HpHog1p still showed a high increase upon treatment with cell wall disturbing agents or high concentrations of salts. The conditional Hppmt1pmt4∆ double mutant strains displayed severely impaired growth, enlarged cell size, and aberrant cell separation, implying that the loss of HpPMT4 function might be lethal to cells in the absence of HpPmt1p. Moreover, the HpPmt4 protein was found to form not only a homomeric complex but also a heteromeric complex with either HpPmt1p or HpPmt2p. Altogether, our results support the function of HpPmt4p as a key player in O-mannosylation of cell surface proteins and its participation in the formation of heterodimers with other PMT members, besides homodimer formation, in H. polymorpha.

  13. Role of 99mTc-octreotide acetate scintigraphy in suspected lung cancer compared with 18F-FDG dual-head coincidence imaging.

    Science.gov (United States)

    Wang, Feng; Wang, Zizheng; Yao, Weixuan; Xie, Hong; Xu, Jie; Tian, Li

    2007-09-01

    The aim of this study was to evaluate the clinical value of tomographic (99m)Tc-octreotide acetate (hereafter, (99m)Tc-octreotide) scintigraphy in the detection of patients with suspected lung cancer in comparison with that of (18)F-FDG dual-head coincidence imaging (DHC). Forty-four consecutive patients with suspected pulmonary neoplasms underwent tomographic (99m)Tc-octreotide scintigraphy and (18)F-FDG coincidence imaging using the same gantry. The region of interest was drawn on the entire primary lesion. The tumor-to-normal tissue tracer values for both (99m)Tc-octreotide and (18)F-FDG were determined using region of interests and expressed as T/N(r) and T/N(m), respectively. Final diagnosis was confirmed by histopathologic analysis or clinical follow-up. Thirty-one of the 44 patients had lung cancer-6 with small cell lung cancer (SCLC) and 25 with non-small cell lung cancer (NSCLC). Thirteen of the 44 patients had benign lung lesions. The sensitivity, specificity, positive predictive value, and negative predictive value of (99m)Tc-octreotide were 100%, 75.7%, 90.1%, and 100%, respectively, and of (18)F-FDG DHC were 100%, 46.1%, 83.8%, and 100%, respectively. In the 31 patients with malignant tumors, all 38 abnormal lymph nodes in 20 patients showed abnormal high focal uptake of (18)F-FDG; only 7 patients with 10 regional lymph adenopathies showed moderate uptake of (99m)Tc-octreotide. Thirteen patients with 39 distant sites of abnormal uptake visualized (imaging stage IV) with (99m)Tc-octreotide included 2 patients with brain metastases, 6 patients with pleural invasion and multiple bone metastasis, 2 patients with contralateral internal lung metastasis and pleural invasion, and 3 patients with only multiple bone metastasis. The final diagnosis was confirmed by histopathology or clinical follow-up. The sensitivity of (99m)Tc-octreotide for the detection of lung cancer at the primary lesion was comparable with that of (18)F-FDG coincidence imaging. Tomographic

  14. Chronic bacterial osteomyelitis: prospective comparison of {sup 18}F-FDG imaging with a dual-head coincidence camera and {sup 111}In-labelled autologous leucocyte scintigraphy

    Energy Technology Data Exchange (ETDEWEB)

    Meller, J.; Siefker, U.; Lehmann, K.; Meyer, I.; Schreiber, K.; Altenvoerde, G.; Becker, W. [Goettingen Univ. (Germany). Abt. fuer Nuklearmedizin; Koester, G. [Dept. of Orthopedics, Goettingen Univ. (Germany); Liersch, T. [Dept. of Traumatic Surgery, Goettingen Univ. (Germany)

    2002-01-01

    Indium-111-labelled white blood cells ({sup 111}In-WBCs) are currently considered the tracer of choice in the diagnostic work-up of suspected active chronic osteomyelitis (COM). Previous studies in a limited number of patients, performed with dedicated PET systems, have shown that [{sup 18}F]2'-deoxy-2-fluoro-D-glucose (FDG) imaging may offer at least similar diagnostic accuracy. The aim of this prospective study was to compare FDG imaging with a dual-head coincidence camera (DHCC) and {sup 111}In-WBC imaging in patients with suspected COM. Thirty consecutive non-diabetic patients with possible COM underwent combined skeletal scintigraphy (30/30 patients), {sup 111}In-WBC imaging (28/30 patients) and FDG-PET with a DHCC (30/30 patients). During diagnostic work-up, COM was proven in 11/36 regions of suspected skeletal infection and subsequently excluded in 25/36 regions. In addition, soft tissue infection was present in five patients and septic arthritis in three. {sup 111}In-WBC imaging in 28 patients was true positive in 2/11 regions with proven COM and true negative in 21/23 regions without further evidence of COM. False-positive results occurred in two regions and false-negative results in nine regions suspected for COM. Most of the false-negative results (7/9) occurred in the central skeleton. If the analysis was restricted to the 18 regions with available histology (n=17) or culture (n=1), {sup 111}In-WBC imaging was true positive in 2/18 regions, true negative in 8/18 regions, false negative in 7/18 regions and false positive in 1/18 regions. FDG-DHCC imaging was true positive in 11/11 regions with proven COM and true negative in 23/25 regions without further evidence of COM. False-positive results occurred in two regions. If the analysis was restricted to the 19 regions with available histology (n=18) or culture (n=1), FDG-DHCC imaging was true positive in 9/9 regions with proven COM and true negative in 10/10 regions without further evidence of COM. It

  15. Comparison between a dual-head and a brain-dedicated SPECT system in the measurement of the loss of dopamine transporters with [{sup 123}I]FP-CIT

    Energy Technology Data Exchange (ETDEWEB)

    Varrone, Andrea [University Federico II, Biostructure and Bioimaging Institute, National Research Council/Department of Biomorphological and Functional Sciences, Napoli (Italy); Karolinska Institutet, Department of Clinical Neuroscience, Stockholm (Sweden); Sansone, Valeria; Pappata, Sabina; Salvatore, Marco [University Federico II, Biostructure and Bioimaging Institute, National Research Council/Department of Biomorphological and Functional Sciences, Napoli (Italy); Pellecchia, Maria T.; Salvatore, Elena; de Michele, Giuseppe; Filla, Alessandro; Barone, Paolo [University Federico II, Department of Neurological Sciences, Napoli (Italy); Amboni, Marianna [University Federico II, Department of Neurological Sciences, Napoli (Italy); IDC-Hermitage, Capodimonte, Napoli (Italy)

    2008-07-15

    Dual-head SPECT systems are used by many clinical departments for [{sup 123}I]FP-CIT SPECT imaging, while triple-head or brain-dedicated systems with better imaging performance are more commonly used by research institutions. There are limited data comparing the capability of the two types of system to measure dopamine transporter (DAT) loss in vivo. The aim of this study was to compare the ability of a dual-head and a brain-dedicated SPECT system to estimate the degree of DAT loss in different movement disorders with variable nigrostriatal impairment, with [{sup 123}I]FP-CIT. Four patients with essential tremor, 24 with Parkinson's disease (PD), six with spinocerebellar ataxia type 2 and six controls were studied with [{sup 123}I]FP-CIT. SPECT scans were performed on a dual-head (E.CAM - Siemens) and subsequently on a brain-dedicated system (Ceraspect - DSI). Striatal DAT outcome measures on the E.CAM and the Ceraspect were strongly correlated and the putamen-to-caudate ratios were almost identical. Although the measured values were lower by 52 {+-} 25% in caudate and by 51 {+-} 31% in putamen on the E.CAM (p < 0.0001), the average striatal DAT decrease in each patient group compared with controls was similar for both systems. In PD patients, similar correlations (p < 0.05) were found between motor UPDRS or Hoehn and Yahr stage and striatal DAT density. Despite underestimation of striatal DAT outcome measures, the E.CAM showed similar capability as the Ceraspect in measuring the degree of nigrostriatal dopaminergic deficit and assessing the correlation between DAT outcome measures and clinical variables of PD severity and stage. (orig.)

  16. EFFECTS OF INDIAN PAN MASALA (PLAIN AND BLENDED - PMP & PMT ON TESTIS AFTER LONG TERM FEEDING (PO IN MICE

    Directory of Open Access Journals (Sweden)

    Suresh Kumar Nigam

    2012-08-01

    Full Text Available Pan masala plain (PMP with or without tobacco (PMT cause testis impairment. Three sets of mice (n = 60, 2% PMP and PMT diet were fed for12 & 13 months. Further six sets of mice in two groups plus control (n=20 received by oral feeding (PO a commercial brand PM (at doses of 8, 40 and 100 mg/kg b.w. in olive 0il by oral administration as a single dose and zarda (PMT too was given same doses and the controls were kept at staple diet only and by oral administration 0.5 ml vehicle for a period of 3 months. The animals were sacrificed (n=10 after 2 weeks and 3 months to study graded dose effects of PM plain and blend on sperm abnormalities. The plain and zarda group showed graded dose related elevated sperm abnormalities compared to control. The damages were high with 100 mg zarda group after 3 months period. The plain and Zarda group when compared, dose-duration wise, at each dose level, and in between two test groups, showed significant structural and functional changes of sperm head and mutilations. The sperm head anomalies were maximum in 12 and 13 months PMP and zarda fed groups in terms of morphology and other abnormalities. The damage is more in 13 months fed mice (p<0.01 and 12 months fed mice (p<0.05 when compared to the control group. Both the groups of PM, showed different types of sperm head abnormalities i.e., banana, beak, hammer shaped, amorphous etc. Testis of 12 and 13 months PMP and PMT groups were processed for histopathology. It was found that PMP and PMT inducts no effects after 2 weeks exposure, whereas caused liver tumor after 56 weeks exposure. PMP and PMT in comparison, and both significantly effect mouse testis showing degenerative changes in seminiferous tubules and interstitial tissue being more prominently effected in PMT group.

  17. A new Design for an High Gain Vacuum Photomultiplier: The Silicon PMT Used as Amplification Stage

    Energy Technology Data Exchange (ETDEWEB)

    Barbarino, Giancarlo [Universita di Napoli ' Federico II' , Dipartimento di Scienze fisiche, via Cintia 80126 Napoli (Italy); Asmundis, Riccardo de; De Rosa, Gianfranca [Istituto Nazionale di fisica Nucleare, sezione di Napoli, Complesso di Monte S. Angelo Ed. 6, via Cintia 80126 Napoli (Italy); Fiorillo, Giuliana; Russo, Stefano [Universita di Napoli ' Federico II' , Dipartimento di Scienze fisiche, via Cintia 80126 Napoli (Italy)

    2009-12-15

    Photons detection will continue to be a channel of great interest in the High Energy Physics and Astroparticle Physics fields for medium and big scale experiments in the next future. Thus, new solutions for photon detectors, that overcome the current limits of classical photomultipliers, are welcomed. We propose an innovative design for a hybrid, modern, high gain Vacuum Silicon Photomultiplier Tube (VSiPMT) which is boosted by the recent Geiger-mode avalanche silicon photodiode (G-APD) for which a massive production is today available.

  18. Bucking Coil Implementation on PMT for Active Cancelling of Magnetic Field

    CERN Document Server

    Gogami, T; Bono, J; Baturin, P; Chen, C; Chiba, A; Chiga, N; Fujii, Y; Hashimoto, O; Kawama, D; Maruta, T; Maxwell, V; Mkrtchyan, A; Nagao, S; Nakamura, S N; Reinhold, J; Shichijo, A; Tang, L; Taniya, N; Wood, S A; Ye, Z

    2013-01-01

    Aerogel and water Cerenkov detectors were employed to tag kaons for a lambda hypernuclear spectroscopic experiment which used the (e,e'K+) reaction in experimental Hall C at Jefferson Lab (JLab E05-115). Fringe fields from the kaon spectrometer magnet yielded ~5 Gauss at the photomultiplier tubes (PMT) for these detectors which could not be easily shielded. As this field results in a lowered kaon detection efficiency, we implemented a bucking coil on each photomultiplier tubes to actively cancel this magnetic field, thus maximizing kaon detection efficiency.

  19. Evaluation of RI images of hepatic blood flow using Tc-99m PMT

    Energy Technology Data Exchange (ETDEWEB)

    Fujiwara, Hiromichi; Iwasaki, Naoya; Ichikawa, Kesato

    1988-03-01

    To evaluate the clinical significance of RI images of hepatic blood flow using Tc-99m-PMT, analysis of the RI images and estimation of hepatic blood flow were carried out in patients with various liver diseases (37 cases). After intravenous injection of Tc-99m-PMT, hepatic accumulation curve of ROI positioned at whole liver area and time activity curve of ROI positioned at celiac artery were obtained through scintillation camera images with the computer-analysed system. Hepatic blood flow coefficient (K) was calculated from the hepatic accumulation curve. Based on the differential curve calculated from the time activity curve, chronological images of arterial, portal, parenchymal and saturated parenchymal phases were obtained. Results ; 1) K was 0.50 + 0.04, 0.35 + 0.02 and 0.26 + 0.04/min in normal type, CH type and LC type respectively. These coefficients well correlated with clinical severity of hepatic diseases. 2) Perfusional phase images of the liver became poorer in accordance with progression of liver disease, while images of spleen, portal venous system and collateral channels were more clearly obtained in liver cirrhosis. This method was shown to have a potential to understanding of severity of liver disease and hepatic blood flow dynamics.

  20. An analogue front-end ASIC prototype designed for PMT signal readout

    Science.gov (United States)

    Liu, Jian-Feng; Zhao, Lei; Yu, Li; Liang, Yu; Qin, Jia-Jun; Yang, Yun-Fan; Wu, Wei-Hao; Liu, Shu-Bin; An, Qi

    2016-06-01

    The Water Cherenkov Detector Array (WCDA) is one of the core detectors in the Large High Altitude Air Shower Observatory (LHAASO), and it consists of 3600 photomultiplier tubes (PMTs). Both high resolution time and charge measurement are required over a large dynamic range from 1 photoelectron (P.E.) to 4000 P.E. The prototype of an analogue front-end Application Specific Integrated Circuit (ASIC) fabricated using Global Foundry 0.35 μm CMOS technology is designed to read out the PMT signal in the WCDA. This ASIC employs leading edge discrimination and an (RC)4 shaping structure. Combined with the following Time-to-Digital Converter (TDC) and Analog-to-Digital Converter (ADC), both the arrival time and charge of the PMT signal can be measured. Initial test results indicate that time resolution is better than 350 ps and charge resolution is better than 10% at 1 P.E. and better than 1% with large input signals (300 P.E. to 4000 P.E.). Besides, this ASIC has a good channel-to-channel isolation of more than 84 dB and the temperature dependency of charge measurement is less than 5% in the range 0-50°C. Supported by Knowledge Innovation Program of Chinese Academy of Sciences (KJCX2-YW-N27), National Natural Science Foundation of China (11175174) and CAS Center for Excellence in Particle Physics (CCEPP)

  1. Light sensors selection for the Cherenkov Telescope Array: PMT and SiPM

    Energy Technology Data Exchange (ETDEWEB)

    Shayduk, M., E-mail: mshayduk@googlemail.com [DESY Zeuthen, D-15738 (Germany); Mirzoyan, R.; Kurz, M.; Knoetig, M. [Max-Planck-Institute for Physics, D-80805 Muenchen (Germany); Bolmont, J. [LPNHE Universite Pierre et Marie Curie, Paris (France); Dickinson, H. [Oskar Klein Centre, Stockholm University (Sweden); Lorenz, E. [Max-Planck-Institute for Physics, D-80805 Muenchen (Germany); Tavernet, J.-P. [LPNHE Universite Pierre et Marie Curie, Paris (France); Hose, J.; Teshima, M. [Max-Planck-Institute for Physics, D-80805 Muenchen (Germany); Vincent, P. [LPNHE Universite Pierre et Marie Curie, Paris (France)

    2012-12-11

    The Cherenkov Telescope Array (CTA) is planned as the next generation ground-based instrument (after VERITAS, H.E.S.S. and MAGIC) for astrophysics by means of very high energy {gamma}-rays. The CTA collaboration includes the MAGIC, the H.E.S.S. and the VERITAS collaborations. Also, a large number of astrophysicists from European institutions, from Japan and USA have joined the CTA. The CTA array will comprise about 100 imaging telescopes of three sizes that shall provide one order of magnitude higher sensitivity than the current generation of telescopes. Every telescope will use an imaging camera based on {approx}2000PMTs. We have set up a PMT development program with Hamamatsu (Japan) and Electron Tube Enterprises (England) aiming to produce 1.5 in. PMTs of optimized parameters for the CTA project. The entire scientific community, including the medicine and biology, as well as many industrial applications, where a low light level sensors are necessary, may profit from it. Together with PMTs also SiPMs are interesting sensor candidates for the CTA telescopes. One expects about two times higher photon detection efficiency for SiPM compared to PMT. A set of parameters like the photon detection efficiency, cross-talk, afterpulsing, dark rate together with other important factors were evaluated. Here we report on the progress of these developments, based on detailed measurements.

  2. Correlates of Protective Motivation Theory (PMT to Adolescents’ Drug Use Intention

    Directory of Open Access Journals (Sweden)

    Cynthia Sau Ting Wu

    2014-01-01

    Full Text Available Early onset and increasing proliferation of illicit adolescent drug-use poses a global health concern. This study aimed to examine the correlation between Protective Motivation Theory (PMT measures and the intention to use drugs among adolescents. An exploratory quantitative correlation design and convenience sampling were adopted. A total of 318 students completed a self-reported questionnaire that solicited information related to their demographics and activities, measures of threat appraisal and coping appraisal, and the intention to use drugs. Logistic regression analysis showed that intrinsic and extrinsic rewards were significant predictors of intention. The odds ratios were equal to 2.90 (p < 0.05 and 8.04 (p < 0.001, respectively. The logistic regression model analysis resulted in a high Nagelkerke R2 of 0.49, which suggests that PMT related measures could be used in predicting drug use intention among adolescents. Further research should be conducted with non-school adolescents to confirm the application.

  3. Dual parameter analysis of CsI:Tl/PMT with a digital oscilloscope

    CERN Document Server

    Devol, T A; Fjeld, R A

    1999-01-01

    Scintillation pulses from alpha-particle and gamma-ray excited CsI:Tl were recorded with a photomultiplier tube and digital oscilloscope card in single parameter (pulse shape or pulse height) and dual parameter (simultaneous pulse shape and pulse height) modes. A 2.8x1.3x1.3 cm sup 3 CsI:Tl crystal was coupled to a Burle 8850 photomultiplier tube (PMT) and excited with sup 1 sup 4 sup 8 Gd (E subalpha=3.18 MeV) and sup 1 sup 3 sup 7 Cs (E subgamma=0.662 MeV). The timing pulses (50 OMEGA terminated dynode signal) from the PMT base were directly input to a GaGe CompuScope 8012A/PCI sup T sup M (12-bit, 50 MHz dual channel digital oscilloscope card) that resided in a P6-300 MHz personal computer. Individual digitized pulses were processed via a LabVIEW sup T sup M V 4.1 interface to the oscilloscope. The ratio of the charge collected over a short time interval to the total charge collected was used for the single parameter pulse shape spectrum while the total charge collected was used for the single parameter pu...

  4. The C-terminal MIR-containing region in the Pmt1 O-mannosyltransferase restrains sporulation and is dispensable for virulence in Beauveria bassiana.

    Science.gov (United States)

    He, Zhangjiang; Luo, Linli; Keyhani, Nemat O; Yu, Xiaodong; Ying, Shenghua; Zhang, Yongjun

    2017-02-01

    Protein O-mannosyltransferases (Pmts) belong to a highly conserved protein family responsible for the initiation of O-glycosylation of many proteins. Pmts contain one dolichyl-phosphate-mannose-protein mannosyltransferases (PMT) domain and three MIR motifs (mannosyltransferase, inositol triphosphate, and ryanodine receptor) that are essential for activity in yeast. We report that in the insect fungal pathogen, Beauveria bassiana, deletion of the C-terminal Pmt1 MIR-containing region (Pmt1∆ (311-902)) does not alter O-mannosyltransferase activity, but does increase total cell wall protein O-mannosylation levels and results in phenotypic changes in fungal development and cell wall stability. B. bassiana mutants harboring the Pmt1 ∆ (311-902) mutation displayed a significant increase in conidiation with up-regulation of conidiation-associated genes and an increase in biomass accumulation as compared to the wild-type parent. However, decreased vegetative growth and blastospore production was noted, and Pmt1 ∆ (311-902) mutants were altered in cell wall composition and cell surface features. Insect bioassays revealed little effect on virulence for the Pmt1 ∆ (311-902) strain via cuticle infection or intrahemocoel injection assays, although differences in hyphal body differentiation in the host hemolymph and up-regulation of virulence-associated genes were noted. These data suggest novel roles for Pmt1 in negatively regulating conidiation and demonstrate that the C-terminal Pmt1 MIR-containing region is dispensable for enzymatic activity and organismal virulence.

  5. ATLAS TileCal Sub-Module Production at UIUC - Photos of Prototype PMT Test Setup

    CERN Multimedia

    Errede, Steve

    2001-01-01

    Photo 1 - Entrance to the lab. Photo 2 - A shot of the center of the lab. Photo 3 - The back of the lab. The Dark Box: Photo 4 - A view of the outside of the Dark Box along with its dry nitrogen system. Photo 5 - A view of the inside of the Dark Box. Photo 6 - The LED holder, beam splitter (removed in this shot), and a pulsing circuit. Photo 7 - The PMT holder. Photo 8 - A possible design for a Stepper Motor controlled filter wheel. Photo 9 - Polishing area for the optical fibers. R&D Work on Stepper Motor/Motion Control: Photo 10 - The complete prototype of the Stepper Motor setup. Photo 11 - The prototype of the Main Stepper Motor Driver Board. Photo 12 - The prototype of the Stepper Motor Power Amplifer. Photo 13 - The prototype of the Stepper Motor LabPC + Interface Board.

  6. Protecting children from myopia: a PMT perspective for improving health marketing communications.

    Science.gov (United States)

    Lwin, May O; Saw, Seang-Mei

    2007-01-01

    This research examined the predictive utility of the protection motivation theory (PMT) model for myopia prevention amongst children. An integrative model for myopia prevention behavior of parents was first developed in the context of theory and survey instruments then refined using information gathered from two focus groups. Empirical data then was collected from parents of primary school children in Singapore, a country with one of the highest rates of myopia in the world, and analyzed using structural equation modeling (SEM). Our findings revealed that coping appraisal variables were more significantly associated with protection motivation, relative to threat appraisal variables. In particular, perceived self-efficacy was the strongest predictor of parental intention to enforce good visual health behaviors, while perceived severity was relatively weak. Health marketing communications and public policy implications are discussed.

  7. Development of a multi-PMT optical module prototype for PINGU

    Energy Technology Data Exchange (ETDEWEB)

    Classen, Lew [ECAP, University of Erlangen, Erwin-Rommel-Str. 1, Erlangen (Germany); Collaboration: IceCube-PINGU Collaboration

    2014-11-18

    The multi-PMT digital optical module (mDOM) contains 41 three-inch{sup 2} PMTs in a cylindrical glass vessel. The design is based on the KM3NeT DOM. Among other advantages, this approach offers a significant increase of photocathode area per module and also per string length. As an R and D activity targeted at potential future extensions, this new type of optical modules will be tested in the framework of the PINGU project (Precision IceCube Next Generation Upgrade). PINGU will add denser instrumentation to the IceCube/DeepCore sub-volume aiming at a further decrease of the neutrino energy threshold (to a few GeV). The current status of the development and the prototype construction is presented.

  8. Research of time discrimination circuits for PMT signal readout over large dynamic range in LHAASO WCDA

    Science.gov (United States)

    Ma, C.; Zhao, L.; Dong, R.; Jiang, Z.; Chu, S.; Gao, X.; Liu, S.; An, Q.

    2016-11-01

    In the readout electronics of the Water Cerenkov Detector Array (WCDA) in the Large High Altitude Air Shower Observatory (LHAASO), both high-resolution charge and time measurement are required over a dynamic range from 1 photoelectron (P.E.) to 4000 P.E. for the PMT signal readout. In this paper, we present our work on the design of time discrimination circuits in LHAASO WCDA, especially on improvement to reduce the circuit dead time. Several approaches were studied through analysis and simulations, and actual circuits were designed and tested in the laboratory to evaluate the performance. Test results indicate that a time resolution better than 500 ps RMS is achieved in the whole large dynamic range, and the circuit dead time is successfully reduced to less than 200 ns.

  9. Electron optics design of an 8-in. spherical MCP-PMT

    Science.gov (United States)

    Chen, Ping; Tian, Jinshou; Qian, Sen; Zhao, Tianchi; Liu, Hulin; Wei, Yonglin; Sai, Xiaofeng; He, Jianping; Wang, Xing; Lu, Yu; Chen, Lin; Guo, Lehui; Pei, Chengquan; Hui, Dandan

    2017-03-01

    This paper discusses the electron optical system of an 8-in. spherical MCP-PMT. The MCP assembly, the supporting pole and the supply voltages are carefully designed to optimize the photoelectron collection efficiency and the transit time spread. Coating the MCP nickel-chromium electrode with an additional high secondary emission material is employed to make a breakthrough on the collection efficiency. With the simulation software CST, the Finite Integration method and the Monte Carlo method are combined to evaluate the collection efficiency, the time properties and the Earth's magnetic field effects. Simulation results show that the photocathode active solid angle is over 3.5 πsr, the average collection efficiency can exceed 95% with the coated MCP and the mean transit time spread is 2.2 ns for a typical electric potential of 500 V applied between the photocathode and the MCP input facet. The prototype and the measured single photoelectron spectrum are also presented.

  10. Comparison of FDG PET and positron coincidence detection imaging using a dual-head gamma camera with 5/8-inch NaI(Tl) crystals in patients with suspected body malignancies.

    Science.gov (United States)

    Boren, E L; Delbeke, D; Patton, J A; Sandler, M P

    1999-04-01

    The purpose of this study was to compare the diagnostic accuracy of fluorine-18 fluorodeoxyglucose (FDG) images obtained with (a) a dual-head coincidence gamma camera (DHC) equipped with 5/8-inch-thick NaI(Tl) crystals and parallel slit collimators and (b) a dedicated positron emission tomograph (PET) in a series of 28 patients with known or suspected malignancies. Twenty-eight patients with known or suspected malignancies underwent whole-body FDG PET imaging (Siemens, ECAT 933) after injection of approximately 10 mCi of 18F-FDG. FDG DHC images were then acquired for 30 min over the regions of interest using a dual-head gamma camera (VariCam, Elscint). The images were reconstructed in the normal mode, using photopeak/photopeak, photopeak/Compton, and Compton/photopeak coincidence events. FDG PET imaging found 45 lesions ranging in size from 1 cm to 7 cm in 28 patients. FDG DHC imaging detected 35/45 (78%) of these lesions. Among the ten lesions not seen with FDG DHC imaging, eight were less than 1.5 cm in size, and two were located centrally within the abdomen suffering from marked attenuation effects. The lesions were classified into three categories: thorax (n=24), liver (n=12), and extrahepatic abdominal (n=9). FDG DHC imaging identified 100% of lesions above 1.5 cm in the thorax group and 78% of those below 1.5 cm, for an overall total of 83%. FDG DHC imaging identified 100% of lesions above 1.5 cm, in the liver and 43% of lesions below 1.5 cm, for an overall total of 67%. FDG DHC imaging identified 78% of lesions above 1.5 cm in the extrahepatic abdominal group. There were no lesions below 1.5 cm in this group. FDG coincidence imaging using a dual-head gamma camera detected 90% of lesions greater than 1.5 cm. These data suggest that DHC imaging can be used clinically in well-defined diagnostic situations to differentiate benign from malignant lesions.

  11. PENGARUH PEMBERIAN TABLET BESI SATU KALI SEMINGGU TERHADAP STATUS HB DAN STATUS BESI ANAK SEKOLAH PENERIMA PMT-AS

    Directory of Open Access Journals (Sweden)

    Muhamad Saidin

    2012-11-01

    Full Text Available It had been conducted a study on "The Effect of Weekly Iron Supplementation on The Status of Hb and Iron among School Children Receiving PMT-AS". The main objective of the study was to investigate the effect of iron tablets supplementation to iron status of school children receiving PMT-AS. The subjects of this study was primary school children in the fourth, fifth and sicth grades in six schools receiving PMT-AS in sub-district of Sidomulyo, south Lampung. The schools were randomly assigned into three groups. The first group received iron tablets given by school teacher. The second group received iron tablets given by school teacher and under supervision of researcher (nutritionist, and the third group was control. Iron tablets containing 60 mg elemental iron were given weekly for the duration of 4.5 months. The results of study showed: 1. The percentage of anemia subjects at the begining of study in group I, II, III were 60.0%, 58.0%, and 55.1% respectively. 2. Weekly Iron Supplementatioon reduced significantly the percentage of anemia subjects (p<0.05. 3. Weekly Iron Supplementation increased Hb status and iron status significantly (p<0.05. 4. Iron tablets distribution conducted by the school teacher without supervision was as effective as iron tablets distribution under supervision of researcher.Keywords: anemia, PMT-AS (School Feeding Program, iron tablet, hemoglobin status.

  12. PEMANFAATAN TEPUNG SUKUN (Artocarpus altilis sp. PADA PEMBUATAN ANEKA KUDAPAN SEBAGAI ALTERNATIF MAKANAN BERGIZI UNTUK PMT-AS

    Directory of Open Access Journals (Sweden)

    Dewanti Putri Pratiwi

    2013-11-01

    Full Text Available ABSTRACTBreadfruit is valuable fruit and has a good of nutrient content, but its usage is limited by poor storage properties of fresh fruit. Processing into flour, can increase its utilization. The aim of this research was to utilize breadfruit flour in production of nutritious snack foods for School Supplementary Feeding Programme (PMT-AS. There were three products developed in this study; brownies, pia, and croquette. The research was conducted using experimental design. The proportions of breadfruit flour and wheat flour were different for each product, which brownies was formulated using 70:30, 80:20, 90:10, and 100:0; whereas pia and croquette was formulated by 50:50, 60:40, 70:30, and 80:20. Proximate analysis showed that 100 g brownies contained 409 kcal energy and 7.5 g protein, 100 g pia had 383 kcal energy and 6.7 g protein and croquette had the highest energy and protein content is 455 kcal and 9.9 g protein. In conclusion, all products were suitable as alternative snacks for PMT-AS. The products have met 300 kcal energy and 5 g protein per serving size. Considered also the cost of production, these products have fulfilled criteria to be used in PMT-AS.Keywords: breadfruit, PMT-AS, snacksABSTRAKSukun merupakan buah yang bernilai dan memiliki kandungan gizi yang baik, tetapi penggunaannya terbatas oleh penyimpanan ketika berbentuk buah segar. Sukun yang diubah ke dalam bentuk tepung dapat meningkatkan pemanfaatannya. Tujuan dari penelitian ini adalah memanfaatkan tepung sukun dalam pembuatan kudapan sebagai alternatif makanan bergizi untuk PMT-AS. Terdapat tiga produk dalam penelitian ini, yaitu brownies, pia, dan kroket. Penelitian ini menggunakan desain eksperimental. Perbandingan tepung sukun dan tepung terigu berbeda untuk masing-masing produk. Formulasi brownies adalah 70:39, 80:20, 90:10, dan 100:0, sedangkan formulasi pia dan kroket adalah 50:50, 60:40, 70:30, dan 80:20. Berdasarkan uji organoleptik diketahui bahwa produk

  13. Characterization of cDNA for PMT: a Partial Nicotine Biosynthesis-Related Gene Isolated from Indonesian Local Tobacco (Nicotiana tabacum cv. Sindoro1

    Directory of Open Access Journals (Sweden)

    Sesanti Basuki

    2013-12-01

    Full Text Available Nicotine is the major alkaloid compound in cultivated tobacco (Nicotiana tabacum that could potentially be converted into carcinogenic compound (nor-nicotine. The PMT gene encoding putrescine N-methyltransferase (PMT is one of the two key genes that play a prominent role in nicotine biosynthesis. The aimed of this study was to isolate and characterize the cDNA sequence originated from Indonesian local tobacco cv. Sindoro1 (Ntpmt_Sindoro1. The results showed that the Ntpmt_Sindoro1 was 1124 bp in length. This cDNA fragment encodes for 374 amino acid residues. The predicted polypeptide from the cDNA is a hidrophilic protein, and has a predicted molecular weight of 40.95 kD. The predicted amino acids sequence also showed high similarity to the PMT gene product Nicotiana sp. available in the GenBank data base. The amino acid sequences also exert conserved residues specifically exhibited only by PMT gene originated from N. tabacum. Clustering analysis revealed that Ntpmt_Sindoro1 belongs to the same clade as the PMT3 gene, a member of the N. tabacum PMT gene family. The Ntpmt_Sindoro1 cDNA sequence covering exon1-exon8 of the PMT gene fragment has been registered in the GenBank data base, under the accession number JX978277.

  14. Investigation of Very Fast Light Detectors: Silicon Photomultiplier and Micro PMT for a Cosmic Ray Array

    Science.gov (United States)

    Cervantes, Omar; Reyes, Liliana; Hooks, Tyler; Perez, Luis; Ritt, Stefan

    2016-03-01

    To construct a cosmic detector array using 4 scintillation detectors, we investigated 2 recent light sensor technologies from Hamamatsu, as possible readout detectors. First, we investigated several homemade versions of the multipixel photon counter (MPPC) light sensors. These detectors were either biased with internal or external high voltage power supplies. We made extensive measurements to confirm for the coincidence of the MPPC devices. Each sensor is coupled to a wavelength shifting fiber (WSF) that is embedded along a plastic scintillator sheet (30cmx60cmx1/4''). Using energetic cosmic rays, we evaluated several of these homemade detector modules placed above one another in a light proof enclosure. Next, we assembled 2 miniaturized micro photomultiplier (micro PMT), a device recently marketed by Hamamatsu. These sensors showed very fast response times. With 3 WSF embedded in scintillator sheets, we performed coincidence experiments. The detector waveforms were captured using the 5GS/sec domino ring sampler, the DRS4 and our workflow using the CERN PAW package and data analysis results would be presented. Title V Grant.

  15. Description of a4-channel FPGA-controlled ADC-based DAQ system for general purpose PMT signals

    Energy Technology Data Exchange (ETDEWEB)

    Conde, Ruben; Salazar, Humberto; Martinez, Oscar [Facultad de Ciencias FIsico Matematicas, BUAP, Puebla (Mexico); Villasenor, L, E-mail: rbn_cnd@hotmail.com [Instituto de Fisica y Matematicas, Universidad Michoacana San Nicolas de Hidalgo, Morelia (Mexico)

    2011-04-01

    We describe a general purpose data acquisition system for PMT signals. Hardware-wise it consists of a 4-channel ADC daughter board, an FPGA mother board, a GPS receiver and an atmospheric pressure sensor and a temperature sensor. The four ADC channels simultaneously sample PMT input signals with a sampling rate of 100MS/s. We have evaluated the noise of our system obtaining less than -48.6dB. This DAQ system includes a firmware suitable for pulse processing in cosmic rays applications. In particular, we describe in detail the way in which this system can be used during the commissioning and early operation phases of the High Altitude Water Cherenkov Observatory (HAWC) currently under construction at Sierra Negra in Mexico.

  16. Optimization of the electron collection efficiency of a large area MCP-PMT for the JUNO experiment

    Energy Technology Data Exchange (ETDEWEB)

    Chen, Lin, E-mail: chenlin@opt.cn [State Key Laboratory of Transient Optics and Photonics, Xi’an Institute of Optics and Precision Mechanics (XIOPM), Chinese Academy of Sciences (CAS), Xi’an 710119 (China); Graduate School of Chinese Academy of Sciences (CAS), Beijing 100049 (China); Xi’an Jiaotong University, Xi’an 710049 (China); Tian, Jinshou [Graduate School of Chinese Academy of Sciences (CAS), Beijing 100049 (China); Liu, Chunliang [Xi’an Jiaotong University, Xi’an 710049 (China); Wang, Yifang; Zhao, Tianchi [Institute of High Energy Physics (IHEP) of CAS, Beijing 100049 (China); Liu, Hulin; Wei, Yonglin; Sai, Xiaofeng [Graduate School of Chinese Academy of Sciences (CAS), Beijing 100049 (China); Chen, Ping [State Key Laboratory of Transient Optics and Photonics, Xi’an Institute of Optics and Precision Mechanics (XIOPM), Chinese Academy of Sciences (CAS), Xi’an 710119 (China); Graduate School of Chinese Academy of Sciences (CAS), Beijing 100049 (China); Wang, Xing; Lu, Yu [Graduate School of Chinese Academy of Sciences (CAS), Beijing 100049 (China); Hui, Dandan; Guo, Lehui [State Key Laboratory of Transient Optics and Photonics, Xi’an Institute of Optics and Precision Mechanics (XIOPM), Chinese Academy of Sciences (CAS), Xi’an 710119 (China); Graduate School of Chinese Academy of Sciences (CAS), Beijing 100049 (China); Liu, Shulin; Qian, Sen; Xia, Jingkai; Yan, Baojun; Zhu, Na [Institute of High Energy Physics (IHEP) of CAS, Beijing 100049 (China); Sun, Jianning; Si, Shuguang [North Night Vision Technology (NNVT) CO., LTD, Nanjing 210110 (China); and others

    2016-08-11

    A novel large-area (20-inch) photomultiplier tube based on microchannel plate (MCP-PMTs) is proposed for the Jiangmen Underground Neutrino Observatory (JUNO) experiment. Its photoelectron collection efficiency C{sub e} is limited by the MCP open area fraction (A{sub open}). This efficiency is studied as a function of the angular (θ), energy (E) distributions of electrons in the input charge cloud and the potential difference (U) between the PMT photocathode and the MCP input surface, considering secondary electron emission from the MCP input electrode. In CST Studio Suite, Finite Integral Technique and Monte Carlo method are combined to investigate the dependence of C{sub e} on θ, E and U. Results predict that C{sub e} can exceed A{sub open}, and are applied to optimize the structure and operational parameters of the 20-inch MCP-PMT prototype. C{sub e} of the optimized MCP-PMT is expected to reach 81.2%. Finally, the reduction of the penetration depth of the MCP input electrode layer and the deposition of a high secondary electron yield material on the MCP are proposed to further optimize C{sub e}.

  17. In-situ calibration of a PMT inside a scintillation detector by means of primary scintillation detection

    CERN Document Server

    Álvarez, V; Cárcel, S; Castel, J; Cebrián, S; Cervera, A; Conde, C A N; Dafni, T; Dias, T H V T; Díaz, J; Egorov, M; Esteve, R; Evtoukhovitch, P; Fernandes, L M P; Ferrario, P; Ferreira, A L; Freitas, E D C; Gehman, V M; Gil, A; Goldschmidt, A; Gómez, H; Gómez-Cadenas, J J; González-Díaz, D; Gutiérrez, R M; Hauptman, J; Morata, J A Hernando; Herrera, D C; Iguaz, F J; Irastorza, I G; Jinete, M A; Labarga, L; Laing, A; Liubarsky, I; Lopes, J A M; Lorca, D; Losada, M; Luzón, G; Marí, A; Martín-Albo, J; Martínez, A; Miller, T; Moiseenko, A; Monrabal, F; Monteiro, C M B; Mora, F J; Moutinho, L M; Vidal, J Muñoz; da Luz, H Natal; Navarro, G; Nebot, M; Nygren, D; Oliveira, C A B; Palma, R; Pérez, J; Aparicio, J L Pérez; Renner, J; Ripoll, L; Rodríguez, A; Rodríguez, J; Santos, F P; Santos, J M F dos; Segui, L; Serra, L; Shuman, D; Simón, A; Sofka, C; Sorel, M; Toledo, J F; Tomás, A; Torrent, J; Tsamalaidze, Z; Vázquez, D; Veloso, J F C A; Villar, J A; Webb, R C; White, J T; Yahlali, N

    2012-01-01

    We have investigated the possibility of calibrating the PMTs of scintillation detectors, using the primary scintillation produced by X-rays to induce single photoelectron response of the PMT. The high-energy tail of this response, can be approximated to an exponential function, under some conditions. In these cases, it is possible to determine the average gain for each PMT biasing voltage from the inverse of the exponent of the exponential fit to the tail, which can be done even if the background and/or noise cover-up most of the distribution. We have compared our results with those obtained by the commonly used single electron response (SER) method, which uses a LED to induce a single photoelectron response of the PMT and determines the peak position of such response, relative to the pedestal peak (the electronic noise peak, which corresponds to 0 photoelectrons). The results of the exponential fit method agree with those obtained by the SER method when the average number of photoelectrons reaching the first...

  18. Cross Talk Study to the Single Photon Response of a Flat Panel PMT for the RICH Upgrade at LHCb

    CERN Multimedia

    Arnaboldi, C; Calvi, M; Fanchini, E; Gotti, C; Maino, M; Matteuzzi, C; Perego, D L; Pessina, G; Wang, J C

    2009-01-01

    The Ring Imaging CHerenkov, RICH, detector at LHCb is now readout by Hybrid Photon Detectors. In view of its upgrade a possible option is the adoption of the flat panel Photon Multipliers Tubes, PMT. An important issue for the good determination of the rings produced in the sensitive media is a negligible level of cross talk. We have experimentally studied the cross talk from the 64x64 pixels of the H9500 PMT from Hamamatsu. Results have shown that at the single photon signal level, as expected at LHCb, the statistics applied to the small number of electrons generated at the first dynode of the PMT chain leads to a cross talk mechanism that must be interpreted in term of the percentage of the number of induced signals rather than on the amplitude of the induced signals. The threshold to suppress cross talk must be increased to a significant fraction of the single photon signal for the worst case. The number of electrons generated at the first dynode is proportional to the biasing voltage. Measurements have sh...

  19. Co-expression of AaPMT and AaTRI effectively enhances the yields of tropane alkaloids in Anisodus acutangulus hairy roots

    Science.gov (United States)

    2011-01-01

    Background Tropane alkaloids (TA) including anisodamine, anisodine, hyoscyamine and scopolamine are a group of important anticholinergic drugs with rapidly increasing market demand, so it is significant to improve TA production by biotechnological approaches. Putrescine N-methyltransferase (PMT) was considered as the first rate-limiting upstream enzyme while tropinone reductase I (TRI) was an important branch-controlling enzyme involved in TA biosynthesis. However, there is no report on simultaneous introduction of PMT and TRI genes into any TA-producing plant including Anisodus acutangulus (A. acutangulus), which is a Solanaceous perennial plant that is endemic to China and is an attractive resource plant for production of TA. Results In this study, 21 AaPMT and AaTRI double gene transformed lines (PT lines), 9 AaPMT single gene transformed lines (P lines) and 5 AaTRI single gene transformed lines (T lines) were generated. RT-PCR and real-time fluorescence quantitative analysis results revealed that total AaPMT (AaPMT T) and total AaTRI (AaTRI T) gene transcripts in transgenic PT, P and T lines showed higher expression levels than native AaPMT (AaPMT E) and AaTRI (AaTRI E) gene transcripts. As compared to the control and single gene transformed lines (P or T lines), PT transgenic hairy root lines produced significantly higher levels of TA. The highest yield of TA was detected as 8.104 mg/g dw in line PT18, which was 8.66, 4.04, and 3.11-times higher than those of the control (0.935 mg/g dw), P3 (highest in P lines, 2.004 mg/g dw) and T12 (highest in T lines, 2.604 mg/g dw), respectively. All the tested samples were found to possess strong radical scavenging capacity, which were similar to control. Conclusion In the present study, the co-expression of AaPMT and AaTRI genes in A. acutangulus hairy roots significantly improved the yields of TA and showed higher antioxidant activity than control because of higher total TA content, which is the first report on

  20. Co-expression of AaPMT and AaTRI effectively enhances the yields of tropane alkaloids in Anisodus acutangulus hairy roots

    Directory of Open Access Journals (Sweden)

    Zhang Ang

    2011-04-01

    Full Text Available Abstract Background Tropane alkaloids (TA including anisodamine, anisodine, hyoscyamine and scopolamine are a group of important anticholinergic drugs with rapidly increasing market demand, so it is significant to improve TA production by biotechnological approaches. Putrescine N-methyltransferase (PMT was considered as the first rate-limiting upstream enzyme while tropinone reductase I (TRI was an important branch-controlling enzyme involved in TA biosynthesis. However, there is no report on simultaneous introduction of PMT and TRI genes into any TA-producing plant including Anisodus acutangulus (A. acutangulus, which is a Solanaceous perennial plant that is endemic to China and is an attractive resource plant for production of TA. Results In this study, 21 AaPMT and AaTRI double gene transformed lines (PT lines, 9 AaPMT single gene transformed lines (P lines and 5 AaTRI single gene transformed lines (T lines were generated. RT-PCR and real-time fluorescence quantitative analysis results revealed that total AaPMT (AaPMT T and total AaTRI (AaTRI T gene transcripts in transgenic PT, P and T lines showed higher expression levels than native AaPMT (AaPMT E and AaTRI (AaTRI E gene transcripts. As compared to the control and single gene transformed lines (P or T lines, PT transgenic hairy root lines produced significantly higher levels of TA. The highest yield of TA was detected as 8.104 mg/g dw in line PT18, which was 8.66, 4.04, and 3.11-times higher than those of the control (0.935 mg/g dw, P3 (highest in P lines, 2.004 mg/g dw and T12 (highest in T lines, 2.604 mg/g dw, respectively. All the tested samples were found to possess strong radical scavenging capacity, which were similar to control. Conclusion In the present study, the co-expression of AaPMT and AaTRI genes in A. acutangulus hairy roots significantly improved the yields of TA and showed higher antioxidant activity than control because of higher total TA content, which is the first

  1. Forward physics in CMS: Simulation of PMT hits in HF and Higgs mass reconstruction methods with a focus on forward jet tagging

    CERN Document Server

    Moeller, Anthony Richard

    2014-01-01

    Abnormally high energy events were seen in the Hadronic Forward (HF) calorimeter for pion and muon data during testbeam in 2004. Analysis of testbeam data suggested that such events were caused by particles traveling the entire length of HF and striking the photomultiplier (PMT) windows in the readout box behind HF. Charged particles traversing the window of the PMT emit cerenkov radiation, which creates abnormally high energy events in the data. To further study these events, a modification of the existing official CMS HF simulation was created that added the PMT windows to the simulation as sensitive detectors. In agreement with testbeam data, abnormally high energy events in the PMTs were seen in the simulation for muons and pions. The simulation was then extended to jets simulated with Pythia, and then for collision like events as well. PMT hits were seen in both of these cases. Energy sharing between PMTs for long and short fibers in HF as well as timing differences between normal HF events and PMT event...

  2. A PMT-like high gain avalanche photodiode based on GaN/AlN periodically stacked structure

    Science.gov (United States)

    Zheng, Jiyuan; Wang, Lai; Wu, Xingzhao; Hao, Zhibiao; Sun, Changzheng; Xiong, Bing; Luo, Yi; Han, Yanjun; Wang, Jian; Li, Hongtao; Brault, Julien; Matta, Samuel; Khalfioui, Mohamed Al; Yan, Jianchang; Wei, Tongbo; Zhang, Yun; Wang, Junxi

    2016-12-01

    Avalanche photodiode (APD) has been intensively investigated as a promising candidate to replace the bulky and fragile photomultiplier tube (PMT) for weak light detection. However, the performance of most available APDs is barely satisfactory compared to that of the PMTs because of inter-valley scattering. Here, we demonstrate a PMT-like APD based on GaN/AlN periodically stacked-structure (PSS), in which the electrons encounter a much less inter-valley scattering during transport than holes. Uni-directional avalanche takes place with a high efficiency. According to our simulations based on a PSS with GaN (10 nm)/AlN (10 nm) in each period, the probability for electrons to trigger ionization in each cycle can reach as high as 80%, while that for holes is only 4%. A record high and stable gain (104) with a low ionization coefficient ratio of 0.05 is demonstrated under a constant bias in a prototype device.

  3. A Study of Personal Health Record User’s Behavioral Model Based on the PMT and UTAUT Integrative Perspective

    Directory of Open Access Journals (Sweden)

    Hui-Lung Hsieh

    2016-12-01

    Full Text Available The personal health record (PHR is a system that enables borderless medical care services by combining technological innovation and human consideration. This study explored factors affecting the adoption of PHR from technical, medical, and social perspectives according to the Protection Motivation Theory (PMT and Unified Theory of Acceptance and Use of Technology (UTAUT model. A survey using a structured questionnaire was subsequently conducted, which produced the following results: (1 The PMT and UTAUT were effective at predicting PHR usage behaviors; (2 Perceived ease-of-use was the most decisive factor influencing the use of PHR, followed by self-efficacy and perceived usefulness; and (3 Behavioral intention for PHR was significantly and positively correlated with usage behavior. From the obtained results, this study recommends that health authorities and medical institutions promote self-efficacy in the use of PHR to improve the levels of behavioral intention and usage behavior among the people. Additionally, medical care institutions are recommended to promote health management and preventive healthcare concepts to help improve public acceptance of the PHR system as a means to self-manage their health. Finally, community centers, medical institutions, and health authorities are urged to work together to enhance public medical knowledge and pool resources for the PHR system, both of which are essential for improving the popularity of the PHR, public quality of life, and the effectiveness of health management.

  4. PERILAKU MAKAN MURID SEKOLAH DASAR PENERIMA PMT-AS DI DESA CIHEULEUT DAN PASIR GAOK KABUPATEN BOGOR

    Directory of Open Access Journals (Sweden)

    Hermina Hermina

    2012-11-01

    Full Text Available FOOD CONSUMPTION BEHAVIOR OF ELEMENTARY SCHOOL PUPILS PARTICIPATING IN "PMT-AS" PROGRAM AT THE CIHEULEUT AND PASIR GAOK VILLAGE DISTRICT OF BOGOR.Objective: To collect informations regarding actual food consumption behaviour of the pupils, i.e. to develop right message to improve food consumption and nutrition status of the pupils.Results: Most of the pupils have not been applying good and acceptable food consumption behavior, i.e. quantitatively and qualitatively as well; their dietary food consumption patterns relatively monotoneous, vegetables are consumted very limited and also protein sources are less varieties. Snack foods which are usually consumed at school are less varieties and relatively unsafe.Conclusions: There are important messages developed to improve food consumption and nutrition status of the pupils, i.e. eat breakfast before go to school, have complete meal 2-3 times a day and consumed vegetables every day.Key Words: food consumption behavior, school suplementary feeding program (PMT-AS, nutrition education, elementary school pupils

  5. A PMT-like high gain avalanche photodiode based on GaN/AlN periodical stacked structure

    CERN Document Server

    Zheng, Ji-yuan; Yang, Di; Yu, Jia-dong; Meng, Xiao; E, Yan-xiong; Wu, Chao; Hao, Zhi-biao; Sun, Chang-zheng; Xiong, Bing; Luo, Yi; Han, Yan-jian; Wang, Jian; Li, Hong-tao; Brault, Julien; Matta, Samuel; Khalfioui, Mohamed Al; Yan, Jian-chang; Wei, Tong-bo; Zhang, Yun; Wang, Jun-xi

    2016-01-01

    Avalanche photodiode (APD) has been intensively investigated as a promising candidate to replace photomultiplier tubes (PMT) for weak light detection. However, in conventional APDs, a large portion of carrier energy drawn from the electric field is thermalized, and the multiplication efficiencies of electron and hole are low and close. In order to achieve high gain, the device should work under breakdown bias, where carrier multiplication proceeds bi-directionally to form a positive feedback multiplication circle. However, breakdown is hard to control, in practice, APDs should work under Geiger mode as a compromise between sustainable detection and high gain. The complexity of system seriously restricts the application. Here, we demonstrate an avalanche photodiode holding high gain without breakdown, which means no quenching circuit is needed for sustainable detection. The device is based on a GaN/AlN periodically-stacked-structure (PSS), wherein electron holds much higher efficiency than hole to draw energy ...

  6. Noise Filter Studies for CMS Forward Hadron Calorimeter (HF) Between Old and New PMT's Using Data in 2012

    CERN Document Server

    Dumanoglu, Isa; Gurpinar, Emine; Kunori, Shuichi; Lezki, Samet; Tali, Bayram

    2016-01-01

    During the data taking before 2012 some abnormal events which have higher signals than expected were observed. Most of these were due to muons. When a muon hits the PMT glass window it creates a huge signal. To eliminate this kind of events 24 old HF PMTs (Hamamatsu R7525) in HF Minus at iphi 43 (corresponds to one sector) were replaced with new multi anode PMTs (Hamamatsu multi anode R7600) which have thin glass windows. These new PMTs were installed and tested in H2 test beam area in 2009 [1]. To check whether these new PMTs perform better than the old ones data taken in 2012 were analyzed using various predefined noise filters. Noisy rechits percentage was found to be around 6-7 \\% for the new PMTs while it varies between 29-66 \\% for the old PMTs for various trigger selections and for HFLongShortFilter after an energy cut of 500GeV [2].

  7. Clinical value of 18F-FDG dual head coincidence imaging and 131I-SPECT/CT in the diagnosis of patients with metastatic after resection of papillary thyroid carcinoma%18F-FDG符合线路显像与131I-SPECT/CT探测甲状腺乳头状癌术后转移的价值

    Institute of Scientific and Technical Information of China (English)

    孙云钢; 冯会娟; 刘金华; 胡瑞; 欧阳伟

    2011-01-01

    目的:评价甲状腺乳头状癌术后18F-FDG符合线路显像与131I-SPECT/CT对转移灶的诊断价值.方法:经过甲状腺手术及131I成功清除甲状腺残留组织的56例甲状腺乳头状癌患者,在第2次131I治疗前1周内行18F-FDG符合线路显像,并在给予剂量3.7~7.4GBq 131I后第3天行131I-SPECT/CT,对比分析两种显像结果,并统计分析影响18F-FDG符合线路显像探测效率的因素.结果:131I-SPECT/CT诊断甲状腺乳头状癌术后转移患者的灵敏度、特异性、准确性、阳性预测值、阴性预测值分别为84.21%(32/38),94.44%(17/18),87.5% (49/56).96.97%( 32/33),73.91%( 17/23).131I-SPECT/CT诊断甲状腺乳头状癌术后转移患者的灵敏度、准确性、阴性预测值高于18F-FDG符合线路显像(x2=16.114,14.175,6.285,P均<0.05).18F-FDG符合线路显像阳性组与阴性组的转移病灶大小分别为( 1.83±0.30)cm、( 1.29+0.26)cm,差异有统计学意义(P<0.001).结论:131I-SPECT/CT诊断甲状腺乳头状癌术后转移患者的灵敏度、准确性、阴性预测值高于18F-FDG符合线路显像;18F-FDG符合线路显像是131I-SPECT/CT在甲状腺乳头状癌转移诊断中的重要补充,其探测效率与转移灶大小有关.%Objective: The aim of this study was to evaluate the value of 18F-FDG dual head coincidence imaging and 131I-SPECT/CT in the diagnosis of patients with metastatic papillary thyroid carcinoma (PTC). Methods: Fifty-six patients who had thyroidectomy and radioiodine ablation of residual normal thyroid tissue were included. They all had 18F-FDG dual head coincidence imaging and 3 days after giving 3.7~7.4GBq 131I I31I-SPECT/CT were performed. We had comparative analysis of the two imaging results and the variable parameters between the I8F-FDG dual head coincidence imaging positive group and 18F-FDG dual head coincidence imaging negative group. Results: The sensitivity, specificity, accuracy, positive predictive value and negative predictive

  8. Hamamatsu PMT R7056 Study for the Extinction Monitoring System of the Mu2e Experiment at Fermilab

    CERN Document Server

    Boi, S; Hedin, D; Johnson, E; Prebys, E; Rubinov, P

    2015-01-01

    The Mu2e experiment at Fermilab proposes to search for the coherent neutrino-less conversion of muons to electrons in the presence of a nucleus. The experimental signature for an aluminum target is an isolated 105 MeV electron exiting the stopping target no earlier than ~700 ns after the pulse of proton beam hits the production target. Any protons that hit the production target in between the pulses can lead to fake conversion electrons during the measurement period. We define the beam extinction as the ratio of the number of protons striking the production target between pulses to the number striking the target during the pulses. It has been established that an extinction of approximately 10-10 is required to reduce the backgrounds to an acceptable level. It would be desirable to measure the extinction of the beam coming out of the accelerator in a minute or less. Studies for the fast extinction monitor based on Hamamatsu PMT R7056 is the subject of this presentation.

  9. Bile leakage after living donor liver transplantation demonstrated with hepatobiliary scan using 9mTc-PMT.

    Science.gov (United States)

    Kanazawa, Akishige; Kubo, Shoji; Tanaka, Hiromu; Takemura, Shigekazu; Yamazaki, Keiichi; Hirohashi, Kazuhiro; Shiomi, Susumu

    2003-09-01

    Although it is recognized that hepatobiliary scan is of value in assessing postoperative complications of biliary surgery or cadaveric whole liver transplantation, there have been few reports regarding its usefulness following living donor liver transplantation. We performed living donor liver transplantation in a patient with biliary cirrhosis due to hepatolithiasis, using a right lobe graft from her sister. On the 15th postoperative day, bile discharge appeared from the operative wound. The leakage point could not be identified by computed tomography and cholangiography from the biliary drainage catheter. Hepatobiliary scan with Tc-99m Sn-N-pyridoxyl-5-methyltryptophan (99mTc-PMT) demonstrated biliary extravasation from the left side of the anastomosis of the hepatico-jejunostomy, indicating biliary leakage from the anastomosis. Conservative therapy was continued because the radioisotope flowed smoothly into the reconstructed jejunum and the biliary drainage catheter, and the leakage was stopped on the 63th postoperative day. Hepatobiliary scan is useful in determining the therapeutic plan as well as detection of bile leakage and identification of leakage points after living donor liver transplantation.

  10. BdCESA7, BdCESA8, and BdPMT utility promoter constructs for targeted expression to secondary cell-wall-forming cells of grasses

    Directory of Open Access Journals (Sweden)

    Deborah ePetrik

    2016-02-01

    Full Text Available Utility vectors with promoters that confer desired spatial and temporal expression patterns are useful tools for studying gene and cellular function and for industrial applications. To target the expression of DNA sequences of interest to cells forming plant secondary cell walls, which generate most of the vegetative biomass, upstream regulatory sequences of the Brachypodium distachyon lignin biosynthetic gene BdPMT and the cellulose synthase genes BdCESA7 and BdCESA8 were isolated and cloned into binary vectors designed for Agrobacterium-mediated transformation of monocots. Expression patterns were assessed using the β-glucuronidase gene GUSPlus and X-glucuronide staining. All three promoters showed strong expression levels in stem tissue at the base of internodes where cell wall deposition is most active, in both vascular bundle xylem vessels and tracheids, and in interfascicular tissues, with expression less pronounced in developmentally older tissues. In leaves, BdCESA7 and BdCESA8 promoter-driven expression was strongest in leaf veins, leaf margins, and trichomes; relatively weaker and patchy expression was observed in the epidermis. BdPMT promoter-driven expression was similar to the BdCESA promoters expression patterns, including strong expression in trichomes. The intensity and extent of GUS staining varied considerably between transgenic lines, suggesting that positional effects influenced promoter activity. Introducing the BdPMT and BdCESA8 Open Reading Frames (ORFs into BdPMT and BdCESA8 utility promoter binary vectors, respectively, and transforming those constructs into Brachypodium pmt and cesa8 loss-of-function mutants resulted in rescue of the corresponding mutant phenotypes. This work therefore validates the functionality of these utility promoter binary vectors for use in Brachypodium and likely other grass species. The identification, in Bdcesa8-1 T-DNA mutant stems, of an 80% reduction in crystalline cellulose levels

  11. Clinical value of 18F-fluorodeoxyglucose dual-head coincidence imaging in metastasis of differentiated thyroid cancer with positive Tg and negative 131I scan%18F-FDG符合线路显像在Tg阳性、131I显像阴性分化型甲状腺癌转移灶中的应用价值

    Institute of Scientific and Technical Information of China (English)

    姚小芹; 王辉; 马超; 傅宏亮

    2013-01-01

    目的 探讨18-氟代脱氧葡萄糖(18F-FDG)符合线路显像在甲状腺球蛋白(Tg)阳性、131I显像阴性分化型甲状腺癌转移灶中的应用价值.方法 选择甲状腺切除术后131I清除残余甲状腺组织治疗成功,随访中血清Tg增高、131I全身显像未发现病灶的35例分化型甲状腺癌患者行18F-FDG符合线路显像,显像结果与手术切除标本或穿刺活检的病理结果和持续随访(Tg、B超、CT和MRI等)结果 进行比较,获得18F-FDG符合线路显像在诊断Tg阳性、131I显像阴性分化型甲状腺癌转移灶中的敏感度、特异度、准确度和阳性预测值.结果 35例患者中,27例最终被病理检查或持续随访证实为甲状腺癌转移.18F-FDG符合线路显像的敏感度为81.5% (22/27),特异度为75.0% (6/8),准确度为80.0% (28/35),阳性预测值为91.7% (22/24).18F-FDG符合线路显像诊断Tg阳性、131I显像阴性分化型甲状腺癌转移灶与病理检查、持续随访结果的一致性较好(κ=0.499,P=0.006).结论 18F-FDG符合线路显像在Tg阳性、131I显像阴性分化型甲状腺癌转移灶的定位和定性诊断中具有重要价值.%Objective To investigate the clinical value of F-fluorodeoxyglucose ( F-FDG) dual-head coincidence imaging in metastasis of differentiated thyroid cancer with positive thyroglobulin ( Tg) and negative I scan. Methods Thirty-five patients with differentiated thyroid cancer and positive Tg and negative I whole-body scan after thyroidectomy were included. 18F-FDG dual-head coincidence imaging was performed in all the patients for the detection of metastatic lesions. The F-FDG imaging results were compared with pathological findings or results of continuous follow-up by Tg and other imaging modalities such as B ultrasound, CT and MRI. The sensitivity, specificity, accuracy and positive diagnosis value of F-FDG dual-head coincidence imaging in patients with differentiated thyroid cancer and positive Tg and negative I

  12. The Penicillium digitatum protein O-mannosyltransferase Pmt2 is required for cell wall integrity, conidiogenesis, virulence and sensitivity to the antifungal peptide PAF26.

    Science.gov (United States)

    Harries, Eleonora; Gandía, Mónica; Carmona, Lourdes; Marcos, Jose F

    2015-09-01

    The activity of protein O-mannosyltransferases (Pmts) affects the morphogenesis and virulence of fungal pathogens. Recently, PMT genes have been shown to determine the sensitivity of Saccharomyces cerevisiae to the antifungal peptide PAF26. This study reports the identification and characterization of the three Pdpmt genes in the citrus post-harvest pathogen Penicillium digitatum. The Pdpmt genes are expressed during fungal growth and fruit infection, with the highest induction for Pdpmt2. Pdpmt2 complemented the growth defect of the S. cerevisiae Δpmt2 strain. The Pdpmt2 gene mutation in P. digitatum caused pleiotropic effects, including a reduction in fungal growth and virulence, whereas its constitutive expression had no phenotypic effect. The Pdpmt2 null mutants also showed a distinctive colourless phenotype with a strong reduction in the number of conidia, which was associated with severe alterations in the development of conidiophores. Additional effects of the Pdpmt2 mutation were hyphal morphological alterations, increased sensitivity to cell wall-interfering compounds and a blockage of invasive growth. In contrast, the Pdpmt2 mutation increased tolerance to oxidative stress and to the antifungal activity of PAF26. These data confirm the role of protein O-glycosylation in the PAF26-mediated antifungal mechanism present in distantly related fungal species. Important to future crop protection strategies, this study demonstrates that a mutation rendering fungi more resistant to an antifungal peptide results in severe deleterious effects on fungal growth and virulence.

  13. 一种用于GR仪器PMT的高压电源设计%The design of high-voltage power for PMT in GR tools

    Institute of Scientific and Technical Information of China (English)

    孙攀峰; 刘荣辉; 董旭锋

    2011-01-01

    The natural GR radioactive signal detection is a main aapproaeh used in oil exploration and production. It can be used to determine the type of day and clay content ,identify the lit hology,and correct the depth for other logging job, GR signal detection can be achieved using PMT drived high performance,high-voltage power amplify,threngh the faint GR signal in the formation detected by scintillation crystal, The paper specially designs a high-voltage switch power using for PMT in the GR tools. The power work under the PWM model has the properities of small bulk ,high efficiency and sta blization in working, The power has passed the test and applied in daily operation.%GR射线探测是石油开发中对井眼中因放射性元素自然衰变产生的GR射线的强度不同来进行地层识别,岩性分析,深度校准的常用方法.GR信号检测时需要采用高性能的高压电源驱动光电倍增管,对烁晶体探测到地层中的微弱GR射线进行放大实现.研究了一种针对GR仪器内PMT工作的高压电源电路,该电路采用PWM的控制方式,体积狭小,转换效率高,工作稳定可靠,并经过了实践的检验和使用,取得了很好的使用效果.

  14. Dimensionless parameterization of lidar for laser remote sensing of the atmosphere and its application to systems with SiPM and PMT detectors.

    Science.gov (United States)

    Agishev, Ravil; Comerón, Adolfo; Rodriguez, Alejandro; Sicard, Michaël

    2014-05-20

    In this paper, we show a renewed approach to the generalized methodology for atmospheric lidar assessment, which uses the dimensionless parameterization as a core component. It is based on a series of our previous works where the problem of universal parameterization over many lidar technologies were described and analyzed from different points of view. The modernized dimensionless parameterization concept applied to relatively new silicon photomultiplier detectors (SiPMs) and traditional photomultiplier (PMT) detectors for remote-sensing instruments allowed predicting the lidar receiver performance with sky background available. The renewed approach can be widely used to evaluate a broad range of lidar system capabilities for a variety of lidar remote-sensing applications as well as to serve as a basis for selection of appropriate lidar system parameters for a specific application. Such a modernized methodology provides a generalized, uniform, and objective approach for evaluation of a broad range of lidar types and systems (aerosol, Raman, DIAL) operating on different targets (backscatter or topographic) and under intense sky background conditions. It can be used within the lidar community to compare different lidar instruments.

  15. PCR method for the rapid detection and discrimination of Legionella spp. based on the amplification of pcs, pmtA, and 16S rRNA genes.

    Science.gov (United States)

    Janczarek, Monika; Palusińska-Szysz, Marta

    2016-05-01

    Legionella bacteria are organisms of public health interest due to their ability to cause pneumonia (Legionnaires' disease) in susceptible humans and their ubiquitous presence in water supply systems. Rapid diagnosis of Legionnaires' disease allows the use of therapy specific for the disease. L. pneumophila serogroup 1 is the most common cause of infection acquired in community and hospital environments. The non-L. pneumophila infections are likely under-detected because of a lack of effective diagnosis. In this work, simplex and duplex PCR assays with the use of new molecular markers pcs and pmtA involved in phosphatidylcholine synthesis were specified for rapid and cost-efficient identification and distinguishing Legionella species. The sets of primers developed were found to be sensitive and specific for reliable detection of Legionella belonging to the eight most clinically relevant species. Among these, four primer sets I, II, VI, and VII used for duplex-PCRs proved to have the highest identification power and reliability in the detection of the bacteria. Application of this PCR-based method should improve detection of Legionella spp. in both clinical and environmental settings and facilitate molecular typing of these organisms.

  16. System, Apparatus and Method Employing a Dual Head Laser

    Science.gov (United States)

    Coyle, Donald B. (Inventor); Stysley, Paul R. (Inventor); Poulios, Demetrios (Inventor)

    2015-01-01

    A system, apparatus and method employing a laser with a split-head, V-assembly gain material configuration. Additionally, the present invention is directed to techniques to better dissipate or remove unwanted energies in laser operations. The present invention is also directed to techniques for better collimated laser beams, with single spatial mode quality (TEM00), with improved efficiency, in extreme environments, such as in outer space.

  17. The Application of PMT to the Determination of Deformation Parameters of Soft Carbonaceous Rock%旁压试验在炭质软岩强度和变形参数测试中的应用

    Institute of Scientific and Technical Information of China (English)

    唐晓玲; 袁永洪; 刘宗祥

    2014-01-01

    本文介绍了岷江庙子坪特大桥工程地质勘察中的难点,阐明了采用旁压试验测试含炭质软岩各项强度和变形参数的可行性,以及取得的实际效果。%This paper deals with difficulties of engineering geological exploration for the Miaoziping Bridge in the Minjiang River valley, feasibility and practice results of the application of PMT to the determination of deformation parameters of soft carbonaceous rock.

  18. Construction of Plant Expression Vectors of PMT,TR-I and H6H%颠茄PMT·TR-I和H6H基因植物高效表达载体的构建

    Institute of Scientific and Technical Information of China (English)

    成瑜; 杨春贤; 王贵君; 李郑娜; 杨颖舫; 冯国庆; 陈敏; 廖志华

    2010-01-01

    [目的]构建1,4-丁二胺-氮-甲基转移酶(Putrescine N-methyltransferase,PMT)基因、托品酮还原酶-I(Tropinone reductase-I,TR-I)基因和莨菪碱 6-β-羟化酶(Hyoscyamine 6β-Hydroxylase,H6H)基因的植物高效表达载体.[方法]采用RT-PCR方法从颠茄中克隆到PMT、TR-I和H6H基因编码区序列,并连接到植物表达载体pCAMBIA1304+ (p1304+)中.[结果]成功构建了植物高效表达载体p1304+-PMT、p1304+-TR-I、p1304+-H6H、 p1304+-PMT-H6H、p1304+-TR-I-PMT和p1304+-TR-I-H6H,并转化农杆菌,获得可直接用于遗传改良颠茄的工程菌.[结论]该研究为利用植物基因工程技术提高东莨菪碱的产量奠定了基础.

  19. 酵母表面展示系统的改进及其在筛选烟草 PMT 基因启动子结合蛋白中的应用%Screening of Promoter-Binding Factors of Tobacco PMT Gene Using a Modi-fied Yeast Surface Display System

    Institute of Scientific and Technical Information of China (English)

    陈红; 牛海峡; 王文静; 马浩然; 李加纳; 柴友荣; 张洪博

    2014-01-01

    Yeast surface display system is an important tool for studying molecular interaction of proteins, however, its application in DNA-binding-protein screening is relatively limited. Yeast surface display system secretes exogenous proteins onto cell surface, thus, it could be applied to determine protein interaction under in-vitro-like experiment conditions. Therefore, it may be more efficient than yeast one-hybrid system in screening the DNA-binding proteins whose DNA-binding capability is affected by en-dogenous yeast factors. In this study, we modified the pYD1 vector in yeast surface display system to make it compatible with the Smart cDNA library construction kit from Clontech, which will be helpful to increase the library construction efficiency. An ex-perimental procedure for DNA-binding protein isolation was established using the modified yeast surface display system. Then, it was successfully applied in screening DNA-binding proteins of a jasmonate (JA) responsive element in the promoter of tobacco PMT (putrescine N-methyltransferase) gene. Among the isolated genes, two encoded ERF transcription factors, which were found to bind the JA responsive element in PMT promoter in vitro but unable to activate the expression of reporters in yeast-one-hybrid system. Our study suggests that yeast surface display system is efficient in screening the DNA-binding proteins whose DNA-binding capability in yeast-one-hybrid system is disrupted by endogenous factors.%筛选 DNA 结合蛋白常用的酵母单杂交系统在应用中有时会因内源干扰而影响筛选结果。与之相比,酵母表面展示系统(yeast surface display system)将外源蛋白展示在细胞表面,可通过接近体外实验的方法筛选 DNA 结合蛋白,能在一定程度上避免酵母内源干扰,但是,该系统在 DNA 结合蛋白筛选研究中的应用还很有限。本研究对酵母表面展示系统常用载体 pYD1进行改造,使其与 Clontech 公司的 Smart cDNA 文

  20. Comparison of 18F-fluorodeoxyglucose dual-head tomography with coincidence and 99mTc-methylenediphosphonate bone scintigraphy in diagnosis and therapeutic evaluation of bone metastases%18F-FDG符合探测显像与99mTc-MDP骨显像评价肿瘤骨转移的对比研究

    Institute of Scientific and Technical Information of China (English)

    武新宇; 高永举; 闫新慧

    2014-01-01

    Objective To compare the value of 18F-fluorodeoxyglucose (18F-FDG) dual-head tomography with coincidence (DHTC) and 99mTc-methylenediphosphonate (99mTc-MDP) bone scintigraphy (BS) in diagnosis and therapeutic evaluation of bone metastases. Methods A total of 42 cases with cancer bone metastases, averagely aged (53.62±12.48) years old, were enrolled in this study. 18 cases did not receive any treatment, and 11 patients received inspection 2-5 times for assessment of therapeutic effects. 18F-FDG DHTC and 99mTc-MDP BS were performed within one week in all patients. The sensitivity, specificity and accuracy of 18F-FDG DHTC and 99mTc-MDP BS were compared. Results Of the 42 patients with bone metastases, 36 cases were correctly detected by 18F-FDG DHTC, and 32 were correctly detected by 99mTc-MDP BS. The difference of the sensitivity was not significant (χ2=1.25,P=0.320). Among 18 patients who did not receive any treatment, all got correct diagnosis by 18F-FDG DHTC, and 12 were positive on 99mTc-MDP BS. The difference of the diagnostic accuracy was significant (χ2=4.17,P<0.05). The result of 18F-FDG DHTC was strongly correlated with the clinical therapeutic evaluation(r=0.834,P<0.02). Conclusion 18F-FDG DHTC offers an advantage in diagnosis and therapeutic evaluation of bone metastases over 99mTc-MDP BS.%目的:比较18F-脱氧葡萄糖(18F-FDG)符合探测显像及99mTc-亚甲基二膦酸盐(99mTc-MDP)骨显像在肿瘤骨转移诊断及疗效评价中的价值。方法收集本院行18F-FDG符合探测显像及99mTc-MDP骨显像的骨转移患者42例,平均年龄(53.62±12.48)岁。其中未进行任何治疗患者18例,另11例治疗后多次(2~5次)行18F-FDG符合探测显像及99mTc-MDP全身骨显像。两种检查在1周内完成。比较两种方法在肿瘤骨转移诊断及疗效评价中的价值。结果18F-FDG符合探测显像有36例明确诊断,99mTc-MDP骨显像有32例明确诊断,两种方法的诊断准确率

  1. Final Technical Report for Award DE-FG02-05ER41389 A New Electrostatically-Focused, UV HPD for Liquid Xenon: A Direct Comparison with APD, PMT, SiPM in an Integrated Database

    Energy Technology Data Exchange (ETDEWEB)

    Elena Aprile

    2009-08-25

    Within the scope of the project, a LXe detector and associated gas handling and purification system were set up to study the response of various photodetectors to the VUV Xe light. In particular we tested an Advanced Photonix Large Area Avalanche Photodiode (APD), Silicon Photomultipliers (SiPMs) from two different sources and an Hamamtsu Photonics APD. As part of the XENON Dark Matter project, sponsored by the National Science Foundation, we have accumulated independent knowledge of the response of compact metal channel photomultipliers. At this stage, we conclude that the last are far superior in terms of reliability and performance in a LXe detector environment. More studies are needed with APDs and SiPMs in LXe, taking advantage of the improved performance of these sensors with time. We could not test a hybrid PMT (HPD) since the only available unit on loan from one manufacturer lacked the mechanical stability and was packaged in a form not compatible with LXe purity requirements. Meanwhile, within the XENON collaboration, we are developing with Hamamatsu a hybrid PMT which is named QUPID (Quartz Photon Intensifying Detector) which promises to solve the problems of radioactivity and purity encountered with previous HPDs. We attach to this report two papers which summarize in detail the experimental st-ups, procedures and results obtained with different APDs and SiPMs operated in LXe. We continue our investigations of APDs in view of their potential appication in large arrays for LXe detectors. We intend to publish the results once we complete tests of newly acquired Hamamatsu APDs.

  2. Study on PMT Ringing Signal of The Daya Bay Neutrino Experiment%大亚湾中微子实验光电倍增管输出振铃脉冲的分析研究

    Institute of Scientific and Technical Information of China (English)

    蒋文奇; 王铮; 李秋菊; 常劲帆; 严雄波; 魏微; 陆卫国; 吕继方

    2012-01-01

    The Daya Bay Neutrino Experiment is a neutrino - oscillation experiment designed to measure the mixing angle θ13 using anti - neutrinos produced by the reactors of the DayaBay Nuclear Power Plant (NPP) and the Ling Ao NPP. The readout signals of the PMTs which are reacted by the Neutrino need to be accurately measured for the goal of the Daya Bay experiment which needs a measurement of sin22θ13 to 0.01 or better. But ringing was found in the PMT test. It describes the ringing in the readout signals of the PMTs, and analyses the cause of the ringing.%大亚湾反应堆中微子实验是一个研究中微子振荡的实验[1],主要目标是利用核反应堆产生的电子反中微子来测定一个具有重大物理意义的参数一中微子混合角θ13.大亚湾中微子实验的目标是将sin22θ13测量到0.01或更高的精度,为实现对大亚湾中微子信号的准确测量,必须要求光电倍增管输出干净脉冲信号到前端电子学(FEE),但在测试实验中,发现光电倍增管输出脉冲含有振铃.针对振铃进行了详尽分析,找到了振铃产生的根源,也确认了电容在高压下的压电效应.

  3. Postmortale tijd (PMT) : PMT-bepaling door temperatuurmeting [Post-mortal time (PMT) assessment by [corpse] temperature measurement

    NARCIS (Netherlands)

    Hartog, E.A. den; Daanen, H.A.M.; Visser, R.; Lelieveld, J.H.L.M.

    1999-01-01

    One of the tasks of the technical forensics experts in the case of unnatural death, is to control the alibi of suspects. For this purpose, the technical forensics experts also use (technical) information available from forensic material, such as a drop of blood with the DNA of the assailant. Along w

  4. Effect of position resolution on LoR discrimination for a dual-head Compton camera

    Science.gov (United States)

    Gillam, John E.; Beveridge, Toby E.; Boston, Andrew J.; Boston, Helen C.; Cooper, Reynold J.; Hall, Chris J.; Mather, Andrew R.; Nolan, Paul J.; Lewis, Rob A.

    2007-04-01

    With the current increase in effective germanium semiconductor detection technology, a positron emission tomography system comprising two opposing HPGe detectors is under development. This type of detection offers not only improvement to some aspects of PET, but also the ability to record single-photon information in the detection process. This information can be used in stand-alone imaging, and also as an additional information source in the PET process. Discrimination based on this single-photon information was proposed; however, the effectiveness of this discrimination is dependent on the resolution of the single-photon information. Simulations of the detection system, in which the positional resolution of the interaction information is variable, was conducted. The single-photon information has then been used in the PET imaging process and its effect on image improvement shown. Much like mechanical collimation, electronic collimation may be used to remove false LoRs from an image, at the expense of efficiency. Moreover, unlike mechanical collimation, this trade off may be dynamically adjusted post data acquisition.

  5. Imaging system for cardiac planar imaging using a dedicated dual-head gamma camera

    Science.gov (United States)

    Majewski, Stanislaw; Umeno, Marc M.

    2011-09-13

    A cardiac imaging system employing dual gamma imaging heads co-registered with one another to provide two dynamic simultaneous views of the heart sector of a patient torso. A first gamma imaging head is positioned in a first orientation with respect to the heart sector and a second gamma imaging head is positioned in a second orientation with respect to the heart sector. An adjustment arrangement is capable of adjusting the distance between the separate imaging heads and the angle between the heads. With the angle between the imaging heads set to 180 degrees and operating in a range of 140-159 keV and at a rate of up to 500kHz, the imaging heads are co-registered to produce simultaneous dynamic recording of two stereotactic views of the heart. The use of co-registered imaging heads maximizes the uniformity of detection sensitivity of blood flow in and around the heart over the whole heart volume and minimizes radiation absorption effects. A normalization/image fusion technique is implemented pixel-by-corresponding pixel to increase signal for any cardiac region viewed in two images obtained from the two opposed detector heads for the same time bin. The imaging system is capable of producing enhanced first pass studies, bloodpool studies including planar, gated and non-gated EKG studies, planar EKG perfusion studies, and planar hot spot imaging.

  6. Blood volume distribution in patients with cirrhosis: aspects of the dual-head gamma-camera technique

    DEFF Research Database (Denmark)

    Kiszka-Kanowitz, Marianne; Henriksen, Jens Henrik; Møller, Søren;

    2001-01-01

    : The close relation between the estimated blood volume in the thorax region and the central and arterial blood volume, obtained by the dynamic indicator dilution technique (r=0.87, PWhole-body scintigraphy showed altered blood volume distribution in the cirrhotic...

  7. First full-beam PET acquisitions in proton therapy with a modular dual-head dedicated system

    Science.gov (United States)

    Sportelli, G.; Belcari, N.; Camarlinghi, N.; Cirrone, G. A. P.; Cuttone, G.; Ferretti, S.; Kraan, A.; Ortuño, J. E.; Romano, F.; Santos, A.; Straub, K.; Tramontana, A.; Del Guerra, A.; Rosso, V.

    2014-01-01

    During particle therapy irradiation, positron emitters with half-lives ranging from 2 to 20 min are generated from nuclear processes. The half-lives are such that it is possible either to detect the positron signal in the treatment room using an in-beam positron emission tomography (PET) system, right after the irradiation, or to quickly transfer the patient to a close PET/CT scanner. Since the activity distribution is spatially correlated with the dose, it is possible to use PET imaging as an indirect method to assure the quality of the dose delivery. In this work, we present a new dedicated PET system able to operate in-beam. The PET apparatus consists in two 10 cm × 10 cm detector heads. Each detector is composed of four scintillating matrices of 23 × 23 LYSO crystals. The crystal size is 1.9 mm × 1.9 mm × 16 mm. Each scintillation matrix is read out independently with a modularized acquisition system. The distance between the two opposing detector heads was set to 20 cm. The system has very low dead time per detector area and a 3 ns coincidence window, which is capable to sustain high single count rates and to keep the random counts relatively low. This allows a new full-beam monitoring modality that includes data acquisition also while the beam is on. The PET system was tested during the irradiation at the CATANA (INFN, Catania, Italy) cyclotron-based proton therapy facility. Four acquisitions with different doses and dose rates were analysed. In all cases the random to total coincidences ratio was equal or less than 25%. For each measurement we estimated the accuracy and precision of the activity range on a set of voxel lines within an irradiated PMMA phantom. Results show that the inclusion of data acquired during the irradiation, referred to as beam-on data, improves both the precision and accuracy of the range measurement with respect to data acquired only after irradiation. Beam-on data alone are enough to give precisions better than 1 mm when at least 5 Gy are delivered.

  8. Determination of kidney function with 99mTc-DTPA renography using a dual-head camera

    DEFF Research Database (Denmark)

    Madsen, Claus J; Møller, Michael L; Zerahn, Bo;

    2013-01-01

    Single-head gamma camera renography has been used for decades to estimate kidney function. An estimate of the glomerular filtration rate (GFR) can be obtained using Tc-diethylenetriaminepentaacetic acid (Tc-DTPA). However, because of differing attenuation, an error is introduced when the kidney...

  9. Light sharing in multi-flat-panel-PMT PEM detectors.

    Science.gov (United States)

    Raylman, Raymond R; Majewski, Stan; Mayhugh, Michael R

    2006-01-01

    Large are a detectors, such as those used in positron emission mammography (PEM) and scintimammography, utilize arrays of discrete semtillator elements mounted on arrays of position sensitive photomultiplier tubes (PSPMT). Scintillator elements can be packed very densely (minimizing area between elements), allowing good detection sensitivity and spatial resolution. And, while new flat panel PSPMTS have minimal inactive edges, when they are placed in arrays significant dead spaces where scintillation light is undetectable are created. To address this problem, a light guide is often placed between the detector and PSPMT array to spread scintillation light so that these gaps can be bridged. In this investigation we studied the effect of light guides of various thickness on system performance. A 10x10 element array of LYSO detector elements was coupled to the center of a 2x2 array of PSPMTs through varying thicknesses (1 to 4 mm) of UV glass. The spot size of the imaged elements and distortions in the regular square pattern of the imaged scintillator arrays were evaluated. Energy resolution was measured by placing single elements of LYSO at several locations of the PSPMT array. Spatial distortions in the images of the array were reduced by using thicker light guides (3-4 mm). Use of thicker light guides, however, resulted in reduced pixel resolution and slight degradation of energy resolution. Therefore, some loss of pixel and energy resolution will accompany the use of thick light guides (minimum of 3 mm) required for optimum identification of detector elements.

  10. Asking the Right Questions: Action Learning and PMT 401

    Science.gov (United States)

    2016-08-01

    program aimed at improving leadership , critical thinking, problem solving and decision­making skills . Participants in this rigorous, in­residence...problem • Skill Development • Urgent and complex problems requiring unique systems thinking • Groups charged with implementing the solution as...is used the world over by business and organizations of all sorts, in the public and private sectors, and makes significant contributions to the

  11. A Cockcroft-Walton PMT base with signal processing circuit

    CERN Document Server

    Jun, Yin; Yapeng, Zhang

    2016-01-01

    Design a surface mount 14-PIN Cockcroft-Walton photomultiplier tube base for a muon detector, which provides both high voltage power supply and signal processing. The whole system, including the detector, adopts a +5V DC power input, and features as tiny size, low power-consumption and good portability, extremely well meeting the requirements of the power supply with a battery on a mobile workstation. Detailed descriptions and test results of a prototype are presented.

  12. Test of timing properties of the Photek 240 PMT

    Energy Technology Data Exchange (ETDEWEB)

    Ronzhin, A.; Albrow, M.; Demarteau, M.; Pronko, S.; Ramberg, E.; /Fermilab; Zatserklyaniy, A.; /Puerto Rico U., Mayaguez

    2010-01-01

    Timing measurements of Silicon Photomultipliers (SiPM) at the picosecond level were performed at Fermilab. The core timing resolution of the electronic measurement technique is approximately 2 picoseconds. The single photoelectron time resolution (SPTR) was measured for the signals coming from the SiPM's. A SPTR of about one hundred picoseconds was obtained for SiPM's illuminated by laser pulses. The dependence of the SPTR on applied bias voltage and on the wavelength of the light was measured. A simple model is proposed to explain the difference in the SPTR for blue and red light. A time of flight system based on the SiPM's, with quartz Cherenkov radiators, was tested in a proton beam at Fermilab. The time resolution obtained is 35 picoseconds per SiPM. Finally, requirements for the SiPM's temperature and bias voltage stability to maintain the time resolution are discussed.

  13. A TOF-PET prototype with position sensitive PMT readout%A TOF-PET prototype with position sensitive PMT readout

    Institute of Scientific and Technical Information of China (English)

    陈金达; 臧永东; 王建松; 孙志宇; 郭忠言; 徐瑚珊; 胡正国; 陈若富; 唐彬; 岳珂; 余玉洪; 章学恒; 孔洁

    2011-01-01

    A prototype of time-of-flight positron emission computed tomography (TOF-PET) has been developed for acquiring the coincident detection of 511 keV γ-rays produced from positron annihilation. It consists of two 80.5 minx80.5 mm LYSO scintillator arrays (co

  14. Photo-sensors for a Multi-PMT optical module in KM3NeT

    NARCIS (Netherlands)

    Kavatsyuk, O.; Dorosti-Hasankiadeh, Q.; Löhner, H.

    2011-01-01

    A deep-sea Neutrino Telescope of at least 1 km(3) size (KM3NeT) is being designed to search for high-energy (1-1000 TeV) neutrinos originating from galactic and extragalactic sources. The detection principle exploits the measurement of Cherenkov light emitted by charged particles resulting from neut

  15. Developments of a large area VUV sensitive gas PMT with GEM/muPIC

    Energy Technology Data Exchange (ETDEWEB)

    Sekiya, H [Kamioka Observatory, Institute for Cosmic Ray Research, University of Tokyo, 456 Higashi-Mozumi, Hida, Gifu, 506-1205 (Japan); Ida, C; Kubo, H; Kurosawa, S; Tanimori, T [Department of Physics, Graduate School of Science, Kyoto University, Kitashirakawa-oiwake, Sakyo, Kyoto, 606-8502 (Japan); Yoshikawa, A; Yanagida, T; Yokota, Y [Institute of Multidisciplinary Research for Advanced Materials, Tohoku University, 2-1-1 Katahira, Aoba, Sendai, Miyagi, 980-8577 (Japan); Fukuda, K; Ishizu, S; Kawaguchi, N; Suyama, T, E-mail: sekiya@icrr.u-tokyo.ac.j [Tokuyama Corporation, 3-3-1 Shibuya, Shibuya, Tokyo, 150-8383 (Japan)

    2009-11-15

    A new large area UV photon detector with micro pattern gaseous detectors is developed and evaluated. A semitransparent CsI photocathode deposited on a MgF{sub 2} window was combined with 10cm x 10cm GEM and muPIC. Using Ar+C{sub 2}H{sub 6} (10%) gas, we achieved the gas gain of more than 10{sup 5} which is enough to detect single photoelectron. We, then, irradiated vacuum UV photons (VUV, around 172nm) from the newly developed LaF{sub 3}(Nd) scintillator to the detector and the single photoelectrons were successfully detected. We also demonstrated the imaging capability of the detector with muPIC readout systems.

  16. The upgraded calibration system for the scintillator-PMT Tile Hadronic Calorimeter of the ATLAS experiment at CERN/LHC

    CERN Document Server

    Chakraborty, Dhiman; The ATLAS collaboration

    2017-01-01

    The ATLAS Tile Calorimeter (TileCal) is the central section of the hadronic calorimeter of the ATLAS experiment and provides important information for reconstruction of hadrons, jets, hadronic decays of tau leptons and missing transverse energy in highest energy proton-proton and heavy-ion collisions at CERN’s Large Hadron Collider. This sampling calorimeter uses steel plates as absorber and scintillating tiles as active medium. The light produced by the passage of charged particles is transmitted by wavelength shifting fibres to photomultiplier tubes (PMTs) located on the outside of the calorimeter. The readout is segmented into about 5000 cells (longitudinally and transversally), each read out by two PMTs in parallel. A multi-component calibration system is employed to calibrate and monitor the stability and performance of each part of the readout chain during data taking. The TileCal calibration system comprises Cesium radioactive sources, laser and charge injection elements and it allows to monitor and ...

  17. A wide-field TCSPC FLIM system based on an MCP PMT with a delay-line anode

    Science.gov (United States)

    Becker, Wolfgang; Hirvonen, Liisa M.; Milnes, James; Conneely, Thomas; Jagutzki, Ottmar; Netz, Holger; Smietana, Stefan; Suhling, Klaus

    2016-09-01

    We report on the implementation of a wide-field time-correlated single photon counting (TCSPC) method for fluorescence lifetime imaging (FLIM). It is based on a 40 mm diameter crossed delay line anode detector, where the readout is performed by three standard TCSPC boards. Excitation is performed by a picosecond diode laser with 50 MHz repetition rate. The photon arrival timing is obtained directly from the microchannel plates, with an instrumental response of ˜190 to 230 ps full width at half maximum depending on the position on the photocathode. The position of the photon event is obtained from the pulse propagation time along the two delay lines, one in x and one in y. One end of a delay line is fed into the "start" input of the corresponding TCSPC board, and the other end is delayed by 40 ns and fed into the "stop" input. The time between start and stop is directly converted into position, with a resolution of 200-250 μm. The data acquisition software builds up the distribution of the photons over their spatial coordinates, x and y, and their times after the excitation pulses, typically into 512 × 512 pixels and 1024 time channels per pixel. We apply the system to fluorescence lifetime imaging of cells labelled with Alexa 488 phalloidin in an epi-fluorescence microscope and discuss the application of our approach to other fluorescence microscopy methods.

  18. Study of hepatic hemodynamics using sup 99m Tc-PMT SPECT in patients with chronic liver disease

    Energy Technology Data Exchange (ETDEWEB)

    Iwasa, Motoh (Mie Univ., Tsu (Japan). School of Medicine)

    1992-06-01

    Effective hepatic blood flow (BF), intrahepatic shunt BF, intrahepatic shunt rate, and total hepatic BF were determined by using dynamic SPECT scans for 10 minutes obtained after iv injection of Tc-99m (Sn)-N-pyridoxyl-5-methyltryptophan and data from a single venous sampling in a total of 72 subjects, consisting of 64 patients with chronic liver disease and 8 healthy persons. Significant decrease in effective hepatic BF and significant increase in intrahepatic shunt BF and intrahepatic shunt rate were found in the group of liver cirrhosis, as compared with the group of chronic hepatitis and the control group. There was no significant difference in total hepatic BF between the three groups. Hepatic BF for liver cirrhosis was independent of the associated liver cancer. For idiopathic portal hypertension, effective hepatic BF was favorably maintained with no evidence of associated intrahepatic shunt BF. In the group of liver cirrhosis, effective hepatic BF was decreased with decreasing liver function; intrahepatic shunt BF was remarkably increased, resulting in an increased total hepatic BF. This may reflect an increased hepatic blood circulation. Effective hepatic BF, intrahepatic shunt BF, and intrahepatic shunt rate significangly correlated with laboratory findings for the severity of liver disease. All of the hemodynamic variables were increased after meal in the group of chronic hepatitis, indicating an increase in hepatic inflow. In the group of liver cirrhosis or idiopathic portal hypertension, however, an increase of hepatic inflow and change of intrahepatic BF were minimal, suggesting the outflow into the extrahepatic shunt. The present SPECT may be a promising noninvasive method for measuring hepatic BF, thereby allowing the evaluation of not only liver function but also liver pathophysiology. (N.K.).

  19. Development of a New Fast Shower Maximum Detector Based on Microchannel Plates Photomultipliers (MCP-PMT) as an Active Element

    Energy Technology Data Exchange (ETDEWEB)

    Ronzhin, A. [Fermilab; Los, S. [Fermilab; Ramberg, E. [Fermilab; Spiropulu, M. [Caltech; Apresyan, A. [Caltech; Xie, S. [Caltech; Kim, H. [Chicago U.; Zatserklyaniy, A. [UC, Santa Cruz

    2014-09-21

    One possibility to make a fast and radiation resistant shower maximum (SM) detector is to use a secondary emitter as an active element. We present below test beam results, obtained with different types of photodetectors based on microchannel plates (MCPs) as the secondary emitter. We performed the measurements at the Fermilab Test Beam Facility with 120GeV proton beam and 12GeV and 32GeV secondary beams. The goal of the measurement with 120GeV protons was to determine time resolution for minimum ionizing particles (MIPs). The SM time resolution we obtained for this new type of detector is at the level of 20-30ps. We estimate that a significant contribution to the detector response originates from secondary emission of the MCP. This work can be considered as the first step in building a new type of calorimeter based on this principle.

  20. Development of a New Fast Shower Maximum Detector Based on Microchannel Plates Photomultipliers (MCP-PMT) as an Active Element

    Energy Technology Data Exchange (ETDEWEB)

    Ronzhin, A. [Fermilab; Los, S. [Fermilab; Ramberg, E. [Fermilab; Spiropulu, M. [Caltech; Apresyan, A. [Caltech; Xie, S. [Caltech; Kim, H. [Chicago U.; Zatserklyaniy, A. [UC, Santa Cruz

    2014-09-21

    One possibility to make a fast and radiation resistant shower maximum (SM) detector is to use a secondary emitter as an active element. We present below test beam results, obtained with different types of photodetectors based on microchannel plates (MCPs) as the secondary emitter. We performed the measurements at the Fermilab Test Beam Facility with 120GeV proton beam and 12GeV and 32GeV secondary beams. The goal of the measurement with 120GeV protons was to determine time resolution for minimum ionizing particles (MIPs). The SM time resolution we obtained for this new type of detector is at the level of 20-30ps. We estimate that a significant contribution to the detector response originates from secondary emission of the MCP. This work can be considered as the first step in building a new type of calorimeter based on this principle.

  1. A wide-field TCSPC FLIM system based on an MCP PMT with a delay-line anode

    OpenAIRE

    Becker, Wolfgang, 1962-; Hirvonen, Liisa; Milnes, James; Conneely, Thomas; Jagutzki, Ottmar; Netz, Holger; Smietana, Stefan; Suhling, Klaus

    2016-01-01

    We report on the implementation of a wide-field time-correlated single photon counting (TCSPC) method for fluorescence lifetime imaging (FLIM). It is based on a 40 mm diameter crossed delay line anode detector, where the readout is performed by three standard TCSPC boards. Excitation is performed by a picosecond diode laser with 50 MHz repetition rate. The photon arrival timing is obtained directly from the microchannel plates, with an instrumental response of ∼190 to 230 ps full width at hal...

  2. A flexible COME and KISS QDC and TDC read-out scheme for PMT, MAPD and diamond detector applications

    Energy Technology Data Exchange (ETDEWEB)

    Rost, Adrian [Technische Universitaet Darmstadt, Darmstadt (Germany); Collaboration: HADES-Collaboration

    2015-07-01

    A flexible COME and KISS Charge-to-Digital-Converter (QDC) and Time-to-Digital-Converter (TDC) read-out scheme will be presented which can be used in a wide range of read-out applications in high energy physics experiments. The focus is on a calorimeter detector read-out via photomultiplier tubes (PMTs) or via multi-pixel avalanche photo-diodes (MAPDs), as well as on diamond detectors for the HADES and CBM experiments at the future FAIR facility in Darmstadt. The detector input signals are integrated with the help of simple analogue electronics (KISS: Keep it Small and Simple). Afterwards the charge measurement is transformed into a Time-over-Threshold (ToT) measurement using an commercial (COME: Use Commercial Elements) FPGA as a discriminator. The well-established TRBv3 platform will provide a precise FPGA TDC for a ToT measurement of the discriminated signals. An 8-channel prototype board PaDiWa-AMPS was manufactured and successfully tested in the laboratory and under beam conditions. In this contribution the current status of the read-out concept is shown.

  3. Tests of PMT Signal Read-out in a Liquid Argon Dark Matter Detector with a New Fast Waveform Digitizer

    CERN Document Server

    Acciarri, R; Cavanna, F; Cortopassi, A; D'Incecco, M; Mini, G; Pietropaolo, F; Romboli, A; Segreto, E; Szelc, A M

    2012-01-01

    The CAEN V1751 is a new generation of Waveform Digitizer recently introduced by CAEN SpA. Its features, i.e. 8 Channels per board, 10 bit, 1 GS/s Flash ADC Waveform Digitizer (or 4 channel, 10 bit, 2 GS/s Flash ADC Waveform Digitizer - Dual Edge Sampling mode) with threshold and Auto-Trigger capabilities provides a very good (relatively low-cost) solution for data acquisition in Dark Matter searches using PMTs to detect scintillation light in liquid argon. The board was tested by operating it in real experimental conditions and by comparing it with a state of the art digital oscilloscope. We find that the sampling at 1 or 2 GS/s is appropriate for the reconstruction of the fast component of the scintillation light in argon (characteristic time of about 6-7 ns) and the extended dynamic range, after a small customization, allows for the detection of signals in the range of energy needed. The bandwidth is found to be adequate and the intrinsic noise is very low.

  4. The fiber-SiPMT beam monitor of the R484 experiment at the RIKEN-RAL muon facility

    Science.gov (United States)

    Carbone, R.; Bonesini, M.; Bertoni, R.; Mazza, R.; Rossella, M.; Tortora, L.; Vacchi, A.; Vallazza, E.; Zampa, G.

    2015-03-01

    The scintillating fibers SiPM based beam monitor detector, designed to deliver position, shape and timing of the low energy muon beam at the RIKEN-RAL muon facility for the R484 experiment, has been successfully tested on the electron beam at the Beam Test Facility (BTF) of the INFN LNF laboratories. We report here the lay out and the read out structure as well as the very promising results.

  5. The Upgraded Calibration System for the Scintillator-PMT Tile Hadronic Calorimeter of the ATLAS experiment at CERN/LHC

    CERN Document Server

    Chakraborty, Dhiman; The ATLAS collaboration

    2017-01-01

    The ATLAS Tile Calorimeter (TileCal) is the central section of the hadronic calorimeter of the ATLAS experiment and provides important information for reconstruction of hadrons, jets, hadronic decays of tau leptons and missing transverse energy in highest energy proton-proton and heavy-ion collisions at CERN’s Large Hadron Collider. This sampling calorimeter uses steel plates as absorber and scintillating tiles as active medium. The light produced by the passage of charged particles is transmitted by wavelength shifting fibres to photomultiplier tubes (PMTs) located on the outside of the calorimeter. The readout is segmented into about 5000 cells (longitudinally and transversally), each read out by two PMTs in parallel. A multi-component calibration system is employed to calibrate and monitor the stability and performance of each part of the readout chain during data taking. The TileCal calibration system comprises Cesium radioactive sources, laser and charge injection elements and it allows to monitor and ...

  6. Design and simulation of a 12-bit, 40 MSPS asynchronous SAR ADC for the readout of PMT signal

    CERN Document Server

    Liu, Jian-Feng; Qin, Jia-Jun; Yang, Yun-Fan; Yu, Li; Liang, Yu; Liu, Shu-Bin; An, Qi

    2016-01-01

    High precision and large dynamic range measurement are required in the readout systems for the Water Cherenkov Detector Array (WCDA) in Large High Altitude Air Shower Observatory (LHAASO). This paper presents a prototype of 12-bit 40 MSPS Analog-to-Digital Converter (ADC) Application Specific Integrated Circuit (ASIC) designed for the readout of LHAASO WCDA. Combining this ADC and the front-end ASIC finished in our previous work, high precision charge measurement can be achieved based on the digital peak detection method. This ADC is implemented based on power-efficient Successive Approximation Register (SAR) architecture, which incorporates the key parts such as Capacitive Digital-to-Analog Converter (CDAC), dynamic comparator and asynchronous SAR control logic. The simulation results indicate that the Effective Number Of Bits (ENOB) with a sampling rate of 40 MSPS is better than 10 bits in an input frequency range below 20 MHz, while its core power consumption is 6.6 mW per channel. The above results are go...

  7. Design and simulation of a 12-bit, 40 MSPS asynchronous SAR ADC for the readout of PMT signals

    Science.gov (United States)

    Liu, Jian-Feng; Zhao, Lei; Qin, Jia-Jun; Yang, Yun-Fan; Yu, Li; Liang, Yu; Liu, Shu-Bin; An, Qi

    2016-11-01

    High precision and large dynamic range measurement are required in the readout systems for the Water Cherenkov Detector Array (WCDA) in the Large High Altitude Air Shower Observatory (LHAASO). This paper presents a prototype of a 12-bit 40 MSPS Analog-to-Digital Converter (ADC) Application Specific Integrated Circuit (ASIC) designed for the readout of the LHAASO WCDA. Combining this ADC and the front-end ASIC finished in our previous work, high precision charge measurement can be achieved based on the digital peak detection method. This ADC is implemented based on a power-efficient Successive Approximation Register (SAR) architecture, which incorporates key parts such as a Capacitive Digital-to-Analog Converter (CDAC), dynamic comparator and asynchronous SAR control logic. The simulation results indicate that the Effective Number Of Bits (ENOB) with a sampling rate of 40 MSPS is better than 10 bits in an input frequency range below 20 MHz, while its core power consumption is 6.6 mW per channel. The above results are good enough for the readout requirements of the WCDA. Supported by Knowledge Innovation Program of the Chinese Academy of Sciences (KJCX2-YW-N27), CAS Center for Excellence in Particle Physics (CCEPP)

  8. High-Resolution L(Y)SO Detectors Using PMT-Quadrant-Sharing for Human and Animal PET Cameras

    Science.gov (United States)

    Ramirez, Rocio A.; Liu, Shitao; Liu, Jiguo; Zhang, Yuxuan; Kim, Soonseok; Baghaei, Hossain; Li, Hongdi; Wang, Yu; Wong, Wai-Hoi

    2008-06-01

    We developed high resolution L(Y)SO detectors for human and animal PET applications using Photomulti- plier-quadrant-sharing (PQS) technology. The crystal sizes were 1.27 times 1.27 times 10 mm3 for the animal PQS-blocks and 3.25 times 3.25 times 20 mm3 for human ones. Polymer mirror film patterns (PMR) were placed between crystals as reflector. The blocks were assembled together using optical grease and wrapped by Teflon tape. The blocks were coupled to regular round PMTs of 19/51 mm in PQS configuration. List-mode data of Ga-68 source (511 keV) were acquired with our high yield pileup-event recovery (HYPER) electronics and data acquisition software. The high voltage bias was 1100 V. Crystal decoding maps and individual crystal energy resolutions were extracted from the data. To investigate the potential imaging resolution of the PET cameras with these blocks, we used GATE (Geant4 Application for Tomographic Emission) simulation package. GATE is a GEANT4 based software toolkit for realistic simulation of PET and SPECT systems. The packing fractions of these blocks were found to be 95.6% and 98.2%. From the decoding maps, all 196 and 225 crystals were clearly identified. The average energy resolutions were 14.1% and 15.6%. For small animal PET systems, the detector ring diameter was 16.5 cm with an axial field of view (AFOV) of 11.8 cm. The simulation data suggests that a reconstructed radial (tangential) spatial resolution of 1.24 (1.25) mm near the center is potentially achievable. For the whole-body human PET systems, the detector ring diameter was 86 cm. The simulation data suggests that a reconstructed radial (tangential) spatial resolution of 3.09(3.38) mm near the center is potentially achievable. From this study we can conclude that the PQS design could achieve high spatial resolutions and excellent energy resolutions on human and animal PET systems with substantially lower production costs and inexpensive readout devices.

  9. ATLAS TileCal Sub-Module Production at UIUC

    CERN Multimedia

    Errede, Steve

    2001-01-01

    Photos of Current PMT Test Setup: Photo 1 - View of the PC, Electronics Rack and PMT Dark Box Photo 2 - Another View of the PC, Electronics Rack and PMT Dark Box. Photo 3 - Overhead shot of PMT Grid inside PMT Dark Box. Photo 4 - View of inside of PMT Light Box.

  10. In-treatment tests for the monitoring of proton and carbon-ion therapy with a large area PET system at CNAO

    Energy Technology Data Exchange (ETDEWEB)

    Rosso, V., E-mail: valeria.rosso@pi.infn.it [Department of Physics, University of Pisa and INFN, Pisa (Italy); Battistoni, G. [INFN Sezione di Milano, Milano (Italy); Belcari, N.; Camarlinghi, N. [Department of Physics, University of Pisa and INFN, Pisa (Italy); Ciocca, M. [Fondazione CNAO, Pavia (Italy); Collini, F. [Department of Physical Sciences, Earth and Environment, University of Siena and INFN, Pisa (Italy); Ferretti, S.; Kraan, A.C.; Lucenò, S. [Department of Physics, University of Pisa and INFN, Pisa (Italy); Molinelli, S.; Pullia, M. [Fondazione CNAO, Pavia (Italy); Sportelli, G.; Zaccaro, E.; Del Guerra, A. [Department of Physics, University of Pisa and INFN, Pisa (Italy)

    2016-07-11

    One of the most promising new radiotherapy techniques makes use of charged particles like protons and carbon ions, rather than photons. At present, there are more than 50 particle therapy centers operating worldwide, and many new centers are being constructed. Positron Emission Tomography (PET) is considered a well-established non-invasive technique to monitor range and delivered dose in patients treated with particle therapy. Nuclear interactions of the charged hadrons with the patient tissue lead to the production of β+ emitting isotopes (mainly {sup 15}O and {sup 11}C), that decay with a short lifetime producing a positron. The two 511 keV annihilation photons can be detected with a PET detector. In-beam PET is particularly interesting because it could allow monitoring the ions range also during dose delivery. A large area dual head PET prototype was built and tested. The system is based on an upgraded version of the previously developed DoPET prototype. Each head covers now 15×15 cm{sup 2} and is composed by 9 (3×3) independent modules. Each module consists of a 23×23 LYSO crystal matrix (2 mm pitch) coupled to H8500 PMT and is readout by custom front-end and a FPGA based data acquisition electronics. Data taken at the CNAO treatment facility in Pavia with proton and carbon beams impinging on heterogeneous phantoms demonstrate the DoPET capability to detect the presence of a small air cavity in the phantom.

  11. In-treatment tests for the monitoring of proton and carbon-ion therapy with a large area PET system at CNAO

    Science.gov (United States)

    Rosso, V.; Battistoni, G.; Belcari, N.; Camarlinghi, N.; Ciocca, M.; Collini, F.; Ferretti, S.; Kraan, A. C.; Lucenò, S.; Molinelli, S.; Pullia, M.; Sportelli, G.; Zaccaro, E.; Del Guerra, A.

    2016-07-01

    One of the most promising new radiotherapy techniques makes use of charged particles like protons and carbon ions, rather than photons. At present, there are more than 50 particle therapy centers operating worldwide, and many new centers are being constructed. Positron Emission Tomography (PET) is considered a well-established non-invasive technique to monitor range and delivered dose in patients treated with particle therapy. Nuclear interactions of the charged hadrons with the patient tissue lead to the production of β+ emitting isotopes (mainly 15O and 11C), that decay with a short lifetime producing a positron. The two 511 keV annihilation photons can be detected with a PET detector. In-beam PET is particularly interesting because it could allow monitoring the ions range also during dose delivery. A large area dual head PET prototype was built and tested. The system is based on an upgraded version of the previously developed DoPET prototype. Each head covers now 15×15 cm2 and is composed by 9 (3×3) independent modules. Each module consists of a 23×23 LYSO crystal matrix (2 mm pitch) coupled to H8500 PMT and is readout by custom front-end and a FPGA based data acquisition electronics. Data taken at the CNAO treatment facility in Pavia with proton and carbon beams impinging on heterogeneous phantoms demonstrate the DoPET capability to detect the presence of a small air cavity in the phantom.

  12. Fast-channel LSO detectors and fiber-optic encoding for excellent dual photon transmission measurements in PET

    Energy Technology Data Exchange (ETDEWEB)

    Jones, W.F.; Moyers, J.C.; Casey, M.E.; Watson, C.C.; Nutt, R. [CTI PET Systems, Inc., Knoxville, TN (United States)

    1999-08-01

    Improved attenuation correction remains critical to PET. Currently with dual photon rotating rod sources, benefits of windowing are limited by counting losses of detectors nearest the rods, the near detectors. With single photon sources, improved statistics are offset by a greater need for collimation and more complex emission background correction. Now, a dual photon point source array with fast-channel, near detectors improves on these earlier techniques -- here, adding transmission measurement to dual-head rotating PET. Arrays of collimated point sources are aligned axially and orbit the FOV. With each source is a dedicated near detector (LSO crystal). Crystals couple to photomultipliers (PMTs). As the crystals are not ``block`` encoded, pulse-processing time is reduced (to 120 ns). Reduced processing time lowers dead time and permits hotter sources. For improved axial sampling, larger arrays (21 sources/head) may be configured. To reduce costs, crystals couple fiber-optically into unique PMT pairs -- decreasing the total number of near-detector PMTs by 71%.

  13. Development of a 24-anode linear-array fine-mesh PMT with 85% photoelectron detection efficiency and 100 ps TTS at B{<=}1 T

    Energy Technology Data Exchange (ETDEWEB)

    Hirose, M.; Akatsu, M.; Enari, Y.; Fujimoto, K.; Fujita, T.; Higashino, Y.; Hokuue, T.; Hotta, Y.; Inami, K.; Ishikawa, A.; Matsui, S.; Matsumoto, T.; Misono, K.; Ohshima, T. E-mail: ohshima@hepl.phys.nagoya-u.ac.jp; Sugi, A.; Sugiyama, A.; Suzuki, A.; Suzuki, S.; Tomoto, M

    2001-03-21

    By shortening the distance between the photocathode and the first dynode to 1 mm and using a finer mesh size of 2500 lines/in. with 4 {mu}m{sup {phi}}, a 24 anode linear-array of fine-mesh photomultiplier tube has produced a clear single-photon peak in its pulse-height distribution under a strong magnetic field of B{<=}1 T, and provided {sigma}{sub TTS}=100 ps of transit time spread (TTS) and 85% of photoelectron detection efficiency.

  14. 18F-FDG双探头符合显像与99mTc-MDP显像在探测恶性肿瘤骨转移中的应用%Clinical application of 18F-FDG dual-head coincidence imaging and 99mTc-MDP bone scan in detection of bone metastatic lesion

    Institute of Scientific and Technical Information of China (English)

    刘洪彪; 占宏伟; 尹丰; 孙达; 许唯; 叶小娟; 包承侃; 何刚强; 张宏

    2007-01-01

    目的 比较双探头带符合线路SPECT仪18F-脱氧葡萄糖(FDG)显像和99mTc-亚甲基二膦酸盐(MDP)显像对恶性肿瘤骨转移病灶的探测效果.方法 各种恶性肿瘤患者37例,分别行18F-FDG胸腹部显像和99mTc-MDP全身骨显像.比较脊柱、肋骨和骨盆等部位骨骼的病变情况.结果 18F-FDG显像和99mTc-MDP显像共发现骨骼病灶130处,其中18F-FDG显像共发现121处(93.1%),99mTc-MDP显像共发现120处(92.3%),两者共同发现114处(87.7%);仅18F-FDG显像发现而99mTc-MDP显像未发现有11处,仅99mTc-MDP显像发现而18F-FDG显像未发现有10处.37例患者中,两种方法共检出有骨转移者24例,其中18F-FDG显像发现23例,99mTc-MDP显像发现22例,18F-FDG显像和99mTc-MDP显像完全相符有15例,不符有9例.18F-FDG显像发现有远处转移者32例.结论 18F-FDG双探头符合显像与99mTc-MDP显像在探测恶性肿瘤骨转移病灶上具有相同的敏感性,但两者在某些病灶的探查上具有互补作用.

  15. Protein (Cyanobacteria): 338715 [PGDBj - Ortholog DB

    Lifescience Database Archive (English)

    Full Text Available protein PMT9312_1470 Prochlorococcus marinus str. MIT 9312 MINSLNFKLCLKNFLNAYQEFWIKATDFKGFTSRSDWWFVQLANLIISFLTIPIFLKTFGFNAYGIACIIPQIAIDIRRIRDFGKDWKWIFINLIPIFGWILWFIWLGFGTSGNGKNKFI ...

  16. Dicty_cDB: AFF679 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VIIPDLLLNAGGVTVSYFEWLKNLSHVRFGRLNKKWEESSKKLLLEFV ESTVNKKLSEAERSLIIHGADEIDIVRSGLEDTMQNACAETRKTANEKNTDYRSAALYNA IMKX*scx...PMT PRADQILLNRGHVIIPDLLLNAGGVTVSYFEWLKNLSHVRFGRLNKKWEESSKKLLLEFV ESTVNKKLSEAERSLIIHGADEIDIVRSGLEDTMQNACAETRK

  17. Protein (Cyanobacteria): 340172 [PGDBj - Ortholog DB

    Lifescience Database Archive (English)

    Full Text Available al protein PMT0535 Prochlorococcus marinus str. MIT 9313 MLLLLTLFIPYGFLEVEIASAGPVEWKEVPATEAGQQWWDIGSLHYDKDGNLSVLSRFTPALREGEKQQNGSLYLMHVDCDQKLFRDTSVNGLHRFRAEWKPSDGDELIDAVIDEVCTAEVT ...

  18. Virulence of the fungal pathogen Candida albicans requires the five isoforms of protein mannosyltransferases.

    Science.gov (United States)

    Rouabhia, Mahmoud; Schaller, Martin; Corbucci, Cristina; Vecchiarelli, Anna; Prill, Stephan K-H; Giasson, Luc; Ernst, Joachim F

    2005-08-01

    The PMT gene family in Candida albicans encodes five isoforms of protein mannosyltransferases (Pmt proteins Pmt1p, Pmt2p, Pmt4p, Pmt5p, and Pmt6p) that initiate O mannosylation of secretory proteins. We compared virulence characteristics of pmt mutants in two complex, three-dimensional models of localized candidiasis, using reconstituted human epithelium (RHE) and engineered human oral mucosa (EHOM); in addition, mutants were tested in a mouse model of hematogenously disseminated candidiasis (HDC). All pmt mutants showed attenuated virulence in the HDC model and at least one model of localized candidiasis. The pmt5 mutant, which lacks in vitro growth phenotypes, was less virulent in the EHOM and HDC assays but had no consistent phenotype in the RHE assay. In contrast, the pmt4 and pmt6 mutants were less virulent in the RHE and HDC assays but not in the EHOM assay. The results stress the contribution of all Pmt isoforms to the virulence of C. albicans and suggest that the importance of individual Pmt isoforms may differ in specific host niches. We propose that Pmt proteins may be suitable targets for future novel classes of antifungal agents.

  19. Study on Method of Motion Control for PRS-XY Type Hybrid Parallel Machine Tool (PMT)%PRS-XY型混联机床运动控制方法研究

    Institute of Scientific and Technical Information of China (English)

    牛志刚; 张建民

    2006-01-01

    为实现PRS-XY型混联机床的运动控制,建立了该机构的逆运动学模型,导出了虚轴和实轴位置变换的逆运动学公式.提出了"PC+Turbo PMAC"开放式数控系统构建模式,将逆运动学变换算法嵌入到Turbo PMAC中,并由Turbo PMAC完成粗插补运算,使运动过程不再依赖上位机,克服了上位机与Turbo PAMC的数据传输瓶颈,提高了控制系统的可靠性和实时性.

  20. Identificación y caracterización funcional de genes PMT relacionados con la glicosilación de proteínas en el hongo patógeno de frutos cítricos Penicillium digitatum

    OpenAIRE

    Harries, Eleonora

    2013-01-01

    En esta tesis se ha caracterizado el mecanismo de acción del péptido antifúngico PAF26 sobre S. cerevisiae como microorganismo modelo. Mediante microscopía confocal, se ha demostrado que PAF26 marcado fluorescentemente interactúa primero con las envueltas celulares, se internaliza en vacuolas y luego se libera al citoplasma coincidiendo con la muerte celular, de forma similar a lo observado en N. crassa. Se ha constatado que los dominios catiónicos e hidrofóbicos de PAF26 se requieren para su...

  1. Immune response to Candida albicans is preserved despite defect in O-mannosylation of secretory proteins.

    Science.gov (United States)

    Corbucci, Cristina; Cenci, Elio; Skrzypek, Franck; Gabrielli, Elena; Mosci, Paolo; Ernst, Joachim F; Bistoni, Francesco; Vecchiarelli, Anna

    2007-12-01

    The PMT gene family in Candida albicans encodes five isoforms of the protein mannosyltransferases that initiate O-mannosylation of secretory proteins. Mutations at the Pmt level have been associated with differences in pathogenicity, e.g. in contrast to pmt5/pmt5, pmt2/PMT2 mutants showed poor virulence. Our objective was to determine whether these differences were related to the capacity of pmt2/PMT2 and pmt5/pmt5 to (i) express differences in selected virulence factors, and (ii) stimulate the natural immune system. The results show that pmt mutants (i) form hyphae in serum, (ii) show defective production of proteases but not of phospholipases with respect to the parental strain, (iii) undergo mycelial transition in the kidneys of hematogenously infected animals, (iv) are phagocytosed and killed by macrophages similar to the parental strain, although neutrophils are unable to destroy pmt5/pmt5, (v) engage TLR4 and stimulate MyD88 leading to NF-kappaB activation, and (vi) stimulate cytokine production by macrophages. Collectively our findings suggest that the defect in protein O-mannosylation in C. albicans cause attenuation of the virulence although the antigenic factors that retain the capacity to stimulate an efficient immune response are preserved.

  2. GENERAL DIAGNOSIS

    Institute of Scientific and Technical Information of China (English)

    2006-01-01

    2006133 Value of 18F-FDG dual-head coincidence imaging in the diagnosis of recurrent and metastatic oesophageal carcinoma. ZHANG Chun (张春), et al. Dept Nucl Med,Beijing Chaoyang Hosp,Capital Med Sci Univ,Beijing 100020. Chin J Nucl Med 2006;26(1):34-36. Objective:To explore the value of 18 F-fluorodeoxyglu-cose (FDG) dual-head coinci dence imaging in the diagnosis of recurrent and metastatic oesophageal carcinoma.

  3. Low Power Photomultiplier Tube Circuit And Method Thereor

    Science.gov (United States)

    Bochenski, Edwin B.; Skinner, Jack L.; Dentinger, Paul M.; Lindblom, Scott C.

    2006-04-18

    An electrical circuit for a photomultiplier tube (PMT) is disclosed that reduces power consumption to a point where the PMT may be powered for extended periods with a battery. More specifically, the invention concerns a PMT circuit comprising a low leakage switch and a high voltage capacitor positioned between a resistive divider and each of the PMT dynodes, and a low power control scheme for recharging the capacitors.

  4. Knockdown of phosphoethanolamine transmethylation enzymes decreases viability of Haemonchus contortus.

    Science.gov (United States)

    Witola, William H; Cooks-Fagbodun, Sheritta; Ordonez, Adriana Reyes; Matthews, Kwame; Abugri, Daniel A; McHugh, Mark

    2016-06-15

    The phosphobase methylation pathway, in which phosphoethanolamine N-methyltransferases (PMTs) successively catalyze the methylation of phosphoethanolamine to phosphocholine, is essential in the free-living nematode Caenorhabditis elegans. Two PMT-encoding genes (HcPMT1 and HcPMT2) cloned from Haemonchus contortus have been shown, by in vitro assays, to possess enzymatic characteristics similar to those of C. elegans PMTs, but their physiological significance in H. contortus is yet to be elucidated. Therefore, in this study, we endeavored to determine the importance of HcPMT1 and HcPMT2 in the survival of H. contortus by adapting the use of phosphorodiamidate morpholino oligomers (PPMO) antisense approach to block the translation of HcPMT1 and HcPMT2 in the worms. We found that PPMOs targeting HcPMT1 and HcPMT2 down-regulated the expression of HcPMT1 and HcPMT2 proteins in adult H. contortus. Analysis of the effect of HcPMT1 and HcPMT2 knockdown showed that it significantly decreased worm motility and viability, thus validating HcPMT1 and HcPMT2 as essential enzymes for survival of H. contortus. Studies of gene function in H. contortus have been constrained by limited forward and reverse genetic technologies for use in H. contortus. Thus, our success in adaptation of use of PPMO antisense approach in H. contortus provides an important reverse genetic technological advance for studying this parasitic nematode of veterinary significance. Copyright © 2016 Elsevier B.V. All rights reserved.

  5. Crystal structure of phosphoethanolamine methyltransferase from Plasmodium falciparum in complex with amodiaquine

    Energy Technology Data Exchange (ETDEWEB)

    Lee, Soon Goo; Alpert, Tara D.; Jez, Joseph M. (WU)

    2012-07-17

    Phosphoethanolamine N-methyltransferase (PMT) is essential for phospholipid biogenesis in the malarial parasite Plasmodium falciparum. PfPMT catalyzes the triple methylation of phosphoethanolamine to produce phosphocholine, which is then used for phosphatidylcholine synthesis. Here we describe the 2.0 {angstrom} resolution X-ray crystal structure of PfPMT in complex with amodiaquine. To better characterize inhibition of PfPMT by amodiaquine, we determined the IC{sub 50} values of a series of aminoquinolines using a direct radiochemical assay. Both structural and functional analyses provide a possible approach for the development of new small molecule inhibitors of PfPMT.

  6. Health Risk Perceptions and Exercise in Older Adulthood: An Application of Protection Motivation Theory.

    Science.gov (United States)

    Ruthig, Joelle C

    2016-09-01

    Protection Motivation Theory (PMT) was applied to explore the relationship between perceived risk of acute health crises and intent to exercise. Interviews of 351 community-living older adults assessed prior physical activity (PPA), all PMT components, and exercise intent. A multi-group structural equation model revealed gender differences in PMT predictors of exercise intent. PPA, age, self-efficacy, and response efficacy directly predicted men's intent. Women's PPA and age predicted PMT components of self-efficacy and response costs, which predicted intent. Findings have implications for devising interventions to enhance physical activity in later life by targeting different PMT components for older men and women.

  7. Micellization Behavior of an Amphiphilic Drug Promethazine Hydrochloride-Surfactant System in an Aqueous Medium%水溶液中两亲药物盐酸异丙嗪,表面活性剂体系的胶束化行为

    Institute of Scientific and Technical Information of China (English)

    KABIR-UD-DIN; KHAN Abbul Bashar; NAQVI Andleeb Z.

    2011-01-01

    The behavior of the mixed amphiphilic drug promethazine hydrochloride (PMT) and cationic as well as nonionic surfactants was studied by tensiometry.The cmc values of the PMT-surfactant systems decrease at a surfactant mole fraction of 0.1 and it then becomes constant.The critical micelle concentration (cmc) values are lower than the ideal cmc (cmc*) values for PMT/TX-100,PMT/TX-114,PMT/Tween 20,and PMT/Tween 60 systems.For the PMT/Tween 40,PMT/Tween 80,PMT/CPC,andPMT/CPB systems the cmc values are close to the cmc* values.This indicates that PMT forms mixed micelles with these surfactants by attractive interactions.The surface excess (Γmax) decreases in the presence of surfactants.The rigid structure of the drug makes adsorption easier and the contribution of the surfactant at the interface decreases.The interaction parametersβm (for the mixed micelles) andβ°(for the mixed monolayer) are negative indicating attraction among the mixed components.

  8. Characterization of the Pichia pastoris protein-O-mannosyltransferase gene family.

    Directory of Open Access Journals (Sweden)

    Juergen H Nett

    Full Text Available The methylotrophic yeast, Pichiapastoris, is an important organism used for the production of therapeutic proteins. However, the presence of fungal-like glycans, either N-linked or O-linked, can elicit an immune response or enable the expressed protein to bind to mannose receptors, thus reducing their efficacy. Previously we have reported the elimination of β-linked glycans in this organism. In the current report we have focused on reducing the O-linked mannose content of proteins produced in P. pastoris, thereby reducing the potential to bind to mannose receptors. The initial step in the synthesis of O-linked glycans in P. pastoris is the transfer of mannose from dolichol-phosphomannose to a target protein in the yeast secretory pathway by members of the protein-O-mannosyltransferase (PMT family. In this report we identify and characterize the members of the P. pastoris PMT family. Like Candida albicans, P. pastoris has five PMT genes. Based on sequence homology, these PMTs can be grouped into three sub-families, with both PMT1 and PMT2 sub-families possessing two members each (PMT1 and PMT5, and PMT2 and PMT6, respectively. The remaining sub-family, PMT4, has only one member (PMT4. Through gene knockouts we show that PMT1 and PMT2 each play a significant role in O-glycosylation. Both, by gene knockouts and the use of Pmt inhibitors we were able to significantly reduce not only the degree of O-mannosylation, but also the chain-length of these glycans. Taken together, this reduction of O-glycosylation represents an important step forward in developing the P. pastoris platform as a suitable system for the production of therapeutic glycoproteins.

  9. Selective Membrane Redistribution and Depletion of Gαq-Protein by Pasteurella multocida Toxin.

    Science.gov (United States)

    Clemons, Nathan C; Luo, Shuhong; Ho, Mengfei; Wilson, Brenda A

    2016-01-01

    Pasteurella multocida toxin (PMT), the major virulence factor responsible for zoonotic atrophic rhinitis, is a protein deamidase that activates the alpha subunit of heterotrimeric G proteins. Initial activation of G alpha-q-coupled phospholipase C-beta-1 signaling by PMT is followed by uncoupling of G alpha-q-dependent signaling, causing downregulation of downstream calcium and mitogenic signaling pathways. Here, we show that PMT decreases endogenous and exogenously expressed G alpha-q protein content in host cell plasma membranes and in detergent resistant membrane (DRM) fractions. This membrane depletion of G alpha-q protein was dependent upon the catalytic activity of PMT. Results indicate that PMT-modified G alpha-q redistributes within the host cell membrane from the DRM fraction into the soluble membrane and cytosolic fractions. In contrast, PMT had no affect on G alpha-s or G beta protein levels, which are not substrate targets of PMT. PMT also had no affect on G alpha-11 levels, even though G alpha-11 can serve as a substrate for deamidation by PMT, suggesting that membrane depletion of PMT-modified G-alpha-q has specificity.

  10. Pulsed-source time-resolved phosphorimetry: comparison of a commercial gated photomultiplier with a specially wired ungated photomultiplier.

    Science.gov (United States)

    Persvik, Øyvind; Melø, Thor Bernt; Naqvi, K Razi

    2013-06-01

    A common problem encountered in recording delayed light emission is that the signal of interest is preceded by a much more intense signal arising from prompt fluorescence. When a photomultiplier tube (PMT) is used as the photosensor in a pulsed-source phosphorimeter, two options are open to an experimenter who finds mechanical shutters inconvenient or impracticable and photon counting inappropriate: apply an electronic gate that suppresses the PMT gain for a brief period, or use a wiring scheme that enables the PMT to quickly regain normal operation after an intense burst of prompt emission. The performance of a squirrel-cage PMT that operates in the latter mode is compared with a new gateable PMT (Hamamatsu H11526 series) with a minimum gate time of 100 ns. The two detectors are found to provide practically the same temporal record of the delayed emission, but the ungated PMT is slightly superior in terms of recovery time and signal-to-noise ratio.

  11. PET-based dose delivery verification in proton therapy: a GATE based simulation study of five PET system designs in clinical conditions

    Science.gov (United States)

    Robert, Charlotte; Fourrier, Nicolas; Sarrut, David; Stute, Simon; Gueth, Pierre; Grevillot, Loïc; Buvat, Irène

    2013-10-01

    PET is a promising technique for in vivo treatment verification in hadrontherapy. Three main PET geometries dedicated to in-beam treatment monitoring have been proposed in the literature: the dual-head PET geometry, the OpenPET geometry and the slanted-closed ring geometry. The aim of this work is to characterize the performance of two of these dedicated PET detectors in realistic clinical conditions. Several configurations of the dual-head PET and OpenPET systems were simulated using GATE v6.2. For the dual-head configuration, two aperture angles (15° and 45°) were studied. For the OpenPET system, two gaps between rings were investigated (110 and 160 mm). A full-ring PET system was also simulated as a reference. After preliminary evaluation of the sensitivity and spatial resolution using a Derenzo phantom, a real small-field head and neck treatment plan was simulated, with and without introducing patient displacements. No wash-out was taken into account. 3D maps of the annihilation photon locations were deduced from the PET data acquired right after the treatment session (5 min acquisition) using a dedicated OS-EM reconstruction algorithm. Detection sensitivity at the center of the field-of-view (FOV) varied from 5.2% (45° dual-head system) to 7.0% (full-ring PET). The dual-head systems had a more uniform efficiency within the FOV than the OpenPET systems. The spatial resolution strongly depended on the location within the FOV for the ϕ = 45° dual-head system and for the two OpenPET systems. All investigated architectures identified the magnitude of mispositioning introduced in the simulations within a 1.5 mm accuracy. The variability on the estimated mispositionings was less than 2 mm for all PET systems.

  12. Feasibility of Nuclear Power on U.S. Military Installations. 2nd Revision

    Science.gov (United States)

    2011-03-01

    2018 2019 2020 Ma nut. & Constr . ($3.38) ($6.77) ($6.77) Year Bal- ance Pmt Inter- est Balance pmt Inter- est Balance pmt Inter- est Total...2018 2019 2020 Manuf. & Constr . 2042 $17.17 ($3.38) $0.86 $39.15 ($6.77) $1.96 $43.73 2043 $14.65 ($3.38) $0.73 $34.34 ($6.77) $1.72 $39.15 2044

  13. Identification of O-mannosylated virulence factors in Ustilago maydis.

    Directory of Open Access Journals (Sweden)

    Alfonso Fernández-Álvarez

    Full Text Available The O-mannosyltransferase Pmt4 has emerged as crucial for fungal virulence in the animal pathogens Candida albicans or Cryptococcus neoformans as well as in the phytopathogenic fungus Ustilago maydis. Pmt4 O-mannosylates specific target proteins at the Endoplasmic Reticulum. Therefore a deficient O-mannosylation of these target proteins must be responsible for the loss of pathogenicity in pmt4 mutants. Taking advantage of the characteristics described for Pmt4 substrates in Saccharomyces cerevisiae, we performed a proteome-wide bioinformatic approach to identify putative Pmt4 targets in the corn smut fungus U. maydis and validated Pmt4-mediated glycosylation of candidate proteins by electrophoretic mobility shift assays. We found that the signalling mucin Msb2, which regulates appressorium differentiation upstream of the pathogenicity-related MAP kinase cascade, is O-mannosylated by Pmt4. The epistatic relationship of pmt4 and msb2 showed that both are likely to act in the same pathway. Furthermore, constitutive activation of the MAP kinase cascade restored appressorium development in pmt4 mutants, suggesting that during the initial phase of infection the failure to O-mannosylate Msb2 is responsible for the virulence defect of pmt4 mutants. On the other hand we demonstrate that during later stages of pathogenic development Pmt4 affects virulence independently of Msb2, probably by modifying secreted effector proteins. Pit1, a protein required for fungal spreading inside the infected leaf, was also identified as a Pmt4 target. Thus, O-mannosylation of different target proteins affects various stages of pathogenic development in U. maydis.

  14. Studies of MaPMTs with beetle-chip read-out

    CERN Document Server

    Muheim, F

    2005-01-01

    We have evaluated the 64-channel Multianode Photo-Multiplier (MaPMT) with 8-stage dynodes for the LHCb RICH detectors. With a Beetle1.2 chip to read-out the MaPMT, we have demonstrated that the MaPMT performance is as expected using particle beams and LED light sources. We have also measured the pulse shape from 12-stage dynode MaPMTs, read out with the Beetle1.2-MA0 chip.

  15. Studies of MaPMTs with beetle-chip read-out

    CERN Document Server

    Muheim, F

    2005-01-01

    We have evaluated the 64-channel Multianode Photo-Multiplier (MaPMT) with 8-stage dynodes for the LHCb RICH detectors. With a Beetle 1.2 chip to read-out the MaPMT, we have demonstrated that the MaPMT performance is as expected using particle beams and LED light sources. We have also measured the pulse shape from 12-stage dynode MaPMTs, read out with the Beetle 1.2-MA0 chip.

  16. Studies on the interaction between promethazine and human serum albumin in the presence of flavonoids by spectroscopic and molecular modeling techniques.

    Science.gov (United States)

    He, Ling-Ling; Wang, Zhi-Xin; Wang, Yong-Xia; Liu, Xian-Ping; Yang, Yan-Jie; Gao, Yan-Ping; Wang, Xin; Liu, Bin; Wang, Xin

    2016-09-01

    Fluorescence, absorption, time-correlated single photon counting (TCSPC), and circular dichroism (CD) spectroscopic techniques as well as molecular modeling methods were used to study the binding characterization of promethazine (PMT) to human serum albumin (HSA) and the influence of flavonoids, rutin and baicalin, on their affinity. The results indicated that the fluorescence quenching mechanism of HSA by PMT is a static quenching due to the formation of complex. The reaction was spontaneous and mainly mediated by hydrogen bonds and hydrophobic interactions. The binding distance between the tryptophan residue of HSA and PMT is less than 8nm, which indicated that the energy transfer from the tryptophan residue of HSA to PMT occurred. The binding site of PMT on HSA was located in sites I and the presence of PMT can cause the conformational changes of HSA. There was the competitive binding to HSA between PMT and flavonoids because of the overlap of binding sites in HSA. The flavonoids could decrease the association constant and increase the binding distance. In addition, their synergistic effect can further change the conformation of HSA. The decrease in the affinities of PMT binding to HSA in the presence of flavonoids may lead to the increase of free drug in blood, which would affect the transportation or disposition of drug and evoke an adverse or toxic effect. Hence, rationalising dosage and diet regimens should be taken into account in clinical application of PMT.

  17. Design of Multi-unit Control System of High Voltage Power Supply for LASCAR Scintillator Detector Array

    Institute of Scientific and Technical Information of China (English)

    WuLijie; WangJinchuan; XiaoGuoqing; GuoZhongyan; ZhanWenlong; QiHuirong; XuZhiguo; ZhangLi; DingXianli; XuHushan; SunZhiyu; LiJiaxing; LiChen; WangMeng; ChenLixin; HuZhengguo; MaoRuishi; ZhaoTiecheng

    2003-01-01

    The power voltages of Photomultipliers (PMTs) at RIBLL LASCAR scintillator detector array are distributed between 900 V and 1 800 V irregularly. 392 CC123 modules are employed to supply high voltage for the PMT array. The CC123 module serves as PMT interface groupware package, and it can transform +12 V DC input voltage to ranges of 0~-2200 V for the PMT power supply corresponding to 0~+5 V output voltage from the control board crate. The relation of PMT power supply with the output voltage of the control crate is shown in Fig.1.

  18. Absolute optical responsivity down to the photon counting level with a photomultiplier tube

    Science.gov (United States)

    Tanabe, M.; Niwa, K.; Kinoshita, K.

    2017-04-01

    A novel method is presented for evaluation of the absolute optical responsivity of a photomultiplier tube (PMT) at optical powers down to the photon counting level under visible light. This method is based on a combination of the calibrated responsivity and nonlinearity corrections using a silicon photodiode and a PMT. The evaluation results with the PMT enable accurate determination of the absolute optical responsivity over a wide power range of 10-11 W to 10-16 W under visible light. This method provides validation of both the photon counting efficiency of a PMT and of accurate optical measurement with attenuators at the photon counting level.

  19. Analysis of hepatitis B vaccination behavior and vaccination willingness among migrant workers from rural China based on protection motivation theory

    National Research Council Canada - National Science Library

    Liu, Rugang; Li, Youwei; Wangen, Knut R; Maitland, Elizabeth; Nicholas, Stephen; Wang, Jian

    2016-01-01

    ...: Using protection motivation theory (PMT), we developed and measured HB cognitive variables and analyze the factors affecting HB vaccination behavior and willingness to vaccinate by migrant workers...

  20. Modification of heterotrimeric G-proteins in Swiss 3T3 cells stimulated with Pasteurella multocida toxin.

    Directory of Open Access Journals (Sweden)

    Rebecca C Babb

    Full Text Available Many bacterial toxins covalently modify components of eukaryotic signalling pathways in a highly specific manner, and can be used as powerful tools to decipher the function of their molecular target(s. The Pasteurella multocida toxin (PMT mediates its cellular effects through the activation of members of three of the four heterotrimeric G-protein families, G(q, G(12 and G(i. PMT has been shown by others to lead to the deamidation of recombinant Gα(i at Gln-205 to inhibit its intrinsic GTPase activity. We have investigated modification of native Gα subunits mediated by PMT in Swiss 3T3 cells using 2-D gel electrophoresis and antibody detection. An acidic change in the isoelectric point was observed for the Gα subunit of the G(q and G(i families following PMT treatment of Swiss 3T3 cells, which is consistent with the deamidation of these Gα subunits. Surprisingly, PMT also induced a similar modification of Gα(11, a member of the G(q family of G-proteins that is not activated by PMT. Furthermore, an alkaline change in the isoelectric point of Gα(13 was observed following PMT treatment of cells, suggesting differential modification of this Gα subunit by PMT. G(s was not affected by PMT treatment. Prolonged treatment with PMT led to a reduction in membrane-associated Gα(i, but not Gα(q. We also show that PMT inhibits the GTPase activity of G(q.

  1. Analytical Study of the Effect of the System Geometry on Photon Sensitivity and Depth of Interaction of Positron Emission Mammography

    Directory of Open Access Journals (Sweden)

    Pablo Aguiar

    2012-01-01

    Full Text Available Positron emission mammography (PEM cameras are novel-dedicated PET systems optimized to image the breast. For these cameras it is essential to achieve an optimum trade-off between sensitivity and spatial resolution and therefore the main challenge for the novel cameras is to improve the sensitivity without degrading the spatial resolution. We carry out an analytical study of the effect of the different detector geometries on the photon sensitivity and the angle of incidence of the detected photons which is related to the DOI effect and therefore to the intrinsic spatial resolution. To this end, dual head detectors were compared to box and different polygon-detector configurations. Our results showed that higher sensitivity and uniformity were found for box and polygon-detector configurations compared to dual-head cameras. Thus, the optimal configuration in terms of sensitivity is a PEM scanner based on a polygon of twelve (dodecagon or more detectors. We have shown that this configuration is clearly superior to dual-head detectors and slightly higher than box, octagon, and hexagon detectors. Nevertheless, DOI effects are increased for this configuration compared to dual head and box scanners and therefore an accurate compensation for this effect is required.

  2. An ultrahigh resolution SPECT system for I-125 mouse brain imaging studies

    Energy Technology Data Exchange (ETDEWEB)

    Meng, L.J. [Department of Nuclear, Plasma and Radiological Engineering, University of Illinois, Urbana-Champaign (United States)], E-mail: ljmeng@umich.edu; Fu, G. [Department of Nuclear, Plasma and Radiological Engineering, University of Illinois, Urbana-Champaign (United States); Roy, E.J.; Suppe, B. [Department of Pathology, University of Illinois, Urbana-Champaign (United States); Chen, C.T. [Department of Radiology, University of Chicago (United States)

    2009-03-01

    This paper presents some initial experimental results obtained with a dual-head prototype single photon emission microscope system (SPEM) that is dedicated to mouse brain studies using I-125 labeled radiotracers. In particular, this system will be used for in vivo tacking of radiolabeled T cells in mouse brain. This system is based on the use of the intensified electron multiplying charge-coupled device (I-EMCCD) camera that offers the combination of an excellent intrinsic spatial resolution, a good signal-to-noise ratio, a large active area and a reasonable detection efficiency over an energy range between 27-140 keV. In this study, the dual-head SPEM system was evaluated using both resolution phantoms and a mouse with locally injected T cells labeled with I-125. It was demonstrated that for a relatively concentrated source object, the current dual-head SPEM system is capable of visualizing the tiny amount of radioactivity ({approx}12 nCi) carried by a very small number (<1000) of T cells. The current SPEM system design allows four or six camera heads to be installed in a stationary system configuration that offers a doubled or tripled sensitivity at a spatial resolution similar to that obtained with the dual-head system. This development would provide a powerful tool for in vivo and non-invasive tracking of radiolabeled T cells in mouse brain and potentially for other rodent brain imaging studies.

  3. An ultrahigh resolution SPECT system for I-125 mouse brain imaging studies

    Science.gov (United States)

    Meng, L. J.; Fu, G.; Roy, E. J.; Suppe, B.; Chen, C. T.

    2009-03-01

    This paper presents some initial experimental results obtained with a dual-head prototype single photon emission microscope system (SPEM) that is dedicated to mouse brain studies using I-125 labeled radiotracers. In particular, this system will be used for in vivo tacking of radiolabeled T cells in mouse brain. This system is based on the use of the intensified electron multiplying charge-coupled device (I-EMCCD) camera that offers the combination of an excellent intrinsic spatial resolution, a good signal-to-noise ratio, a large active area and a reasonable detection efficiency over an energy range between 27-140 keV. In this study, the dual-head SPEM system was evaluated using both resolution phantoms and a mouse with locally injected T cells labeled with I-125. It was demonstrated that for a relatively concentrated source object, the current dual-head SPEM system is capable of visualizing the tiny amount of radioactivity (˜12 nCi) carried by a very small number (<1000) of T cells. The current SPEM system design allows four or six camera heads to be installed in a stationary system configuration that offers a doubled or tripled sensitivity at a spatial resolution similar to that obtained with the dual-head system. This development would provide a powerful tool for in vivo and non-invasive tracking of radiolabeled T cells in mouse brain and potentially for other rodent brain imaging studies.

  4. The R&D of the 20 in. MCP-PMTs for JUNO

    Science.gov (United States)

    Chang, Yaping; Huang, Guorui; Heng, Yuekun; Li, Dong; Liu, Huilin; Liu, Shulin; Li, Weihua; Ning, Zhe; Qi, Ming; Qian, Sen; Sun, Jianning; Si, Shuguang; Tian, Jinshou; Wang, Xingchao; Wang, Xing; Wang, Yifang; Wei, Yonglin; Wang, Wenwen; Xia, Jingkai; Xin, Liwei; Zhao, Tianchi

    2016-07-01

    A new concept of large area photomultiplier based on MCPs was conceived for JUNO by the scientists in IHEP, and with the collaborative work of the MCP-PMT collaboration in China, 8 in. and 20 in. prototypes were produced. Test results show that this type of MCP-PMT can have good SPE performance as the traditional dynode type PMTs.

  5. Gclust Server: 142016 [Gclust Server

    Lifescience Database Archive (English)

    Full Text Available 142016 Pm2_PMT2112 Cluster Sequences - 82 possible Alanine racemase 1 1.00e-40 0.0 ...0.0 4.0 0.0 0.0 0.0 Show 142016 Cluster ID 142016 Sequence ID Pm2_PMT2112 Link to cluster sequences Cluster

  6. Rhetorical Dissent as an Adaptive Response to Classroom Problems: A Test of Protection Motivation Theory

    Science.gov (United States)

    Bolkan, San; Goodboy, Alan K.

    2016-01-01

    Protection motivation theory (PMT) explains people's adaptive behavior in response to personal threats. In this study, PMT was used to predict rhetorical dissent episodes related to 210 student reports of perceived classroom problems. In line with theoretical predictions, a moderated moderation analysis revealed that students were likely to voice…

  7. Application of the protection motivation theory in predicting cigarette smoking among adolescents in China.

    Science.gov (United States)

    Yan, Yaqiong; Jacques-Tiura, Angela J; Chen, Xinguang; Xie, Nianhua; Chen, Jing; Yang, Niannian; Gong, Jie; Macdonell, Karen Kolmodin

    2014-01-01

    Reducing tobacco use among adolescents in China represents a significant challenge for global tobacco control. Existing behavioral theories developed in the West - such as the Protection Motivation Theory (PMT) - may be useful tools to help tackle this challenge. We examined the relationships between PMT factors and self-reported cigarette smoking behavior and intention among a random sample of vocational high school students (N=553) in Wuhan, China. Tobacco-related perceptions were assessed using the PMT Scale for Adolescent Smoking. Among the total sample, 45% had initiated cigarette smoking, and 25% smoked in the past month. Among those who never smoked, 15% indicated being likely or very likely to smoke in a year. Multiple regression modeling analysis indicated the significance of the seven PMT constructs, the four PMT perceptions and the two PMT pathways in predicting intention to smoke and actual smoking behavior. Overall, perceived rewards of smoking, especially intrinsic rewards, were consistently positively related to smoking intentions and behavior, and self-efficacy to avoid smoking was negatively related to smoking. The current study suggests the utility of PMT for further research examining adolescent smoking. PMT-based smoking prevention and clinical smoking cessation intervention programs should focus more on adolescents' perceived rewards from smoking and perceived efficacy of not smoking to reduce their intention to and actual use of tobacco. © 2013.

  8. Meiosis and SUMO

    DEFF Research Database (Denmark)

    Holm, Lærke Rebekka

    to target proteins can be catalyzed by the SUMO E3 ligase Pli1. In this study we investigate the role of Pli1 and Pmt3 during meiotic differentiation and at repetitive DNA during mitotic growth. Target proteins for Pmt3 are many; however, Pli1 has a meiosis-specic function regulating meiotic recombination...

  9. Rhetorical Dissent as an Adaptive Response to Classroom Problems: A Test of Protection Motivation Theory

    Science.gov (United States)

    Bolkan, San; Goodboy, Alan K.

    2016-01-01

    Protection motivation theory (PMT) explains people's adaptive behavior in response to personal threats. In this study, PMT was used to predict rhetorical dissent episodes related to 210 student reports of perceived classroom problems. In line with theoretical predictions, a moderated moderation analysis revealed that students were likely to voice…

  10. Linearity of Air-Biased Coherent Detection for Terahertz Time-Domain Spectroscopy

    DEFF Research Database (Denmark)

    Wang, Tianwu; Iwaszczuk, Krzysztof; Wrisberg, Emil Astrup

    2016-01-01

    ), and linearity of detection have been characterized. Moreover, the performance of a photomultiplier tube (PMT) and an avalanche photodiode (APD) as photodetector in the ABCD have been compared. We have observed nonlinear behavior of PMT detector, which leads to artificial gain factor in TDS spectroscopy. The APD...

  11. Can Emotional Language Skills Be Taught during Parent Training for Conduct Problem Children?

    Science.gov (United States)

    Salmon, Karen; Dadds, Mark R.; Allen, Jennifer; Hawes, David J.

    2009-01-01

    To assess the effectiveness of providing training in elaborative, emotion rich reminiscing (emotional reminiscing, ER) as an adjunct to Parent Management Training (PMT) for parents of children (N = 38, M age = 56.9, SD = 15.8 months) with oppositional behaviors. "Control" parents received PMT and non-language adjunct intervention, child-directed…

  12. Training the Navy Preventive Medicine Technician

    Science.gov (United States)

    Janoski, Tom

    1977-01-01

    This article gives the history and purpose of the Navy Preventive Medicine Technician (PMT) School, overviews the program's goals, and summarizes the program of study. PMT students receive 26 weeks of intensive didactic and practical instruction in preventive medicine and environmental health. Graduates receive 421/2 semester hours of college…

  13. Meiosis and SUMO

    DEFF Research Database (Denmark)

    Holm, Lærke Rebekka

    to target proteins can be catalyzed by the SUMO E3 ligase Pli1. In this study we investigate the role of Pli1 and Pmt3 during meiotic differentiation and at repetitive DNA during mitotic growth. Target proteins for Pmt3 are many; however, Pli1 has a meiosis-specic function regulating meiotic recombination...

  14. The R&D of the 20 in. MCP–PMTs for JUNO

    Energy Technology Data Exchange (ETDEWEB)

    Chang, Yaping [Institute of High Energy Physics, Chinese Academy of Sciences, Beijing 100049 (China); State Key Laboratory of Particle Detection and Electronics, Beijing 100049 (China); University of Chinese Academy of Sciences, Beijing 100049 (China); Huang, Guorui [North Night Vision Tech. Ltd., Nanjing 211106 (China); Heng, Yuekun [Institute of High Energy Physics, Chinese Academy of Sciences, Beijing 100049 (China); State Key Laboratory of Particle Detection and Electronics, Beijing 100049 (China); Li, Dong [North Night Vision Tech. Ltd., Nanjing 211106 (China); Liu, Huilin [Xi’an Institute of Optics and Precision Mechanics, Chinese Academy of Sciences, Xi’an 710068 (China); Liu, Shulin [Institute of High Energy Physics, Chinese Academy of Sciences, Beijing 100049 (China); State Key Laboratory of Particle Detection and Electronics, Beijing 100049 (China); Li, Weihua [Xi’an Institute of Optics and Precision Mechanics, Chinese Academy of Sciences, Xi’an 710068 (China); Ning, Zhe [Institute of High Energy Physics, Chinese Academy of Sciences, Beijing 100049 (China); State Key Laboratory of Particle Detection and Electronics, Beijing 100049 (China); Qi, Ming [Department of Physics, Nanjing University, Nanjing 210093 (China); Qian, Sen, E-mail: qians@ihep.ac.cn [Institute of High Energy Physics, Chinese Academy of Sciences, Beijing 100049 (China); State Key Laboratory of Particle Detection and Electronics, Beijing 100049 (China); Sun, Jianning; Si, Shuguang [North Night Vision Tech. Ltd., Nanjing 211106 (China); Tian, Jinshou [Xi’an Institute of Optics and Precision Mechanics, Chinese Academy of Sciences, Xi’an 710068 (China); Wang, Xingchao [North Night Vision Tech. Ltd., Nanjing 211106 (China); and others

    2016-07-11

    A new concept of large area photomultiplier based on MCPs was conceived for JUNO by the scientists in IHEP, and with the collaborative work of the MCP–PMT collaboration in China, 8 in. and 20 in. prototypes were produced. Test results show that this type of MCP–PMT can have good SPE performance as the traditional dynode type PMTs.

  15. Comparing Music Literacy Performance with Memory Functioning.

    Science.gov (United States)

    Danley, William E., Jr.; Tanner, Don R.

    1982-01-01

    Describes the development of a memory assessment instrument, the Perceptual Memory Test (PMT), which allows the nonverbal evaluation of various memory modalities. Compares the PMT with the Iowa Test of Musical Literacy and concludes that memory in a general sense might be important in performance on a musical assessment device. (FL)

  16. Biochemical and genetic analysis of the phosphoethanolamine methyltransferase of the human malaria parasite Plasmodium falciparum.

    Science.gov (United States)

    Reynolds, Jennifer M; Takebe, Sachiko; Choi, Jae-Yeon; El Bissati, Kamal; Witola, William H; Bobenchik, April M; Hoch, Jeffrey C; Voelker, Dennis R; Mamoun, Choukri Ben

    2008-03-21

    The PfPMT enzyme of Plasmodium falciparum, the agent of severe human malaria, is a member of a large family of known and predicted phosphoethanolamine methyltransferases (PMTs) recently identified in plants, worms, and protozoa. Functional studies in P. falciparum revealed that PfPMT plays a critical role in the synthesis of phosphatidylcholine via a plant-like pathway involving serine decarboxylation and phosphoethanolamine methylation. Despite their important biological functions, PMT structures have not yet been solved, and nothing is known about which amino acids in these enzymes are critical for catalysis and binding to S-adenosyl-methionine and phosphoethanolamine substrates. Here we have performed a mutational analysis of PfPMT focused on 24 residues within and outside the predicted catalytic motif. The ability of PfPMT to complement the choline auxotrophy of a yeast mutant defective in phospholipid methylation enabled us to characterize the activity of the PfPMT mutants. Mutations in residues Asp-61, Gly-83 and Asp-128 dramatically altered PfPMT activity and its complementation of the yeast mutant. Our analyses identify the importance of these residues in PfPMT activity and set the stage for advanced structural understanding of this class of enzymes.

  17. Gclust Server: 22229 [Gclust Server

    Lifescience Database Archive (English)

    Full Text Available 22229 Pm4_PMT9312_1418 Cluster Sequences - 103 hypothetical protein 5 1.00e-35 0.0 ...0.0 20.0 0.0 0.0 0.0 Show 22229 Cluster ID 22229 Sequence ID Pm4_PMT9312_1418 Link to cluster sequences Clus

  18. A compact neutron-gamma spectrometer

    Science.gov (United States)

    Cester, D.; Nebbia, G.; Stevanato, L.; Pino, F.; Sajo-Bohus, L.; Viesti, G.

    2013-08-01

    A compact neutron/gamma detector has been developed using a liquid scintillator cell coupled to a Flat Panel PMT; performances have been compared with a second cell coupled to a traditional linearly-focused 12 dynodes PMT. Energy resolution and pulse shape discrimination (PSD) measured by using a fast digitizer are very similar for the two detectors with the time resolution of the Flat Panel PMT slightly worse. The new detector results to be weakly affected by the influence of a moderate magnetic field while the traditional PMT exhibits strong pulse reduction. The compact size and the low power consumption obtained by using the Flat Panel PMT are very useful in portable neutron/gamma spectrometers.

  19. Cathode Position Response of Large-Area Photomultipliers Under a Magnetic Field

    CERN Document Server

    Koblesky, T; Polly, C; Peng, J C

    2011-01-01

    With the increasingly common use of large area PMTs (photomultiplier tubes) for nuclear and particle physics experiments, information on the position dependent magnetic field effects across the PMT's photocathode is important to effectively analyze and understand data collected from PMTs. Using an automated two-dimensional scanner, we have measured the PMT response to an external magnetic field as a function of the cathode position impinged by a collimated light source. This study shows a clear dependence on the cathode position in both collection efficiency and gain of the PMT in the presence of a magnetic field. In particular, a pronounced valley in the collection efficiency is observed for certain locations of the cathode when the magnetic field is transverse to the PMT axis. The pattern of the position dependence is presented for several different magnitudes and orientations of the magnetic field relative to the PMT.

  20. Implosion chain reaction mitigation in underwater assemblies of photomultiplier tubes

    Energy Technology Data Exchange (ETDEWEB)

    Ling, Jiajie, E-mail: jjling@bnl.gov [Brookhaven National Laboratory, Upton, NY 11973 (United States); Bishai, Mary; Diwan, Milind; Dolph, Jeffrey; Kettell, Steve; Sexton, Kenneth; Sharma, Rahul; Simos, Nikolaos; Stewart, James [Brookhaven National Laboratory, Upton, NY 11973 (United States); Tanaka, Hidekazu [Brookhaven National Laboratory, Upton, NY 11973 (United States); Kamioka Observatory, Institute for Cosmic Ray Research, The University of Tokyo, 456 Higashi-Mozumi, Kamioka, Hida, Gifu 506-1205 (Japan); Viren, Brett [Brookhaven National Laboratory, Upton, NY 11973 (United States); Arnold, Douglas; Tabor, Philip; Turner, Stephen [Naval Undersea Warfare Center, Newport, RI 02841 (United States); Benson, Terry; Wahl, Daniel; Wendt, Christopher [University of Wisconsin-Madison, WI 53706 (United States); Hahn, Alan; Kaducak, Marc; Mantsch, Paul [Fermi National Accelerator Laboratory, Batavia, IL 60510 (United States); and others

    2013-11-21

    Since the accident with a cascade failure of photomultiplier tubes (PMTs) in the Super-Kamiokande experiment in 2001, the mechanical performance of large format semi-hemispherical PMTs has become a critical issue for large water Cherenkov detectors. The subject of this study is the survival of an assembled array of PMTs under significant hydrostatic pressure and subjected to shock waves caused by the failure of a single PMT. This paper details the results of the second stage of a R and D program focused on the design and testing of different PMT assemblies to mitigate the risk of a “chain-reaction” of PMT failures. The initial results show that our PMT assembly design can effectively reduce the magnitude of the shock wave. With the testing results in this paper and the hydrodynamic simulation calculation, we can further improve the design of PMT deployment to mitigate the risk of chain reactions caused by implosion induced shock waves.

  1. Identification of inhibitors of Plasmodium falciparum phosphoethanolamine methyltransferase using an enzyme-coupled transmethylation assay

    Directory of Open Access Journals (Sweden)

    Voelker Dennis R

    2010-01-01

    Full Text Available Abstract Background The phosphoethanolamine methyltransferase, PfPMT, of the human malaria parasite Plasmodium falciparum, a member of a newly identified family of phosphoethanolamine methyltransferases (PMT found solely in some protozoa, nematodes, frogs, and plants, is involved in the synthesis of the major membrane phospholipid, phosphatidylcholine. PMT enzymes catalyze a three-step S-adenosylmethionine-dependent methylation of the nitrogen atom of phosphoethanolamine to form phosphocholine. In P. falciparum, this activity is a limiting step in the pathway of synthesis of phosphatidylcholine from serine and plays an important role in the development, replication and survival of the parasite within human red blood cells. Results We have employed an enzyme-coupled methylation assay to screen for potential inhibitors of PfPMT. In addition to hexadecyltrimethylammonium, previously known to inhibit PfPMT, two compounds dodecyltrimethylammonium and amodiaquine were also found to inhibit PfPMT activity in vitro. Interestingly, PfPMT activity was not inhibited by the amodiaquine analog, chloroquine, or other aminoquinolines, amino alcohols, or histamine methyltransferase inhibitors. Using yeast as a surrogate system we found that unlike wild-type cells, yeast mutants that rely on PfPMT for survival were sensitive to amodiaquine, and their phosphatidylcholine biosynthesis was inhibited by this compound. Furthermore NMR titration studies to characterize the interaction between amoidaquine and PfPMT demonstrated a specific and concentration dependent binding of the compound to the enzyme. Conclusion The identification of amodiaquine as an inhibitor of PfPMT in vitro and in yeast, and the biophysical evidence for the specific interaction of the compound with the enzyme will set the stage for the development of analogs of this drug that specifically inhibit this enzyme and possibly other PMTs.

  2. Introduction of leadership training based on PM theory at a nuclear power plant. An analysis of leadership, morale and self-efficacy

    Energy Technology Data Exchange (ETDEWEB)

    Yoshida, Michio [Kumamoto Univ. (Japan). Dept. of Physics; Yoshiyama, Naohiro; Misumi, Emiko; Matsuda, Ryosuke; Misumi, Jyuji; Hiraki, Tadao; Sakurai, Yukihiro

    1997-09-01

    PM leadership training(PMT) course was introduced into three nuclear power plants for the purpose of accident prevention. PMT is a six-month training course consisting of three parts, i.e., lecture, PM survey, and participants` practice at their workplace. The major aim of PMT is to change participants` leadership behavior into PM-type that is the most desirable for group effectiveness. In this study, we examined the effects of PMT on participants` leadership, subordinates` morale and participants` self-efficacy. Participants were fifty-six supervisors working in operation or maintenance in each nuclear power plant. The supervisors have eight hundred forty five subordinates in all. The major results were as follows: (1) Not only participants` leadership Performance(P) and Maintenance(M) behavior was strengthened, but also their subordinates` morale increased during PMT`s 6-month course. (2) Strengthening both P and M behavior was the most effective in building up subordinates` morale, especially in teamwork, meeting satisfaction, and communication. (3) Participants` self-efficacy was related with the strength of their P behavior and subordinates` group morale. These results show that PMT course is effective in accident prevention in nuclear power plants. Finally, we discuss some future problems of the development of PMT in nuclear power plants. (author)

  3. Photomultiplier voltage setting: possible important source of variability in molecular equivalents of soluble fluorochrome (MESF) calculation?

    Science.gov (United States)

    Rigolin, G M; Lanza, F; Castoldi, G

    1995-08-01

    We evaluated the effect of flow cytometer photomultiplier (PMT) voltage setting on molecular equivalents of soluble fluorochrome (MESF) calculation by using two different quantitative microbead calibrating kits as calibrating standards and a third one as an unknown testing sample of stable intensity of fluorescence. Based on the analysis of residual values derived from linear regression and on the determinations of the resolution index, we demonstrated that, on a FACScan instrument, the window of photomultiplier setting for fluorescein isothiocyanate (FITC) fluorescence determinations is 590-670 V. However, the best region was in the range of 610-650 V. Within the 590-670 PMT voltage region, the evaluation of the same testing sample at different PMT voltages, at 590 V, gave MESF percentage differences of 15% and 13% on the two lower unknown standards of intensity compared to the values obtained at the nearby 630 V setting. In the analyzed PMT region, logarithmic amplifier response was globally maintained, whereas evaluation of the same unknown testing sample in both linear (Lin) and logarithmic (Log) amplification demonstrated (at the higher intensities of fluorescence) Log-Lin minimal differences within the 610-650 PMT voltage range. According to our data, it can be stated that PMT voltages between 610 and 650 provide the best instrument performances and that PMT setting may be proposed as a source of variability in MESF calculation that deserves a careful evaluation in quality-control trials.

  4. Putrescine N-methyltransferase--the start for alkaloids.

    Science.gov (United States)

    Biastoff, Stefan; Brandt, Wolfgang; Dräger, Birgit

    2009-01-01

    Putrescine N-methyltransferase (PMT) catalyses S-adenosylmethionine (SAM) dependent methylation of the diamine putrescine. The product N-methylputrescine is the first specific metabolite on the route to nicotine, tropane, and nortropane alkaloids. PMT cDNA sequences were cloned from tobacco species and other Solanaceae, also from nortropane-forming Convolvulaceae and enzyme proteins were synthesised in Escherichia coli. PMT activity was measured by HPLC separation of polyamine derivatives and by an enzyme-coupled colorimetric assay using S-adenosylhomocysteine. PMT cDNA sequences resemble those of plant spermidine synthases (putrescine aminopropyltransferases) and display little similarity to other plant methyltransferases. PMT is likely to have evolved from the ubiquitous enzyme spermidine synthase. PMT and spermidine synthase proteins share the same overall protein structure; they bind the same substrate putrescine and similar co-substrates, SAM and decarboxylated S-adenosylmethionine. The active sites of both proteins, however, were shaped differentially in the course of evolution. Phylogenetic analysis of both enzyme groups from plants revealed a deep bifurcation and confirmed an early descent of PMT from spermidine synthase in the course of angiosperm development.

  5. Evolution of the key alkaloid enzyme putrescine N-methyltransferase from spermidine synthase.

    Directory of Open Access Journals (Sweden)

    Anne eJunker

    2013-07-01

    Full Text Available Putrescine N-methyltransferases (PMTs are the first specific enzymes of the biosynthesis of nicotine and tropane alkaloids. PMTs transfer a methyl group onto the diamine putrescine from S-adenosyl-L-methionine (SAM as coenzyme. PMT proteins have presumably evolved from spermidine synthases (SPDSs, which are ubiquitous enzymes of polyamine metabolism. SPDS use decarboxylated SAM as coenzyme to transfer an aminopropyl group onto putrescine. In an attempt to identify possible and necessary steps in the evolution of PMT from SPDS, homology based modeling of Datura stramonium SPDS1 and PMT was employed to gain deeper insight in the preferred binding positions and conformations of the substrate and the alternative coenzymes. Based on predictions of amino acids responsible for the change of enzyme specificities, sites of mutagenesis were derived. PMT activity was generated in Datura stramonium SPDS1 after few amino acid exchanges. Concordantly, Arabidopsis thaliana SPDS1 was mutated and yielded enzymes with both, PMT and SPDS activities. Kinetic parameters were measured for enzymatic characterization. The switch from aminopropyl to methyl transfer depends on conformational changes of the methionine part of the coenzyme in the binding cavity of the enzyme. The rapid generation of PMT activity in SPDS proteins and the wide-spread occurrence of putative products of N-methylputrescine suggest that PMT activity is present frequently in the plant kingdom.

  6. Program Management Tool

    Science.gov (United States)

    Gawadiak, Yuri; Wong, Alan; Maluf, David; Bell, David; Gurram, Mohana; Tran, Khai Peter; Hsu, Jennifer; Yagi, Kenji; Patel, Hemil

    2007-01-01

    The Program Management Tool (PMT) is a comprehensive, Web-enabled business intelligence software tool for assisting program and project managers within NASA enterprises in gathering, comprehending, and disseminating information on the progress of their programs and projects. The PMT provides planning and management support for implementing NASA programmatic and project management processes and requirements. It provides an online environment for program and line management to develop, communicate, and manage their programs, projects, and tasks in a comprehensive tool suite. The information managed by use of the PMT can include monthly reports as well as data on goals, deliverables, milestones, business processes, personnel, task plans, monthly reports, and budgetary allocations. The PMT provides an intuitive and enhanced Web interface to automate the tedious process of gathering and sharing monthly progress reports, task plans, financial data, and other information on project resources based on technical, schedule, budget, and management criteria and merits. The PMT is consistent with the latest Web standards and software practices, including the use of Extensible Markup Language (XML) for exchanging data and the WebDAV (Web Distributed Authoring and Versioning) protocol for collaborative management of documents. The PMT provides graphical displays of resource allocations in the form of bar and pie charts using Microsoft Excel Visual Basic for Application (VBA) libraries. The PMT has an extensible architecture that enables integration of PMT with other strategic-information software systems, including, for example, the Erasmus reporting system, now part of the NASA Integrated Enterprise Management Program (IEMP) tool suite, at NASA Marshall Space Flight Center (MSFC). The PMT data architecture provides automated and extensive software interfaces and reports to various strategic information systems to eliminate duplicative human entries and minimize data integrity

  7. Signal-Induced Noise Effects in a Photon Counting System for Stratospheric Ozone Measurement

    Science.gov (United States)

    Harper, David B.; DeYoung, Russell J.

    1998-01-01

    Signal-induced noise (SIN) is a common effect resulting when a photomultiplier tube (PMT) is saturated, for a brief moment, with a high intensity light pulse. After the laser pulse is sent into the atmosphere a very large light return, from either the near-field or a cloud, causes the PMT to momentarily saturate. The PMT is gated off at this time so no signal is seen at the anode. When the PMT gate is turned on, the far-field light return from the atmosphere is observed. This signal is distorted, however because of the addition of SIN to the received light signal causing a slower than expected decay of the atmospheric signal return. We have characterized SIN responses to varying parameters of the incident light on the PMT. These varied parameters included incident wavelength, PMT voltage, incident intensity, and tube type. We found that only the amplitude of the SIN was effected by varying PMT voltages and light intensities. The amplitude increased linearly as input light intensity increased. Different incident wavelengths at the same intensity did not effect the amplitude or the temporal behavior of the SIN response. Finally, different PMT tubes with similar physical structures exhibited similar SIN responses although with different amplitudes. The different amplitudes can be attributed to the different gains and operating voltages of each tube. These results suggest that SIN is caused by photocathode electron dynamics such as charge accumulation on internal PMT surfaces. These surfaces then emit the electrons slowly resulting in a long decay noise signal. With the SIN responses characterized we can now try to develop a method to reduce or eliminate SIN in DIAL systems.

  8. Trigger Study for KM3Net-Italia

    CERN Document Server

    Bouhadef, B

    2014-01-01

    A new trigger for NEMO Phase 2 tower based on the time differences of the PMT hits has been studied. Such a trigger uses only a fixed number of PMT hits in a chosen time windows. The background trigger rate is drastically reduced requiring hits from different PMTs. A 87% trigger efficiency was estimated by Montecarlo simulation for muon tracks with at least 5 PMT hits. The trigger rate estimated by Montecarlo was also measured on raw data. The results from Montecarlo simulations and raw data are reported.

  9. Plastic-film mulching and urea types affect soil CO2 emissions and grain yield in spring maize on the Loess Plateau, China

    OpenAIRE

    Qiaofei Liu; Yu Chen; Weiwei Li; Yang Liu; Juan Han; Xiaoxia Wen; Yuncheng Liao

    2016-01-01

    A 2-year field experiment was conducted on maize (Zea mays L.) to explore effective ways to decrease soil CO2 emissions and increase grain yield. Treatments established were: (1) no mulching with urea, (2) no mulching with controlled release fertiliser (CRF), (3) transparent plastic-film mulching (PMt) with urea, (4) PMt with CRF, (5) black plastic-film mulching (PMb) with urea, and (6) PMb with CRF. During the early growth stages, soil CO2 emissions were noted as PMt > PMb > no mulching, and...

  10. Evaluation of candidate photomultiplier tubes for the NOE scintillating fiber calorimeter

    CERN Document Server

    Barbarino, G C; Brigida, M; Campana, D; Candela, A; Caruso, R; Ceres, A; De Mitri, I; Di Credico, A; Favuzzi, C; Fusco, P; Gargano, F; Giglietto, N; Giordano, F; Grillo, A; Guarino, F; Leone, A; Lindozzi, M; Loparco, F; Mancarella, G; Mazziotta, M N; Mongelli, M; Osteria, G; Palladino, V; Perchiazzi, M; Pinto, C; Rain; Rain; Sacchetti, A; Scapparone, E; Spinelli, P; Zilli, A

    2002-01-01

    Several measurements have been made on different phototubes in order to select the type to be used for the readout system of the NOE magnetized scintillating fiber calorimeter. Characteristics such as gain, linearity, time resolution and cathode uniformity have been examined on several PMT types with standard, fine mesh or channel multiplier structure. The PMT response in the presence of the magnetized calorimeter fringe fields has also been studied. Here we report on the results of these measurements and of the comparisons between the different PMT types.

  11. Linearity of Air-Biased Coherent Detection for Terahertz Time-Domain Spectroscopy

    Science.gov (United States)

    Wang, Tianwu; Iwaszczuk, Krzysztof; Wrisberg, Emil Astrup; Denning, Emil Vosmar; Jepsen, Peter Uhd

    2016-06-01

    The performance of air-biased coherent detection (ABCD) in a broadband two-color laser-induced air plasma system for terahertz time-domain spectroscopy (THz-TDS) has been investigated. Fundamental parameters of the ABCD detection, including signal-to-noise ratio (SNR), dynamic range (DR), and linearity of detection have been characterized. Moreover, the performance of a photomultiplier tube (PMT) and an avalanche photodiode (APD) as photodetector in the ABCD have been compared. We have observed nonlinear behavior of PMT detector, which leads to artificial gain factor in TDS spectroscopy. The APD turns out to have superior linearity and three times higher dynamic compared to the PMT.

  12. Evaluation of triggering schemes for KM3NeT

    Energy Technology Data Exchange (ETDEWEB)

    Seitz, T., E-mail: Thomas.Seitz@physik.uni-erlangen.de [Erlangen Centre for Astroparticle Physics, Erwin-Rommel-Str. 1, 91058 Erlangen (Germany); Herold, B., E-mail: Bjoern.Herold@physik.uni-erlangen.de [Erlangen Centre for Astroparticle Physics, Erwin-Rommel-Str. 1, 91058 Erlangen (Germany); Shanidze, R., E-mail: shanidze@physik.uni-erlangen.de [Erlangen Centre for Astroparticle Physics, Erwin-Rommel-Str. 1, 91058 Erlangen (Germany)

    2013-10-11

    The future neutrino telescope KM3NeT, to be built in the Mediterranean Sea, will be the largest of its kind. It will include nearly two hundred thousand photomultiplier tubes (PMT) mounted in multi-PMT digital optical modules (DOM). The dominant source of the PMT signals is decays of {sup 40}K and marine fauna bioluminescence. Selection of neutrino and muon events from this continuous optical background signals requires the implementation of fast and efficient triggers. Various schemes for the filtering of background data and the selection of neutrino and muon events were evaluated for the KM3NeT telescope using Monte Carlo simulations.

  13. Molecular breast imaging: First results from Italian-National-Institute-of-Health clinical trials

    Science.gov (United States)

    Cusanno, F.; Cisbani, E.; Colilli, S.; Fratoni, R.; Garibaldi, F.; Giuliani, F.; Gricia, M.; Lucentini, M.; Magliozzi, M. L.; Santanvenere, F.; Torrioli, S.; Cinti, M. N.; Pani, R.; Pellegrini, R.; Simonetti, G.; Schillaci, O.; Del Vecchio, S.; Salvatore, M.; Majewski, S.; De Vincentis, G.; Scopinaro, F.

    2007-02-01

    Dedicated high resolution detectors are needed for detection of small tumors by molecular imaging with radionuclides. Absorptive collimation are typically used for imaging single photon emitters, but it results in a strong reduction in efficiency. Systems based on electronic collimation offer higher efficiency but they are complex and expensive. In case of scintimammography, dual-head detectors increase sensitivity and cancel out the dependence of the lesion depth. In the system presented here, pixellated scintillator arrays (NaI:Tl) were coupled to arrays of PSPMT's, HPK H8500 Flat Panel. A dual-head detector having field of view of 100×100 mm 2 and 150×200 mm 2 were designed and built. The electronic system allows readout of all the anode pad signals. First clinical trials, performed in the framework of the Scintimammography project of Italian National Institute of Health and University of Tor Vergata in Rome, and University of Naples, are presented.

  14. Predictors of Iranian women's intention to first papanicolaou test practice: An application of protection motivation theory.

    Science.gov (United States)

    Dehdari, T; Hassani, L; Shojaeizadeh, D; Hajizadeh, E; Nedjat, S; Abedini, M

    2016-01-01

    Given the importance of papanicolaou (Pap) test in the early detection and timely treatment of cervical cancer, present study was designed to determine predictors of a sample of Iranian women's intention to first Pap test practice based on the protection motivation theory (PMT) variables. In this cross-sectional study, a total of 240 women referral to the 30 primary health care clinics were selected. They completed a developed scale based on PMT variables including intention, perceived vulnerability and severity, fear, response costs, response efficacy and self-efficacy. Path analysis was used to determine the association between predictive factors and intention. The results showed that PMT had goodness of fit with a χ2/df = 2.37, df = 28, P= 0.001 and RMSEA = 0.076. PMT explained 42% of the variance in women's intention to get first Pap smear test. Self-efficacy (b = 0.55, Ptheory-based educational interventions associated with Pap testing among women.

  15. 47 CFR 76.1909 - Redistribution control of unencrypted digital terrestrial broadcast content.

    Science.gov (United States)

    2010-10-01

    ... of the 8-VSB, 16-VSB, 64-QAM or 256-QAM signal, inspect either the EIT or PMT for the broadcast flag...; and (2) Use 8-VSB, 16-VSB, 64-QAM, or 256-QAM signal modulation for the retransmission. (d)...

  16. Protection motivation theory and physical activity in the general population: a systematic literature review.

    Science.gov (United States)

    Bui, Linh; Mullan, Barbara; McCaffery, Kirsten

    2013-01-01

    An appropriate theoretical framework may be useful for guiding the development of physical activity interventions. This review investigates the effectiveness of the protection motivation theory (PMT), a model based on the cognitive mediation processes of behavioral change, in the prediction and promotion of physical activity participation. A literature search was conducted using the databases MEDLINE, PsycINFO, PubMed, and Web of Science, and a manual search was conducted on relevant reference lists. Studies were included if they tested or applied the PMT, measured physical activity, and sampled from healthy populations. A total of 20 studies were reviewed, grouped into four design categories: prediction, stage discrimination, experimental manipulation, and intervention. The results indicated that the PMT's coping appraisal construct of self-efficacy generally appears to be the most effective in predicting and promoting physical activity participation. In conclusion, the PMT shows some promise, however, there are still substantial gaps in the evidence.

  17. Ocean Color Underwater Low Light Advanced Radiometer?Ocean Color at Night Project

    Data.gov (United States)

    National Aeronautics and Space Administration — The principal objective of the OCULLAR project is to pair a PMT with a SiP microradiometer where their overlapping sensitivities maximize the dynamic range at each...

  18. The Experiment and Design of Confocal Laser Scanner for Biochip

    Institute of Scientific and Technical Information of China (English)

    Guangzhao Zhang; Huijie Huang; Hao Ruan; Dan Chen; Bingqiang Ren

    2003-01-01

    In this article ,we chiefly discuss optical part and photoelectrical part, and analyze the result data to make out the relationship between pinhole and special resolution and the influence of PMT on the result data.

  19. Gclust Server: 61801 [Gclust Server

    Lifescience Database Archive (English)

    Full Text Available 61801 Pm2_PMT2041 Cluster Sequences - 192 possible Dockerin type I repeat 2 1.00e-9...ter Sequences Link to related sequences - Sequence length 192 Representative annotation possible Dockerin ty

  20. Step-index optical fibre drawn from 3D printed preforms

    CERN Document Server

    CooK, Kevin; Canning, John; Chartier, Loic; Athanaze, Tristan; Hossain, Md Arafat; Han, Chunyang; Comatti, Jade-Edouard; Luo, Yanhua; Peng, Gang-Ding

    2016-01-01

    Optical fibre is drawn from a dual-head 3D printer fabricated preform made of two optically transparent plastics with a high index core (NA ~ 0.25, V > 60). The asymmetry observed in the fibre arises from asymmetry in the 3D printing process. The highly multi-mode optical fibre has losses measured by cut-back as low as {\\alpha} ~ 0.44 dB/cm in the near IR.

  1. Branchburg Solar Farm and Carport

    Energy Technology Data Exchange (ETDEWEB)

    Gregory, John [Township of Branchburg, NJ (United States)

    2013-10-23

    To meet the goal of becoming a model of green, clean, and efficient consumer of energy, the Township of Branchburg will install of a 250kw solar farm to provide energy for the Township of Branchburg Municipal Building, a 50kw Solar carport to provide power to the Municipal Annex, purchase 3 plug in hybrid-electric vehicles, and install 3 dual-head charging stations.

  2. Characterization of photomultiplier tubes in a novel secondary ionization mode for Secondary Emission Ionization Calorimetry

    CERN Document Server

    Tiras, E; Ogul, H; Southwick, D; Bilki, B; Nachtman, J; Onel, Y

    2016-01-01

    Hamamatsu single anode R7761 and multi-anode R5900-00-M16 Photomultiplier Tubes have been characterized for use in Secondary Emission Ionization Calorimetry study, that is a novel techique to measure the electromagnetic shower particles in extreme radiation environment. There are different SE modes used in the tests, developed from conventional PMT mode. Here, the technical design of secondary emission modules and characterization measurements of both SE modes and the PMT mode are reported.

  3. Defining the role of phosphomethylethanolamine N-methyltransferase from Caenorhabditis elegans in phosphocholine biosynthesis by biochemical and kinetic analysis.

    Science.gov (United States)

    Palavalli, Lavanya H; Brendza, Katherine M; Haakenson, William; Cahoon, Rebecca E; McLaird, Merry; Hicks, Leslie M; McCarter, James P; Williams, D Jeremy; Hresko, Michelle C; Jez, Joseph M

    2006-05-16

    In plants and Plasmodium falciparum, the synthesis of phosphatidylcholine requires the conversion of phosphoethanolamine to phosphocholine by phosphoethanolamine methyltransferase (PEAMT). This pathway differs from the metabolic route of phosphatidylcholine synthesis used in mammals and, on the basis of bioinformatics, was postulated to function in the nematode Caenorhabditis elegans. Here we describe the cloning and biochemical characterization of a PEAMT from C. elegans (gene, pmt-2; protein, PMT-2). Although similar in size to the PEAMT from plants, which contain two tandem methyltransferase domains, PMT-2 retains only the C-terminal methyltransferase domain. RNA-mediated interference experiments in C. elegans show that PMT-2 is essential for worm viability and that choline supplementation rescues the RNAi-generated phenotype. Unlike the plant and Plasmodium PEAMT, which catalyze all three methylations in the pathway, PMT-2 catalyzes only the last two steps in the pathway, i.e., the methylation of phosphomonomethylethanolamine (P-MME) to phosphodimethylethanolamine (P-DME) and of P-DME to phosphocholine. Analysis of initial velocity patterns suggests a random sequential kinetic mechanism for PMT-2. Product inhibition by S-adenosylhomocysteine was competitive versus S-adenosylmethionine and noncompetitive versus P-DME, consistent with formation of a dead-end complex. Inhibition by phosphocholine was competitive versus each substrate. Fluorescence titrations show that all substrates and products bind to the free enzyme. The biochemical data are consistent with a random sequential kinetic mechanism for PMT-2. This work provides a kinetic basis for additional studies on the reaction mechanism of PEAMT. Our results indicate that nematodes also use the PEAMT pathway for phosphatidylcholine biosynthesis. If the essential role of PMT-2 in C. elegans is conserved in parasitic nematodes of mammals and plants, then inhibition of the PEAMT pathway may be a viable approach

  4. Suppressing ringing caused by large photomultiplier tube signals

    Institute of Scientific and Technical Information of China (English)

    JIANG Wen-Qi; GU Shu-Di; John Joseph; LIU Da-Wei; Kam-Biu Luk; Herbert Steiner; WANG Zheng; WU Qun

    2012-01-01

    We describe here the characteristic features of the ringing we observed following large PMT signalsin the Daya Bay reactor antineutrino experiment.We conclude that the ceramic capacitors used in the circuitryof the PMT bases and the HV-signal decouplers are the primary cause for this ringing.We present some possibleschemes to reduce the ringing when replacing these ceramic capacitors is not feasible.

  5. Why the time is right for a radical paradigm shift in early powered mobility: the role of powered mobility technology devices, policy and stakeholders.

    Science.gov (United States)

    Feldner, Heather A; Logan, Samuel W; Galloway, James C

    2015-09-04

    This article explores the changing landscape of early pediatric powered mobility. We specifically focus on key indicators that suggest pediatric powered mobility technology (PMT) practice for very young children is poised for a radical paradigm shift. This shift will challenge the current purview of PMT design and function, how it is obtained, and its introduction to children and their families. We propose that this positive, yet radical shift is essential in achieving a standard of practice in which PMT provides for early exploration and participation for children with disabilities at an age concomitant with their non-disabled peers, and within socially inclusive environments. To sustain this new standard, we must acknowledge the significant disconnect that currently exists between clinical research supporting the use of PMT with very young children, and barriers to widespread device access, effective user-driven design and positive social perception of PMT. In this article, we discuss three areas that are particularly important for both shift and sustained change: the history and current availability of novel and conventional PMT devices, pediatric PMT policies and the role of children and families as primary stakeholders in PMT practices. Within each area, we suggest barriers, facilitators and future directions. Implications for Rehabilitation The time is right for reframing how powered mobility technology for very young children is conceived, designed, and implemented. In order for multiple innovative devices to survive in the powered mobility industry, it is important to continue to show the benefits of early powered mobility use for both traditional and non-traditional users, and also enact and enforce policy that promotes sustainable access and financial support for powered mobility technology. The experiences of children and families and the realities of everyday use of powered mobility technology must be brought to the forefront of a movement toward user

  6. On the detector arrangement for in-beam PET for hadron therapy monitoring.

    Science.gov (United States)

    Crespo, Paulo; Shakirin, Georgy; Enghardt, Wolfgang

    2006-05-07

    In-beam positron emission tomography (in-beam PET) is currently the only method for an in situ monitoring of highly tumour-conformed charged hadron therapy. At the experimental carbon ion tumour therapy facility, running at the Gesellschaft für Schwerionenforschung, Darmstadt, Germany, all treatments have been monitored by means of a specially adapted dual-head PET scanner. The positive clinical impact of this project triggered the construction of a hospital-based hadron therapy facility, with in-beam PET expected to monitor more delicate radiotherapeutic situations. Therefore, we have studied possible in-beam PET improvements by optimizing the arrangement of the gamma-ray detectors. For this, a fully 3D, rebinning-free, maximum likelihood expectation maximization algorithm applicable to several closed-ring or dual-head tomographs has been developed. The analysis of beta(+)-activity distributions simulated from real-treatment situations and detected with several detector arrangements allows us to conclude that a dual-head tomograph with narrow gaps yields in-beam PET images with sufficient quality for monitoring head and neck treatments. For monitoring larger irradiation fields, e.g. treatments in the pelvis region, a closed-ring tomograph was seen to be highly desirable. Finally, a study of the space availability for patient and bed, tomograph and beam portal proves the implementation of a closed-ring detector arrangement for in-beam PET to be feasible.

  7. Lipoprotein N-acyl transferase (Lnt1) is dispensable for protein O-mannosylation by Streptomyces coelicolor.

    Science.gov (United States)

    Córdova-Dávalos, Laura Elena; Espitia, Clara; González-Cerón, Gabriela; Arreguín-Espinosa, Roberto; Soberón-Chávez, Gloria; Servín-González, Luis

    2014-01-01

    A protein glycosylation system related to that for protein mannosylation in yeast is present in many actinomycetes. This system involves polyprenyl phosphate mannose synthase (Ppm), protein mannosyl transferase (Pmt), and lipoprotein N-acyl transferase (Lnt). In this study, we obtained a series of mutants in the ppm (sco1423), lnt1 (sco1014), and pmt (sco3154) genes of Streptomyces coelicolor, which encode Ppm, Lnt1, and Pmt, to analyze their requirement for glycosylation of the heterologously expressed Apa glycoprotein of Mycobacterium tuberculosis. The results show that both Ppm and Pmt were required for Apa glycosylation, but that Lnt1 was dispensable for both Apa and the bacteriophage φC31 receptor glycosylation. A bacterial two-hybrid assay revealed that contrary to M. tuberculosis, Lnt1 of S. coelicolor does not interact with Ppm. The D2 catalytic domain of M. tuberculosisPpm was sufficient for complementation of an S. coelicolor double mutant lacking Lnt1 and Ppm, both for Apa glycosylation and for glycosylation of φC31 receptor. On the other hand, M. tuberculosisPmt was not active in S. coelicolor, even when correctly localized to the cytoplasmic membrane, showing fundamental differences in the requirements for Pmt activity in these two species.

  8. Exposure and response prevention with or without parent management training for children with obsessive-compulsive disorder complicated by disruptive behavior: a multiple-baseline across-responses design study.

    Science.gov (United States)

    Sukhodolsky, Denis G; Gorman, Bernard S; Scahill, Lawrence; Findley, Diane; McGuire, Joseph

    2013-04-01

    Comorbidity with disruptive behavior disorders may have important implications for exposure-based cognitive behavioral treatments of children with OCD. Child noncompliance and parent-child conflict may interfere with performance of exposure activities and completion of therapeutic homework assignments, thus diminishing response to treatment. We investigated whether response to exposure and response prevention (ERP) can be enhanced if disruptive behavior is treated first with parent management training (PMT). A multiple-baseline across-responses design was used to investigate the effects of ERP with or without PMT in six children (age range 9-14 years) with OCD and disruptive behavior. Weekly ratings of OCD were conducted for four weeks to establish baseline. After that, children were randomly assigned to receive six weekly sessions of PMT and then twelve weekly sessions of ERP (ERP-plus-PMT condition) or to receive ERP after a six week waiting period (ERP-only condition). The outcome assessments were conducted weekly using the Child Yale-Brown Obsessive Compulsive Scale (CY-BOCS) administered by an experienced clinician, who was blind to treatment assignment. Three subjects in the ERP-plus-PMT condition evidenced a 39 percent reduction in the CY-BOCS score versus a 10 percent reduction in three subjects in the ERP-only condition. The results of our single-subject study suggest the feasibility and positive effects of combining ERP with PMT for children with OCD complicated by disruptive behavior.

  9. Worldwide assessment of the Penman-Monteith temperature approach for the estimation of monthly reference evapotranspiration

    Science.gov (United States)

    Almorox, Javier; Senatore, Alfonso; Quej, Victor H.; Mendicino, Giuseppe

    2016-11-01

    When not all the meteorological data needed for estimating reference evapotranspiration ETo are available, a Penman-Monteith temperature (PMT) equation can be adopted using only measured maximum and minimum air temperature data. The performance of the PMT method is evaluated and compared with the Hargreaves-Samani (HS) equation using the measured long-term monthly data of the FAO global climatic dataset New LocClim. The objective is to evaluate the quality of the PMT method for different climates as represented by the Köppen classification calculated on a monthly time scale. Estimated PMT and HS values are compared with FAO-56 Penman-Monteith ETo values through several statistical performance indices. For the full dataset, the approximated PMT expressions using air temperature alone produce better results than the uncalibrated HS method, and the performance of the PMT method is even more improved adopting corrections depending on the climate class for the estimation of the solar radiation, especially in the tropical climate class.

  10. In vitro anthelmintic efficacy of inhibitors of phosphoethanolamine Methyltransferases in Haemonchus contortus.

    Science.gov (United States)

    Witola, William H; Matthews, Kwame; McHugh, Mark

    2016-04-01

    The essential phosphobase methylation pathway for synthesis of phosphocholine is unique to nematodes, protozoa and plants, and thus an attractive antiparasitic molecular target. Herein, we screened compounds from the National Cancer Institute (Developmental Therapeutics Program Open Chemical Repository) for specific inhibitory activity against Haemonchus contortus phosphoethanolamine methyltransferases (HcPMT1 and HcPMT2), and tested candidate compounds for anthelmintic activity against adult and third-stage larvae of H. contortus. We identified compound NSC-641296 with IC50 values of 8.3 ± 1.1 μM and 5.1 ± 1.8 μM for inhibition of the catalytic activity of HcPMT1 alone and HcPMT1/HcPMT2 combination, respectively. Additionally we identified compound NSC-668394 with inhibitory IC50 values of 5.9 ± 0.9 μM and 2.8 ± 0.6 μM for HcPMT1 alone and HcPMT1/HcPMT2 combination, respectively. Of the two compounds, NSC-641296 depicted significant anthelmintic activity against third-stage larvae (IC50 = 15 ± 2.9 μM) and adult stages (IC50 = 7 ± 2.9 μM) of H. contortus, with optimal effective in vitro concentrations being 2-fold and 4-fold, respectively, lower than its cytotoxic IC50 (29 ± 2.1 μM) in a mammalian cell line. Additionally, we identified two compounds, NSC-158011 and NSC-323241, with low inhibitory activity against the combined activity of HcPMT1 and HcPMT2, but both compounds did not show any anthelmintic activity against H. contortus. The identification of NSC-641296 that specifically inhibits a unique biosynthetic pathway in H. contortus and has anthelmintic activity against both larval and adult stages of H. contortus, provides impetus for the development of urgently needed new efficacious anthelmintics to address the prevailing problem of anthelmintic-resistant H. contortus.

  11. In vitro anthelmintic efficacy of inhibitors of phosphoethanolamine Methyltransferases in Haemonchus contortus

    Directory of Open Access Journals (Sweden)

    William H. Witola

    2016-04-01

    Full Text Available The essential phosphobase methylation pathway for synthesis of phosphocholine is unique to nematodes, protozoa and plants, and thus an attractive antiparasitic molecular target. Herein, we screened compounds from the National Cancer Institute (Developmental Therapeutics Program Open Chemical Repository for specific inhibitory activity against Haemonchus contortus phosphoethanolamine methyltransferases (HcPMT1 and HcPMT2, and tested candidate compounds for anthelmintic activity against adult and third-stage larvae of H. contortus. We identified compound NSC-641296 with IC50 values of 8.3 ± 1.1 μM and 5.1 ± 1.8 μM for inhibition of the catalytic activity of HcPMT1 alone and HcPMT1/HcPMT2 combination, respectively. Additionally we identified compound NSC-668394 with inhibitory IC50 values of 5.9 ± 0.9 μM and 2.8 ± 0.6 μM for HcPMT1 alone and HcPMT1/HcPMT2 combination, respectively. Of the two compounds, NSC-641296 depicted significant anthelmintic activity against third-stage larvae (IC50 = 15 ± 2.9 μM and adult stages (IC50 = 7 ± 2.9 μM of H. contortus, with optimal effective in vitro concentrations being 2-fold and 4-fold, respectively, lower than its cytotoxic IC50 (29 ± 2.1 μM in a mammalian cell line. Additionally, we identified two compounds, NSC-158011 and NSC-323241, with low inhibitory activity against the combined activity of HcPMT1 and HcPMT2, but both compounds did not show any anthelmintic activity against H. contortus. The identification of NSC-641296 that specifically inhibits a unique biosynthetic pathway in H. contortus and has anthelmintic activity against both larval and adult stages of H. contortus, provides impetus for the development of urgently needed new efficacious anthelmintics to address the prevailing problem of anthelmintic-resistant H. contortus.

  12. Monte Carlo simulation of simultaneous radiation detection in the hybrid tomography system ClearPET-XPAD3/CT

    Science.gov (United States)

    Dávila, H. Olaya; Sevilla, A. C.; Castro, H. F.; Martínez, S. A.

    2016-07-01

    Using the Geant4 based simulation framework SciFW1, a detailed simulation was performed for a detector array in the hybrid tomography prototype for small animals called ClearPET / XPAD, which was built in the Centre de Physique des Particules de Marseille. The detector system consists of an array of phoswich scintillation detectors: LSO (Lutetium Oxy-ortosilicate doped with cerium Lu2SiO5:Ce) and LuYAP (Lutetium Ortoaluminate of Yttrium doped with cerium Lu0.7Y0.3AlO3:Ce) for Positron Emission Tomography (PET) and hybrid pixel detector XPAD for Computed Tomography (CT). Simultaneous acquisition of deposited energy and the corresponding time - position for each recorded event were analyzed, independently, for both detectors. interference between detection modules for PET and CT. Information about amount of radiation reaching each phoswich crystal and XPAD detector using a phantom in order to study the effectiveness by radiation attenuation and influence the positioning of the radioactive source 22Na was obtained. The simulation proposed will improve distribution of detectors rings and interference values will be taken into account in the new versions of detectors.

  13. NEMA NU 4-2008 Comparison of Preclinical PET Imaging Systems

    Science.gov (United States)

    Goertzen, Andrew L.; Bao, Qinan; Bergeron, Mélanie; Blankemeyer, Eric; Blinder, Stephan; Cañadas, Mario; Chatziioannou, Arion F.; Dinelle, Katherine; Elhami, Esmat; Jans, Hans-Sonke; Lage, Eduardo; Lecomte, Roger; Sossi, Vesna; Surti, Suleman; Tai, Yuan-Chuan; Vaquero, Juan José; Vicente, Esther; Williams, Darin A.; Laforest, Richard

    2014-01-01

    The National Electrical Manufacturers Association (NEMA) standard NU 4-2008 for performance measurements of small-animal tomographs was recently published. Before this standard, there were no standard testing procedures for preclinical PET systems, and manufacturers could not provide clear specifications similar to those available for clinical systems under NEMA NU 2-1994 and 2-2001. Consequently, performance evaluation papers used methods that were modified ad hoc from the clinical PET NEMA standard, thus making comparisons between systems difficult. Methods We acquired NEMA NU 4-2008 performance data for a collection of commercial animal PET systems manufactured since 2000: micro- PET P4, microPET R4, microPET Focus 120, microPET Focus 220, Inveon, ClearPET, Mosaic HP, Argus (formerly eXplore Vista), VrPET, LabPET 8, and LabPET 12. The data included spatial resolution, counting-rate performance, scatter fraction, sensitivity, and image quality and were acquired using settings for routine PET. Results The data showed a steady improvement in system performance for newer systems as compared with first-generation systems, with notable improvements in spatial resolution and sensitivity. Conclusion Variation in system design makes direct comparisons between systems from different vendors difficult. When considering the results from NEMA testing, one must also consider the suitability of the PET system for the specific imaging task at hand. PMID:22699999

  14. WE-AB-BRB-03: Investigation of a Small Photomultiplier-Based Probe for Use in Beam Diagnostics and Medical Dosimetry

    Energy Technology Data Exchange (ETDEWEB)

    Bateman, F; Tosh, R [NIST, Gaithersburg, MD (United States)

    2015-06-15

    Purpose: Investigate the use of a small photomultiplier-based probe as a possible beam diagnostic and medical dosimetry tool. Methods: Cerenkov emission produced by clinical accelerator beams was detected by a small photomultiplier tube (PMT). Measurements of Clinac beams were made both in air and by inserting the PMT directly into a water phantom. A conical collimator placed in front of the PMT reduced the angular acceptance and the detection of scattered light. With this arrangement, we obtained response curves as a function of depth along the central axis similar in shape and magnitude to those obtained with ionization chambers. Subsequent measurements were made with the PMT covered in aluminum foil, obtaining a signal arising primarily from direct Cerenkov light produced in the glass entrance window. With an oscilloscope and amplifier/MCA system, we were able to monitor the response to individual beam pulses and observe variations in the beam pulse shape and magnitude as a function of dose rate. Results: Using Cerenkov signals detected by a PMT, we were able to obtain reasonable beam quality metrics, and the response was found to be linear over a range of dose rates. The fast response of the PMT allowed for the observation of small changes in the shape and magnitude of the beam pulse. With this system we were able to detect small changes in the dose per pulse delivered by the accelerator. Conclusion: A small PMT probe has shown promise as a beam diagnostic and medical dosimetry tool. Its fast response allows for real time beam pulse monitoring, and the integrated response can yield relative and perhaps even absolute dose information with a properly calibrated system. For accelerator diagnostics, monitoring of the beam pulse shape can aid in beam tuning, particularly in electron mode, where no target current pulse is available.

  15. Combined treatment of subacute and acute synthetic and venous bypass-graft occlusions with percutaneous mechanical thrombectomy and thrombolysis

    Energy Technology Data Exchange (ETDEWEB)

    Hundt, Walter, E-mail: hundt@med.uni-marburg.de [Department of Radiology, Philipps University Marburg (Germany); Kalinowski, Mark; Stamm, Anna C. [Department of Radiology, Philipps University Marburg (Germany); Portig, Irene [Department of Cardiology, Division of Angiology, Philipps University Marburg (Germany); Swaid, Zaher; Dietz, Carsten; Geks, Josef [Department of Surgery, Philipps University Marburg (Germany); Burbelko, Mykhaylo [Department of Radiology, Philipps University Marburg (Germany)

    2013-12-01

    Introduction: Percutaneous mechanical thrombectomy (PMT) is a third choice of treatment for acute arterial occlusions, in addition to thrombolysis and surgical thrombectomy. The aim of this retrospective study was to compare the combined treatment of PMT and local thrombolysis with thrombolysis therapy alone. Materials and methods: Sixty-nine patients with acute (<14 days [n = 35]) or subacute (14–42 days [n = 34]) femoropopliteal bypass occlusions were treated with PMT combined with thrombolysis. Seventy-two patients with acute [n = 40] or subacute [n = 32] femoropopliteal bypass occlusions were treated with thrombolysis alone. The thrombolysis in myocardial infarction (TIMI) classification was used to assess the bypass occlusion. Local thrombolysis time and dosage, reopening time, time in the intensive care unit, necessary surgical re-interventions, and clinical outcome were compared between the 2 groups. Results: The TIMI scores were significantly higher in the PMT plus thrombolysis group than in the thrombolysis group (acute occlusions 1188 versus 935, p < 0.001; subacute occlusions 935 versus 605, p < 0.001). The total urokinase dosage, the total hours of thrombolysis, time in the intensive care unit, and total hospital stay in the acute PMT plus thrombolysis group were significantly lesser than those in the thrombolysis group. After 24 h of treatment, the ankle-brachial index improved in all groups (p < 0.001): in the acute and subacute PMT plus thrombolysis group to 0.63 ± 0.14 and 0.43 ± 0.08, respectively; and in the acute and subacute thrombolysis group to 0.51 ± 0.11 and 0.41 ± 0.04, respectively. Conclusions: PMT combined with thrombolysis is a safe and very effective therapy for acute and subacute femoropopliteal bypass occlusions compared to treatment with thrombolysis alone.

  16. The protection motivation theory within the stages of the transtheoretical model - stage-specific interplay of variables and prediction of exercise stage transitions.

    Science.gov (United States)

    Lippke, Sonia; Plotnikoff, Ronald C

    2009-05-01

    Two different theories of health behaviour have been chosen with the aim of theory integration: a continuous theory (protection motivation theory, PMT) and a stage model (transtheoretical model, TTM). This is the first study to test whether the stages of the TTM moderate the interrelation of PMT-variables and the mediation of motivation, as well as PMT-variables' interactions in predicting stage transitions. Hypotheses were tested regarding (1) mean patterns, stage pair-comparisons and nonlinear trends using ANOVAs; (2) prediction-patterns for the different stage groups employing multi-group structural equation modelling (MSEM) and nested model analyses; and (3) stage transitions using binary logistic regression analyses. Adults (N=1,602) were assessed over a 6 month period on their physical activity stages, PMT-variables and subsequent behaviour. (1) Particular mean differences and nonlinear trends in all test variables were found. (2) The PMT adequately fitted the five stage groups. The MSEM revealed that covariances within threat appraisal and coping appraisal were invariant and all other constrains were stage-specific, i.e. stage was a moderator. Except for self-efficacy, motivation fully mediated the relationship between the social-cognitive variables and behaviour. (3) Predicting stage transitions with the PMT-variables underscored the importance of self-efficacy. Only when threat appraisal and coping appraisal were high, stage movement was more likely in the preparation stage. Results emphasize stage-specific differences of the PMT mechanisms, and hence, support the stage construct. The findings may guide further theory building and research integrating different theoretical approaches.

  17. Effect of peripheral and respiratory muscle training on the functional capacity of hemodialysis patients.

    Science.gov (United States)

    Pellizzaro, Cíntia O; Thomé, Fernando S; Veronese, Francisco V

    2013-01-01

    Patients on hemodialysis (HD) show changes in muscle structure and function reducing their functional capacity. This study was conduted to assess the effects of respiratory muscle training (RMT) and peripheral muscle training (PMT) during dialysis on functional parameters, inflammatory state, and quality of life (QoL) in patients on HD. Randomized controlled trial included 39 patients on HD, and they were divided into three groups: RMT (n = 11), PMT (n = 14), and controls (C, n = 14). Training was performed during the HD session for 10 weeks. Maximal inspiratory pressure (PI(max)), maximal expiratory pressure (PE(max)), forced vital capacity (FVC), six-minute walk test (6MWT), Kt/V(sp), biochemical parameters, and inflammatory state (i.e., level of high sensitivity C-reactive protein) were evaluated. Variation from baseline was calculated by Analysis of Covariance (ANCOVA). The ΔPI(max) was 22.5 ± 3.2, 9.1 ± 2.9, and -4.9 ± 2.8 cmH(2)O in the RMT, PMT and C, respectively (p RMT and PMT (65.5 ± 9; 30.8 ± 8 m) than in C (-0.5 ± 8.1 m), p RMT and PMT groups. There was a significant increase in QoL scores in the training groups (vs. C) in energy/fatigue (p = 0.002), sleep (p RMT or PMT during HD significantly improved functional capacity, with RMT showing greater effect than PMT. Muscle training improved biochemical and inflammatory markers, but a direct cause and effect relationship could not be established by this study.

  18. Structure and Reaction Mechanism of Phosphoethanolamine Methyltransferase from the Malaria Parasite Plasmodium falciparum

    Science.gov (United States)

    Lee, Soon Goo; Kim, Youngchang; Alpert, Tara D.; Nagata, Akina; Jez, Joseph M.

    2012-01-01

    In the malarial parasite Plasmodium falciparum, a multifunctional phosphoethanolamine methyltransferase (PfPMT) catalyzes the methylation of phosphoethanolamine (pEA) to phosphocholine for membrane biogenesis. This pathway is also found in plant and nematodes, but PMT from these organisms use multiple methyltransferase domains for the S-adenosylmethionine (AdoMet) reactions. Because PfPMT is essential for normal growth and survival of Plasmodium and is not found in humans, it is an antiparasitic target. Here we describe the 1.55 Å resolution crystal structure of PfPMT in complex with AdoMet by single-wavelength anomalous dispersion phasing. In addition, 1.19–1.52 Å resolution structures of PfPMT with pEA (substrate), phosphocholine (product), sinefungin (inhibitor), and both pEA and S-adenosylhomocysteine bound were determined. These structures suggest that domain rearrangements occur upon ligand binding and provide insight on active site architecture defining the AdoMet and phosphobase binding sites. Functional characterization of 27 site-directed mutants identifies critical active site residues and suggests that Tyr-19 and His-132 form a catalytic dyad. Kinetic analysis, isothermal titration calorimetry, and protein crystallography of the Y19F and H132A mutants suggest a reaction mechanism for the PMT. Not only are Tyr-19 and His-132 required for phosphobase methylation, but they also form a “catalytic” latch that locks ligands in the active site and orders the site for catalysis. This study provides the first insight on this antiparasitic target enzyme essential for survival of the malaria parasite; however, further studies of the multidomain PMT from plants and nematodes are needed to understand the evolutionary division of metabolic function in the phosphobase pathway of these organisms. PMID:22117061

  19. Structure and reaction mechanism of phosphoethanolamine methyltransferase from the malaria parasite Plasmodium falciparum: an antiparasitic drug target.

    Science.gov (United States)

    Lee, Soon Goo; Kim, Youngchang; Alpert, Tara D; Nagata, Akina; Jez, Joseph M

    2012-01-06

    In the malarial parasite Plasmodium falciparum, a multifunctional phosphoethanolamine methyltransferase (PfPMT) catalyzes the methylation of phosphoethanolamine (pEA) to phosphocholine for membrane biogenesis. This pathway is also found in plant and nematodes, but PMT from these organisms use multiple methyltransferase domains for the S-adenosylmethionine (AdoMet) reactions. Because PfPMT is essential for normal growth and survival of Plasmodium and is not found in humans, it is an antiparasitic target. Here we describe the 1.55 Å resolution crystal structure of PfPMT in complex with AdoMet by single-wavelength anomalous dispersion phasing. In addition, 1.19-1.52 Å resolution structures of PfPMT with pEA (substrate), phosphocholine (product), sinefungin (inhibitor), and both pEA and S-adenosylhomocysteine bound were determined. These structures suggest that domain rearrangements occur upon ligand binding and provide insight on active site architecture defining the AdoMet and phosphobase binding sites. Functional characterization of 27 site-directed mutants identifies critical active site residues and suggests that Tyr-19 and His-132 form a catalytic dyad. Kinetic analysis, isothermal titration calorimetry, and protein crystallography of the Y19F and H132A mutants suggest a reaction mechanism for the PMT. Not only are Tyr-19 and His-132 required for phosphobase methylation, but they also form a "catalytic" latch that locks ligands in the active site and orders the site for catalysis. This study provides the first insight on this antiparasitic target enzyme essential for survival of the malaria parasite; however, further studies of the multidomain PMT from plants and nematodes are needed to understand the evolutionary division of metabolic function in the phosphobase pathway of these organisms.

  20. A Preliminary Comparison of Laryngeal Manipulation and Postural Treatment on Voice Quality in a Prospective Randomized Crossover Study.

    Science.gov (United States)

    Kennard, Elliot J; Lieberman, Jacob; Saaid, Arjmand; Rolfe, Kerstin J

    2015-11-01

    This crossover study compared the effects of two osteopathic treatments specific laryngeal manipulation (SLM) and postural manual therapy (PMT) on voice quality and pitch. Twelve asymptomatic singers were measured acoustically immediately before and immediately after each intervention using a laryngograph. Fundamental frequency and the glottal closing quotient were used to determine any differences between groups before and after. Fundamental frequency showed a statistically significant change following both interventions (combined [P = 0.007] and PMT and SLM individually (P = 0.0143, P = 0.018, respectively). Although the benefit demonstrated using SLM was greater than that with PMT (2.4, 2.02, respectively), following Bonferroni correction there was no statistical significance demonstrated between the two groups. There was no statistically significant change with glottal closing time for any intervention or at any time (P = 0.52). This pilot study provides evidence of the benefit for both SLM and PMT in singers. A significant difference was found in the voice quality of the participants involved in both PMT and SLM. These results set the way for further larger scale studies to evaluate group interactions and potential benefits in symptomatic patients. Copyright © 2015 The Voice Foundation. Published by Elsevier Inc. All rights reserved.

  1. The ATLAS Tile Calorimeter experience with 10,000 readout photomultipliers operating since the start of the p-p collisions at LHC

    CERN Document Server

    Lazar, Hadar; The ATLAS collaboration

    2017-01-01

    The channels of TileCal, the hadron calorimeter of the Atlas experiment at the LHC, is readout with 8-stage fine-mesh PhotoMulTipliers (PMTs), a special version of the Hamamatsu model R5900. About 10000 PMTs are operating in TileCal. The PMT response stability allows to calibrate accurately the calorimeter and to achieve high performance of the energy reconstruction of the cells. Currently, no PMT replacement is foreseen before completion of the High Luminosity program of the LHC collider in the next decade. In this perspective, a number of measurements and tests are in progress to qualify the PMT robustness in terms of lifetime and response stability. Data from the Tile calibration procedure for the detector PMTs and from laboratory tests of spare PMTs are being analysed. Results on PMT failures, gain loss and quantum efficiency loss are presented. Analysis is focused on the study of the observed down-drift with time of the PMT response as a function of the integrated anode charge, and depending on the indiv...

  2. Laboratory tests of the response stability of the ATLAS Tile Calorimeter photomultipliers

    CERN Document Server

    Kazanin, Vassili; The ATLAS collaboration; Scuri, Fabrizio

    2017-01-01

    High performance of the ATLAS Tile Calorimeter response is achieved with a multi-stage calibration. One step of the calibration is based on measurements of the response to laser pulse excitation of the PMTs used to read out the calorimeter cells. A facility to study the PMT stability response is operating in the PISA-INFN laboratories since 2015. Goals of the tests are to study the time evolution of the PMT response as a function of the integrated anode charge and to compare test bench results with the observed response drifts of the Tile Calorimeter PMTs during LHC Run I and Run II. A new statistical approach was used to measure the drift of the absolute PMT gain. A new procedure which combines studies of the time evolution of the global PMT responses and of the individual PMT gains was adopted to derive the evolution of the cathode quantum efficiency. The experimental setup of the Pisa facility is described and the first results obtained by testing about 30 PMTs Hamamatsu model R7877 (a special evolution fo...

  3. Progress in characterization of the Photomultiplier Tubes for XENON1T Dark Matter Experiment

    CERN Document Server

    Lyashenko, Alexey

    2015-01-01

    We report on the progress in characterization of the Hamamatsu model R11410-21 Photomultiplier tubes (PMTs) for XENON1T dark matter experiment. The absolute quantum efficiency (QE) of the PMT was measured at low temperatures down to -110 $^0$C (a typical the PMT operation temperature in liquid xenon detectors) in a spectral range from 154.5 nm to 400 nm. At -110 $^0$C the absolute QE increased by 10-15\\% at 175 nm compared to that measured at room temperature. A new low power consumption, low radioactivity voltage divider for the PMTs is being developed. The measurement results showed that the PMT with the current version of the divider demonstrated a linear response (within 5\\%) down to 5$\\cdot$10$^4$ photoelectrons at a rate of 200 Hz. The radioactive contamination induced by the PMT and the PMT voltage divider materials satisfies the requirements for XENON1T detector not to exceed a total radioactive contamination in the detector of 0.5 evts/year/1tonn. Most of the PMTs received from the manufacturer showe...

  4. Plastic-film mulching and urea types affect soil CO2 emissions and grain yield in spring maize on the Loess Plateau, China.

    Science.gov (United States)

    Liu, Qiaofei; Chen, Yu; Li, Weiwei; Liu, Yang; Han, Juan; Wen, Xiaoxia; Liao, Yuncheng

    2016-01-01

    A 2-year field experiment was conducted on maize (Zea mays L.) to explore effective ways to decrease soil CO2 emissions and increase grain yield. Treatments established were: (1) no mulching with urea, (2) no mulching with controlled release fertiliser (CRF), (3) transparent plastic-film mulching (PMt) with urea, (4) PMt with CRF, (5) black plastic-film mulching (PMb) with urea, and (6) PMb with CRF. During the early growth stages, soil CO2 emissions were noted as PMt > PMb > no mulching, and this order was reversed in the late growth stages. This trend was the result of topsoil temperature dynamics. There were no significant correlations noted between soil CO2 emissions and soil temperature and moisture. Cumulative soil CO2 emissions were higher for the PMt than for the PMb, and grain yield was higher for the PMb treatments than for the PMt or no mulching treatments. The CRF produced higher grain yield and inhibited soil CO2 emissions. Soil CO2 emissions per unit grain yield were lower for the BC treatment than for the other treatments. In conclusion, the use of black plastic-film mulching and controlled release fertiliser not only increased maize yield, but also reduced soil CO2 emissions.

  5. Determinants of Skin Cancer Preventive Behaviors Among Rural Farmers in Iran: an Application of Protection Motivation Theory.

    Science.gov (United States)

    Babazadeh, Towhid; Nadrian, Haidar; Banayejeddi, Morteza; Rezapour, Baratali

    2017-09-01

    Skin cancer is one of the most prevalent cancers, worldwide, which happens more among those with more sunlight exposure like farmers. The aim of this study was to explore the determinants of skin cancer preventive behaviors (SCPBs) among rural farmers using Protection Motivation Theory (PMT). In this cross-sectional study, multistage random sampling was employed to enroll 238 farmers referring to rural health houses (HH) in Chaldoran County, Iran. A valid and reliable instrument based on PMT variables was used. Significant correlations were found between all PMT variables with SCPBs (p Motivation and SCPBs as outcome variables. Predictors for these two outcome variables were classified in two different blocks according to their natures. Demographic characteristics (p > 0.05) and PMT constructs (p Motivation, respectively. Also, no significant effect was found on SCPBs by demographic variables, in the first block (∆R (2) = 0.025); however, in the second block, Perceived Susceptibility (p = 0.000), Rewards (p = 0.022), Self-efficacy (p = 0.000), and Response Cost (p = 0.001) were significant predictors of SCPBs (∆R (2) = 0.432). Health care providers may consider PMT as a framework for developing educational interventions aiming at improving SCPBs among rural farmers.

  6. Protection motivation theory and social distancing behaviour in response to a simulated infectious disease epidemic.

    Science.gov (United States)

    Williams, Lynn; Rasmussen, Susan; Kleczkowski, Adam; Maharaj, Savi; Cairns, Nicole

    2015-01-01

    Epidemics of respiratory infectious disease remain one of the most serious health risks facing the population. Non-pharmaceutical interventions (e.g. hand-washing or wearing face masks) can have a significant impact on the course of an infectious disease epidemic. The current study investigated whether protection motivation theory (PMT) is a useful framework for understanding social distancing behaviour (i.e. the tendency to reduce social contacts) in response to a simulated infectious disease epidemic. There were 230 participants (109 males, 121 females, mean age 32.4 years) from the general population who completed self-report measures assessing the components of PMT. In addition, participants completed a computer game which simulated an infectious disease epidemic in order to provide a measure of social distancing behaviour. The regression analyses revealed that none of the PMT variables were significant predictors of social distancing behaviour during the simulation task. However, fear (β = .218, p < .001), response efficacy (β = .175, p < .01) and self-efficacy (β = .251, p < .001) were all significant predictors of intention to engage in social distancing behaviour. Overall, the PMT variables (and demographic factors) explain 21.2% of the variance in intention. The findings demonstrated that PMT was a useful framework for understanding intention to engage in social distancing behaviour, but not actual behaviour during the simulated epidemic. These findings may reflect an intention-behaviour gap in relation to social distancing behaviour.

  7. Ionic liquid-assisted electrochemical determination of pyrimethanil using reduced graphene oxide conjugated to flower-like NiCo2O4.

    Science.gov (United States)

    Yang, Lijun; Hu, Yandong; Wang, Qiong; Dong, Yuanyuan; Zhang, Lei

    2016-09-07

    The novel hierarchical flower-like superstructure NiCo2O4/reduced graphene oxide (rGO) hybrids have been successfully synthesized with a facile one-step hydrothermal process for the determination of fungicide pyrimethanil (PMT). For comparison, various structures of NiCo2O4/rGO including hexagonal nanoplates and nanorods were also synthesized. Among them, three-dimensional (3D) flower-like NiCo2O4/rGO exhibited the highest electrocatalytic activity for the oxidation of PMT. With the synergistic effect of [OMIM]PF6 ionic liquid (IL), the electrochemical sensor film (NiCo2O4/rGO/IL) further facilitated interfacial electron transfer and enhanced electrocatalytic activity for the oxidation of PMT. Under the optimum conditions, the electrochemical sensor exhibited two linear ranges of 0.1-10.0 μmol/L and 20.0-140 μmol/L for PMT with a low detection concentration of 11.0 nmol/L. Besides, the interference, repeatability, reproducibility and stability measurements were also evaluated. The proposed method was successfully applied to the detection of PMT in water, seawater, fruits and vegetables with good recovery ranging from 93% to 105%, and possessed potential applications in the analysis of real samples.

  8. Electrochemically selective determination of dopamine in the presence of ascorbic and uric acids on the surface of the modified Nafion/single wall carbon nanotube/poly(3-methylthiophene) glassy carbon electrodes.

    Science.gov (United States)

    Quan, Do Phuc; Tuyen, Do Phuc; Lam, Tran Dai; Tram, Phan Thi Ngoc; Binh, Nguyen Hai; Viet, Pham Hung

    2011-12-01

    A voltammetric method based on a combination of incorporated Nafion, single-walled carbon nanotubes and poly(3-methylthiophene) film-modified glassy carbon electrode (NF/SWCNT/PMT/GCE) has been successfully developed for selective determination of dopamine (DA) in the ternary mixture of dopamine, ascorbic acid (AA) and uric acid (UA) in 0.1M phosphate buffer solution (PBS) pH 4. It was shown that to detect DA from binary DA-AA mixture, the use of NF/PMT/GCE was sufficient, but to detect DA from ternary DA-AA-UA mixture NF/SWCNT/PMT/GCE was required. The later modified electrode exhibits superior electrocatalytic activity towards AA, DA and UA thanks to synergic effect of NF/SWCNT (combining unique properties of SWCNT such as high specific surface area, electrocatalytic and adsorptive properties, with the cation selectivity of NF). On the surface of NF/SWCNT/PMT/GCE AA, DA, UA were oxidized respectively at distinguishable potentials of 0.15, 0.37 and 0.53 V (vs. Ag/AgCl), to form well-defined and sharp peaks, making possible simultaneous determination of each compound. Also, it has several advantages, such as simple preparation method, high sensitivity, low detection limit and excellent reproducibility. Thus, the proposed NF/SWCNT/PMT/GCE could be advantageously employed for the determination of DA in real pharmaceutical formulations.

  9. Laboratory tests of the response stability of the ATLAS Tile Calorimeter photomultipliers

    CERN Document Server

    AUTHOR|(INSPIRE)INSPIRE-00216540; The ATLAS collaboration; Leone, Sandra; Scuri, Fabrizio

    2017-01-01

    High performance of the ATLAS Tile Calorimeter response is achieved with a multi- stage calibration. One step of the calibration is based on measurements of the response to laser pulse excitation of the PMTs used to read out the calorimeter cells. A facility to study the PMT stability response is operating in the PISA-INFN laboratories since 2015. Goals of the tests are to study the time evolution of the PMT response as a function of the integrated anode charge and to compare test bench results with the observed response drifts of the Tile Calorimeter PMTs during LHC Run I and Run II. A new statistical approach was used to measure the drift of the absolute PMT gain. A new procedure which combines studies of the time evolution of the global PMT responses and of the individual PMT gains was adopted to derive the evolution of the cathode quantum efficiency. The experimental setup of the Pisa facility is described and the first results obtained by testing about 30 PMTs Hamamatsu model R7877 (a special evolution f...

  10. Study of Various Photomultiplier Tubes with Muon Beams And Cerenkov Light Produced in Electron Showers

    CERN Document Server

    Chatrchyan, Serguei; Sirunyan, Albert M; Mossolov, Vladimir; Shumeiko, Nikolai; De Wolf, Eddi A; Ochesanu, Silvia; Roland, Benoit; Van Haevermaet, Hans; Van Mechelen, Pierre; Blyweert, Stijn; Damgov, Jordan; Dimitrov, Lubomir; Genchev, Vladimir; Piperov, Stefan; Vankov, Ivan; Roinishvili, Vladimir; Borras, Kerstin; Campbell, Alan; Jung, Hannes; Katkov, Igor; Knutsson, Albert; Sen, Niladri; Panagiotis, K; Panagiotou, Apostolos; Theodoros, M; Aranyi, Attila; Bencze, Gyorgy; Boldizsar, Laszlo; Horvath, David; Vesztergombi, Gyorgy; Bansal, Sunil; Beri, Suman Bala; Jindal, Monika; Kaur, Manjit; Kohli, Jatinder Mohan; Mehta, Manuk Zubin; Nishu, Nishu; Saini, Lovedeep Kaur; Singh, Amandeep; Singh, Jas Bir; Aziz, Tariq; Gurtu, Atul; Maity, Manas; Majumder, Devdatta; Majumder, Gobinda; Mazumdar, Kajari; Saha, Anirban; Sudhakar, Katta; Banerjee, Sunanda; Dugad, Shashikant; Mondal, Naba Kumar; Arfaei, Hessamaddin; Bakhshiansohi, Hamed; Mohammadi Najafabadi, Mojtaba; Paktinat Mehdiabadi, Saeid; Penzo, Aldo; Bunin, Pavel; Finger, Miroslav; Finger, Miroslav; Golutvin, Igor; Smirnov, Vitaly; Vishnevskiy, Alexander; Volodko, Anton; Zarubin, Anatoli; Andreev, Yuri; Kirsanov, Mikhail; Pashenkov, Anatoli; Toropin, Alexander; Troitsky, Sergey; Epshteyn, Vladimir; Gavrilov, Vladimir; Ilina, N; Kaftanov, Vitali; Kossov, Mikhail; Krokhotin, Andrey; Kuleshov, Sergey; Oulianov, Alexei; Safronov, Grigory; Semenov, Sergey; Shreyber, Irina; Stolin, Viatcheslav; Vlasov, Evgueni; Zhokin, Alexander; Demianov, A; Ershov, Alexander; Gribushin, Andrey; Klyukhin, Vyacheslav; Kodolova, Olga; Lokhtin, Igor; Obraztsov, Stepan; Petrushanko, Sergey; Proskuryakov, Alexander; Sarycheva, Ludmila; Savrin, Viktor; Vardanyan, Irina; Dremin, Igor; Kirakosyan, Martin; Konovalova, Nina; Vinogradov, Alexey; Krychkine, Victor; Petrov, Vladimir; Ryutin, Roman; Slabospitsky, Sergey; Sobol, Andrei; Sytine, Alexandre; Tourtchanovitch, Leonid; Volkov, Alexey; Adiguzel, Aytul; Bakirci, Mustafa Numan; Cerci, Salim; Dumanoglu, Isa; Eskut, Eda; Girgis, Semiray; Gurpinar, Emine; Karaman, Tugba; Kayis Topaksu, Aysel; Kurt, Pelin; Onengut, G; Ozdemir, Kadri; Ozturk, Sertac; Polatoz, A; Sogut, Kenan; Tali, Bayram; Topakli, Huseyin; Uzun, Dilber; Aliev, Takhmasib; Deniz, Muhammed; Guler, Ali Murat; Ocalan, Kadir; Serin, Meltem; Sever, Ramazan; Yildirim, Eda; Zeyrek, Mehmet; Deliomeroglu, Mehmet; Gulmez, E; Halu, Arda; Isildak, Bora; Kaya, Mithat; Kaya, Ozlem; Ozbek, M; Sonmez, Nasuf; Levchuk, Leonid; Sorokin, Pavel; Clough, Andrew; Hazen, Eric; Heering, Arjan Hendrix; Heister, Arno; John, J. St; Lawson, Philip; Lazic, Dragoslav; Rohlf, James; Sulak, Lawrence; Wu, Shouxiang; Avetisyan, Aram; Chou, John Paul; Esen, Selda; Kukartsev, Gennadiy; Landsberg, Greg; Narain, Meenakshi; Nguyen, N; Tsang, Ka Vang; Gary, J William; Liu, Feng; Nguyen, Harold; Sturdy, Jared; Winn, Dave; Banerjee, Sudeshna; Bhat, Pushpalatha C; Binkley, Morris; Chlebana, Frank; Churin, Igor; Cihangir, Selcuk; Crawford, Matt; Dagenhart, William; Demarteau, Marcel; Derylo, Greg; Dykstra, David; Eartly, David P; Elias, John E; Elvira, Victor Daniel; Freeman, Jim; Green, Dan; Hahn, Adrienne; Hanlon, Jack; Harris, Robert M; Kousouris, Konstantinos; Kunori, Shuichi; Limon, Peter; Newman-Holmes, Catherine; Sharma, Seema; Spalding, William J; Vidal, Richard; Whitmore, Juliana; Wu, Weimin; Ceron, Cristobal; Gaultney, Vanessa; Lebolo, Luis Miguel; Linn, Stephan; Markowitz, Pete; Martinez, German; Bertoldi, Maurizio; Gleyzer, Sergei V; Haas, Jeff; Hagopian, Sharon; Hagopian, Vasken; Jenkins, Merrill; Sekmen, Sezen; Baarmand, Marc M; Mermerkaya, Hamit; Ralich, Robert; Vodopiyanov, Igor; Garcia-Solis, Edmundo Javier; Akgun, Ugur; Albayrak, Elif Asli; Bilki, Burak; Cankocak, Kerem; Clarida, Warren; Duru, Firdevs; McCliment, Edward; Merlo, Jean-Pierre; Mestvirishvili, Alexi; Moeller, Anthony; Nachtman, Jane; Norbeck, Edwin; Onel, Yasar; Ozok, Ferhat; Schmidt, Ianos; Sen, Sercan; Yetkin, Taylan; Yi, Kai; Grachov, Oleg; Murray, Michael; Wood, Jeffrey Scott; Baden, Drew; Boutemeur, Madjid; Eno, Sarah Catherine; Ferencek, Dinko; Hadley, Nicholas John; Kellogg, Richard G; Kirn, Malina; Rossato, Kenneth; Rumerio, Paolo; Santanastasio, Francesco; Skuja, Andris; Temple, Jeffrey; Tonjes, Marguerite; Ton-war, S.C; Twedt, Elizabeth; Cole, Perrie; Cushman, Priscilla; Dudero, Phillip Russell; Klapoetke, Kevin; Mans, Jeremy; Cremaldi, Lucien Marcus; Godang, Romulus; Kroeger, Rob; Rahmat, Rahmat; Sanders, David A; Anastassov, Anton; Ofierzynski, Radoslaw Adrian; Pozdnyakov, Andrey; Velasco, Mayda; Won, Steven; Karmgard, Daniel John; Ruchti, Randy; Warchol, Jadwiga; Ziegler, Jill; Adam, Nadia; Berry, Edmund; Gerbaudo, Davide; Halyo, Valerie; Hunt, Adam; Jones, John; Laird, Edward; Lopes Pegna, David; Marlow, Daniel; Medvedeva, Tatiana; Mooney, Michael; Olsen, James; Tully, Christopher; Werner, Jeremy Scott; Zuranski, Andrzej; Barnes, Virgil E; Laasanen, Alvin T; Sedov, Alexey; Bodek, Arie; Chung, Yeon Sei; de Barbaro, Pawel; Garcia-Bellido, Aran; Han, Jiyeon; Harel, Amnon; Miner, Daniel Carl; Vishnevskiy, Dmitry; Zielinski, Marek; Bhatti, Anwar; Goulianos, Konstantin; Yan, Ming; Gurrola, Alfredo; Kamon, Teruki; Sengupta, Sinjini; Toback, David; Weinberger, Michael; Akchurin, Nural; Jeong, Chiyoung; Lee, Sang Joon; Popescu, Sorina; Roh, Youn; Sill, Alan; Volobouev, Igor; Wigmans, Richard; Yazgan, Efe

    2010-01-01

    The PMTs of the CMS Hadron Forward calorimeter were found to generate a large size signal when their windows were traversed by energetic charged particles. This signal, which is due to Cerenkov light production at the PMT window, could interfere with the calorimeter signal and mislead the measurements. In order to find a viable solution to this problem, the response of four different types of PMTs to muons traversing their windows at different orientations is measured at the H2 beam-line at CERN. Certain kinds of PMTs with thinner windows show significantly lower response to direct muon incidence. For the four anode PMT, a simple and powerful algorithm to identify such events and recover the PMT signal using the signals of the quadrants without window hits is also presented. For the measurement of PMT responses to Cerenkov light, the Hadron Forward calorimeter signal was mimicked by two different setups in electron beams and the PMT performances were compared with each other. Superior performance of particula...

  11. Plastic-film mulching and urea types affect soil CO2 emissions and grain yield in spring maize on the Loess Plateau, China

    Science.gov (United States)

    Liu, Qiaofei; Chen, Yu; Li, Weiwei; Liu, Yang; Han, Juan; Wen, Xiaoxia; Liao, Yuncheng

    2016-01-01

    A 2-year field experiment was conducted on maize (Zea mays L.) to explore effective ways to decrease soil CO2 emissions and increase grain yield. Treatments established were: (1) no mulching with urea, (2) no mulching with controlled release fertiliser (CRF), (3) transparent plastic-film mulching (PMt) with urea, (4) PMt with CRF, (5) black plastic-film mulching (PMb) with urea, and (6) PMb with CRF. During the early growth stages, soil CO2 emissions were noted as PMt > PMb > no mulching, and this order was reversed in the late growth stages. This trend was the result of topsoil temperature dynamics. There were no significant correlations noted between soil CO2 emissions and soil temperature and moisture. Cumulative soil CO2 emissions were higher for the PMt than for the PMb, and grain yield was higher for the PMb treatments than for the PMt or no mulching treatments. The CRF produced higher grain yield and inhibited soil CO2 emissions. Soil CO2 emissions per unit grain yield were lower for the BC treatment than for the other treatments. In conclusion, the use of black plastic-film mulching and controlled release fertiliser not only increased maize yield, but also reduced soil CO2 emissions. PMID:27329934

  12. An Alternative Mechanism for the Methylation of Phosphoethanolamine Catalyzed by Plasmodium falciparum Phosphoethanolamine Methyltransferase*♦

    Science.gov (United States)

    Saen-oon, Suwipa; Lee, Soon Goo; Jez, Joseph M.; Guallar, Victor

    2014-01-01

    The phosphobase methylation pathway catalyzed by the phosphoethanolamine methyltransferase in Plasmodium falciparum (PfPMT), the malaria parasite, offers an attractive target for anti-parasitic drug development. PfPMT methylates phosphoethanolamine (pEA) to phosphocholine for use in membrane biogenesis. Quantum mechanics and molecular mechanics (QM/MM) calculations tested the proposed reaction mechanism for methylation of pEA involving the previously identified Tyr-19–His-132 dyad, which indicated an energetically unfavorable mechanism. Instead, the QM/MM calculations suggested an alternative mechanism involving Asp-128. The reaction coordinate involves the stepwise transfer of a proton to Asp-128 via a bridging water molecule followed by a typical Sn2-type methyl transfer from S-adenosylmethionine to pEA. Functional analysis of the D128A, D128E, D128Q, and D128N PfPMT mutants shows a loss of activity with pEA but not with the final substrate of the methylation pathway. X-ray crystal structures of the PfPMT-D128A mutant in complex with S-adenosylhomocysteine and either pEA or phosphocholine reveal how mutation of Asp-128 disrupts a hydrogen bond network in the active site. The combined QM/MM, biochemical, and structural studies identify a key role for Asp-128 in the initial step of the phosphobase methylation pathway in Plasmodium and provide molecular insight on the evolution of multiple activities in the active site of the PMT. PMID:25288796

  13. Protection motivation theory and adolescent drug trafficking: relationship between health motivation and longitudinal risk involvement.

    Science.gov (United States)

    Wu, Ying; Stanton, Bonita F; Li, Xiaoming; Galbraith, Jennifer; Cole, Matthew L

    2005-03-01

    To assess health protection motivation as explained by the constructs of protection motivation theory (PMT) and its association with drug trafficking over 2 years. The sample included 817 African American youth (13-16 years old) participating in an adolescent risk-reduction program. We developed an instrument measuring the level of health protection motivation (LHPM) using factor analysis. Changes in LHPM over time were examined among drug traffickers, abstainers, initiators, and nonrisk youths. In sum, 151 participants reported selling and/or delivering drugs during the study period. The significant inverse correlation between drug-trafficking intention and health protection motivation was consistent with PMT. Changes in LHPM were strongly associated with the dynamics of behavior over 2 years. Adolescent drug trafficking can be predicted by an overall level of health protection motivation. PMT and related theories should be considered in the design of drug-trafficking prevention intervention.

  14. Signal pulse emulation for scintillation detectors using Geant4 Monte Carlo with light tracking simulation

    Energy Technology Data Exchange (ETDEWEB)

    Ogawara, R. [Department of Medical Physics and Engineering, Graduate School of Medicine, Hokkaido University, Kita-15 Nishi-7, Kita-ku, Sapporo-shi, Hokkaido (Japan); Ishikawa, M., E-mail: masayori@med.hokudai.ac.jp [Graduate School of Health Science, Hokkaido University, Kita-12 Nishi-5, Kita-ku, Sapporo-shi, Hokkaido (Japan)

    2016-07-15

    The anode pulse of a photomultiplier tube (PMT) coupled with a scintillator is used for pulse shape discrimination (PSD) analysis. We have developed a novel emulation technique for the PMT anode pulse based on optical photon transport and a PMT response function. The photon transport was calculated using Geant4 Monte Carlo code and the response function with a BC408 organic scintillator. The obtained percentage RMS value of the difference between the measured and simulated pulse with suitable scintillation properties using GSO:Ce (0.4, 1.0, 1.5 mol%), LaBr{sub 3}:Ce and BGO scintillators were 2.41%, 2.58%, 2.16%, 2.01%, and 3.32%, respectively. The proposed technique demonstrates high reproducibility of the measured pulse and can be applied to simulation studies of various radiation measurements.

  15. Status of the SPHERE experiment

    CERN Document Server

    Antonov, R A; Bonvech, E A; Chernov, D V; Dzhatdoev, T A; Finger, Mir; Finger, M; Galkin, V I; Kabanova, N N; Petkun, A S; Podgrudkov, D A; Roganova, T M; Shaulov, S B; Sysoeva, T I

    2012-01-01

    Here is presented the current state of the SPHERE-2 balloon-borne experiment. The detector is elevated up to 1 km above the snow surface and registers the reflected Vavilov-Cherenkov radiation from extensive air showers. This method has good sensitivity to the mass-composition of the primary cosmic rays due to its high resolution near the shower axis. The detector consists of a 1500 mm spherical mirror with a 109 PMT cluster in its focus. The electronics record a signal pulse profile in each PMT. In the last 2 years the detector was upgraded: time resolution of pulse registration was enhanced up to 12.5 ns, channel sensitivity was increased by a factor of 3, a new LED-based relative PMT calibration method was introduced, and new hardware and etc. was installed.

  16. Laser calibration of the ATLAS Tile Calorimeter

    CERN Document Server

    Di Gregorio, Giulia; The ATLAS collaboration

    2017-01-01

    High performance stability of the ATLAS Tile calorimeter is achieved with a set of calibration procedures. One step of the calibrtion procedure is based on measurements of the response stability to laser excitation of the photomultipliers (PMTs) that are used to readout the calorimeter cells. A facility to study in lab the PMT stability response is operating in the PISA-INFN laboratories since 2015. Goals of the test in lab are to study the time evolution of the PMT response to reproduce and to understand the origin of the resonse drifts seen with the PMT mounted on the Tile calorimeter in its normal operation during LHC run I and run II. A new statistical approach was developed to measure the drift of the absolute gain. This approach was applied to both the ATLAS laser calibration data and to the data collected in the Pisa local laboratory. The preliminary results from these two studies are shown.

  17. Laser Calibration of the ATLAS Tile Calorimeter

    CERN Document Server

    Di Gregorio, Giulia; The ATLAS collaboration

    2017-01-01

    High performance stability of the ATLAS Tile Calorimeter is achieved with a set of calibration procedures. One step of the calibration procedure is based on measurements of the response stability to laser excitation of the PMTs that are used to readout the calorimeter cells. A facility to study in lab the PMT stability response is operating in the PISA-INFN laboratories since 2015. Goals of the tests in lab are to study the time evolution of the PMT response to reproduce and to understand the origin of the response drifts seen with the PMT mounted on the Tile calorimeter in its normal operating during LHC run I and run II. A new statistical approach was developed to measure drift of the absolute gain. This approach was applied to both the ATLAS laser calibration data and to data collected in the Pisa local laboratory. The preliminary results from these two studies are shown.

  18. A concise quantum efficiency measurement system for gaseous photomultipliers

    Energy Technology Data Exchange (ETDEWEB)

    Moriya, Toru [Department of Physics, Yamagata University, Yamagata 990-8560 (Japan); Tokanai, Fuyuki, E-mail: tokanai@sci.kj.yamagata-u.ac.jp [Department of Physics, Yamagata University, Yamagata 990-8560 (Japan); Okazaki, Keisuke; Sakurai, Hirohisa; Gunji, Shuichi [Department of Physics, Yamagata University, Yamagata 990-8560 (Japan); Kawabata, Hironobu; Sohtome, Takayuki [BUNKOUKEIKI Co., Ltd., Hachioji, Tokyo 192-0033 (Japan); Sumiyoshi, Takayuki [Graduate School of the Faculty of Science and Engineering, Tokyo Metropolitan University, Tokyo 192-0397 (Japan); Sugiyama, Hirioyuki; Okada, Teruyuki; Ohishi, Noboru [Electron Tube Division, Hamamatsu Photonics K.K., Shizuoka 438-0193 (Japan); Kishimoto, Syunji [Institute of Material Structure Science, KEK, Tsukuba 305-0801 (Japan)

    2013-12-21

    We have been developing gaseous photomultiplier tubes (PMTs) with a bialkali photocathode combined with micropattern gas detectors (MPGDs). The sensitivity of a PMT is described in terms of its quantum efficiency (QE). The QE is very important in many experiments, particularly when dealing with low photon statistics. A concise QE measurement system has been developed to evaluate the characteristics of a sealed gaseous PMT with a bialkali photocathode. This QE measurement system consists of a Xe arc lamp source, reflective optics and filters, a monochromator, and a reference Si photodiode detector. Using the system, we evaluated the QE, gain, and long-term stability of the gaseous PMT. Here, we report the results of our evaluation.

  19. The membrane localization domains of two distinct bacterial toxins form a 4-helix-bundle in solution.

    Science.gov (United States)

    Hisao, Grant S; Brothers, Michael C; Ho, Mengfei; Wilson, Brenda A; Rienstra, Chad M

    2017-03-01

    Membrane localization domain (MLD) was first proposed for a 4-helix-bundle motif in the crystal structure of the C1 domain of Pasteurella multocida toxin (PMT). This structure motif is also found in the crystal structures of several clostridial glycosylating toxins (TcdA, TcdB, TcsL, and TcnA). The Ras/Rap1-specific endopeptidase (RRSP) module of the multifunctional autoprocessing repeats-in-toxins (MARTX) toxin produced by Vibrio vulnificus has sequence homology to the C1-C2 domains of PMT, including a putative MLD. We have determined the solution structure for the MLDs in PMT and in RRSP using solution state NMR. We conclude that the MLDs in these two toxins assume a 4-helix-bundle structure in solution. © 2016 The Protein Society.

  20. Preparation of Three-Dimensional Graphene Foams Using Powder Metallurgy Templates.

    Science.gov (United States)

    Sha, Junwei; Gao, Caitian; Lee, Seoung-Ki; Li, Yilun; Zhao, Naiqin; Tour, James M

    2016-01-26

    A simple and scalable method which combines traditional powder metallurgy and chemical vapor deposition is developed for the synthesis of mesoporous free-standing 3D graphene foams. The powder metallurgy templates for 3D graphene foams (PMT-GFs) consist of particle-like carbon shells which are connected by multilayered graphene that shows high specific surface area (1080 m(2) g(-1)), good crystallization, good electrical conductivity (13.8 S cm(-1)), and a mechanically robust structure. The PMT-GFs did not break under direct flushing with DI water, and they were able to recover after being compressed. These properties indicate promising applications of PMT-GFs for fields requiring 3D carbon frameworks such as in energy-based electrodes and mechanical dampening.

  1. Recent insights into Pasteurella multocida toxin and other G-protein-modulating bacterial toxins.

    Science.gov (United States)

    Wilson, Brenda A; Ho, Mengfei

    2010-08-01

    Over the past few decades, our understanding of the bacterial protein toxins that modulate G proteins has advanced tremendously through extensive biochemical and structural analyses. This article provides an updated survey of the various toxins that target G proteins, ending with a focus on recent mechanistic insights in our understanding of the deamidating toxin family. The dermonecrotic toxin from Pasteurella multocida (PMT) was recently added to the list of toxins that disrupt G-protein signal transduction through selective deamidation of their targets. The C3 deamidase domain of PMT has no sequence similarity to the deamidase domains of the dermonecrotic toxins from Escherichia coli (cytotoxic necrotizing factor [CNF]1-3), Yersinia (CNFY) and Bordetella (dermonecrotic toxin). The structure of PMT-C3 belongs to a family of transglutaminase-like proteins, with active site Cys-His-Asp catalytic triads distinct from E. coli CNF1.

  2. Detection of Cherenkov light emission in liquid argon

    Energy Technology Data Exchange (ETDEWEB)

    Antonello, M.; Arneodo, F.; Badertscher, A.; Baiboussinov, B.; Baldo Ceolin, M.; Battistoni, G.; Bekman, B.; Benetti, P.; Bernardini, E.; Bischofberger, M.; Borio di Tigliole, A.; Brunetti, R.; Bueno, A.; Calligarich, E.; Campanelli, M.; Carpanese, C.; Cavalli, D.; Cavanna, F. E-mail: flavio.cavanna@aquila.infn.it; Cennini, P.; Centro, S.; Cesana, A.; Chen, C.; Chen, D.; Chen, D.B.; Chen, Y.; Cieslik, C.; Cline, D.; Dai, Z.; De Vecchi, C.; Dabrowska, A.; Dolfini, R.; Felcini, M.; Ferrari, A.; Ferri, F.; Ge, Y.; Gibin, D.; Gigli Berzolari, A.; Gil-Botella, I.; Graczyk, K.; Grandi, L.; Guglielmi, A.; He, K.; Holeczek, J.; Huang, X.; Juszczak, C.; Kielczewska, D.; Kisiel, J.; Kozlowski, T.; Laffranchi, M.; Lagoda, J.; Li, Z.; Lu, F.; Ma, J.; Markiewicz, M.; Matthey, C.; Mauri, F.; Mazza, D.; Meng, G.; Messina, M.; Montanari, C.; Muraro, S.; Navas-Concha, S.; Nurzia, G.; Otwinowski, S.; Ouyang, Q.; Palamara, O.; Pascoli, D.; Periale, L.; Piano Mortari, G.B.; Piazzoli, A.; Picchi, P.; Pietropaolo, F.; Polchlopek, W.; Rancati, T.; Rappoldi, A.; Raselli, G.L.; Rico, J.; Rondio, E.; Rossella, M.; Rubbia, A.; Rubbia, C.; Sala, P.; Scannicchio, D.; Segreto, E.; Seo, Y.; Sergiampietri, F.; Sobczyk, J.; Stepaniak, J.; Szarska, M.; Szeptycka, M.; Terrani, M.; Ventura, S.; Vignoli, C.; Wang, H.; Woo, J.; Xu, G.; Xu, Z.; Zalewska, A.; Zalipska, J.; Zhang, C.; Zhang, Q.; Zhen, S.; Zipper, W

    2004-01-11

    Detection of Cherenkov light emission in liquid argon has been obtained with an ICARUS prototype, during a dedicated test run at the Gran Sasso Laboratory external facility. Ionizing tracks from cosmic ray muons crossing the detector active volume have been collected in coincidence with visible light signals from a photo-multiplier (PMT) immersed in liquid argon. A 3D reconstruction of the tracks has been performed exploiting the ICARUS imaging capability. The angular distributions of the tracks triggered by the PMT signals show an evident directionality. By means of a detailed Monte Carlo simulation we show that the geometrical characteristics of the events are compatible with the hypothesis of Cherenkov light emission as the main source of the PMT signals.

  3. Effects of parent management training programs on disruptive behavior for children with a developmental disability: a meta-analysis.

    Science.gov (United States)

    Skotarczak, Laura; Lee, Gloria K

    2015-03-01

    This meta-analysis determined the effects of parent management training (PMT) on disruptive behaviors in children with a developmental disability. Parent management training programs, based on behavioral theories of psychology, are commonly used in addressing disruptive behavior in children. Eleven studies met inclusion criteria with a total of 540 participants, with 275 in experimental groups and 265 in control groups. The effect of PMT on the disruptive behavior in children with a developmental disability was significant (g=0.39). The moderator effects of type of PMT, delivery type and setting, and administrator level of education were also significant. The moderator effects of child age, and session number and duration were not significant in this meta-analysis.

  4. Distributed beam loss monitor based on the Cherenkov effect in an optical fiber

    Science.gov (United States)

    Maltseva, Yu; Emanov, F. A.; Petrenko, A. V.; Prisekin, V. G.

    2015-05-01

    This review discusses a distributed beam loss monitor which is based on the Cherenkov effect in an optical fiber and which has been installed at the VEPP-5 Injection Complex at the Budker Institute of Nuclear Physics. The principle of the device operation consists in detecting the Cherenkov radiation generated in an optical fiber by relativistic charged particles that are produced in an electromagnetic shower when highly relativistic beam particles (electrons or positrons) hit the accelerator vacuum chamber wall. Our experiments used a photomultiplier tube (PMT) to detect the Cherenkov light. Knowing when the PMT signal arrives tells us where the beam loss occurs. Using a 20-m-long optical fiber allowed a detector spatial resolution of 3 m. The way to improve the resolution is to optimize the monitor working conditions and optical fiber and PMT parameters, potentially leading to a resolution of as fine as 0.5 m according to our estimates.

  5. Evaluation of Photo Multiplier Tube candidates for the Cherenkov Telescope Array

    Energy Technology Data Exchange (ETDEWEB)

    Mirzoyan, R. [Max-Planck-Institute for Physics, Föhringer Ring 6, 80805 Munich (Germany); Müller, D., E-mail: dmueller@mpp.mpg.de [Max-Planck-Institute for Physics, Föhringer Ring 6, 80805 Munich (Germany); Hanabata, Y. [Institute for Cosmic Ray Research, The University of Tokyo, Kashiwa, Chiba 277-8582 (Japan); Hose, J.; Menzel, U. [Max-Planck-Institute for Physics, Föhringer Ring 6, 80805 Munich (Germany); Nakajima, D.; Takahashi, M. [Institute for Cosmic Ray Research, The University of Tokyo, Kashiwa, Chiba 277-8582 (Japan); Teshima, M. [Max-Planck-Institute for Physics, Föhringer Ring 6, 80805 Munich (Germany); Institute for Cosmic Ray Research, The University of Tokyo, Kashiwa, Chiba 277-8582 (Japan); Toyama, T. [Max-Planck-Institute for Physics, Föhringer Ring 6, 80805 Munich (Germany); Yamamoto, T. [Department of Physics, Konan University, Okamoto 8-9-1, Higashinada-ku, Kobe, Hyogo 658-0072 (Japan)

    2016-07-11

    Photo Multiplier Tubes (PMTs) are the most wide spread detectors for fast, faint light signals. Six years ago, an improvement program for the PMT candidates for the Cherenkov Telescope Array (CTA) project was started with the companies Hamamatsu Photonics K.K. and Electron Tubes Enterprises Ltd. (ETE). For maximizing the performance of the CTA imaging cameras we need PMTs with outstanding good quantum efficiency, high photoelectron collection efficiency, short pulse width, very low afterpulse probability and transit time spread. We will report on the measurements of PMT R-12992-100 from Hamamatsu as their final product and the PMT D573KFLSA as one of the latest test versions from ETE as candidate PMTs for the CTA project.

  6. Parent Management Training Program Developed by “Research Units on Pediatric Psychopharmacology and Psychosocial Interventions (RUPP Autism Network” for Education of Family with Children in Autism

    Directory of Open Access Journals (Sweden)

    Sevda Arslan

    2014-08-01

    Full Text Available Parent management training programme was prepared by Research Units on Pediatric Psychopharmacology and Psychosocial Interventions (RUPP Autism Network based on ABA (Applied Behavior Analysis. The programme aims to prevent or decrease the problem behavior and to bring the children with autism in positive behaviors by educating their families. The controlled randomized clinical research of RUPP has determined that Parent Managament Training (PMT have provided meaningful improvements on childrens’ function and family relationships. The group of children on which risperidone and PMT have implemented together had statistically meaningful improvements such as increase in adaptive skills and decrease in the aggressive behaviors when compared with the children who used only risperidone. There is no such programme in Turkey for the families with children in pervasive developmet disorder. This paper aims to introduce and show the potentials of the PMT programme that has been developed by RUPP Autism Network.

  7. Vaccination with Recombinant Non-transmembrane Domain of Protein Mannosyltransferase 4 Improves Survival during Murine Disseminated Candidiasis.

    Science.gov (United States)

    Wang, Li; Yan, Lan; Li, Xing Xing; Xu, Guo Tong; An, Mao Mao; Jiang, Yuan Ying

    2015-01-01

    Candida albicans is the most common cause of invasive fungal infections in humans. The C. albicans cell wall proteins play an important role in crucial host-fungus interactions and might be ideal vaccine targets to induce protective immune response in host. Meanwhile, protein that is specific to C. albicans is also an ideal target of vaccine. In this study, 11 proteins involving cell wall biosynthesis, yeast-to-hypha formation, or specific to C. albicans were chosen and were successfully cloned, purified and verified. The immune protection of vaccination with each recombinant protein respectively in preventing systemic candidiasis in BALB/c mice was assessed. The injection of rPmt4p vaccination significantly increased survival rate, decreased fungal burdens in the heart, liver, brain, and kidneys, and increased serum levels of both immunoglobulin G (IgG) and IgM against rPmt4p in the immunized mice. Histopathological assessment demonstrated that rPmt4p vaccination protected the tissue structure, and decreased the infiltration of inflammatory cells. Passive transfer of the rPmt4p immunized serum increased survival rate against murine systemic candidiasis and significantly reduced organ fungal burden. The immune serum enhanced mouse neutrophil killing activity by directly neutralizing rPmt4p effects in vitro. Levels of interleukin (IL)-4, IL-10, IL-12p70, IL-17A and tumor necrosis factor (TNF)-α in serum were higher in the immunized mice compared to those in the adjuvant control group. In conclusion, our results suggested that rPmt4p vaccination may be considered as a potential vaccine candidate against systemic candidiasis.

  8. The Key of the Maze: The role of mental imagery and cognitive flexibility in navigational planning.

    Science.gov (United States)

    Bocchi, Alessia; Carrieri, Marika; Lancia, Stefania; Quaresima, Valentina; Piccardi, Laura

    2017-06-09

    Spatial navigation planning ability relies on both mental imagery and cognitive flexibility. Considering the importance of planning ability in everyday life, several neuropsychological tests are used in clinical practice for its assessment, although some of these are not aimed at assessing the strategies of navigational planning. The Porteus Maze Test (PMT) and the Key Search Task (KST) require to plan a strategy in a maze and in an imagined space, respectively. To the best of our knowledge, although these two tests share some features, the relationship between them has never been explored. The purpose of the present study was to investigate, for the first time, the relationship between the PMT and the KST performances in 38 healthy subjects in order to understand the implications of this association for the assessment of spatial navigation ability. Subjects were subdivided in bad or good navigation planners on the basis of the their KST score. The results of the study have revealed a significant difference (t=2.35; p=0.03) in the number of errors made at the PMT by bad navigational planners (0.78±0.28) and good navigational planners (0.10±0.06). The first group (bad navigational planners) made more errors at the PMT than the good navigational planners (who made less errors at the PMT). This provides evidence of the possibility to use the KST and the PMT in a combined way as a new tool for the assessment of spatial navigational planning ability. Furthermore, this finding highlights the importance of mental imagery and cognitive flexibility in spatial navigation, suggesting that these functions could be the link between a good planning ability and a successful spatial navigation. In conclusion, this study suggests that an efficient navigation would not be possible without a good navigational planning ability. Copyright © 2017 Elsevier B.V. All rights reserved.

  9. Rho/ROCK-dependent inhibition of 3T3-L1 adipogenesis by G-protein-deamidating dermonecrotic toxins: differential regulation of Notch1, Pref1/Dlk1, and β-catenin signaling

    Directory of Open Access Journals (Sweden)

    Yuka eBannai

    2012-06-01

    Full Text Available The dermonecrotic toxins from Pasteurella multocida (PMT, Bordetella (DNT, Escherichia coli (CNF1-3 and Yersinia (CNFY modulate their G-protein targets through deamidation and/or transglutamination of an active site Gln residue, which results in activation of the G protein and its cognate downstream signaling pathways. Whereas DNT and the CNFs act on small Rho GTPases, PMT acts on the α subunit of heterotrimeric Gq, Gi and G12/13 proteins. We previously demonstrated that PMT potently blocks adipogenesis and adipocyte differentiation in a calcineurin-independent manner through downregulation of Notch1 and stabilization of β-catenin and Pref1/Dlk1, key proteins in signaling pathways strongly linked to cell fate decisions, including fat and bone development. Here, we report that similar to PMT, DNT and CNF1 completely block adipogenesis and adipocyte differentiation by preventing upregulation of adipocyte markers, PPARγ and C/EBPα, while stabilizing the expression of Pref1/Dlk1 and β-catenin. We show that the Rho/ROCK inhibitor Y-27632 prevented or reversed these toxin-mediated effects, strongly supporting a role for Rho/ROCK signaling in dermonecrotic toxin-mediated inhibition of adipogenesis and adipocyte differentiation. Toxin treatment was also accompanied by downregulation of Notch1 expression, although this inhibition was independent of Rho/ROCK signaling. We further show that PMT-mediated downregulation of Notch1 expression occurs primarily through G12/13 signaling. Our results reveal new details of the pathways involved in dermonecrotic toxin action on adipocyte differentiation, and the role of Rho/ROCK signaling in mediating toxin effects on Wnt/β-catenin and Notch1 signaling, and in particular the role of Gq and G12/13 in mediating PMT effects on Rho/ROCK and Notch1 signaling.

  10. Measuring SeHCAT retention: a technical note.

    Science.gov (United States)

    Notghi, Alp; O'Brien, Joseph; Low, Chen Sheng; Thomson, William

    2011-10-01

    TauroH-23-((75)Se)selena-25-homocholic acid (SeHCAT) retention has been used for the diagnosis of bile acid malabsorption since the early 1980s. Bile acid malabsorption has been increasingly recognized as an important cause of severe chronic diarroea with subsequent increase in the number of referrals for the SeHCAT test. In this study, we review and discuss the standard techniques for the measurement of SeHCAT retention and describe a simple and modified technique using a noncollimated whole-body scanner, suitable for most modern dual-headed cameras.

  11. Targeting the Poor: Evidence from a Field Experiment in Indonesia

    Science.gov (United States)

    Alatas, Vivi; Banerjee, Abhijit; Hanna, Rema; Olken, Benjamin A.; Tobias, Julia

    2014-01-01

    This paper reports an experiment in 640 Indonesian villages on three approaches to target the poor: proxy-means tests (PMT), where assets are used to predict consumption; community targeting, where villagers rank everyone from richest to poorest; and a hybrid. Defining poverty based on PPP$2 per-capita consumption, community targeting and the hybrid perform somewhat worse in identifying the poor than PMT, though not by enough to significantly affect poverty outcomes for a typical program. Elite capture does not explain these results. Instead, communities appear to apply a different concept of poverty. Consistent with this finding, community targeting results in higher satisfaction. PMID:25197099

  12. Characterization of Novel Operation Modes for Secondary Emission Ionization Calorimetry

    Science.gov (United States)

    Tiras, Emrah; Dilsiz, Kamuran; Ogul, Hasan; Snyder, Christina; Bilki, Burak; Onel, Yasar; Winn, David

    2017-01-01

    Secondary Emission (SE) Ionization Calorimetry is a novel technique to measure electromagnetic showers in high radiation environments. We have developed new operation modes by modifying the bias of the conventional PMT circuits. Hamamatsu single anode R7761 and multi-anode R5900-00-M16 Photomultiplier Tubes (PMTs) with modified bases are used as SE detector modules in our SE calorimetry prototype. In this detector module, the first dynode is used as the active media as opposed to photocathode. Here, we report the technical design of new modes and characterization measurements for both SE and PMT modes.

  13. Chemotherapeutic Studies on Schistosomiasis.

    Science.gov (United States)

    1978-10-01

    Mortality test and Curative Test Systems During FY78 No. WRA I R /BRAS I L IA Bn Pro phyl ac ti c Cura ti ve Numb er Dru g T est (PMT )* Tes t (PCT...the pre-estab lished priorities. 7the Primary Mortality Test (PMT) is a prophy lactic test system which uses mice exposed to 3 ,000 or more S. ma...cur- ative testing; and two compounds were designated for onl y mortality testing . (See below for description s A of t he test systems) While these

  14. Study of semi-transparent conductive layers for the realization of high quantum efficiency transmission mode CsI photocathodes for vacuum photodetectors

    Science.gov (United States)

    Barbato, F. C. T.; Valentini, A.; Casamassima, G.; Campajola, L.; Di Capua, F.

    2017-07-01

    We worked on the R&D of an innovative photodetector, the Vacuum Silicon Photomultiplier Tube (VSiPMT). The VSiPMT is composed by a photocathode and a solid state amplification stage. A semi-transparent conductive layer is necessary to supply voltage and to obtain a highly efficient CsI photocathode. Since the literature is poor on this topic we performed a systematic and detailed study of a set of semi-transparent conductive layers, made by different material and thickness. A CsI photocathode was evaporated on each sample. The impact of the semi-transparent conductive layer on the quantum efficiency of the photocathode is discussed.

  15. The impact of permanent magnetic fields on photomultiplier HAMAMATSU R7899-20 used in a hadron calorimeter of LHCb experiment

    Science.gov (United States)

    Dmitrenko, V. V.; Vorobyev, K. A.; Vlasik, K. F.; Grachev, V. M.; Muravyev-Smirnov, S. S.; Novikov, A. S.; Ulin, S. E.; Uteshev, Z. M.; Shustov, A. E.; Petrenko, D. V.; Chernysheva, I. V.; Shmatkov, I. A.

    2017-01-01

    The influence of a permanent magnetic field strength up to 40 Gs (4 mT) to operation PMT HAMAMATSU R7899-20 with its standart magnetic screens and without them is investigated. This PMT is used in a hadron calorimeter of LHCb experiment at CERN. It is shown that the use of a protective housing made of steel in joint its use with permalloy screen significantly reduces screening efficiency. It proposed to use a protective housing made from non-magnetic material (duralumin) electrolytic coated with a multilayered film as magnetic shield. This solution can be used in a hadron calorimeter, the CERN installations SHiP.

  16. Perambatan Gelombang Optik pada Grating Sinusoidal dengan Chirp dan Taper

    Directory of Open Access Journals (Sweden)

    Isnani Darti

    2009-11-01

    menggunakan MIL, dipelajari perubahan respon optik pada grating sinusoidal akibat variasi amplitudo modulasi indeks (taper dan variasi frekuensi spasial grating (chirp. Hasil simulasi menunjukkan bahwa taper menyebabkan adanya fenomena penghilangan side-lobe pada spektrum transmitansi. Adanya chirp menyebabkan penghalusan side-lobe pada spektrum transmitansi dengan semakin besar parameter chirp menyebabkan peningkatan transmitansi di sekitar pusat band-gap dari grating homogen. Selain implementasi integrasi numerik (Runge-Kutta, MIL merupakan metode eksak sehingga dapat digunakan untuk mengevaluasi validitas metode yang sering digunakan yaitu Persamaan Moda Tergandeng (PMT. Dari hasil perbandingan dapat disimpulkan bahwa secara umum PMT kurang akurat dalam menganalisis struktur grating sinusoidal baik homogen maupun tak-homogen.

  17. Deltamethrin and Permethrin in the liver and heart of Wistar rats submitted to oral subchronic exposure

    OpenAIRE

    Santos,Mônica A. T; Rodrigues,Marili V. N; Áreas, Miguel A; Reyes,Felix G. R.

    2011-01-01

    For 28 days male Wistar rats were submitted to oral exposure with 1/10 of the LD50 value of permethrin (PMT) or deltamethrin (DMT). The aim of this study was to determine the residues of PMT and DMT in the liver and heart of the rats at the end of the exposure period, as well as to evaluate the effect of ingesting pectin and cellulose via the diet. The analytes were extracted with acetonitrile and the extracts were cleaned up by solid phase extraction with florisil before GC-ECD (gas chromato...

  18. Performance of a cluster of multi-anode photomultipliers equipped with lenses for use in a prototype RICH detector

    Energy Technology Data Exchange (ETDEWEB)

    Albrecht, E.; Baker, J.; Barber, G.; Bibby, J.; Calvi, M.; Charles, M.; Duane, A.; Easo, S.; Eisenhardt, S.; Eklund, L.; French, M.; Gibson, V.; Halley, A.; Halsall, R.; Harnew, N.; John, M.J.J.; Katvars, S.G.; Libby, J. E-mail: jim.libby@cern.ch; Muheim, F.; Paganoni, M.; Petrolini, A.; Playfer, S.; Price, D.; Rademacker, J.; Smale, N.; Topp-Jorgenson, S.; Websdale, D.; Wilkinson, G.; Wotton, S.A

    2002-08-01

    A cluster of multi-anode photomultiplier tubes (MaPMTs) equipped with focusing lenses in front of the tubes was tested in a prototype ring imaging Cherenkov (RICH) detector in a charged particle beam. The readout electronics were capable of capturing the data at 40 MHz. The effects due to charged particles and magnetic field on the MaPMT performance were also studied. The results are used to evaluate the MaPMT as a possible photodetector for the LHCb RICH detectors.

  19. Performance of a cluster of Multi-anode Photomultipliers equipped with lenses for use in a prototype RICH detector

    CERN Document Server

    Albrecht, E; Barber, G J; Bibby, J; Calvi, M; Charles, M J; Duane, A; Easo, S; Eisenhardt, S; Eklund, L; French, M; Gibson, V; Halley, A; Halsall, R; Harnew, N; John, M J J; Katvars, S G; Libby, J; Muheim, F; Paganoni, M; Petrolini, A; Playfer, S; Price, D; Rademacker, J; Smale, N J; Topp-Jørgensen, S; Websdale, David M; Wilkinson, G R; Wooton, S A

    2002-01-01

    A cluster of Multi--anode Photomultiplier Tubes (MaPMTs) equipped with focusing lenses in front of the tubes was tested in a prototype Ring Imaging \\v{C}erenkov detector in a charged particle beam. The readout electronics were capable of capturing the data at 40~MHz. The effects due to charged particles and magnetic field on the MaPMT performance were also studied. The results are used to evaluate the MaPMT as a possible photodetector for the LHCb RICH detectors.

  20. Solid State Research

    Science.gov (United States)

    2010-08-26

    width at half-maximum measured at 4 K of GalnAsSb layers grown on GaSb substrates. Solid circles this work; open squares from [9]; open triangle from...Rowe N. R. Newbury A. Sanchez-Rubio C. A. Primmerman Bermuda Grass Smut Spores WhitET 0 12 3 4 5 6 Ratio (PMT1 / PMT2) Figure 1-4...measured at 4 K of GalnAsSb layers grown on GaSb sub- strates. Solid circles this work; open squares from [9]; open triangle from [10]. [9],[10

  1. A curved-grid gas proportional scintillation counter instrumented with a 25-mm active-diameter photosensor

    Energy Technology Data Exchange (ETDEWEB)

    Monteiro, C.M.B.; Morgado, R.E.; Santos, J.M.F. dos E-mail: jmf@gian.fis.uc.pt; Conde, C.A.N

    2004-04-21

    The curved-grid technique provides a simple method to compensate for the variation in solid angle viewed by the PMT in large-area gas proportional scintillation counters (GPSC), improving their performance. The scintillation region is delimited by a planar grid and a curved one, whose shape is calculated to produce a radially increasing scintillation yield, compensating for the decrease in the solid angle. In this work, we applied this technique to a GPSC instrumented with a PMT having a 25-mm diameter photocathode. The maximum ratio of the detector entrance window to the photocathode diameter thus far achieved, without significant performance degradation, is 1.

  2. Recent measurements on scintillator-photodetector systems

    Energy Technology Data Exchange (ETDEWEB)

    Sakai, E.

    1987-02-01

    The pulse height distributions from eleven kinds of scintillators coupled with a photomultiplier (PMT) and with a silicon photodiode were measured for gamma-ray energies between 14 keV and 1836 keV and compared. The numbers of photoelectrons from the PMT photocathode and those of electron-hole pairs in the photodiode were obtained. The intrinsic pulse height broadening was clearly demonstrated in NaI(T1), CsI(Na), CsI(T1) and CsI(pure) scintillators.

  3. Recent measurements on the Hamamatsu 13 in., R8055, PhotoMultiplier Tubes

    Science.gov (United States)

    The NESTOR Collaboration; Tsagli, S.; Aggouras, G.; Anassontzis, E. G.; Ball, A. E.; Chinowsky, W.; Fahrun, E.; Grammatikakis, G.; Green, C.; Grieder, P.; Katrivanos, P.; Koske, P.; Ludvig, J.; Markopoulos, E.; Minkowsky, P.; Nygren, D.; Papageorgiou, K.; Przybylski, G.; Resvanis, L. K.; Siotis, I.; Sopher, J.; Staveris, T.; Tsagli, V.; Zhukov, V. A.

    2006-11-01

    The key component of NESTOR, the deep-sea Cherenkov neutrino telescope, built in the Mediterranean, NW of Greece, is the optical module. The NESTOR Optical Module employs a PhotoMultiplier Tube (PMT) in a transparent glass pressure housing. The Hamamatsu PMT R8055-01, 13 in. photomultiplier was selected for NESTOR to replace the old 15'' Hamamatsu PMTs (R2018-03). Extensive tests have been made on the sensitivity, uniformity, time resolution and noise rates of 162 R8055-01 13 in. PMTs

  4. Performance of Hamamatsu R11410-20 PMTs under intense illumination in a two-phase cryogenic emission detector

    Science.gov (United States)

    Akimov, D. Yu.; Belov, V. A.; Bolozdynya, A. I.; Kaplin, V. A.; Khromov, A. V.; Kozlova, E. S.; Maklyaev, E. F.; Melikyan, Yu. A.; Shakirov, A. V.; Sosnovtsev, V. V.

    2016-12-01

    Hamamatsu R11410-20 PMTs are used in the RED-100 two-phase xenon emission detector built to search for the rare process of coherent elastic neutrino-nucleus scattering using intense artificial neutrino flux. We demonstrate how to adapt the PMTs for their operation under strong illumination caused by electroluminescent signals from gamma and cosmogenic muon backgrounds which are significant at shallow depth experimental sites. The PMT linearity is demonstrated for signals in the dynamic range from 1 to 2*104 photoelectrons. Impact of a photoelectric effect at the PMT first dynode to the capabilities of the RED-100 photodetection system is studied and quantified.

  5. Was the Scanner Calibration Slide used for its intended purpose?

    Science.gov (United States)

    2011-01-01

    In the article, Scanner calibration revisited, BMC Bioinformatics 2010, 11:361, Dr. Pozhitkov used the Scanner Calibration Slide, a key product of Full Moon BioSystems to generate data in his study of microarray scanner PMT response and proposed a mathematic model for PMT response [1]. In the end, the author concluded that "Full Moon BioSystems calibration slides are inadequate for performing calibration," and recommended "against using these slides." We found these conclusions are seriously flawed and misleading, and his recommendation against using the Scanner Calibration Slide was not properly supported. PMID:21510874

  6. Was the Scanner Calibration Slide used for its intended purpose?

    Directory of Open Access Journals (Sweden)

    Zong Yaping

    2011-04-01

    Full Text Available Abstract In the article, Scanner calibration revisited, BMC Bioinformatics 2010, 11:361, Dr. Pozhitkov used the Scanner Calibration Slide, a key product of Full Moon BioSystems to generate data in his study of microarray scanner PMT response and proposed a mathematic model for PMT response 1. In the end, the author concluded that "Full Moon BioSystems calibration slides are inadequate for performing calibration," and recommended "against using these slides." We found these conclusions are seriously flawed and misleading, and his recommendation against using the Scanner Calibration Slide was not properly supported.

  7. Setup a photomultiplier tube test bench for use at LHAASO-KM2A

    CERN Document Server

    Wang, Xu; Tian, Ye; Li, Changyu; Sun, Yansheng; Feng, Cunfeng

    2015-01-01

    To fulfill the requirements of testing the photomultiplier tubes of the electromagnetic detector at the Large High Altitude Air Shower Observatory (LHAASO), a multi-functional PMT test bench with a two-dimensional scanning system is developed. With this 2D scanning system, 16 PMTs are scanned simultaneously to test their uniformity and cathode transit time difference, and we can also perform PMT tests of SPE spectrum, gain vs. high voltage, linear behavior and dark noise. The programmable hardware and intelligent software of the test bench make it convenient to use and provide reliable results. The test methods are described in detail and primary results are presented.

  8. Monte Carlo simulations of GeoPET experiments: 3D images of tracer distributions (18F, 124I and 58Co) in Opalinus clay, anhydrite and quartz

    Science.gov (United States)

    Zakhnini, Abdelhamid; Kulenkampff, Johannes; Sauerzapf, Sophie; Pietrzyk, Uwe; Lippmann-Pipke, Johanna

    2013-08-01

    Understanding conservative fluid flow and reactive tracer transport in soils and rock formations requires quantitative transport visualization methods in 3D+t. After a decade of research and development we established the GeoPET as a non-destructive method with unrivalled sensitivity and selectivity, with due spatial and temporal resolution by applying Positron Emission Tomography (PET), a nuclear medicine imaging method, to dense rock material. Requirements for reaching the physical limit of image resolution of nearly 1 mm are (a) a high-resolution PET-camera, like our ClearPET scanner (Raytest), and (b) appropriate correction methods for scatter and attenuation of 511 keV—photons in the dense geological material. The latter are by far more significant in dense geological material than in human and small animal body tissue (water). Here we present data from Monte Carlo simulations (MCS) reflecting selected GeoPET experiments. The MCS consider all involved nuclear physical processes of the measurement with the ClearPET-system and allow us to quantify the sensitivity of the method and the scatter fractions in geological media as function of material (quartz, Opalinus clay and anhydrite compared to water), PET isotope (18F, 58Co and 124I), and geometric system parameters. The synthetic data sets obtained by MCS are the basis for detailed performance assessment studies allowing for image quality improvements. A scatter correction method is applied exemplarily by subtracting projections of simulated scattered coincidences from experimental data sets prior to image reconstruction with an iterative reconstruction process.

  9. Set-up and preliminary performance of a digital radiology conference system

    Institute of Scientific and Technical Information of China (English)

    王学建; 胡建; 曹军; 王波; 焦俊; 魏渝清; 王小林; 罗敏; 罗松

    2003-01-01

    Objective To investigate the set-up and preliminary performance of a digital radiology conference system and its characteristics. Methods The imaging system included a dual-screen image-text workstation with a Matrox G450 demonstration dual-head card, two multimedia projectors, a large screen, and a line-pair and grey scale test card. Patient information on radiology information system (RIS) and images on picture archiving and communication system (PACS) were fetched with GE Radworks software based on Intranet and PACS. The fetching velocity and resolution and grey scale of the images were measured. Results Patient information in the form of texts and images were demonstrated successfully on two screens with Matrox G450 demonstration dual-head card and switched rapidly between text-image two-screen and image two-screen. The image fetching velocity was fast, the resolution was high, and the grey scale was good. Conclusion The digital conference radiology system is good, and should be popularized.

  10. Deconstructing family meals: Do family structure, gender and employment status influence the odds of having a family meal?

    Science.gov (United States)

    Sharif, Mienah Z; Alcalá, Héctor E; Albert, Stephanie L; Fischer, Heidi

    2017-07-01

    We assessed the odds of having a family dinner by parental gender, family structure and parental employment. This study used data from the American Time Use Survey (ATUS) (2006-2008). Multivariate analyses assessed the odds of two outcomes among parents: 1) eating at all with children and 2) having a family dinner. Single men had lower odds of eating at all with children and eating a family dinner in comparison to partnered/married males. Partnered/married women had increased odds of eating at all with children and eating a family dinner compared to their partnered/married male counterparts. While single women had increased odds of eating at all with children compared to partnered/married males, no difference was detected in the odds of having a family dinner. Among dual-headed households, women had lower odds of eating a family dinner when both parents were employed compared a dual-headed household with employed male/non-employed female. There were no differences among men regardless of their employment status or that of their partner/spouse. Family structure, parental gender and employment status all influence the odds of having a family dinner. Future research on family meals should consider all of these factors to better understand trends and disparities across household compositions. Copyright © 2017. Published by Elsevier Ltd.

  11. Pasteurella multocida and immune cells.

    Science.gov (United States)

    Kubatzky, Katharina F

    2012-01-01

    Pasteurella multocida was first discovered by Perroncito in 1878 and named after Louis Pasteur who first isolated and described this Gram-negative bacterium as the cause of fowl disease in 1880. Subsequently, P. multocida was also found to cause atrophic rhinitis in pigs, haemorrhagic septicaemia in cattle and respiratory diseases in many other animals. Among other factors such as lipopolysaccharide, outer membrane proteins and its capsule, the protein toxin (PMT) of P. multocida is an important virulence factor that determines the immunological response of the host's immune system. However, the exact molecular mechanisms taking place in cells of the innate and adaptive immune system are largely unknown for any of these virulence factors. Due to the obvious function of PMT on cells of the porcine skeletal system where it causes bone destruction, PMT was regarded as an osteolytic protein toxin. However, it remained unclear what the actual benefit for the bacteria would be. Recently, more attention was drawn to the osteoimmunological effects of PMT and the interplay between bone and immune cells. This review summarises the knowledge of effects of P. multocida virulence factors on the host's immune system.

  12. Phase1 upgrade of the CMS-HF Calorimeter

    CERN Document Server

    Gulmez, Erhan

    2016-01-01

    In this presentation, results of the Phase I upgrade of the CMS Hadron Forward Calorimeter (HF) are discussed. The CMS-HF Calorimeter was using regular PMTs. Cherenkov light produced in the quartz fibers embedded in the iron absorber was read out with the PMTs. However, occasionally, stray muons hitting the PMT windows cause Cherenkov radiation in the PMT itself and produce large signals. These large signals mimic a very high-energy particle and are tagged as important by the trigger. To reduce this problem, PMTs had to be replaced. The four-anode PMTs that were chosen have thinner windows; thereby reducing the Cherenkov radiation in the PMT window. As part of the upgrade, the read-out electronics is to be replaced so that the PMTs are read out in two channels by connecting each pair of anodes to a single channel. Information provided by these two channels will help us reject the false signals due to the stray muons since the Cherenkov radiation in the PMT window is more likely to produce a signal only in one...

  13. Identification of poor households for premium exemptions in Ghana's National Health Insurance Scheme: empirical analysis of three strategies.

    NARCIS (Netherlands)

    Aryeetey, G.C.N.O.; Jehu-Appiah, C.; Spaan, E.J.A.M.; D'Exelle, B.; Agyepong, I.; Baltussen, R.M.P.M.

    2010-01-01

    OBJECTIVES: To evaluate the effectiveness of three alternative strategies to identify poor households: means testing (MT), proxy means testing (PMT) and participatory wealth ranking (PWR) in urban, rural and semi-urban settings in Ghana. The primary motivation was to inform implementation of the

  14. Teaching techniques in the operating room: the importance of perceptual motor teaching.

    Science.gov (United States)

    Skoczylas, Laura C; Littleton, Eliza B; Kanter, Steven L; Sutkin, Gary

    2012-03-01

    To identify sucessful teaching techniques in the operating room environment through examining the teaching of the midurethral sling (MUS) surgery. The authors distributed questionnaires with open-ended questions about teaching and learning MUS to 5 urogynecology attendings and 16 obstetrics-gynecology residents in spring 2010. In an effort to identify qualities of an effective sling teacher, the authors used grounded theory to determine common themes and to code participant responses for examples. Of 21 potential respondents, 14 (67%) returned questionnaires. The authors analyzed these and identified seven commonalities among effective sling teachers: they (1) emphasize anatomical landmarks (as determined by 64 total comments); (2) use perceptual-motor teaching (PMT; 38 comments); (3) encourage repetition (28); (4) promote early independence (34); (5) demonstrate confident competence (23); (6) maintain a calm demeanor in the operating room (20); and (7) exhibit a willingness to accept responsibility for mistakes and consequences (9). The second-most common attribute, using PMT, requires the teaching attending to emphasize the motor and tactile aspects of operating and involves incorporating not only what learners see but also what they feel. The authors report seven qualities or techniques fundamental to good teaching practice in a high-stress, high-technology surgical environment, and they have identified the use of PMT, which to their knowledge has not been previously described. Teachers and learners in this study characterized PMT, which is likely generalizable to surgical procedures other than the MUS, as important. Future research should focus on exploring this technique in other surgeries.

  15. Costs, equity, efficiency and feasibility of identifying the poor in Ghana's National Health Insurance Scheme: empirical analysis of various strategies.

    NARCIS (Netherlands)

    Aryeetey, G.C.N.O.; Jehu-Appiah, C.; Spaan, E.J.A.M.; Agyepong, I.; Baltussen, R.M.

    2012-01-01

    Objectives To analyse the costs and evaluate the equity, efficiency and feasibility of four strategies to identify poor households for premium exemptions in Ghana's National Health Insurance Scheme (NHIS): means testing (MT), proxy means testing (PMT), participatory wealth ranking (PWR) and geograph

  16. Chemotherapeutic Studies on Schistosomiasis and Clinical, Epidemiological and Immunological Studies on Malaria in Amazonas, Brazil, along the Ituxi River. Report Number VII.

    Science.gov (United States)

    1980-10-01

    Prophylactic ( Mortality ) Testing (Pt4T) were conducted. In the PMT, test results for 430 different compounds were compiled. Of these 150 were toxic and 6 were...especially those of related chemical classes to those compounds already identified as potentially active. 2. Continue secondary cura -tive testing on

  17. 4x10Gb/s WDM Bi-directional Gating in a Semiconductor Optical Amplifier by Using Polarization Multiplexing Technique

    DEFF Research Database (Denmark)

    Yu, Jianjun; Jeppesen, Palle

    2000-01-01

    Bi-directional SOA gating can further reduce the number of gating elements in the space switch, we demonstrate that a conventional SOA employing polarization multiplexing technique (PMT) can be used for bi-directional WDM gating operation at 10Gb/s....

  18. Characterization of O-mannosyltransferase family in Schizosaccharomyces pombe.

    Science.gov (United States)

    Tanaka, Naotaka; Fujita, Yasuko; Suzuki, Shotaro; Morishita, Masayo; Giga-Hama, Yuko; Shimoda, Chikashi; Takegawa, Kaoru

    2005-05-13

    Protein O-glycosylation is an essential protein modification in eukaryotic cells. In Saccharomyces cerevisiae, O-mannosylation is initiated in the lumen of the endoplasmic reticulum by O-mannosyltransferase gene products (Pmt1p-7p). A search of the Schizosaccharomyces pombe genome database revealed a total of three O-glycoside mannosyltransferase homologs (ogm1+, ogm2+, and ogm4+), closely related to Saccharomyces cerevisiae PMT1, PMT2, and PMT4. Although individual ogm genes were not found to be essential, ogm1Delta and ogm4Delta mutants exhibited aberrant morphology and failed to agglutinate during mating. The phenotypes of the ogm4Delta mutant were not complemented by overexpression of ogm1+ or ogm2+, suggesting that each of the Ogm proteins does not have overlapping functions. Heterologous expression of a chitinase from S. cerevisiae in the ogm mutants revealed that O-glycosylation of chitinase had decreased in ogm1Delta cells. A GFP-tagged Fus1p from S. cerevisiae was specifically not glycosylated and accumulated in the Golgi in ogm4Delta cells. These results indicate that O-glycosylation initiated by Ogm proteins plays crucial physiological roles and can serve as a sorting determinant for protein transport of membrane glycoproteins in S. pombe.

  19. The design and performance of a prototype water Cherenkov optical time-projection chamber

    CERN Document Server

    Oberla, E

    2015-01-01

    A first experimental test of tracking relativistic charged particles by `drifting' Cherenkov photons in a water-based optical time-projection chamber (OTPC) has been performed at the Fermilab Test Beam Facility. The prototype OTPC detector consists of a 77~cm long, 28~cm diameter, 40~kg cylindrical water mass instrumented with a combination of commercial $5.1\\times5.1$~cm$^2$ micro-channel plate photo-multipliers (MCP-PMT) and $6.7\\times6.7$~cm$^2$ mirrors. Five MCP-PMTs are installed in two columns along the OTPC cylinder in a small-angle stereo configuration. A mirror is mounted opposite each MCP-PMT on the far side of the detector cylinder, effectively doubling the photo-detection efficiency and providing a time-resolved image of the Cherenkov light on the opposing wall. Each MCP-PMT is coupled to an anode readout consisting of thirty 50 Ohm microstrips. A 180-channel data acquisition system digitizes the MCP-PMT signals on one end of the microstrips using the PSEC4 waveform sampling-and-digitizing chip op...

  20. Photomultiplier tube calibration based on Na lidar observation and its effect on heat flux bias.

    Science.gov (United States)

    Liu, Alan Z; Guo, Yafang

    2016-11-20

    Na lidar can measure vertical wind and temperature at high temporal and vertical resolutions, enough to resolve gravity wave perturbations. Heat flux due to dissipating gravity waves is an important quantity that can be derived from such perturbations. When lidar signals are high, a photomultiplier tube (PMT) used to count incoming photons may suffer from the saturation effect, and its output count is not linearly related to incoming photon counts. Corrections to this effect can be measured in a laboratory setting but may have large errors at high count rates. We show that the errors in the PMT correction can cause significant bias in the heat flux calculation due to the inherent correlation between wind and temperature errors. Using the measurements made by Na lidar at the Andes Lidar Observatory with Hamamatsu PMTs, we developed a calibration procedure to remove such PMT correction errors from laboratory measurements. By applying the revised PMT correction curve we demonstrated that the heat flux bias can be removed through this procedure.

  1. Inertial bioluminescence rhythms at the Capo Passero (KM3NeT-Italia) site, Central Mediterranean Sea

    Science.gov (United States)

    Aguzzi, J.; Fanelli, E.; Ciuffardi, T.; Schirone, A.; Craig, J.; Aiello, S.; Ameli, F.; Anghinolfi, M.; Barbarino, G.; Barbarito, E.; Beverini, N.; Biagi, S.; Biagioni, A.; Bouhadef, B.; Bozza, C.; Cacopardo, G.; Calamai, M.; Calì, C.; Capone, A.; Caruso, F.; Cecchini, S.; Ceres, A.; Chiarusi, T.; Circella, M.; Cocimano, R.; Coniglione, R.; Costa, M.; Cuttone, G.; D’Amato, C.; D’Amico, A.; De Bonis, G.; De Luca, V.; Deniskina, N.; Distefano, C.; Di Mauro, L. S.; Fermani, P.; Ferrara, G.; Flaminio, V.; Fusco, L. A.; Garufi, F.; Giordano, V.; Gmerk, A.; Grasso, R.; Grella, G.; Hugon, C.; Imbesi, M.; Kulikovskiy, V.; Larosa, G.; Lattuada, D.; Leismüller, K. P.; Leonora, E.; Litrico, P.; Lonardo, A.; Longhitano, F.; Presti, D. Lo; Maccioni, E.; Margiotta, A.; Marinelli, A.; Martini, A.; Masullo, R.; Mele, R.; Migliozzi, P.; Migneco, E.; Miraglia, A.; Mollo, C. M.; Mongelli, M.; Morganti, M.; Musico, P.; Musumeci, M.; Nicolau, C. A.; Orlando, A.; Orzelli, A.; Papaleo, R.; Pellegrino, C.; Pellegriti, M. G.; Perrina, C.; Piattelli, P.; Poma, E.; Pulvirenti, S.; Raffaelli, F.; Randazzo, N.; Riccobene, G.; Rovelli, A.; Sanguineti, M.; Sapienza, P.; Sciacca, V.; Sgura, I.; Simeone, F.; Sipala, V.; Speziale, F.; Spitaleri, A.; Spurio, M.; Stellacci, S. M.; Taiuti, M.; Terreni, G.; Trasatti, L.; Trovato, A.; Versari, F.; Vicini, P.; Viola, S.; Vivolo, D.

    2017-01-01

    In the deep sea, the sense of time is dependent on geophysical fluctuations, such as internal tides and atmospheric-related inertial currents, rather than day-night rhythms. Deep-sea neutrino telescopes instrumented with light detecting Photo-Multiplier Tubes (PMT) can be used to describe the synchronization of bioluminescent activity of abyssopelagic organisms with hydrodynamic cycles. PMT readings at 8 different depths (from 3069 to 3349 m) of the NEMO Phase 2 prototype, deployed offshore Capo Passero (Sicily) at the KM3NeT-Italia site, were used to characterize rhythmic bioluminescence patterns in June 2013, in response to water mass movements. We found a significant (p bioluminescence signal, corresponding to inertial fluctuations. Waveform and Fourier analyses of PMT data and tower orientation were carried out to identify phases (i.e. the timing of peaks) by subdividing time series on the length of detected inertial periodicity. A phase overlap between rhythms and cycles suggests a mechanical stimulation of bioluminescence, as organisms carried by currents collide with the telescope infrastructure, resulting in the emission of light. A bathymetric shift in PMT phases indicated that organisms travelled in discontinuous deep-sea undular vortices consisting of chains of inertially pulsating mesoscale cyclones/anticyclones, which to date remain poorly known. PMID:28332561

  2. Adolescents' protection motivation and smoking behaviour

    NARCIS (Netherlands)

    Thrul, J.; Stemmler, M.; Bühler, A.; Kuntsche, E.N.

    2013-01-01

    The protection motivation theory (PMT) is a well-known theory of behaviour change. This study tested the applicability of the sub-constructs of threat and coping appraisal in predicting adolescents' smoking-related behavioural intentions and smoking behaviour longitudinally. Adolescents (N = 494) ag

  3. Time-Synchronized CW-Laser Induced Fluorescence Velocity Measurements of a Diverging Cusped Field Thruster

    Science.gov (United States)

    2013-10-01

    signal is collected by a 100 mm diameter plano -convex lens with a focal length of 250 mm. This lens is oriented 30◦ from the exit plane, a distance of...the vacuum chamber and is focused into a 125 mm focal length monochromator with a photomultiplier tube (PMT) by a second 100 mm diameter plano -convex

  4. Mechanisms of Char Formation during Flammability.

    Science.gov (United States)

    1980-02-25

    CCO. and the resulting polybenzoxazole from 4-NO2 PMT has higher heat resistance than that from 4-NO 2PMI. Although poly(3-nitro-1,4-phenylene tere...Combust., 9th, Cornell Univ., Ithaca, NY, pp. 733-46 (1962). 5. J. Preston, High Performance Fibers from Aromatic Polymers,. Polymer Eng. and Sd., 16(5

  5. Simultaneous and sensitive detection of dopamine and uric acid using a poly(L-methionine)/gold nanoparticle-modified glassy carbon electrode

    Institute of Scientific and Technical Information of China (English)

    Reza Ojani; Jahan-Bakhsh Raoof; Ali Asghar Maleki; Saeid Safshekan

    2014-01-01

    A novel electrochemical sensor was fabricated by electrodeposition of gold nanoparticles on a poly(L-methionine) (PMT)-modified glassy carbon electrode (GCE) to form a nano-Au/PMT compo-site-modified GCE (nano-Au/PMT/GCE). Scanning electron microscopy and electrochemical tech-niques were used to characterize the composite electrode. The modified electrode exhibited con-siderable electrocatalytic activity towards the oxidation of dopamine (DA) and uric acid (UA) in phosphate buffer solution (pH = 7.00). Differential pulse voltammetry revealed that the electrocat-alytic oxidation currents of DA and UA were linearly related to concentration over the range of 5.0 × 10-8 to 10-6 mol/L for DA and 7.0 × 10-8 to 10-6 mol/L for UA. The detection limits were 3.7 × 10-8 mol/L for DA and 4.5 × 10-8 mol/L for UA at a signal-to-noise ratio of 3. According to our experi-mental results, nano-Au/PMT/GCE can be used as a sensitive and selective sensor for simultaneous determination of DA and UA.

  6. Performance of new 8-inch photomultiplier tube used for the Tibet muon-detector array

    CERN Document Server

    Huang, Ying Zhangm Jing; Zhai, Liu-Ming; Chen, Xu; Hu, Xiao-Bin; Lin, Yu-Hui; Zhang, Xue-Yao; Feng, Cun-Feng; Jia, Huan-Yu; Zhou, Xun-Xiu; Dan-Zen, Luo-bu; Chen, Tian-Lu; Laba, Ci-Ren; Mao-Yuan,; Gao, Qi; Zha-xi, Ci-ren

    2016-01-01

    A new hybrid experiment has been constructed to measure the chemical composition of cosmic rays around the "knee" in the wide energy range by the Tibet AS$\\gamma$ collaboration at Tibet, China, since 2014. They consist of a high-energy air-shower-core array (YAC-II), a high-density air-shower array (Tibet-III) and a large underground water-Cherenkov muon-detector array (MD). In order to obtain the primary proton, helium and iron spectra and their "knee" positions in the energy range lower than $10^{16}$ eV, each of PMTs equipped to the MD cell is required to measure the number of photons capable of covering a wide dynamic range of 100 - $10^{6}$ photoelectrons (PEs) according to Monte Carlo simulations. In this paper, we firstly compare the characteristic features between R5912-PMT made by Japan Hamamatsu and CR365-PMT made by Beijing Hamamatsu. This is the first comparison between R5912-PMT and CR365-PMT. If there exists no serious difference, we will then add two 8-inch-in-diameter PMTs to meet our requirem...

  7. Near Field Imaging for the Characterization of Diffusion Length and Waveguiding in Zinc Oxide Nanowires

    Science.gov (United States)

    2012-06-01

    SECURITY CLASSIFICATION OF REPORT Unclassified 18. SECURITY CLASSIFICATION OF THIS PAGE Unclassified 19. SECURITY CLASSIFICATION OF ABSTRACT...deposition ( PVD ) on silicon substrate. Sample mounted on sample holder by light adhesive. Copper tape and wire electrically grounds sample to NSOM stage...Field Scanning Optical Microscope PMT Photomultiplier Tube PVD Physical Vapor Deposition SEM Scanning Electron Microscope SPM Scanning

  8. Psychomotor therapy and aggression regulation in eating disorders

    NARCIS (Netherlands)

    Boerhout, Cees; van Busschbach, Jooske T.; Wiersma, Durk; Hoek, Hans W.

    2013-01-01

    Eating disorder behaviours can be seen as self-destructive behaviours to a great extent related to inhibited anger expression. However, a treatment protocol targeted at anger and aggression in these disorders is lacking. This paper describes a psychomotor therapy (PMT) model as a body-oriented metho

  9. Light Readout Optimisation using Wavelength Shifter - Reflector Combinations

    Energy Technology Data Exchange (ETDEWEB)

    Mavrokoridis, Konstantinos, E-mail: k.mavrokoridis@liverpool.ac.uk [Department of Physics, University of Liverpool, Oliver Lodge Lab, Oxford Street, Liverpool, L69 7ZE (United Kingdom)

    2011-07-25

    The use of reflectors coated with a wavelength shifter (WLS) along with standard bialkali PMTs is an economical method for an efficient readout system for vacuum ultra violet (VUV) light produced in large liquid argon detectors. Various thicknesses of tetraphenyl butadiene (TPB) were deposited by spraying and vacuum evaporation onto both specular 3M{sup TM}-foil and diffuse Tetratex{sup TM} (TTX) reflectors. 128 nm VUV light generated in 1 bar argon gas by a 5.4 MeV {alpha} source was detected by a 3-inch bialkali borosilicate PMT within a 1 m tube lined internally with a TPB coated reflector. The light collection was recorded as a function of separation between source and PMT for each combination of coating and reflector for distances up to 1m. Reflection coefficients of TPB coated reflectors were measured using a spectroradiometer. WLS coating on the PMT window was also studied. The optimum coating and reflector combination was TPB evaporated on TTX. Measurements with coating thicknesses of 0.2 mg/cm{sup 2} and 1.0 mg/cm{sup 2} yielded a similar performance. The best PMT window coating is obtained by TPB evaporation of 0.05 mg/cm{sup 2}.

  10. In-Situ Measurement of Relative Attenuation Length of Gadolinium-Loaded Liquid Scintillator Using Source Data at RENO Experiment

    CERN Document Server

    Kim, H S; Choi, J H; Choi, W Q; Choi, Y; Jang, H I; Jang, J S; Joo, K K; Kim, B R; Kim, J Y; Kim, S B; Kim, W; Kwon, E; Lee, D H; Lim, I T; Pac, M Y; Park, I G; Park, J S; Park, R G; Seo, H; Seo, S H; Seon, Y G; Shin, C D; Yeo, I S; Yu, I

    2016-01-01

    We present an in-situ method of measuring the relative attenuation length of gadolinium-loaded liquid scintillator in the RENO detectors using radioactive source calibration data without requiring any PMT performance model. We observed the degradation of the attenuation length of the gadolinium-loaded liquid scintillator in the RENO detectors by ~50% over a period of about 4 years.

  11. Drug: D06194 [KEGG MEDICUS

    Lifescience Database Archive (English)

    Full Text Available ulfide bridge: 86-146; 192-250, Dimer: 51; 54) Peptide P-selectin antagonist 42-89-glycoprotein (human clone PMT21:PL85 P-selectin... glycoprotein ligand 1) fusion protein with immunoglobulin (human constant region) P-selectin

  12. Calibrating the MINERvA detector

    Energy Technology Data Exchange (ETDEWEB)

    Mousseau, Joel [University of Florida, Gainesville FL, 32611 (United States)

    2012-08-15

    The MINERvA experiment, located at Fermilab, will use the NuMI beam line for measuring neutrino-nucleus interaction rates with very high precision. In order to obtain the unprecedented precision MINERvA is capable of, sophisticated calibration techniques are applied both prior to installation and in situ.Calibration of PMT gains and scintillator response is discussed.

  13. Exploring the Impact of Parental Psychopathology and Emotion Regulation on Evidence-Based Parenting Interventions: A Transdiagnostic Approach to Improving Treatment Effectiveness

    Science.gov (United States)

    Maliken, Ashley C.; Katz, Lynn Fainsilber

    2013-01-01

    Parenting interventions, particularly those categorized as parent management training (PMT), have a large evidence base supporting their effectiveness with most families who present for treatment of childhood behavior problems. However, data suggest that PMTs are not effective at treating all families who seek services. Parental psychopathology…

  14. Laser Spectroscopy Investigations of Materials for Solid State Laser Systems.

    Science.gov (United States)

    1988-02-01

    Experimental geometry for anisotropic self-diffraction expert. Permanent address: Departamento de Optics y Estructura de Is Materia, mints. e refers to the...the helium-neon laser and PMT is the photo- "Permanent address: Departamento de Optics y Estructura de Ia Materia, multiplier tube. The results are sent

  15. Exploring the Impact of Parental Psychopathology and Emotion Regulation on Evidence-Based Parenting Interventions: A Transdiagnostic Approach to Improving Treatment Effectiveness

    Science.gov (United States)

    Maliken, Ashley C.; Katz, Lynn Fainsilber

    2013-01-01

    Parenting interventions, particularly those categorized as parent management training (PMT), have a large evidence base supporting their effectiveness with most families who present for treatment of childhood behavior problems. However, data suggest that PMTs are not effective at treating all families who seek services. Parental psychopathology…

  16. Extension of photomultiplier tube dynamic range for the LHAASO-KM2A electromagnetic particle detectors

    Energy Technology Data Exchange (ETDEWEB)

    Lv, Hongkui, E-mail: lvhk@ihep.ac.cn [Key Laboratory of Particle Astrophysics, Institute of High Energy Physics, Chinese Academy of Sciences, Beijing 100049 (China); University of Chinese Academy of Sciences, Beijing 100049 (China); Sheng, Xiangdong; He, Huihai; Liu, Jia [Key Laboratory of Particle Astrophysics, Institute of High Energy Physics, Chinese Academy of Sciences, Beijing 100049 (China); Zhang, Zhongquan [Shandong University, Jinan 250100 (China); Hou, Chao; Zhao, Jing [Key Laboratory of Particle Astrophysics, Institute of High Energy Physics, Chinese Academy of Sciences, Beijing 100049 (China)

    2015-05-01

    In the Large High Altitude Air Shower Observatory (LHAASO), the 1 km{sup 2} array (KM2A) requires linear measurement of optical intensity with a wide dynamic range. Over 5000 photomultiplier tubes (PMTs) are employed in this experiment and developed as “two outputs” device (anode and dynode) to meet the relevant requirements. In this study, the linearity of the anode and the eighth dynode (DY8), which is limited by space charge effects and mainly related to the relative dynode voltage ratios of the PMT divider, is examined. A voltage divider for the Hamamatsu R11102 PMT is designed and a dramatically enhanced linearity is demonstrated. Test results show that this design can cover a wide dynamic range from 20 to 2×10{sup 5} photoelectrons and achieve a peak anode current of 380 mA at a PMT gain of 10{sup 5}, which satisfies the requirements of KM2A electromagnetic particle detectors. The circuit design has been successfully simulated using the simulation software Multisim. The details of PMT performance tests and simulations are described.

  17. High-resolution electrophoretic separation and integrated-waveguide excitation of fluorescent DNA molecules in a lab on a chip

    NARCIS (Netherlands)

    Dongre, Chaitanya; Weerd, van Jasper; Besselink, Geert A.J.; Weeghel, van Rob; Martinez-Vazquez, Rebecca; Osellame, Roberto; Cerullo, Giulio; Cretich, Marina; Chiari, Marcella; Hoekstra, Hugo J.W.M.; Pollnau, Markus

    2010-01-01

    By applying integrated-waveguide laser excitation to an optofluidic chip, fluorescently labeled DNA molecules of 12 or 17 different sizes are separated by CE with high operating speed and low sample consumption of ~600 pL. When detecting the fluorescence signals of migrating DNA molecules with a PMT

  18. Postmortem time estimation using body temperature and a finite-element computer model

    NARCIS (Netherlands)

    Hartog, E.A. den; Lotens, W.A.

    2004-01-01

    In the Netherlands most murder victims are found 2-24 h after the crime. During this period, body temperature decrease is the most reliable method to estimate the postmortem time (PMT). Recently, two murder cases were analysed in which currently available methods did not provide a su.ciently reliabl

  19. Gas Cherenkov Detectors For Gamma Ray Measurements At The National Ignition Facility (NIF)

    Science.gov (United States)

    Herrmann, Hans W.; Kim, Y. H.; Zylstra, A. B.; Lopez, F. E.; Griego, J.; Fatherley, V. E.; Oertel, J. A.; Batha, S. H.; Carpenter, A.; Khater, H.; Hernandez, J. E.; Rubery, M. S.; Horsfield, C. J.; Gales, S.; Leatherland, A.; Hilsabeck, T.; Kilkenny, J. D.; Malone, R. M.; Hares, J. D.; Milnes, J.; Shmayda, W. T.

    2016-10-01

    New requirements to improve reaction history and ablator areal density measurements at the NIF necessitate diagnostic capability improvements in sensitivity, temporal and spectral response relative to the existing Gamma Reaction History diagnostic (GRH-6m) located 6 meters from target chamber center (TCC). Relative to GRH-6m, a new DIM-based ``Super'' Gas Cherenkov Detector (GCD) will ultimately provide 200x more sensitivity to DT fusion gamma rays, reduce the effective temporal resolution from 100 to 10 ps and lower the energy threshold from 2.9 to 1.8 MeV. Initially, the existing GCD-3 will be placed into a reentrant well, putting it within 4 meters of TCC. This diagnostic platform will allow assessment of the x-ray radiation background environment within the well which will be fed into the shielding design for the follow-on ``Super'' GCD. It will also enable use of a pulse-dilation PMT (PD-PMT) which has the potential to improve the effective measurement bandwidth by 10x relative to current PMT technology. Initial measurements of both GCD-3 on NIF and a PD-PMT prototype on ORION will be discussed.

  20. Promoter activity of a putative pollen monosaccharide transporter in Petunia hybrida and characterisation of a transposon insertion mutant

    NARCIS (Netherlands)

    Garrido, D.; Busscher-Lange, J.; Tunen, van A.J.

    2006-01-01

    For the growth of the male reproductive cells of plants, the pollen, the presence of sufficient sucrose or monosaccharides is of vital importance. From Petunia hybrida a pollen-specific putative monosaccharide transporter designated PMT1 (for petunia monosaccharide transporter) has been identified p

  1. Botrytis cinerea protein O-mannosyltransferases play critical roles in morphogenesis, growth, and virulence.

    Directory of Open Access Journals (Sweden)

    Mario González

    Full Text Available Protein O-glycosylation is crucial in determining the structure and function of numerous secreted and membrane-bound proteins. In fungi, this process begins with the addition of a mannose residue by protein O-mannosyltransferases (PMTs in the lumen side of the ER membrane. We have generated mutants of the three Botrytis cinerea pmt genes to study their role in the virulence of this wide-range plant pathogen. B. cinerea PMTs, especially PMT2, are critical for the stability of the cell wall and are necessary for sporulation and for the generation of the extracellular matrix. PMTs are also individually required for full virulence in a variety of hosts, with a special role in the penetration of intact plant leaves. The most significant case is that of grapevine leaves, whose penetration requires the three functional PMTs. Furthermore, PMT2 also contributes significantly to fungal adherence on grapevine and tobacco leaves. Analysis of extracellular and membrane proteins showed significant changes in the pattern of protein secretion and glycosylation by the pmt mutants, and allowed the identification of new protein substrates putatively glycosylated by specific PMTs. Since plants do no possess these enzymes, PMTs constitute a promising target in the development of novel control strategies against B. cinerea.

  2. ‘Beweging in trauma’ : psychomotorische therapie in de stabilisatiefase van complex trauma

    NARCIS (Netherlands)

    Scheffers, Mia; Nissen, Ingrid; Verveld, Sjoukje; Berkel, Krista van; Hatzmann, Janneke; Busschbach, Jooske van

    2016-01-01

    Aanleiding tot het schrijven van deze module is het onderzoek 'Beweging in trauma' naar het effect van psychomotorische therapie (PMT) in de stabilisatiefase van complex trauma. Dit onderzoek werd uitgevoerd met financiering vanuit het RAAK-Publiek programma. Eén van de doelen van dit programma is h

  3. Enhanced red and near infrared detection in flow cytometry using avalanche photodiodes.

    Science.gov (United States)

    Lawrence, William G; Varadi, Gyula; Entine, Gerald; Podniesinski, Edward; Wallace, Paul K

    2008-08-01

    Polychromatic flow cytometry enables detailed identification of cell phenotype using multiple fluorescent parameters. The photomultiplier tubes (PMTs) used to detect fluorescence in current instruments limit the sensitivity in the long wavelength spectral range. We demonstrate the flow cytometric applications of silicon avalanche photodiodes (APDs), which have improved red sensitivity and a working fluorescence detection range beyond 1,000 nm. A comparison of the wavelength-dependent performance of the APD and PMT was carried out using pulsed light-emitting diode sources, calibrated test beads, and biological samples. A breadboard flow cytometer test bench was constructed to compare the performance of PMTs and APD detectors. The APD used an additional amplifier stage to match the internal gain of the PMT. The resolution of the APD and PMT was compared for flow cytometry applications using a pulsed light-emitting diode source over the 500-1060 nm spectral range. These measurements showed the relative changes in the signal-to-noise performance of the APD and PMT over a broad spectral range. Both the APD and PMTs were used to measure the signal-to-noise response for a set of six peak calibration beads over the 530-800 nm wavelength range. CD4-positive cells labeled with antibody-conjugated phycoerythrin or 800 nm quantum dots were identified by simultaneous detection using the APD and the PMT. The ratios of the intensities of the CD4- and CD4+ populations were found to be similar for both detectors in the visible wavelengths, but only the APD was able to separate these populations at wavelengths above 800 nm. These measurements illustrate the differences in APD and PMT performance at different wavelengths and signal intensity levels. While the APD and PMT show similar signal-to-noise performance in the visible spectral range, the dark noise of the APD detector reduces the sensitivity at low signal levels. At wavelengths longer than 650 nm, the high quantum efficiency

  4. Evaluating the fall risk among elderly population by choice step reaction test

    Directory of Open Access Journals (Sweden)

    Wang D

    2016-08-01

    Full Text Available Donghai Wang,1 Jian Zhang,1 Yuliang Sun,2 Wenfei Zhu,2 Shiliu Tian,1 Yu Liu1 1Key Laboratory of Exercise and Health Sciences of the Ministry of Education, Shanghai University of Sport, Shanghai, People’s Republic of China; 2School of Physical Education, Shaanxi Normal University, Xian, People’s Republic of China Abstract: Falls during daily activities are often associated with injuries and physical disabilities, thereby affecting quality of life among elder adults. Balance control, which is crucial in avoiding falls, is composed of two elements: muscle strength and central nervous system (CNS control. A number of studies have reported that reduced muscle strength raises the risk of falling. However, to date there has been only limited research focused on the relationship between fall risk and the CNS. This study aimed to investigate the relationship between CNS and risk of falling among the elderly. A total of 140 elderly people (92 females and 48 males were divided into faller and nonfaller groups based on questionnaire responses concerning falls in their daily life. Participants undertook a choice step reaction test in which they were required to respond to random visual stimuli using foot movements as fast as possible in the left or right directions. Response time was quantified as premotor time (PMT and motor time (MT. In addition, the participants’ electromyography data were recorded during the choice step reaction test. A maximal isokinetic torque test was also performed. PMT was greater in the fallers than in the nonfallers group. There was a significant difference between fall status and direction on PMT. PMT of the left limb in nonfallers was faster than the right, but in fallers there was no difference between left and right limbs. A similar phenomenon was also observed for MT. There were significant differences between fallers and nonfallers in maximum isokinetic torque at knee and ankle joints. The correct rate of PMT was

  5. Evaluating the fall risk among elderly population by choice step reaction test

    Science.gov (United States)

    Wang, Donghai; Zhang, Jian; Sun, Yuliang; Zhu, Wenfei; Tian, Shiliu; Liu, Yu

    2016-01-01

    Falls during daily activities are often associated with injuries and physical disabilities, thereby affecting quality of life among elder adults. Balance control, which is crucial in avoiding falls, is composed of two elements: muscle strength and central nervous system (CNS) control. A number of studies have reported that reduced muscle strength raises the risk of falling. However, to date there has been only limited research focused on the relationship between fall risk and the CNS. This study aimed to investigate the relationship between CNS and risk of falling among the elderly. A total of 140 elderly people (92 females and 48 males) were divided into faller and nonfaller groups based on questionnaire responses concerning falls in their daily life. Participants undertook a choice step reaction test in which they were required to respond to random visual stimuli using foot movements as fast as possible in the left or right directions. Response time was quantified as premotor time (PMT) and motor time (MT). In addition, the participants’ electro-myography data were recorded during the choice step reaction test. A maximal isokinetic torque test was also performed. PMT was greater in the fallers than in the nonfallers group. There was a significant difference between fall status and direction on PMT. PMT of the left limb in nonfallers was faster than the right, but in fallers there was no difference between left and right limbs. A similar phenomenon was also observed for MT. There were significant differences between fallers and nonfallers in maximum isokinetic torque at knee and ankle joints. The correct rate of PMT was higher than other variables, such as MT and maximal isokinetic torque, in evaluating elderly fall risk by using logistic regression analyses. The results suggest that PMT in the choice step reaction test could be a useful parameter to assess risk of fall among elder adults. In addition, decreased maximal isokinetic torque was related to greater

  6. Identification of poor households for premium exemptions in Ghana's National Health Insurance Scheme: empirical analysis of three strategies.

    Science.gov (United States)

    Aryeetey, Genevieve Cecilia; Jehu-Appiah, Caroline; Spaan, Ernst; D'Exelle, Ben; Agyepong, Irene; Baltussen, Rob

    2010-12-01

    To evaluate the effectiveness of three alternative strategies to identify poor households: means testing (MT), proxy means testing (PMT) and participatory wealth ranking (PWR) in urban, rural and semi-urban settings in Ghana. The primary motivation was to inform implementation of the National Health Insurance policy of premium exemptions for the poorest households. Survey of 145-147 households per setting to collect data on consumption expenditure to estimate MT measures and of household assets to estimate PMT measures. We organized focus group discussions to derive PWR measures. We compared errors of inclusion and exclusion of PMT and PWR relative to MT, the latter being considered the gold standard measure to identify poor households. Compared to MT, the errors of exclusion and inclusion of PMT ranged between 0.46-0.63 and 0.21-0.36, respectively, and of PWR between 0.03-0.73 and 0.17-0.60, respectively, depending on the setting. Proxy means testing and PWR have considerable errors of exclusion and inclusion in comparison with MT. PWR is a subjective measure of poverty and has appeal because it reflects community's perceptions on poverty. However, as its definition of the poor varies across settings, its acceptability as a uniform strategy to identify the poor in Ghana may be questionable. PMT and MT are potential strategies to identify the poor, and their relative societal attractiveness should be judged in a broader economic analysis. This study also holds relevance to other programmes that require identification of the poor in low-income countries. © 2010 Blackwell Publishing Ltd.

  7. Investigation of the Role of Training Health Volunteers in Promoting Pap Smear Test Use among Iranian Women Based on the Protection Motivation Theory.

    Science.gov (United States)

    Ghahremani, Leila; Harami, Zahra Khiyali; Kaveh, Mohammad Hossein; Keshavarzi, Sareh

    2016-01-01

    Cervical cancer is known as one of the most prevalent types of cancers and a major public health problem in developing countries which can be detected by Pap test, prevented, and treated. Despite the effective role of Pap test in decreasing the incidence and mortality due to cervical cancer, it is still one the most common causes of cancer-related deaths among women, especially in developing countries. Thus, this study aimed to examine the effect of educational interventions implemented by health volunteers based on protection motivation theory (PMT) on promoting Pap test use among women. This quasi-experimental study was conducted on 60 health volunteers and 420 women. The study participants were divided into an intervention and a control group. Data were collected using a valid self-reported questionnaire including demographic variables and PMT constructs which was completed by both groups before and 2 months after the intervention. Then, the data were entered into the SPSS statistical software, version 19 and were analyzed using Chi-square test, independent T-test, and descriptive statistical methods. P<0.05 was considered as statistically significant. The findings of this study showed that the mean scores of PMT constructs (i.e. perceived vulnerability, perceived severity, fear, response-costs, self-efficacy, and intention) increased in the intervention group after the intervention (P<0.001). However, no significant difference was found between the two groups regarding response efficacy after the intervention (P=0.06). The rate of Pap test use also increased by about 62.9% among the study women. This study showed a significant positive relationship between PMT-based training and Pap test use. The results also revealed the successful contribution of health volunteers to training cervical cancer screening. Thus, training interventions based on PMT are suggested to be designed and implemented and health volunteers are recommended to be employed for educational

  8. Can anti-speeding messages based on protection motivation theory influence reported speeding intentions?

    Science.gov (United States)

    Glendon, A Ian; Walker, Britta L

    2013-08-01

    The study investigated the effects of anti-speeding messages based on protection motivation theory (PMT) components: severity, vulnerability, rewards, self-efficacy, response efficacy, and response cost, on reported speeding intentions. Eighty-three participants aged 18-25 years holding a current Australian driver's license completed a questionnaire measuring their reported typical and recent speeding behaviors. Comparisons were made between 18 anti-speeding messages used on Australian roads and 18 new anti-speeding messages developed from the PMT model. Participants reported their reactions to the 36 messages on the perceived effectiveness of the message for themselves and for the general population of drivers, and also the likelihood of themselves and other drivers driving within the speed limit after viewing each message. Overall the PMT model-derived anti-speeding messages were better than jurisdiction-use anti-speeding messages in influencing participants' reported intention to drive within the speed limit. Severity and vulnerability were the most effective PMT components for developing anti-speeding messages. Male participants reported significantly lower intention to drive within the speed limit than did female participants. However, males reported significantly higher intention to drive within the speed limit for PMT-derived messages compared with jurisdiction-based messages. Third-person effects were that males reported anti-speeding messages to be more effective for the general driving population than for themselves. Females reported the opposite effect - that all messages would be more effective for themselves than for the general driving population. Findings provided support for using a sound conceptual basis as an effective foundation for anti-speeding message development as well as for evaluating proposed anti-speeding messages on the target driver population. Copyright © 2013 Elsevier Ltd. All rights reserved.

  9. Prevalence and predictors of complementary and alternative medicine use among people with coronary heart disease or at risk for this in the sixth Tromsø study: a comparative analysis using protection motivation theory.

    Science.gov (United States)

    Kristoffersen, Agnete E; Sirois, Fuschia M; Stub, Trine; Hansen, Anne Helen

    2017-06-19

    Engagement in healthy lifestyle behaviors, such as healthy diet and regular physical activity, are known to reduce the risk of developing coronary heart disease (CHD). Complementary and alternative medicine (CAM) is known to be associated with having a healthy lifestyle. The primary aim of this study was to examine the prevalence and predictors of CAM use in CHD patients, and in those without CHD but at risk for developing CHD, using Protection Motivation Theory (PMT) as a guiding conceptual framework. Questionnaire data were collected from 12,981 adult participants in the cross-sectional sixth Tromsø Study (2007-8). Eligible for analyses were 11,103 participants who reported whether they had used CAM or not. Of those, 830 participants reported to have or have had CHD (CHD group), 4830 reported to have parents, children or siblings with CHD (no CHD but family risk), while 5443 reported no CHD nor family risk of CHD. We first compared the patterns of CAM use in each group, and then examined the PMT predictors of CAM use. Health vulnerability from the threat appraisal process of PMT was assessed by self-rated health and expectations for future health. Response efficacy from the coping appraisal process of PMT was assessed as preventive health beliefs and health behavior frequency. Use of CAM was most commonly seen in people with no CHD themselves, but family risk of developing CHD (35.8%), compared to people already diagnosed with CHD (30.2%) and people with no CHD nor family risk (32.1%). All four of the PMT factors; self-rated health, expectations for future health, preventive health beliefs, and the health behavior index - were predictors for CAM use in the no CHD but family risk group. These findings suggest that people use CAM in response to a perceived risk of developing CHD, and to prevent disease and to maintain health.

  10. Tobacco Transcription Factors NtMYC2a and NtMYC2b Form Nuclear Complexes with the NtJAZ1 Repressor and Regulate Multiple Jasmonate-Inducible Steps in Nicotine Biosynthesis

    Institute of Scientific and Technical Information of China (English)

    Hong-Bo Zhang; Marta T. Bokowiec; Paul J. Rushton; Sheng-Cheng Han; Michael P. Timko

    2012-01-01

    Biotic and abiotic stress lead to elevated levels of jasmonic acid (JA) and its derivatives and activation of the biosynthesis of nicotine and related pyridine alkaloids in cultivated tobacco (Nicotiana tabacum L.).Among the JAresponsive genes is NtPMT1a,encoding putrescine N-methyl transferase,a key regulatory enzyme in nicotine formation.We have characterized three genes (NtMYC2a,b,c) encoding basic helix-loop-helix (bH LH) transcription factors (TFs) whose expression is rapidly induced by JA and that specifically activate JA-inducible NtPMT1a expression by binding a G-box motif within the NtPMT1a promoter in in vivo and in vitro assays.Using split-YFP assays,we further show that,in the absence of JA,NtMYC2a and NtMYC2b are present as nuclear complexes with the NtJAZ1 repressor.RNA interference (RNAi)-mediated knockdown of NtMYC2a and NtMYC2b expression results in significant decreases in JA-inducible NtPMT1a transcript levels,as well as reduced levels of transcripts encoding other enzymes involved in nicotine and minor alkaloid biosynthesis,including an 80-90% reduction in the level of transcripts encoding the putative nicotine synthase gene NtA662.In contrast,ectopic overexpression of NtMYC2a and NtMYC2b had no effect on NtPMT1a expression in the presence or absence of exogenously added JA.These data suggest that NtMYC2a,b,c are required components of JA-inducible expression of multiple genes in the nicotine biosynthetic pathway and may act additively in the activation of JA responses.

  11. Characterizing ICF Neutron Scintillation Diagnostics on the nTOF line at SUNY Geneseo

    Science.gov (United States)

    Lawson-Keister, Pat; Padawar-Curry, Jonah; Visca, Hannah; Fletcher, Kurt; Padalino, Stephen; Sangster, T. Craig; Regan, Sean

    2015-11-01

    Neutron scintillator diagnostics for ICF and HEDP can be characterized using the neutron time-of-flight (nTOF) line on Geneseo's 1.7 MV tandem Pelletron accelerator. Neutron signals can be differentiated from gamma signals by employing coincidence methods. A 1.8-MeV beam of deuterons incident on a deuterated polyethylene target produces neutrons via the 2H(d,n)3He reaction. Neutrons emerging at a lab angle of 88° have an energy of 2.96 MeV; the 3He ions associated with these neutrons are detected at a scattering angle of 43° using a surface barrier detector. The time of flight of the neutron can be measured by using the 3He detection as a ``start'' signal and the scintillation detection as a ``stop'' signal. This time of flight requirement is used to identify the 2.96-MeV neutron signals in the scintillator. To measure the light curve produced by these monoenergetic neutrons, two photomultiplier (PMT) tubes are attached to the scintillator. The full aperture PMT establishes the nTOF coincidence. The other PMT is fitted with a pinhole to collect single events. The time between the full aperture PMT signal and the arrival of the signal in the pinhole PMT is used to determine the light curve for the scintillator. This system will enable the neutron response of various scintillators to be compared. Supported in part by the Department of Energy National Nuclear Security Administration under Award Number DE-NA0001944.

  12. Optical properties of water for the Yangbajing water cherenkov detector

    Science.gov (United States)

    Gao, Shang-qi; Sun, Zhi-bin; Jiang, Yuan-da; Wang, Chao; Du, Ke-ming

    2011-08-01

    Cherenkov radiation is used to study the production of particles during collisions, cosmic rays detections and distinguishing between different types of neutrinos and electrons. The optical properties of water are very important to the research of Cherenkov Effect. Lambert-beer law is a method to study the attenuation of light through medium. In this paper, optical properties of water are investigated by use of a water attenuation performance test system. The system is composed of the light-emitting diode (LED) light source and the photon receiver models. The LED light source model provides a pulse light signal which frequency is 1 kHz and width is 100ns. In photon receiver model, a high sensitivity photomultiplier tube (PMT) is used to detect the photons across the water. Because the output voltage amplitude of PMT is weak which is from 80mv to 120mV, a low noise pre-amplifier is used to improve the detector precise. An effective detector maximum time window of PMT is 100ns for a long lifetime, so a peak holder circuit is used to hold the maximum peak amplitude of PMT for the induced photons signal before the digitalization. In order to reduce the noise of peak holder, a multi-pulse integration is used before the sampling of analog to digital converter. At last, the detector of photons from the light source to the PMT across the water is synchronized to the pulse width of the LED. In order to calculate the attenuation coefficient and attenuation length of water precisely, the attenuation properties of air-to-water boundary is considered in the calculation.

  13. Do evidence-based interventions work when tested in the "real world?" A systematic review and meta-analysis of parent management training for the treatment of child disruptive behavior.

    Science.gov (United States)

    Michelson, Daniel; Davenport, Clare; Dretzke, Janine; Barlow, Jane; Day, Crispin

    2013-03-01

    Evidence-based interventions are often unavailable in everyday clinical settings. This may partly reflect practitioners' assumptions that research evidence does not reflect "real-world" conditions. To examine this further, we systematically assessed the clinical effectiveness of parent management training (PMT) for the treatment of child disruptive behavior across different real-world practice contexts. We identified 28 relevant randomized controlled trials from a systematic search of electronic bibliographic databases and conducted a meta-analysis of child outcomes across trials. Planned subgroup analyses involved comparisons between studies grouped according to individual real-world practice criteria and total real-world practice criteria scores, reflecting the extent to which PMT was delivered by non-specialist therapists, to a clinic-referred population, in a routine setting, and as part of a routine service. Meta-analysis revealed a significant overall advantage for PMT compared with waitlist control conditions. Subgroup analyses did not demonstrate significant differences in effect size estimates according to the total number of real-world practice criteria met by studies. Moreover, no consistent relationships were found between specific practice criteria and effect size estimates. In conclusion, PMT appears to be an effective treatment for children with disruptive behavior problems. There was no clear evidence that conducting PMT in real-world practice contexts is a deterrent to achieving effective child behavior outcomes, although relative advantage to "usual care" was not directly examined and the power of the analysis was limited as a result of significant heterogeneity. More research is needed to investigate whether this finding is generalizable to other psychological interventions. Suggestions are also made for developing more differentiated criteria to assist with evaluating the specific applicability of research evidence to different care providers.

  14. An alternative mechanism for the methylation of phosphoethanolamine catalyzed by Plasmodium falciparum phosphoethanolamine methyltransferase.

    Science.gov (United States)

    Saen-Oon, Suwipa; Lee, Soon Goo; Jez, Joseph M; Guallar, Victor

    2014-12-05

    The phosphobase methylation pathway catalyzed by the phosphoethanolamine methyltransferase in Plasmodium falciparum (PfPMT), the malaria parasite, offers an attractive target for anti-parasitic drug development. PfPMT methylates phosphoethanolamine (pEA) to phosphocholine for use in membrane biogenesis. Quantum mechanics and molecular mechanics (QM/MM) calculations tested the proposed reaction mechanism for methylation of pEA involving the previously identified Tyr-19-His-132 dyad, which indicated an energetically unfavorable mechanism. Instead, the QM/MM calculations suggested an alternative mechanism involving Asp-128. The reaction coordinate involves the stepwise transfer of a proton to Asp-128 via a bridging water molecule followed by a typical Sn2-type methyl transfer from S-adenosylmethionine to pEA. Functional analysis of the D128A, D128E, D128Q, and D128N PfPMT mutants shows a loss of activity with pEA but not with the final substrate of the methylation pathway. X-ray crystal structures of the PfPMT-D128A mutant in complex with S-adenosylhomocysteine and either pEA or phosphocholine reveal how mutation of Asp-128 disrupts a hydrogen bond network in the active site. The combined QM/MM, biochemical, and structural studies identify a key role for Asp-128 in the initial step of the phosphobase methylation pathway in Plasmodium and provide molecular insight on the evolution of multiple activities in the active site of the PMT. © 2014 by The American Society for Biochemistry and Molecular Biology, Inc.

  15. Passive movement therapy in patients with moderate to severe paratonia; study protocol of a randomised clinical trial (ISRCTN43069940

    Directory of Open Access Journals (Sweden)

    de Bie Rob A

    2007-12-01

    Full Text Available Abstract Background Paratonia, a form of hypertonia, is associated with loss of mobility and with the development of contractures especially in the late stages of the dementia. Passive movement therapy (PMT currently is the main physiotherapeutic intervention. General doubt about the beneficial effects of this widely used therapy necessitates a randomised clinical trial (RCT to study the efficacy of PMT on the severity of paratonia and on the improvement of daily care. Methods/Design A RCT with a 4-week follow-up period. Patients with dementia (according to the DSM-IV-TR Criteria and moderate to severe paratonia are included in the study after proxy consent. By means of computerised and concealed block randomisation (block-size of 4 patients are included in one of two groups. The first group receives PMT, the second group receives usual care without PMT. PMT is given according to a protocol by physical therapist three times a week for four weeks in a row. The severity of paratonia (Modified Ashworth scale, the severity of the dementia (Global Deterioration Scale, the clinical improvement (Clinical Global Impressions, the difficulty in daily care (Patient Specific Complaints and the experienced pain in daily care of the participant (PACSLAC-D is assessed by assessors blind to treatment allocation at baseline, after 6 and 12 treatments. Success of the intervention is defined as a significant increase of decline on the modified Ashworth scale. The 'proportion of change' in two and four weeks time on this scale will be analysed. Also a multiple logistic regression analysis using declined/not declined criteria as dependent variable with correction for relevant confounders (e.g. stage of dementia, medication, co-morbidity will be used. Discussion This study is the first RCT of this size to gain further insight on the effect of passive movement therapy on the severity of paratonia. Trial registration Current Controlled Trials ISRCTN43069940

  16. Control effect of protection motivation theory for risk factors of diabetic foot%保护动机理论在控制糖尿病足危险因素中的应用效果

    Institute of Scientific and Technical Information of China (English)

    韦琼; 张志凯; 谭春荷; 张衍宁; 符桂娇; 周君霞; 张长明

    2016-01-01

    Objective:To study the control effect of protection motivation theory(PMT)for the risk factors of di-abetic foot(DF).Methods:A total of 91 cases of diabetes mellitus(DM)patients in the outpatient department in our hospital from June 2014 to January 2013 were chosen as the research objects.They were randomly divided into PMT group and control group according to the registration order.The risk factors of DF in the two groups were evaluated respectively.The PMT group received the management mode which based on the protection mo-tivation theory.The patients in control group received routine diabetes health education management mode.Fol-lowed up lasted for 6 months after the intervention.Results:PMT group DF nursing knowledge,glycemic index, DF risk factors were improved obviously at the same time compared with that before the intervention and the control group.The difference was statistically significant(P <0.05).Conclusion:The management mode imple-mented based on the protection motivation theory can improve patients’self management ability,improve me-tabolism and prevent the occurrence of diabetic foot ulcer.%[目的]探讨保护动机理论(PMT)对糖尿病足危险因素的控制效果。[方法]选取2013年1月—2014年6月在我院门诊部就诊的91例糖尿病病人为研究对象。按就诊的先后顺序随机分为 PMT 组和对照组,对两组糖尿病足的危险因素进行评估,PMT 组接受以 PMT 为指导的管理模式,对照组接受常规的糖尿病健康教育管理模式,干预后随访6个月。[结果]PMT 组糖尿病足护理知识、血糖指标、糖尿病足危险因素较干预前及对照组同期明显改善,差异有统计学意义(P <0.05)。[结论]对糖尿病足危险因素实施以保护动机理论为指导的管理模式,可提高病人的自我管理能力,改善代谢指标,对糖尿病足溃疡的发生起到预防作用。

  17. Development of a PET/Cerenkov-light hybrid imaging system

    Energy Technology Data Exchange (ETDEWEB)

    Yamamoto, Seiichi, E-mail: s-yama@met.nagoya-u.ac.jp; Hamamura, Fuka; Kato, Katsuhiko; Ogata, Yoshimune [Radiological and Medical Laboratory Sciences, Nagoya University Graduate School of Medicine, Aichi 461-8673 (Japan); Watabe, Tadashi; Ikeda, Hayato; Kanai, Yasukazu; Hatazawa, Jun [Department of Molecular Imaging in Medicine, Osaka University Graduate School of Medicine, Osaka 565-0871 (Japan); Watabe, Hiroshi [CYRIC, Tohoku University, Miyagi 980-8578 (Japan)

    2014-09-15

    Purpose: Cerenkov-light imaging is a new molecular imaging technology that detects visible photons from high-speed electrons using a high sensitivity optical camera. However, the merit of Cerenkov-light imaging remains unclear. If a PET/Cerenkov-light hybrid imaging system were developed, the merit of Cerenkov-light imaging would be clarified by directly comparing these two imaging modalities. Methods: The authors developed and tested a PET/Cerenkov-light hybrid imaging system that consists of a dual-head PET system, a reflection mirror located above the subject, and a high sensitivity charge coupled device (CCD) camera. The authors installed these systems inside a black box for imaging the Cerenkov-light. The dual-head PET system employed a 1.2 × 1.2 × 10 mm{sup 3} GSO arranged in a 33 × 33 matrix that was optically coupled to a position sensitive photomultiplier tube to form a GSO block detector. The authors arranged two GSO block detectors 10 cm apart and positioned the subject between them. The Cerenkov-light above the subject is reflected by the mirror and changes its direction to the side of the PET system and is imaged by the high sensitivity CCD camera. Results: The dual-head PET system had a spatial resolution of ∼1.2 mm FWHM and sensitivity of ∼0.31% at the center of the FOV. The Cerenkov-light imaging system's spatial resolution was ∼275μm for a {sup 22}Na point source. Using the combined PET/Cerenkov-light hybrid imaging system, the authors successfully obtained fused images from simultaneously acquired images. The image distributions are sometimes different due to the light transmission and absorption in the body of the subject in the Cerenkov-light images. In simultaneous imaging of rat, the authors found that {sup 18}F-FDG accumulation was observed mainly in the Harderian gland on the PET image, while the distribution of Cerenkov-light was observed in the eyes. Conclusions: The authors conclude that their developed PET

  18. Expanding protection motivation theory: investigating an application to animal owners and emergency responders in bushfire emergencies.

    Science.gov (United States)

    Westcott, Rachel; Ronan, Kevin; Bambrick, Hilary; Taylor, Melanie

    2017-04-26

    Protection Motivation Theory (PMT) was developed by Rogers in 1975, to describe how individuals are motivated to react in a self-protective way towards a perceived health threat. Rogers expected the use of PMT to diversify over time, which has proved true over four decades. The purpose of this paper is to explore how PMT can be used and expanded to inform and improve public safety strategies in natural hazards. As global climate change impacts on the Australian environment, natural hazards seem to be increasing in scale and frequency, and Emergency Services' public education campaigns have necessarily escalated to keep pace with perceived public threat. Of concern, is that the awareness-preparedness gap in residents' survival plans is narrowing disproportionately slowly compared to the magnitude of resources applied to rectify this trend. Practical applications of adaptable social theory could be used to help resolve this dilemma. PMT has been used to describe human behaviour in individuals, families, and the parent-child unit. It has been applied to floods in Europe and wildfire and earthquake in the United States. This paper seeks to determine if an application of PMT can be useful for achieving other-directed human protection across a novel demographic spectrum in natural hazards, specifically, animal owners and emergency responders in bushfire emergencies. These groups could benefit from such an approach: owners to build and fortify their response- and self-efficacy, and to help translate knowledge into safer behaviour, and responders to gain a better understanding of a diverse demographic with animal ownership as its common denominator, and with whom they will be likely to engage in contemporary natural hazard management. Mutual collaboration between these groups could lead to a synergy of reciprocated response efficacy, and safer, less traumatic outcomes. Emergency services' community education programs have made significant progress over the last decade, but

  19. Breast Imaging Utilizing Dedicated Gamma Camera and (99m)Tc-MIBI: Experience at the Tel Aviv Medical Center and Review of the Literature Breast Imaging.

    Science.gov (United States)

    Even-Sapir, Einat; Golan, Orit; Menes, Tehillah; Weinstein, Yuliana; Lerman, Hedva

    2016-07-01

    The scope of the current article is the clinical role of gamma cameras dedicated for breast imaging and (99m)Tc-MIBI tumor-seeking tracer, as both a screening modality among a healthy population and as a diagnostic modality in patients with breast cancer. Such cameras are now commercially available. The technology utilizing a camera composed of a NaI (Tl) detector is termed breast-specific gamma imaging. The technology of dual-headed camera composed of semiconductor cadmium zinc telluride detectors that directly converts gamma-ray energy into electronic signals is termed molecular breast imaging. Molecular breast imaging system has been installed at the Department of Nuclear medicine at the Tel Aviv Sourasky Medical Center, Tel Aviv in 2009. The article reviews the literature well as our own experience. Copyright © 2016 Elsevier Inc. All rights reserved.

  20. Gamma camera performance: technical assessment protocol

    Energy Technology Data Exchange (ETDEWEB)

    Bolster, A.A. [West Glasgow Hospitals NHS Trust, London (United Kingdom). Dept. of Clinical Physics; Waddington, W.A. [University College London Hospitals NHS Trust, London (United Kingdom). Inst. of Nuclear Medicine

    1996-12-31

    This protocol addresses the performance assessment of single and dual headed gamma cameras. No attempt is made to assess the performance of any associated computing systems. Evaluations are usually performed on a gamma camera commercially available within the United Kingdom and recently installed at a clinical site. In consultation with the manufacturer, GCAT selects the site and liaises with local staff to arrange a mutually convenient time for assessment. The manufacturer is encouraged to have a representative present during the evaluation. Three to four days are typically required for the evaluation team to perform the necessary measurements. When access time is limited, the team will modify the protocol to test the camera as thoroughly as possible. Data are acquired on the camera`s computer system and are subsequently transferred to the independent GCAT computer system for analysis. This transfer from site computer to the independent system is effected via a hardware interface and Interfile data transfer. (author).

  1. Portable wireless power transmission system for video capsule endoscopy.

    Science.gov (United States)

    Zhiwei, Jia; Guozheng, Yan; Bingquan, Zhu

    2014-10-01

    Wireless power transmission is considered a practical way of overcoming the power shortage of wireless capsule endoscopy (VCE). However, most patients cannot tolerate the long hours of lying in a fixed transmitting coil during diagnosis. To develop a portable wireless power transmission system for VCE, a compact transmitting coil and a portable inverter circuit driven by rechargeable batteries are proposed. The couple coils, optimized considering the stability and safety conditions, are 28 turns of transmitting coil and six strands of receiving coil. The driven circuit is designed according to the portable principle. Experiments show that the integrated system could continuously supply power to a dual-head VCE for more than 8 h at a frame rate of 30 frames per second with resolution of 320 × 240. The portable VCE exhibits potential for clinical applications, but requires further improvement and tests.

  2. Performance evaluation of a LYSO-based PET scanner for monitoring of dose delivery in hadrontherapy

    Science.gov (United States)

    Fabbiani, E.; Belcari, N.; Camarlinghi, N.; Del Guerra, A.; Ferretti, S.; Kraan, A.; Panetta, D.; Sportelli, G.; Rosso, V.

    2015-12-01

    The DoPET scanner is a compact positron emission tomography (PET) device. It has been developed for monitoring the range of charged particles during therapy with hadron beams. Previous works have focused on the development and upgrade of the device and on data analysis. In this paper, a full performance characterization of the DoPET system in terms of the energy resolution, spatial resolution, sensitivity, uniformity, and noise equivalent count rate is reported. All measurements refer to an adapted version of the National Electrical Manufacturers Association (NEMA) NU 4 - 2008 protocol, which was written originally for small animal PET systems. Since DoPET is a dual head planar system, it requires a modified characterisation procedure with respect to those described for ring geometries as in the NEMA NU 4 - 2008 protocol. The presented procedure may be of interest for any other PET system with a similar geometry as DoPET.

  3. VERITAS Observations under Bright Moonlight

    CERN Document Server

    ,

    2015-01-01

    The presence of moonlight is usually a limiting factor for imaging atmospheric Cherenkov telescopes due to the high sensitivity of the camera photomultiplier tubes (PMTs). In their standard configuration, the extra noise limits the sensitivity of the experiment to gamma-ray signals and the higher PMT currents also accelerates PMT aging. Since fall 2012, observations have been carried out with VERITAS under bright moonlight (Moon illumination $> 35\\%$), in two observing modes, by reducing the voltage applied to the PMTs and with UV bandpass filters, which allow observations up to $\\sim80\\%$ Moon illumination resulting in $29\\%$ more observing time over the course of the year. In this presentation, we provide details of these new observing modes and their performance relative to the standard VERITAS observations.

  4. Improving Photoelectron Counting and Particle Identification in Scintillation Detectors with Bayesian Techniques

    CERN Document Server

    Akashi-Ronquest, M; Batygov, M; Beltran, B; Bodmer, M; Boulay, M G; Broerman, B; Buck, B; Butcher, A; Cai, B; Caldwell, T; Chen, M; Chen, Y; Cleveland, B; Coakley, K; Dering, K; Duncan, F A; Formaggio, J A; Gagnon, R; Gastler, D; Giuliani, F; Gold, M; Golovko, V V; Gorel, P; Graham, K; Grace, E; Guerrero, N; Guiseppe, V; Hallin, A L; Harvey, P; Hearns, C; Henning, R; Hime, A; Hofgartner, J; Jaditz, S; Jillings, C J; Kachulis, C; Kearns, E; Kelsey, J; Klein, J R; Kuzniak, M; LaTorre, A; Lawson, I; Li, O; Lidgard, J J; Liimatainen, P; Linden, S; McFarlane, K; McKinsey, D N; MacMullin, S; Mastbaum, A; Mathew, R; McDonald, A B; Mei, D -M; Monroe, J; Muir, A; Nantais, C; Nicolics, K; Nikkel, J A; Noble, T; O'Dwyer, E; Olsen, K; Gann, G D Orebi; Ouellet, C; Palladino, K; Pasuthip, P; Perumpilly, G; Pollmann, T; Rau, P; Retiere, F; Rielage, K; Schnee, R; Seibert, S; Skensved, P; Sonley, T; Vazquez-Jauregui, E; Veloce, L; Walding, J; Wang, B; Wang, J; Ward, M; Zhang, C

    2014-01-01

    Many current and future dark matter and neutrino detectors are designed to measure scintillation light with a large array of photomultiplier tubes (PMTs). The energy resolution and particle identification capabilities of these detectors depend in part on the ability to accurately identify individual photoelectrons in PMT waveforms despite large variability in pulse amplitudes and pulse pileup. We describe a Bayesian technique that can identify the times of individual photoelectrons in a sampled PMT waveform without deconvolution, even when pileup is present. To demonstrate the technique, we apply it to the general problem of particle identification in single-phase liquid argon dark matter detectors. Using the output of the Bayesian photoelectron counting algorithm described in this paper, we construct several test statistics for rejection of backgrounds for dark matter searches in argon. Compared to simpler methods based on either observed charge or peak finding, the photoelectron counting technique improves ...

  5. Spectroscopic measurement of ion temperature and ion velocity distributions in the flux-coil generated FRC

    Energy Technology Data Exchange (ETDEWEB)

    Gupta, D.; Gota, H.; Hayashi, R.; Kiyashko, V.; Morehouse, M.; Primavera, S. [Tri Alpha Energy, Inc., Rancho Santa Margarita, California 92688 (United States); Bolte, N. [Tri Alpha Energy, Inc., Rancho Santa Margarita, California 92688 (United States); Department of Physics and Astronomy, University of California, Irvine, California 92697 (United States); Marsili, P. [Department of Physics, University of Pisa, Largo B. Pontecorvo 3, 56127 Pisa (Italy); Roche, T. [Department of Physics and Astronomy, University of California, Irvine, California 92697 (United States); Wessel, F. [Department of Physics and Astronomy, University of California, Irvine, California 92697 (United States); Tri Alpha Energy, Inc., Rancho Santa Margarita, California 92688 (United States)

    2010-10-15

    One aim of the flux-coil generated field reversed configuration at Tri Alpha Energy (TAE) is to establish the plasma where the ion rotational energy is greater than the ion thermal energy. To verify this, an optical diagnostic was developed to simultaneously measure the Doppler velocity-shift and line-broadening using a 0.75 m, 1800 groves/mm, spectrometer. The output spectrum is magnified and imaged onto a 16-channel photomultiplier tube (PMT) array. The individual PMT outputs are coupled to high-gain, high-frequency, transimpedance amplifiers, providing fast-time response. The Doppler spectroscopy measurements, along with a survey spectrometer and photodiode-light detector, form a suite of diagnostics that provide insights into the time evolution of the plasma-ion distribution and current when accelerated by an azimuthal-electric field.

  6. KM3NeT: Optimization studies for a cubic kilometer neutrino detector

    Energy Technology Data Exchange (ETDEWEB)

    Coniglione, R. [INFN, Laboratori Nazionali del Sud, Via S. Sofia 62, 95123 Catania (Italy)], E-mail: coniglione@lns.infn.it; Distefano, C. [INFN, Laboratori Nazionali del Sud, Via S. Sofia 62, 95123 Catania (Italy); Migneco, E. [INFN, Laboratori Nazionali del Sud, Via S. Sofia 62, 95123 Catania (Italy); Dipartimento di Fisica e Astronomia Universita di Catania, Via S. Sofia 64, 95123 Catania (Italy); Sapienza, P. [INFN, Laboratori Nazionali del Sud, Via S. Sofia 62, 95123 Catania (Italy)

    2009-04-11

    In the KM3NeT Collaboration an important task is the simulation of the detector performance which aims at the optimization of the detector design. In this work the effect of two important items are studied: the PMT photocathode quantum efficiency and the effect of the bar length of a three-dimensional detection units. Simulation studies including the improved PMT photocathode quantum efficiency show that, especially at energy below 100 TeV, the increasing of the neutrino effective area is important. Moreover, simulations that optimize the geometry of one of the detection units proposed in KM3NeT are presented. In particular an increase in the effective areas for longer bars is observed.

  7. Using a combined protection motivation theory and health action process approach intervention to promote exercise during pregnancy.

    Science.gov (United States)

    Gaston, Anca; Prapavessis, Harry

    2014-04-01

    Despite the benefits of exercise during pregnancy, many expectant mothers are inactive. This study examined whether augmenting a protection motivation theory (PMT) intervention with a Health Action Process Approach can enhance exercise behavior change among pregnant women. Sixty inactive pregnant women were randomly assigned to one of three treatment groups: PMT-only, PMT + action-planning, and PMT + action-and-coping-planning. Week-long objective (accelerometer) and subjective (self-report) exercise measures were collected at baseline, and at 1- and 4-weeks post-intervention. Repeated-measures ANOVAs demonstrated that while all participants reported increased exercise from baseline to 1-week post-intervention, participants in both planning groups were significantly more active (p planning can enhance exercise behavior change in pregnant women.

  8. Data acquisition system for segmented reactor antineutrino detector

    Science.gov (United States)

    Hons, Z.; Vlášek, J.

    2017-01-01

    This paper describes the data acquisition system used for data readout from the PMT channels of a segmented detector of reactor antineutrinos with active shielding. Theoretical approach to the data acquisition is described and two possible solutions using QDCs and digitizers are discussed. Also described are the results of the DAQ performance during routine data taking operation of DANSS. DANSS (Detector of the reactor AntiNeutrino based on Solid Scintillator) is a project aiming to measure a spectrum of reactor antineutrinos using inverse beta decay (IBD) in a plastic scintillator. The detector is located close to an industrial nuclear reactor core and is covered by passive and active shielding. It is expected to have about 15000 IBD interactions per day. Light from the detector is sensed by PMT and SiPM.

  9. Light Collection in the Prototypes of the ANAIS Dark Matter Project

    CERN Document Server

    Amaré, Julio; Cuesta, Clara; García, Eduardo; Martínez, María; Oliván, Miguel A; Ortigoza, Ysrael; de Solórzano, Alfonso Ortíz; Pobes, Carlos; Puimedón, Jorge; Sarsa, María Luisa; Villar, José Ángel; Villar, Patricia

    2015-01-01

    The ANAIS experiment aims at the confirmation of the DAMA/LIBRA signal using the same target and technique at the Canfranc Underground Laboratory (LSC) in Spain. ANAIS detectors consist of large NaI crystals coupled to two photomultipliers (PMTs). In this work we present Single Electron Response (SER) data for several units of the Hamamatsu R12669SEL2 PMT model extracted from normal operation data of ANAIS underground prototypes and we compare them with PMT SER characterization previously done at surface lab before coupling them to NaI crystal. Moreover, total light collection for different ANAIS prototypes has been calculated, producing an excellent average result of 15 phe/keV, which has a good impact in both energy resolution and threshold.

  10. Timing characteristics of Ce doped Gd{sub 3}Ga{sub 3}Al{sub 2}O{sub 12} single crystals in comparison with CsI(Tl) scintillators

    Energy Technology Data Exchange (ETDEWEB)

    Tyagi, M.; Singh, A.K.; Singh, S.G.; Sen, S.; Gadkari, S.C. [Technical Physics Division, Bhabha Atomic Research Centre, Mumbai, 400085 (India); Desai, V.V.; Nayak, B.K. [Nuclear Physics Division, Bhabha Atomic Research Centre, Mumbai, 400085 (India)

    2015-10-15

    Single crystals of Gd{sub 3}Ga{sub 3}Al{sub 2}O{sub 12}:Ce with B codopants were successfully grown using the Czochralski technique. The timing characteristics of the crystal was measured by coupling the crystal to photomultiplier tubes (PMT) or silicon photodiodes [Si(PIN)]. The two prompt γ-rays emitted in a cascade from {sup 60}Co or {sup 22}Na source were detected in coincidence using Gd{sub 3}Ga{sub 3}Al{sub 2}O{sub 12}:Ce,B crystal detectors and a BaF{sub 2} detector. The time resolution of these crystals are observed to be better than that measured for CsI:Tl crystal coupled to PMT or Si(PIN) in an identical measurement setup. (copyright 2015 WILEY-VCH Verlag GmbH and Co. KGaA, Weinheim)

  11. Sinonasal Phosphaturic Mesenchymal Tumor: A Rare and Misinterpreted Entity

    Science.gov (United States)

    Arnaoutakis, Demetri; Naseri, Iman

    2015-01-01

    Objectives Oncogenic osteomalacia is a paraneoplastic syndrome in which the tumor secretes a peptide-like hormone, fibroblast growth factor, resulting in urinary loss of phosphates. Methods We present the case of a 50-year-old woman with a benign phosphaturic mesenchymal tumor (PMT) involving the ethmoid sinus with obstruction of the ostiomeatal complex causing unilateral nasal airway obstruction. Results The tumor was initially thought to be an esthesioneuroblastoma based on primary pathology interpretation and on clinical and radiographic appearance. However, a benign PMT was later confirmed by further testing. Conclusion The tumor was removed entirely by the endoscopic transnasal approach, leading to a full resolution of symptoms. PMID:26623233

  12. The FAST Project - A Next Generation UHECR Observatory

    Directory of Open Access Journals (Sweden)

    Fujii Toshihiro

    2017-01-01

    Full Text Available We present a concept for large-area, low-cost detection of ultrahigh-energy cosmic rays (UHECRs with a Fluorescence detector Array of Single-pixel Telescopes (FASTb, addressing the requirements for the next generation of UHECR experiments. In the FAST design, a large field of view is covered by a few pixels at the focal plane of a mirror or Fresnel lens. We report on the first results of a FAST prototype installed at the Telescope Array (TA site, consisting of a single 200 mm photomultiplier tube (PMT at the focal plane of a 1 m2 Fresnel lens system taken from the prototype of the JEM-EUSO experiment. We also report on the status of the full-scale FAST prototype soon to be installed at the TA site, comprising a segmented spherical mirror of 1.6 m diameter and a 2 × 2 PMT camera.

  13. The FAST Project - A Next Generation UHECR Observatory

    Science.gov (United States)

    Fujii, Toshihiro; Malacari, Max; Bellido, Jose A.; Horvath, Pavel; Hrabovsky, Miroslav; Jiang, Jiaqi; Mandat, Dusan; Matalon, Ariel; Matthews, John N.; Motloch, Pavel; Palatka, Miroslav; Pech, Miroslav; Privitera, Paolo; Schovanek, Petr; Thomas, Stan B.; Travnicek, Petr

    2017-03-01

    We present a concept for large-area, low-cost detection of ultrahigh-energy cosmic rays (UHECRs) with a Fluorescence detector Array of Single-pixel Telescopes (FAST)b, addressing the requirements for the next generation of UHECR experiments. In the FAST design, a large field of view is covered by a few pixels at the focal plane of a mirror or Fresnel lens. We report on the first results of a FAST prototype installed at the Telescope Array (TA) site, consisting of a single 200 mm photomultiplier tube (PMT) at the focal plane of a 1 m2 Fresnel lens system taken from the prototype of the JEM-EUSO experiment. We also report on the status of the full-scale FAST prototype soon to be installed at the TA site, comprising a segmented spherical mirror of 1.6 m diameter and a 2 × 2 PMT camera.

  14. Monte Carlo calculations of the optical coupling between bismuth germanate crystals and photomultiplier tubes

    Energy Technology Data Exchange (ETDEWEB)

    Derenzo, S.E.; Riles, J.K.

    1981-10-01

    The high density and atomic number of bismuth germanate (Bi/sub 4/Ge/sub 3/O/sub 12/ or BGO) make it a very useful detector for positron emission tomography. Modern tomograph designs use large numbers of small, closely-packed crystals for high spatial resolution and high sensitivity. However, the low light output, the high refractive index (n=2.15), and the need for accurate timing make it important to optimize the transfer of light to the photomultiplier tube (PMT). We describe the results of a Monte Carlo computer program developed to study the effect of crystal shape, reflector type, and the refractive index of the PMT window on coupling efficiency. The program simulates total internal, external, and Fresnel reflection as well as internal absorption and scattering by bubbles.

  15. Generation of tobacco lines with widely different reduction in nicotine levels via RNA silencing approaches

    Indian Academy of Sciences (India)

    Peng Wang; Zhifeng Liang; Jia Zeng Wenchao; Wenchao Li; Xiaofen Sun; Zhiqi Miao; Kexuan Tang

    2008-06-01

    Issues related to the nicotine content of tobacco have been public concerns. Several reports have described decreasing nicotine levels by silencing the putrescine N-methyltransferase (PMT) genes, but the reported variations of nicotine levels among transgenic lines are relatively low in general. Here we describe the generation in tobacco (Nicotiana tabacum) lines with widely different, reduced nicotine levels using three kinds of RNA-silencing approaches. The relative efficacies of suppression were compared among the three approaches regarding the aspect of nicotine level in tobacco leaves. By suppressing expression of the PMT genes, over 200 transgenic lines were obtained with nicotine levels reduced by 9.1–96.7%. RNA interference (RNAi) was the most efficient method of reducing the levels of nicotine, whereas cosuppression and antisense methods were less effective. This report gives clues to the efficient generation of plants with a variety of metabolite levels, and the results demonstrate the relative efficiencies of various RNA-silencing methods.

  16. Demonstration of neutron detection utilizing open cell foam and noble gas scintillation

    Energy Technology Data Exchange (ETDEWEB)

    Lavelle, C. M., E-mail: christopher.lavelle@jhuapl.edu; Miller, E. C. [The Johns Hopkins University Applied Physics Laboratory, Asymmetric Operations Department, Laurel, Maryland 20723 (United States); Coplan, M. [Institute for Physical Science and Technology, University of Maryland College Park, Maryland 20142 (United States); Thompson, Alan K.; Vest, Robert E.; Yue, A. T. [National Institute of Standards and Technology, Gaithersburg, Maryland 20899 (United States); Kowler, A. L. [Department of Chemical Physics, University of Maryland, College Park, Maryland 20142 (United States); Koeth, T. [Institute for Research in Electronics and Applied Physics, University of Maryland, College Park, Maryland 20142 (United States); Al-Sheikhly, M. [Department of Materials Science and Engineering, University of Maryland, College Park, Maryland 20742 (United States); Clark, Charles W. [Institute for Physical Science and Technology, University of Maryland College Park, Maryland 20142 (United States); National Institute of Standards and Technology, Gaithersburg, Maryland 20899 (United States); Joint Quantum Institute, National Institute of Standards and Technology and University of Maryland, Gaithersburg, Maryland 20899 (United States)

    2015-03-02

    We present results demonstrating neutron detection via a closely spaced converter structure coupled to low pressure noble gas scintillation instrumented by a single photo-multiplier tube (PMT). The converter is dispersed throughout the gas volume using a reticulated vitreous carbon foam coated with boron carbide (B{sub 4}C). A calibrated cold neutron beam is used to measure the neutron detection properties, using a thin film of enriched {sup 10}B as a reference standard. Monte Carlo computations of the ion energy deposition are discussed, including treatment of the foam random network. Results from this study indicate that the foam shadows a significant portion of the scintillation light from the PMT. The high scintillation yield of Xe appears to overcome the light loss, facilitating neutron detection and presenting interesting opportunities for neutron detector design.

  17. Temperature dependence of the scintillation properties of Ce:GSO and Ce:GSOZ

    Energy Technology Data Exchange (ETDEWEB)

    Kurosawa, Shunsuke, E-mail: kurosawa@imr.tohoku.ac.jp [Institute for Materials Research, Tohoku University, 2-1-1 Katahira, Aoba-ku, Sendai, Miyagi 980-8577 (Japan); Sugiyama, Makoto [Institute for Materials Research, Tohoku University, 2-1-1 Katahira, Aoba-ku, Sendai, Miyagi 980-8577 (Japan); Yanagida, Takayuki [New Industry Creation Hatchery Center (NICHe), 6-6-10 Aoba Aramaki, Aoba-ku, Sendai, Miyagi 980-8579 (Japan); Yokota, Yuui [Institute for Materials Research, Tohoku University, 2-1-1 Katahira, Aoba-ku, Sendai, Miyagi 980-8577 (Japan); Yoshikawa, Akira [Institute for Materials Research, Tohoku University, 2-1-1 Katahira, Aoba-ku, Sendai, Miyagi 980-8577 (Japan); New Industry Creation Hatchery Center (NICHe), 6-6-10 Aoba Aramaki, Aoba-ku, Sendai, Miyagi 980-8579 (Japan)

    2012-10-21

    The light output and decay times of Ce:GSO and Ce:GSOZ scintillators depend on Ce concentration and temperature. We investigated the temperature dependence of the light output and the decay time for Ce:GSO and Ce:GSOZ doped with 0.3 (only GSO), 0.5, 1.0, and 1.5 mol% Ce. These samples were measured with a ruggedized photomultiplier (PMT) (Hamamatsu R6877A) at 175 Degree-Sign C (in the thermostat chamber). Up to 100 Degree-Sign C, the relative light output of all of the samples remained within 10% after correcting the PMT gain, which depends on the temperature. The decay times of the GSO and GSOZ samples with the identical Ce concentrations were equal. Moreover, the quenching energy values for all the samples were equivalent.

  18. Effects of an educational intervention based on the protection motivation theory and implementation intentions on first and second pap test practice in Iran.

    Science.gov (United States)

    Dehdari, Tahereh; Hassani, Laleh; Hajizadeh, Ebrahim; Shojaeizadeh, Davoud; Nedjat, Saharnaz; Abedini, Mehrandokht

    2014-01-01

    Few Iranian women take the Papanicolaou test despite its important role in preventing cervical cancer. This study aimed to determine the effectiveness of an educational intervention based on the protection motivation theory (PMT) variables and implementation intentions in the first and second Pap test practice among Iranian women. In this quasi-randomized controlled trial, 200 women who were referred to 30 primary health care clinics in Tehran were randomly selected. PMT variables and Pap test practice were measured at baseline and again after 3 and 15 months. The 4-week educational intervention program was conducted for the intervention group. Following the intervention, the mean scores of self-efficacy, perceived vulnerability, and behavior intention variables were significantly higher in the intervention group when compared to the control group (ptheory-based framework for developing educational interventions regarding Pap test practice in Iran.

  19. Effects of moment of inertia on simple reaction time.

    Science.gov (United States)

    Anson, J G

    1989-03-01

    Two experiments examined the effect of altering the moment of inertia within an anatomical unit on simple reaction time (SRT), premotor time (PMT), and motor time (MOT) during the initiation of a discrete rapid movement. In Experiment 1 (N = 14), moment of inertia of the forearm was increased with the addition of a weighted cuff fastened around the wrist. In Experiment 2 (N = 7), moment of inertia was altered by the addition of a weighted sleeve to the index finger prior to rapid extension of the digit. Results from both experiments were unequivocal. An increase in the moment of inertia resulted in a significant increase in SRT and MOT but had no significant effect on PMT. Within selected anatomical unites (forearm and index finger), an increase in the moment of inertia does not appear to require additional neuromotor programming time but does influence the overall duration of response initiation.

  20. DANSS Experiment Data Acquisition System

    CERN Document Server

    Hons, Zdenek

    2016-01-01

    DANSS (Detector of the reactor AntiNeutrino based on Solid Scintillator) is a project aiming to measure a spectrum of reactor antineutrinos using inverse beta decay (IBD) in a plastic scintillator. The detector is located close to an industrial nuclear reactor core and is covered by passive and active shielding. It is expected to detect about 15000 IBD events per day. Light from the detector is sensed by PMT and SiPM. This paper describes the data acquisition system used for data readout of the 50 detector PMT channels and active shielding. Theoretical approach to the data acquisition is described and two possible solutions using QDCs and digitizers are discussed. Also described are the results of the DAQ performance during routine data taking operation of the detector.

  1. Study on the performance of electromagnetic particle detectors of LHAASO-KM2A

    Science.gov (United States)

    Zhang, Zhongquan; Hou, Chao; Cao, Zhen; Chang, Jingfan; Feng, Cunfeng; Hanapia, Erlan; Gong, Guanghua; Liu, Jia; Lv, Hongkui; Sheng, Xiangdong; Zhang, Shaoru; Zhu, Chengguang

    2017-02-01

    The electromagnetic particle detectors (EDs) for one square kilometer detector array (KM2A) of large high altitude air shower observation (LHAASO) are designed to measure the densities and arrival times of secondary particles in extensive air showers (EASs). ED is a type of plastic scintillator detector with an active area of 1 m2. This study investigates the design and performance of prototype ED. Approximately 20 photoelectrons are collected by the 1st dynode of a photomultiplier tube (PMT). The prototype ED exhibited good detection efficiency and time resolution. The detection for the wide dynamic particle density varying from 1 to 10 000 particles/m2 is realized with the design of the PMT divider for the readout of both the anode and 6th dynode.

  2. Adaptive algorithms of position and energy reconstruction in Anger-camera type detectors: experimental data processing in ANTS

    Science.gov (United States)

    Morozov, A.; Defendi, I.; Engels, R.; Fraga, F. A. F.; Fraga, M. M. F. R.; Gongadze, A.; Guerard, B.; Jurkovic, M.; Kemmerling, G.; Manzin, G.; Margato, L. M. S.; Niko, H.; Pereira, L.; Petrillo, C.; Peyaud, A.; Piscitelli, F.; Raspino, D.; Rhodes, N. J.; Sacchetti, F.; Schooneveld, E. M.; Solovov, V.; Van Esch, P.; Zeitelhack, K.

    2013-05-01

    The software package ANTS (Anger-camera type Neutron detector: Toolkit for Simulations), developed for simulation of Anger-type gaseous detectors for thermal neutron imaging was extended to include a module for experimental data processing. Data recorded with a sensor array containing up to 100 photomultiplier tubes (PMT) or silicon photomultipliers (SiPM) in a custom configuration can be loaded and the positions and energies of the events can be reconstructed using the Center-of-Gravity, Maximum Likelihood or Least Squares algorithm. A particular strength of the new module is the ability to reconstruct the light response functions and relative gains of the photomultipliers from flood field illumination data using adaptive algorithms. The performance of the module is demonstrated with simulated data generated in ANTS and experimental data recorded with a 19 PMT neutron detector. The package executables are publicly available at http://coimbra.lip.pt/~andrei/

  3. Portable biochip scanner device

    Energy Technology Data Exchange (ETDEWEB)

    Perov, Alexander (Troitsk, RU); Sharonov, Alexei (Moscow, RU); Mirzabekov, Andrei D. (Darien, IL)

    2002-01-01

    A portable biochip scanner device used to detect and acquire fluorescence signal data from biological microchips (biochips) is provided. The portable biochip scanner device employs a laser for emitting an excitation beam. An optical fiber delivers the laser beam to a portable biochip scanner. A lens collimates the laser beam, the collimated laser beam is deflected by a dichroic mirror and focused by an objective lens onto a biochip. The fluorescence light from the biochip is collected and collimated by the objective lens. The fluorescence light is delivered to a photomultiplier tube (PMT) via an emission filter and a focusing lens. The focusing lens focuses the fluorescence light into a pinhole. A signal output of the PMT is processed and displayed.

  4. Study of the timing performance of micro-channel plate photomultiplier for use as an active layer in a shower maximum detector

    Energy Technology Data Exchange (ETDEWEB)

    Ronzhin, A., E-mail: ronzhin@fnal.gov [Fermilab, Batavia, Il 60510 (United States); Los, S.; Ramberg, E. [Fermilab, Batavia, Il 60510 (United States); Apresyan, A.; Xie, S.; Spiropulu, M. [California Institute of Technology, Pasadena, CA 91126 (United States); Kim, H. [University of Chicago, Chicago, Il 60637 (United States)

    2015-09-21

    We continue the study of micro-channel plate photomultiplier (MCP-PMT) as the active element of a shower maximum (SM) detector. We present test beam results obtained with Photek 240 and Photonis XP85011 MCP-PMTs devices. For proton beams, we obtained a time resolution of 9.6 ps, representing a significant improvement over past results using the same time of flight system. For electron beams, the time resolution obtained for this new type of SM detector is measured to be at the level of 13 ps when we use Photek 240 as the active element of the SM. Using the Photonis XP85011 MCP-PMT as the active element of the SM, we performed time resolution measurements with pixel readout, and achieved a TR better than 30 ps, The pixel readout was observed to improve upon the TR compared to the case where the individual channels were summed.

  5. KTAG: The Kaon Identification Detector for CERN experiment NA62

    Science.gov (United States)

    Fry, J. R.

    2016-07-01

    In the study of ultra-rare kaon decays, CERN experiment NA62 exploits an unseparated monochromatic (75 GeV/c) beam of charged particles of flux 800 MHz, of which 50 MHz are K+. Kaons are identified with more than 95% efficiency, a time resolution of better than 100 ps, and misidentification of less than 10-4 using KTAG, a differential, ring-focussed, Cherenkov detector. KTAG utilises 8 sets of 48 Hamamatsu PMTs, of which 32 are of type 9880 and 16 of type 7400, with signals fed directly to the differential inputs of NINO front-end boards and then to TDC cards within the TEL62 system. Leading and trailing edges of the PMT signal are digitised, enabling slewing corrections to be made, and a mean hit rate of 5 MHz per PMT is supported. The electronics is housed within a cooled and insulated Faraday cage with environmental monitoring capabilities.

  6. Photomultiplier tube selection for the Wide Field of view Cherenkov/fluorescence Telescope Array of the Large High Altitude Air Shower Observatory

    Energy Technology Data Exchange (ETDEWEB)

    Ge, Maomao, E-mail: gemaomao@ynu.edu.cn [Department of Physics, Yunnan University, Kunming 650091 (China); Key Laboratory of Astroparticle Physics of Yunnan Province, Kunming 650091 (China); Zhang, Li, E-mail: lizhang@ynu.edu.cn [Department of Physics, Yunnan University, Kunming 650091 (China); Key Laboratory of Astroparticle Physics of Yunnan Province, Kunming 650091 (China); Chen, Yingtao [Department of Physics, Yunnan University, Kunming 650091 (China); Key Laboratory of Astroparticle Physics of Yunnan Province, Kunming 650091 (China); Cao, Zhen; Zhang, Shoushan; Wang, Chong; Bi, Baiyang [Institute of High Energy Physics, CAS, Beijing 100049 (China)

    2016-05-21

    For the purpose of selecting the most suitable photomultiplier tubes (PMTs) for the Wide Field of view Cherenkov/fluorescence Telescope Array (WFCTA), we have performed extensive tests on seven models of 25.4 mm PMTs: Hamamatsu R1924A and R7899, Beijing Hamamatsu CR303, CR332A and CR364, and HZC Photonics XP3102 and XP3182. A dedicated test system has been developed to measure the PMT characteristics such as single photo-electron spectrum, gain, linearity, and spatial uniformity of anode output. The XP3182 and CR364 (R7899) tubes both meet the pivotal requirement due to their superior pulse linearity. The PMT test system, techniques used for these measurements, and their results are also reported.

  7. Photomultiplier tube selection for the Wide Field of view Cherenkov/fluorescence Telescope Array of the Large High Altitude Air Shower Observatory

    Science.gov (United States)

    Ge, Maomao; Zhang, Li; Chen, Yingtao; Cao, Zhen; Zhang, Shoushan; Wang, Chong; Bi, Baiyang

    2016-05-01

    For the purpose of selecting the most suitable photomultiplier tubes (PMTs) for the Wide Field of view Cherenkov/fluorescence Telescope Array (WFCTA), we have performed extensive tests on seven models of 25.4 mm PMTs: Hamamatsu R1924A and R7899, Beijing Hamamatsu CR303, CR332A and CR364, and HZC Photonics XP3102 and XP3182. A dedicated test system has been developed to measure the PMT characteristics such as single photo-electron spectrum, gain, linearity, and spatial uniformity of anode output. The XP3182 and CR364 (R7899) tubes both meet the pivotal requirement due to their superior pulse linearity. The PMT test system, techniques used for these measurements, and their results are also reported.

  8. The electronics system for the LBNL positron emission mammography (PEM) camera

    CERN Document Server

    Moses, W W; Baker, K; Jones, W; Lenox, M; Ho, M H; Weng, M

    2001-01-01

    Describes the electronics for a high-performance positron emission mammography (PEM) camera. It is based on the electronics for a human brain positron emission tomography (PET) camera (the Siemens/CTI HRRT), modified to use a detector module that incorporates a photodiode (PD) array. An application-specified integrated circuit (ASIC) services the photodetector (PD) array, amplifying its signal and identifying the crystal of interaction. Another ASIC services the photomultiplier tube (PMT), measuring its output and providing a timing signal. Field-programmable gate arrays (FPGAs) and lookup RAMs are used to apply crystal-by-crystal correction factors and measure the energy deposit and the interaction depth (based on the PD/PMT ratio). Additional FPGAs provide event multiplexing, derandomization, coincidence detection, and real-time rebinning. Embedded PC/104 microprocessors provide communication, real-time control, and configure the system. Extensive use of FPGAs make the overall design extremely flexible, all...

  9. The atmospheric nightglow in the 300-400 nm wavelength Results by the balloon-borne experiment 'BABY'

    CERN Document Server

    Catalano, O; Biondo, B; Celi, F; Di Raffaele, R; Giarrusso, S; Linsley, J; Lo Bue, A; Mangano, A; Russo, F

    2002-01-01

    The balloon-borne experiment, named BAckground BYpass (BABY) belongs to a wider program that has as its final goal the detection and study of high-energy cosmic rays from space (satellite, Space Station). An information of fundamental importance for this class of projects concerns the nighttime background light. The instrument designed to detect fluorescence photons is basically composed of two collimated photomultipliers: a single photon-counting PMT and a charge integration PMT. We briefly report the details of the design, operation and performance of the detector, which was designed and completely built at the IFCAI-CNR Institute in Palermo. Preliminary analysis and results of the nocturnal background in the range of 300-400 nm are presented for the whole duration of the flight during the 1998 Mediterranean balloon flight campaign. A substantial part of the flight was at night over the sea.

  10. Analysis of Gamma Rays and Cosmic Muons with a Single Detector

    CERN Document Server

    Bachri, Abdel G; Goldschmidt, Azriel

    2011-01-01

    We report on the construction and upgrade of a Lawrence Berkeley National Laboratory Cosmic Muons Detector. We modify the electronics and mechanics to achieve a highly efficient gamma-ray and cosmic-ray detector. Each detector module uses a one-inch-thick scintillator, attached to a photomultiplier tube (PMT) and mounted on a solid aluminum frame. The detector uses scintillation to transform passing radiation into detectable photons that are guided toward a photocathode surface of the PMT, triggering the release of photoelectrons that are then amplified to yield measurable electronic signals. The modules were connected to an electronics section that compared the signals from the two PMTs and logically determined if they were coincidence events. A data-collection device was added for faster and prolonged count rates. A cobalt-60, which produced two gamma rays and a beta particle has been used as a calibration source. To investigate the isotropic behavior of radiation, two detection modules were adjusted to dif...

  11. Characterization of photomultiplier tubes in a novel operation mode for Secondary Emission Ionization Calorimetry

    Science.gov (United States)

    Tiras, E.; Dilsiz, K.; Ogul, H.; Southwick, D.; Bilki, B.; Wetzel, J.; Nachtman, J.; Onel, Y.; Winn, D.

    2016-10-01

    Hamamatsu single anode R7761 and multi-anode R5900-00-M16 Photomultiplier Tubes have been characterized for use in a Secondary Emission (SE) Ionization Calorimetry study. SE Ionization Calorimetry is a novel technique to measure electromagnetic shower particles in extreme radiation environments. The different operation modes used in these tests were developed by modifying the conventional PMT bias circuit. These modifications were simple changes to the arrangement of the voltage dividers of the baseboard circuits. The PMTs with modified bases, referred to as operating in SE mode, are used as an SE detector module in an SE calorimeter prototype, and placed between absorber materials (Fe, Cu, Pb, W, etc.). Here, the technical design of different operation modes, as well as the characterization measurements of both SE modes and the conventional PMT mode are reported.

  12. Spectroscopic measurement of ion temperature and ion velocity distributions in the flux-coil generated FRC.

    Science.gov (United States)

    Gupta, D; Bolte, N; Gota, H; Hayashi, R; Kiyashko, V; Marsili, P; Morehouse, M; Primavera, S; Roche, T; Wessel, F

    2010-10-01

    One aim of the flux-coil generated field reversed configuration at Tri Alpha Energy (TAE) is to establish the plasma where the ion rotational energy is greater than the ion thermal energy. To verify this, an optical diagnostic was developed to simultaneously measure the Doppler velocity-shift and line-broadening using a 0.75 m, 1800 groves/mm, spectrometer. The output spectrum is magnified and imaged onto a 16-channel photomultiplier tube (PMT) array. The individual PMT outputs are coupled to high-gain, high-frequency, transimpedance amplifiers, providing fast-time response. The Doppler spectroscopy measurements, along with a survey spectrometer and photodiode-light detector, form a suite of diagnostics that provide insights into the time evolution of the plasma-ion distribution and current when accelerated by an azimuthal-electric field.

  13. Enhancing the Linear Dynamic Range in Multi-Channel Single Photon Detector beyond 7OD

    Science.gov (United States)

    Gudkov, Dmytro; Gudkov, George; Gorbovitski, Boris; Gorfinkel, Vera

    2015-01-01

    We present design, implementation, and characterization of a single photon detector based on 32-channel PMT sensor [model H7260-20, Hamamatsu]. The developed high speed electronics enables the photon counting with linear dynamic range (LDR) up to 108count/s per detector's channel. The experimental characterization and Monte-Carlo simulations showed that in the single photon counting mode the LDR of the PMT sensor is limited by (i) “photon” pulse width (current pulse) of 900ps and (ii) substantial decrease of amplitudes of current pulses for count rates exceeding 108 count/s. The multi-channel architecture of the detector and the developed firm/software allow further expansion of the dynamic range of the device by 32-fold by using appropriate beam shaping. The developed single photon counting detector was tested for the detection of fluorescence labeled microbeads in capillary flow. PMID:27087788

  14. A Cross-sectional Study for Determinations of Prevention Behaviors of Domestic Accidents in Mothers with Children Less than 5- year

    Directory of Open Access Journals (Sweden)

    Farbod Ebadi Fardazar

    2016-05-01

    Full Text Available Background: Accidents are the first cause of death in children under 5- year, especially in low- and middle-income countries. The aim of this study was to identify the determinants of prevention behavior of domestic accidents in mothers of children fewer than 5 years old based on protection motivation theory PMT(. Materials and Methods: In this cross-sectional descriptive-analytic study, 190 mothers were randomly selected. The data collection tool was researcher made questionnaire about prevention behaviors of home accidents in children less than five years based on the structures of protection motivation theory.then collected data entered in the software SPSS-22 and were analyzed using descriptive and analytical statistical tests. Results: Mean of perceived response efficacy was in good level and mean of other structures of PMT were in moderate level. There was a significant correlations between the scores of perceived vulnerability (r=.39, P

  15. Effects of 60 MeV C{sup 5+} ion irradiation on PmT-PVC and p-TSA doped PoT-PVC blends

    Energy Technology Data Exchange (ETDEWEB)

    Lakshmi, G.B.V.S.; Siddiqui, Azher M.; Ali, Vazid [Department of Physics, Jamia Millia Islamia (Central University), New Delhi 25 (India); Kulriya, Pawan K. [Inter University Accelerator Centre, New Delhi 67 (India); Zulfequar, M. [Department of Physics, Jamia Millia Islamia (Central University), New Delhi 25 (India)], E-mail: mzulfe@rediffmail.com

    2008-04-15

    Poly(m-toluidine) (PmT) and Poly(o-toluidine) (PoT) have been synthesized from derivatives of aniline (m-toluidine), (o-toluidine) monomers by chemical oxidative polymerization method. After polymerization, PoT powder was doped with p-toluene sulphonic acid (p-TSA) and the polymer powders were blended with poly vinyl chloride (PVC) to achieve PmT and p-TSA doped PoT dispersed films. XRD, FTIR and UV-visible studies were carried out to get their structural changes and optical information. These blends were irradiated by 60 MeV C{sup 5+} ions with different fluences. Post Irradiation XRD, FTIR and UV-visible spectroscopy were also performed on all films. On p-TSA doped PoT-PVC blends dc-conductivity measurements are also carried out before and after irradiation. The results show structural modifications which lead to changes in optical and electrical properties.

  16. Effects of 60 MeV C 5+ ion irradiation on PmT-PVC and p-TSA doped PoT-PVC blends

    Science.gov (United States)

    Lakshmi, G. B. V. S.; Siddiqui, Azher M.; Ali, Vazid; Kulriya, Pawan K.; Zulfequar, M.

    2008-04-01

    Poly(m-toluidine) (PmT) and Poly(o-toluidine) (PoT) have been synthesized from derivatives of aniline (m-toluidine), (o-toluidine) monomers by chemical oxidative polymerization method. After polymerization, PoT powder was doped with p-toluene sulphonic acid (p-TSA) and the polymer powders were blended with poly vinyl chloride (PVC) to achieve PmT and p-TSA doped PoT dispersed films. XRD, FTIR and UV-visible studies were carried out to get their structural changes and optical information. These blends were irradiated by 60 MeV C5+ ions with different fluences. Post Irradiation XRD, FTIR and UV-visible spectroscopy were also performed on all films. On p-TSA doped PoT-PVC blends dc-conductivity measurements are also carried out before and after irradiation. The results show structural modifications which lead to changes in optical and electrical properties.

  17. Efficient and fast 511-keV γ detection through Cherenkov radiation: the CaLIPSO optical detector

    Science.gov (United States)

    Ramos, E.; Kochebina, O.; Yvon, D.; Verrecchia, P.; Sharyy, V.; Tauzin, G.; Mols, J. P.; Starzinski, P.; Desforges, D.; Flouzat, Ch.; Bulbul, Y.; Jan, S.; Mancardi, X.; Canot, C.; Alokhina, M.

    2016-11-01

    The CaLIPSO project aims to develop a high precision brain-scanning PET device with time-of-flight capability. The proposed device uses an innovative liquid, the TriMethyl Bismuth, as the detection medium. It detects simultaneously the ionization and optical signals from the 511 keV gamma conversion. In this paper we present the design, the Monte Carlo simulation, and the tests results for the CaLIPSO optical prototype. In this prototype we demonstrated the ability to detect efficiently the low number of the optical photons produced by the relativistic electron from the gamma conversion through the Cherenkov effect. The time resolution of the current prototype is limited by the moderate time transition spread of the PMT, but should be improved to the level better than 100 ps (FWHM) by using micro-channel-plate PMT according to the Geant 4 simulation.

  18. Triple-head gamma camera PET: system overview and performance characteristics.

    Science.gov (United States)

    Grosev, D; Loncarić, S; Vandenberghe, S; Dodig, D

    2002-08-01

    Positron emission tomography (PET) is currently performed using either a dedicated PET scanner or scintillation gamma camera equipped with electronic circuitry for coincidence detection of 511 keV annihilation quanta (gamma camera PET system). Although the resolution limits of these two instruments are comparable, the sensitivity and count rate performance of the gamma camera PET system are several times lower than that of the PET scanner. Most gamma camera PET systems are manufactured as dual-detector systems capable of performing dual-head coincidence imaging. One possible step towards the improvement of the sensitivity of the gamma camera PET system is to add another detector head. This work investigates the characteristics of one such triple-head gamma camera PET system capable of performing triple-head coincidence imaging. The following performance characteristics of the system were assessed: spatial resolution, sensitivity, count rate performance. The spatial resolution, expressed as the full width at half-maximum (FWHM), at 1 cm radius is 5.9 mm; at 10 cm radius, the transverse radial resolution is 5.3 mm, whilst the transverse tangential and axial resolutions are 8.9 mm and 13.3 mm, respectively. The sensitivity for a standard cylindrical phantom is 255 counts.s(-1).MBq*(-1)), using a 30% width photopeak energy window. An increase of 35% in the PET sensitivity is achievable by opening an additional 30% width energy window in the Compton region. The count rate in coincidence mode, at the upper limit of the systems optimal performance, is 45 kc.s(-1) (kc=kilocounts) using the photopeak energy window only, and increases to 60 kc.s(-1) using the photopeak + Compton windows. Sensitivity results are compared with published data for a similar dual-head detector system.

  19. The findings of F-18 FDG camera-based coincidence PET in acute leukemia

    Energy Technology Data Exchange (ETDEWEB)

    Yoon, S. N.; Joh, C. W.; Lee, M. H. [Ajou University School of Medicine, Suwon (Korea, Republic of)

    2002-07-01

    We evaluated the usefulness of F-18 FDG coincidence PET (CoDe-PET) using a dual-head gamma camera in the assessment of patients with acute leukemia. F-18 FDG CoDE-PET studies were performed in 5 patients with acute leukemia (6 ALL and 2 AML) before or after treatment. CoDe-PET was performed utilizing a dual-head gamma camera equipped with 5/8 inch NaI(Tl) crystal. Image acquisition began 60 minutes after the injection of F-18 FDG in the fasting state. A whole trunk from cervical to inguinal regions or selected region were scanned. No attenuation correction was made and image reconstruction was done using filtered back-projection. CoDe-PET studies were evaluated visually. F-18 FDG image performed in 5 patients with ALL before therapy depicted multiple lymph node involvement and diffuse increased uptake involving axial skeleton, pelvis and femurs. F-18 FDG image done in 2 AML after chemotherapy showed only diffuse increased uptake in sternum, ribs, spine, pelvis and proximal femur and these may be due to G-CSF stimulation effect in view of drug history. But bone marrow histology showed scattered blast cell suggesting incomplete remission in one and completer remission in another. F-18 image done in 1 ALL after therapy showed no abnormal uptake. CoDe-PET with F-18 FDG in acute lymphoblastic lymphoma showed multiple lymphnode and bone marrow involvement in whole body. Therefore we conclude that CoDe-PET with F-18 FDG usefulness for evaluation of extent in acute lymphoblastic leukemia. But there was a limitation to assess therapy effectiveness during therapy due to reactive bone marrow.

  20. A novel portable system for detecting and measuring tritium

    Science.gov (United States)

    Barillari, Domenico

    2007-06-01

    A novel tritium detector configuration is described based on the anthracene scintillation method. Tritium-bearing samples are applied to a plate-bearing finely sublimed anthracene crystals and viewed in a field-able PMT-based reader against a standard plate. A microprocessor-based control and signal analysis system delivers a reading with a sensitivity of better than 5 nCi 3H in approximately 3 min, and 2.3 nCi in 10 min of counting.

  1. The AMANDA Neutrino Detector

    Energy Technology Data Exchange (ETDEWEB)

    Wischnewski, R.; Andres, E.; Askebjer, P.; Barwick, S.; Bay, R.; Bergstrom, L.; Biron, A.; Booth, J.; Botner, O.; Bouchta, A.; Carius, S.; Carlson, M.; Chinowsky, W.; Chirkin, D.; Cowen, D.; Costa, C.; Dalberg,E.; Deyoung, T.; Edsjo, J.; Ekstrom, P.; Goobar, A.; Gray, L.; Hallgren,A.; Halzen, F.; Hardtke, R.; He, Y.; Hill, G.; Hulth, P.; Hundertmark,S.; Jacobsen, J.; Kandhadai, V.; Karle, A.; Kim, J.; Leich, H.; Leuthold,M.; Lindahl, P.; Liss, T.; Liubarsky, I.; Loaiza, P.; Lowder, D.; Marciniewski, P.; Miller, T.; Miocinovic, P.; Mock, P.; Morse, R.; Newcomer, M.; Niessen, P.; Nygren, D.; de, los, Heros, CP.; Porrata, R.; Price, P.; Przybylski, G.; Rhode, W.; Richter, S.; Rodriguez, J.; Romenesko, P.; Ross, D.; Rubinstein, H.; Schmidt, T.; Schneider, E.; Schwarz, R.; Schwendicke, U.; Smoot, G.; Solarz, M.; Sorin, V.; Spiering,C.; Steffen, P.; Stokstad, R.; Streicher, O.; Thollander, L.; Thon, T.; Tilav, S.; Walck, C.; Wiebusch, C.; Woschnagg, K.; Wu, W.; Yodh, G.; Young, S.

    1999-08-23

    The first stage of the AMANDA High Energy Neutrino Detectorat the South Pole, the 302 PMT array AMANDA-B with an expected effectivearea for TeV neutrinos of similar to 10(4) m(2), has been taking datasince 1997. Progress with calibration, investigation of ice properties,as well as muon and neutrino data analysis are described. The next stage20-string detector AMANDA-II with similar to 800 PMTs will be completedin spring 2000.

  2. The AMANDA Neutrino Detector

    Energy Technology Data Exchange (ETDEWEB)

    Wischnewski, R.; Andres, E.; Askebjer, P.; Barwick, S.; Bay, R.; Bergstroem, L.; Biron, A.; Booth, J.; Botner, O.; Bouchta, A.; Carius, S.; Carlson, M.; Chinowsky, W.; Chirkin, D.; Cowen, D.; Costa, C.; Dalberg, E.; Deyoung, T.; Edsjo, J.; Ekstroem, P.; Goobar, A.; Gray, L.; Hallgren, A.; Halzen, F.; Hardtke, R.; He, Y.; Hill, G.; Hulth, P.; Hundertmark, S.; Jacobsen, J.; Kandhadai, V.; Karle, A.; Kim, J.; Leich, H.; Leuthold, M.; Lindahl, P.; Liss, T.; Liubarsky, I.; Loaiza, P.; LOwder, D.; Marciniewski, P.; Miller, T.; Miocinovic, P.; Mock, P.; Morse, R.; Newcomer, M.; Niessen, P.; Nygren, D.; Perez de los Heros, C.; Porrata, R.; Price, P.; Przybylski, G.; Rhode, W.; Richter, S.; Rodriguez, J.; Romenesko, P.; Ross, D.; Rubinstein, H.; Schmidt, T.; Schneider, E.; Schwarz, R.; Schwendicke, U.; Smoot, G.; Solarz, M.; Sorin, V.; Spiering, C.; Steffen, P.; Stokstad, R.; Streicher, O.; Thollander, L.; Thon, T.; Tilav, S.; Walck, C.; Wiebusch, C.; Woschnagg, K.; Wu, W.; Yodh, G.; Young, S

    1999-03-01

    The first stage of the AMANDA High Energy Neutrino Detector at the South Pole, the 302 PMT array AMANDA-B with an expected effective area for TeV neutrinos of {approx} 10{sup 4} m{sup 2}, has been taking data since 1997. Progress with calibration, investigation of ice properties, as well as muon and neutrino data analysis are described. The next stage 20-string detector AMANDA-II with {approx}800 PMTs will be completed in spring 2000.

  3. The AMANDA Neutrino Detector - Status report

    Energy Technology Data Exchange (ETDEWEB)

    Wischnewski, R.; Andres, E.; Bai, X.; Barouch, G.; Barwick, S.; Bay, R.; Becker, K.; Bergstroem, L.; Bertrand, D.; Besson, D.; Biron, A.; Booth, J.; Botner, O.; Bouchta, A.; Carius, S.; Carlson, M.; Chinowsky, W.; Chirkin, D.; Conrad, J.; Cowen, D.F.; Costa, C.; Dalberg, E.; Desiati, P.; Dewulf, J.; Deyoung, T.; Doksus, P.; Edsjoe, J.; Ekstroem, P.; Feser, T.; Frichter, G.; Gaisser, T.; Goldschmidt, A.; Goobar, A.; Hallgren, A.; Halzen, F.; Hardtke, R.; Hellwig, M.; Hill, G.; Hulth, P.; Hundertmark, S.; Jacobsen, J.; Karle, A.; Kim, J.; Koepke, L.; Kowalski, M.; Kravchenko, I.; Lamoureux, J.; Leich, H.; Leuthold, M.; Lindahl, P.; Liss, T.; Loaiza, P.; Lowder, D.; Ludvig, J.; Marciniewski, P.; Matis, H.; Miller, T.; Miocinovic, P.; Mock, P.; Morse, R.; Neunhoeffer, T.; Newcomer, M.; Niessen, P.; Nygren, D.; Perez de los Heros, C.; Porrata, R.; Price, P.; Przybylski, G.; Rawlins, K.; Rhode, W.; Richter, S.; Rodriguez, J.; Romenesko, P.; Ross, D.; Rubinstein, H.; Sander, H.; Schaefer, U.; Schmidt, T.; Schneider, E.; Schwarz, R.; Schwendicke, U.; Silvestri, A.; Smoot, G.; Solarz, M.; Spiczak, G.; Spiering, C.; Starinski, N.; Steffen, P.; Stokstad, R.; Streicher, O.; Taboada, I.; Thollander, L.; Thon, T.; Tilav, S.; Vander Donckt, M.; Walck, C.; Wiebusch, C.; Woschnagg, K.; Wu, W.; Yodh, G.; Young, S

    2000-05-01

    The first stage of the AMANDA High Energy Neutrino Detector at the South Pole, the 302 PMT array AMANDA-B10, is taking data since 1997. We describe results on atmospheric neutrinos, limits on indirect WIMP detection, seasonal muon flux variation, relativistic monopole flux limits, a search for gravitational collapse neutrinos, and a depth scan of the optical ice properties. The next stage 19-string detector AMANDA-II with {approx}650 PMTs will be completed in spring 2000.

  4. Proceedings of the High Energy Density Matter (HEDM) Conference Held in Rosslyn, Virginia on 12-13 May 1987,

    Science.gov (United States)

    1987-09-01

    laser initiated decomposition, IR, UV-Vis, ultraviolet, visible, spectroscopy, H 30, N 202, dinitrogen dioxide , CO, carbon monoxide, CH, high spin...asymmetric dinitrogen dioxide (a-N202), is an analogue of fluorine azide (FN3) and is predicted to be a cryogenic solid. Benard reported that FN3 can be...DETECTION OF H4 * PHOTODISSOCIATION TO FORM H2(B) - A 500 nm - DETECT H2 (B) EMISSION WITH PMT - FLASHLAMP PHOTOLYSIS, X = 200 TO 800 nm - LASER

  5. Data Acquisition System of Low-dose X-ray for People and Package Synchronous Detection

    Institute of Scientific and Technical Information of China (English)

    ZHANG; Shuai; ZHANG; Guo-guang; FENG; Shu-qiang

    2015-01-01

    Low-dose X-ray system for people and parcel detection at the same time is a system of double angle one-dimensional array detector scanning imaging.It’s front detector using LYSO crystal of UM-MicroC Si-PMT.Each 16pixels package for a small module,and export signals.Each 8small modules composite one floor(128pixels

  6. Nuclear criticality safety: 300 Area

    Energy Technology Data Exchange (ETDEWEB)

    1991-07-31

    This Standard applies to the receipt, processing, storage, and shipment of fissionable material in the 300 Area and in any other facility under the control of the Reactor Materials Project Management Team (PMT). The objective is to establish practices and process conditions for the storage and handling of fissionable material that prevent the accidental assembly of a critical mass and that comply with DOE Orders as well as accepted industry practice.

  7. Measurement of Photomultipier Plateau Curves and Single MIP response in the AD detector at ALICE

    CERN Document Server

    Sanchez Falero, Sebastian De Jesus

    2015-01-01

    The Alice Diffractive (AD) detector is a forward detector in the ALICE experiment at CERN. It is aimed to the triggering on diffractive events and extends the pseudorapidity coverage to about 4.9 < /n/ < 6.3. In this work, a PMT's efficiency plateau and single MIP response are measured using a replica of the detector's scintillator modules, electronic and data acquisition system and cosmic rays as particle source.

  8. Demonstration of photomultiplier tube operation at 29 K

    CERN Document Server

    Nikkel, J A; McKinsey, D N; Nikkel, James A.; Kinsey, Daniel N. Mc

    2007-01-01

    We describe measurements of gain, dark current, and quantum efficiency obtained while cooling a Hamamatsu R5912-02-MOD photomultiplier tube from room temperature to 29 K. We found that the PMT operated normally down to 29 K, with a reduced gain and quantum efficiency at the lowest temperatures. Furthermore, we found that the dark count rate increased as the temperature decreased. We conclude that these PMTs appear to be adequate for the requirements of the CLEAN experiment.

  9. The FUNK search for Hidden Photon Dark Matter in the eV range

    CERN Document Server

    Döbrich, Babette; Engel, Ralph; Jaeckel, Joerg; Kowalski, Marek; Lindner, Axel; Mathes, Hermann-Josef; Redondo, Javier; Roth, Markus; Schäfer, Christoph; Ulrich, Ralf; Veberic, Darko

    2015-01-01

    We give a brief update on the search for Hidden Photon Dark Matter with FUNK. The experiment uses a large spherical mirror, which, if Hidden Photon Dark Matter exists in the accessible mass and coupling parameter range, would yield an optical signal in the mirror's center in an otherwise dark environment. After a test run with a CCD, preparations for a run with a low-noise PMT are under way and described in this proceedings.

  10. Transposition of Tn5096 from a temperature-sensitive transducible plasmid in Streptomyces spp.

    Science.gov (United States)

    McHenney, M A; Baltz, R H

    1991-09-01

    Transposon Tn5096 was inserted into a derivative of the temperature-sensitive plasmid pMT660 containing the bacteriophage FP43 pac site. The resulting plasmid, pRHB126, was transduced by FP43 into several Streptomyces species. Tn5096 transposed from pRHB126 into different sites in the genomes of Streptomyces ambofaciens, Streptomyces cinnamonensis, Streptomyces coelicolor A3(2), Streptomyces fradiae, Streptomyces griseofuscus, and Streptomyces thermotolerans.

  11. Complete genome sequence of Yersinia pestis strain 91001, an isolate avirulent to humans

    DEFF Research Database (Denmark)

    Song, Yajun; Tong, Zongzhong; Wang, Jin;

    2004-01-01

    -Microtus brandti. The genome of strain 91001 consists of one chromosome and four plasmids (pPCP1, pCD1, pMT1 and pCRY). The 9609-bp pPCP1 plasmid of strain 91001 is almost identical to the counterparts from reference strains (CO92 and KIM). There are 98 genes in the 70,159-bp range of plasmid pCD1. The 106,642-bp...

  12. Ultraviolet Communication for Medical Applications

    Science.gov (United States)

    2012-06-01

    plasma discharges every 100 μs. The location of each discharge can be modulated to produce M-ary pulse position modulation (PPM), which encodes...counting compound semiconductor avalanche photodiodes (APD) are not yet commercially available, and no component manufacturer has stated that one is...short optical pulses with either an LED or Plasma-shell source, and receives scattered photons with a photon-counting PMT and data-logs the received

  13. Photocathode-Uniformity Tests of the Hamamatsu R5912 Photomultiplier Tubes Used in the Milagro Experiment

    CERN Document Server

    Vasileiou, V; Smith, A J

    2007-01-01

    The Milagro experiment observes the extensive air showers produced by very high energy gamma-rays impacting the Earth's atmosphere. Milagro uses 898 Hamamatsu R5912 Photomultiplier Tubes. To complete our Monte Carlo simulations, we tested the photocathode uniformity of our PMTs. The main finding was that the PMT gain and detection efficiency are a function of the distance from the center of the photocathode. Both quantities become considerably smaller as the illumination position nears the edge of the photocathode.

  14. Protection motivation theory in predicting intention to engage in protective behaviors against schistosomiasis among middle school students in rural China.

    Science.gov (United States)

    Xiao, Han; Li, Shiyue; Chen, Xinguang; Yu, Bin; Gao, Mengting; Yan, Hong; Okafor, Chukwuemeka N

    2014-10-01

    Among millions of people who suffer from schistosomiasis in China, adolescents are at increased risk to be infected. However, there is a lack of theory-guided behavioral prevention intervention programs to protect these adolescents. This study attempted to apply the Protection Motivation Theory (PMT) in predicting intentions to engage in protective behaviors against schistosomiasis infection. The participants were selected using the stratified cluster sampling method. Survey data were collected using anonymous self-reported questionnaire. The advanced structural equation modeling (SEM) method was utilized to assess the complex relationship among schistosomiasis knowledge, previous risk exposure and protective measures in predicting intentions to engage in protective behavior through the PMT constructs. Approximately 70% of participants reported they were always aware of schistosomiasis before exposure to water with endemic schistosomiasis, 6% of the participants reported frequency of weekly or monthly prior exposure to snail-conditioned water. 74% of participants reported having always engaged in protective behaviors in the past three months. Approximately 7% were unlikely or very unlikely to avoid contact with snail-conditioned water, and to use protective behaviors before exposure. Results from SEM analysis indicated that both schistosomiasis knowledge and prior exposure to schistosomiasis were indirectly related to behavior intentions through intrinsic rewards and self-efficacy; prior protective behaviors were indirectly related to behavior intentions through severity, intrinsic rewards and self-efficacy, while awareness had an indirect relationship with behavior intentions through self-efficacy. Among the seven PMT constructs, severity, intrinsic rewards and self-efficacy were significantly associated with behavior intentions. The PMT can be used to predict the intention to engage in protective behaviors against schistosomiasis. Schistosomiasis intervention

  15. New regulations regarding Postgraduate Medical Training in Spain: perception of the tutor's role in the Murcia Region

    Directory of Open Access Journals (Sweden)

    Saura-Llamas José

    2010-06-01

    Full Text Available Abstract Background Recently introduced regulatory changes have expanded the Tutor role to include their primary responsibility for Postgraduate Medical Training (PMT. However, accreditation and recognition of that role has been devolved to the autonomic regions. The opinions of the RT may be relevant to future decisions; Methods A comprehensive questionnaire, including demographic characteristics, academic and research achievement and personal views about their role, was sent to 201 RTs in the Murcia Region of Spain. The responses are described using median and interquartile ranges (IQR; Results There were 147 replies (response rate 73%, 69% male, mean age 45 ± 7 yrs. RTs perception of the residents' initial knowledge and commitment throughout the program was 5 (IQR 4-6 and 7 (IQR 5-8, respectively. As regards their impact on the PMT program, RTs considered that their own contribution was similar to that of senior residents. RTs perception of how their role was recognised was 5 (IQR 3-6. Only 16% did not encounter difficulties in accessing specific RT training programs. Regarding the RTs view of their various duties, supervision of patient care was accorded the greatest importance (64% while the satisfactory completion of the PMT program and supervision of day-to-day activities were also considered important (61% and 59% respectively. The main RT requirements were: a greater professional recognition (97%, protected time (95%, specific RT training programs (95% and financial recognition (86%; Conclusions This comprehensive study, reflecting the feelings of our RTs, provides a useful insight into the reality of their work and the findings ought to be taken into consideration in the imminent definitive regulatory document on PMT.

  16. Determination of Radon concentration in air using scinti-cell radon monitor

    Energy Technology Data Exchange (ETDEWEB)

    Koga, Taeko [Kinki Univ., Higashi-Osaka, Osaka (Japan). Atomic Energy Research Inst; Morishima, Hiroshige; Arai, Naoki; Shiraishi, Masatoshi; Shigehara, Makiko [Dept. of Nuclear Engineering, School of Science and Technology, Kinki Univ., Higashi-Osaka, Osaka(Japan); Mifune, Masaaki

    2000-01-01

    This study is carried out the methodology characteristics of {sup 222}Rn (Radon) concentration in air using the scinti-cell radon monitor (Trace environmental level detector (PMT-TEL) and Lucas cell (300 A), Pylon Co. and the determination of Radon concentrations in air on Misasa spa area in Tottori pref. and Ikeda spa in Shimane pref. on November 1995 and 1996. We have reached to the following results; (1) Minimum detectable Radon concentrations in air using the scinti-cell monitor are 7.6 Bq/m{sup 3} with 23% of accuracy (relative standard deviation) on the grab sampling of Lucas cell and 0.58 Bq/m{sup 3} with that of 17% on the continuous measuring of PMT-TEL, when it measured after 3.5 hours on the air sampling to determine the mean radon concentrations. The radon concentrations by the PMT-TEL method is about ten times more detectable than those by Lucas cell, that the former is the most sensitive among the detectors used on this research and is able to detect low level environmental concentrations, particularly outdoor and the later is valuable to use conveniently and portably on grab spot sampling of high level radon concentrations indoor air. (2) On the comparison of characteristics on spot monitoring of radon in air, a pico-rad method is suitable for the determination of the mean concentration for continuous sampling period by PMT-TEL and Lucas cell 300 A, and the variation of radon concentration can be observed on elapse of time course. (author)

  17. Enhanced Photon Traps for Hyper-Kamiokande

    OpenAIRE

    Rott, Carsten; In, Seongjin; Retière, Fabrice; Gumplinger, Peter

    2017-01-01

    Hyper-Kamiokande, the next generation large water Cherenkov detector in Japan, is planning to use approximately 80,000 20-inch photomultiplier tubes (PMTs). They are one of the major cost factors of the experiment. We propose a novel enhanced photon trap design based on a smaller and more economical PMT in combination with wavelength shifters, dichroic mirrors, and broadband mirrors. GEANT4 is utilized to obtain photon collection efficiencies and timing resolution of the photon traps. We comp...

  18. Gclust Server: 98465 [Gclust Server

    Lifescience Database Archive (English)

    Full Text Available uence length 253 Representative annotation dehydrogenase with different specificities...98465 Pm4_PMT9312_1351 Cluster Sequences Related Sequences(192) 253 dehydrogenase with different specificiti...es 1 1.00e-99 0.0 0.0 4.0 0.0 0.0 0.0 Show 98465 Cluster ID 98465 Sequence ID Pm4_P

  19. PHOSPHATURIC MESENCHYMAL TUMOUR ASSOCIATED WITH OSTEOMALACIA : A CASE REPORT

    Directory of Open Access Journals (Sweden)

    Veena

    2015-02-01

    Full Text Available Phosphaturic mesenchymal tumour is a tumour that can involve bone or soft tissue. This is a rare tumour and is known to be associated with osteomalasia. This is caused by tumour induced expression of fibroblastic growth factor (FGF23. We present a case of PMT in a 72 year old female patient who was diagnosed with osteomalasia due to nutritional deficiency of vitamin D and was appropriately treated but later presented with a mass in her foot.

  20. A novel compensation method for the anode gain non-uniformity of multi-anode photomultiplier tubes.

    Science.gov (United States)

    Lee, Chan Mi; Il Kwon, Sun; Ko, Guen Bae; Ito, Mikiko; Yoon, Hyun Suk; Lee, Dong Soo; Hong, Seong Jong; Lee, Jae Sung

    2012-01-07

    The position-sensitive multi-anode photomultiplier tube (MA-PMT) is widely used in high-resolution scintillation detectors. However, the anode gain nonuniformity of this device is a limiting factor that degrades the intrinsic performance of the detector module. The aim of this work was to develop a gain compensation method for the MA-PMT and evaluate the resulting enhancement in the performance of the detector. The method employs a circuit that is composed only of resistors and is placed between the MA-PMT and a resistive charge division network (RCN) used for position encoding. The goal of the circuit is to divide the output current from each anode, so the same current flows into the RCN regardless of the anode gain. The current division is controlled by the combination of a fixed-value series resistor with an output impedance that is much larger than the input impedance of the RCN, and a parallel resistor, which detours part of the current to ground. PSpice simulations of the compensation circuit and the RCN were performed to determine optimal values for the compensation resistors when used with Hamamatsu H8500 MAPMTs. The intrinsic characteristics of a detector module consisting of this MA-PMT and a lutetium-gadolinium-oxyorthosilicate (LGSO) crystal array were tested with and without the gain compensation method. In simulation, the average coefficient of variation and max/min ratio decreased from 15.7% to 2.7% and 2.0 to 1.2, respectively. In the flood map of the LGSO-H8500 detector, the uniformity of the photopeak position for individual crystals and the energy resolution were much improved. The feasibility of the method was shown by applying it to an octagonal prototype positron emission tomography scanner.

  1. Range Precision of LADAR Systems

    Science.gov (United States)

    2008-09-01

    Radars with Geiger - Mode Avalanche Photodiode Ar- rays,” Lincoln Laboratory Journal , 13 (2):351–370 (2002). 3. Andrews L. and Phillips R. Laser Beam...5 APD Avalanche Photodiode . . . . . . . . . . . . . . . . . . . . 5 MLE Maximum Likelihood Estimate . . . . . . . . . . . . . . . 7 CRLB Cramer...Typical detectors are photomultiplier tubes (PMT)s, p-i-n diodes, and avalanche photodiodes (APD)s. There is noise in the received signal. One source of

  2. Characterization of large volume 3.5″×8″ LaBr3:Ce detectors

    Science.gov (United States)

    Giaz, A.; Pellegri, L.; Riboldi, S.; Camera, F.; Blasi, N.; Boiano, C.; Bracco, A.; Brambilla, S.; Ceruti, S.; Coelli, S.; Crespi, F. C. L.; Csatlòs, M.; Frega, S.; Gulyàs, J.; Krasznahorkay, A.; Lodetti, S.; Million, B.; Owens, A.; Quarati, F.; Stuhl, L.; Wieland, O.

    2013-11-01

    The properties of large volume cylindrical 3.5″×8″ (89 mm×203 mm) LaBr3:Ce scintillation detectors coupled to the Hamamatsu R10233-100SEL photo-multiplier tube were investigated. These crystals are among the largest ones ever produced and still need to be fully characterized to determine how these detectors can be utilized and in which applications. We tested the detectors using monochromatic γ-ray sources and in-beam reactions producing γ rays up to 22.6 MeV; we acquired PMT signal pulses and calculated detector energy resolution and response linearity as a function of γ-ray energy. Two different voltage dividers were coupled to the Hamamatsu R10233-100SEL PMT: the Hamamatsu E1198-26, based on straightforward resistive network design, and the “LABRVD”, specifically designed for our large volume LaBr3:Ce scintillation detectors, which also includes active semiconductor devices. Because of the extremely high light yield of LaBr3:Ce crystals we observed that, depending on the choice of PMT, voltage divider and applied voltage, some significant deviation from the ideally proportional response of the detector and some pulse shape deformation appear. In addition, crystal non-homogeneities and PMT gain drifts affect the (measured) energy resolution especially in case of high-energy γ rays. We also measured the time resolution of detectors with different sizes (from 1″×1″ up to 3.5″×8″), correlating the results with both the intrinsic properties of PMTs and GEANT simulations of the scintillation light collection process. The detector absolute full energy efficiency was measured and simulated up to γ-rays of 30 MeV

  3. A versatile test bench for photomultiplier tube characterization and its application in the DAMPE-PSD

    CERN Document Server

    Zhou, Yong; Yu, Yuhong; Zhang, Yongjie; Fang, Fang; Chen, Junling; Hu, Bitao

    2016-01-01

    A versatile test bench system, dedicated for massive PMT characterization, is developed at the Institute of Modern Physics, Chinese Academy of Sciences. It can perform many test contents with large capacity and high level of automation, and the migration from one testing configuration to another is lightweight and time-saving. This system has been used in the construction of the Plastic Scintillator Detector of DArk Matter Particle Explorer already, and a total of 570 Hamamatsu R4443 tubes have been tested successfully.

  4. 何首乌醇提物对脂多糖诱导大鼠肝TLR4/TRIF/IRF-3信号通路的影响%Effect of ethanol extracts from Polygonum multiflorum Thunb on expressions of signal pathway TLR4/TRIF/IRF-3 in LPS induced rats liver

    Institute of Scientific and Technical Information of China (English)

    毛宏梅; 谢丽华; 樊星; 吴纯启; 王茜莎; 王全军

    2016-01-01

    目的:研究大鼠经革兰阴性菌外膜成分脂多糖(LPS)诱导后,何首乌醇提物(PMT)对大鼠的肝毒性,并探讨其肝损伤机制与固有免疫炎症信号通路Toll样受体4(TLR4)-干扰素调节因子3(IRF-3)的关系。方法雄性SD大鼠随机分为正常对照组、对乙酰氨基酚(APAP,625 mg/kg)组、PMT 6 g/kg(PMT-L)和12 g/kg(PMT-H)组、脂多糖(LPS,4 g/L)组、(LPS+APAP)和(LPS+PMT-L/-H)组。后4组经尾静脉注射LPS 4 mg/kg,2 h后各实验组分别灌胃给予相应药物每日1次,连续7 d。观察每日大鼠体质量变化,分别在给药结束后2 h、14 h、5 d和8 d经HE染色检测大鼠组织形态变化,采用实时荧光定量PCR(RT-qPCR)法及Western印迹法检测肝细胞中TLR4信号通路干扰素TIR结构域衔接蛋白(TRIF)、IRF-3的表达情况。结果大鼠尾静脉注射LPS诱导后2 h,肝实质出现微小肉芽肿,其后,LPS组大鼠肝损伤逐渐恢复。诱导第8天时,LPS组大鼠肝组织结构清晰完整,LPS+APAP组和LPS+PMT各剂量组肝细胞灶状坏死,伴炎细胞浸润。RT-qPCR检测法和Western印迹法检测结果显示,单独灌胃何首乌醇提物的大鼠肝细胞中TLR4、TRIF和IRF-3的mRNA和蛋白表达水平与正常组相比无显著差异,而经LPS诱导的大鼠肝细胞TLR4、TRIF和IRF-3 mRNA和蛋白表达水平显著高于正常对照组,与LPS组相比有显著性差异(P<0.05),但PMT各剂量组间相比无显著差异。结论何首乌醇提物经LPS诱导能引起肝损伤,其引起的肝毒性与正性调控TLR4/IRF-3信号通路的表达有关,其肝损伤程度与给药剂量无关,提示TLR4/IRF-3信号通路的激活是LPS诱导何首乌醇提物肝损伤的作用机制之一。%Objective To research the toxicity of ethanol extracts from Poylgonum multiflorum Thunb(PMT)induced by en⁃dotoxin of Gram-negative bacteria lipopolysaccharide(LPS)in rat liver,and then

  5. Characterization of large volume 3.5″×8″ LaBr{sub 3}:Ce detectors

    Energy Technology Data Exchange (ETDEWEB)

    Giaz, A.; Pellegri, L.; Riboldi, S. [Università degli Studi di Milano, Physics Department, Via Celoria 16, 20133 Milano (Italy); INFN Milano, Via Celoria 16, 20133 Milano (Italy); Camera, F., E-mail: Franco.Camera@mi.infn.it [Università degli Studi di Milano, Physics Department, Via Celoria 16, 20133 Milano (Italy); INFN Milano, Via Celoria 16, 20133 Milano (Italy); Blasi, N.; Boiano, C. [INFN Milano, Via Celoria 16, 20133 Milano (Italy); Bracco, A. [Università degli Studi di Milano, Physics Department, Via Celoria 16, 20133 Milano (Italy); INFN Milano, Via Celoria 16, 20133 Milano (Italy); Brambilla, S. [INFN Milano, Via Celoria 16, 20133 Milano (Italy); Ceruti, S. [Università degli Studi di Milano, Physics Department, Via Celoria 16, 20133 Milano (Italy); Coelli, S. [INFN Milano, Via Celoria 16, 20133 Milano (Italy); Crespi, F.C.L. [Università degli Studi di Milano, Physics Department, Via Celoria 16, 20133 Milano (Italy); INFN Milano, Via Celoria 16, 20133 Milano (Italy); Csatlòs, M. [Institute of Nuclear Research of the Hungarian Academy of Sciences (ATOMKI), P.O. Box 51, H-4001 Debrecen (Hungary); Frega, S. [Università degli Studi di Milano, Physics Department, Via Celoria 16, 20133 Milano (Italy); Gulyàs, J.; Krasznahorkay, A. [Institute of Nuclear Research of the Hungarian Academy of Sciences (ATOMKI), P.O. Box 51, H-4001 Debrecen (Hungary); Lodetti, S. [Università degli Studi di Milano, Physics Department, Via Celoria 16, 20133 Milano (Italy); Million, B. [INFN Milano, Via Celoria 16, 20133 Milano (Italy); Owens, A.; Quarati, F. [SRE-PA, ESA/ESTEC, Keplerlaan 1, 2200AG Noordwijk (Netherlands); Stuhl, L. [Institute of Nuclear Research of the Hungarian Academy of Sciences (ATOMKI), P.O. Box 51, H-4001 Debrecen (Hungary); and others

    2013-11-21

    The properties of large volume cylindrical 3.5″×8″ (89 mm×203 mm) LaBr{sub 3}:Ce scintillation detectors coupled to the Hamamatsu R10233-100SEL photo-multiplier tube were investigated. These crystals are among the largest ones ever produced and still need to be fully characterized to determine how these detectors can be utilized and in which applications. We tested the detectors using monochromatic γ–ray sources and in-beam reactions producing γ rays up to 22.6 MeV; we acquired PMT signal pulses and calculated detector energy resolution and response linearity as a function of γ-ray energy. Two different voltage dividers were coupled to the Hamamatsu R10233-100SEL PMT: the Hamamatsu E1198-26, based on straightforward resistive network design, and the “LABRVD”, specifically designed for our large volume LaBr{sub 3}:Ce scintillation detectors, which also includes active semiconductor devices. Because of the extremely high light yield of LaBr{sub 3}:Ce crystals we observed that, depending on the choice of PMT, voltage divider and applied voltage, some significant deviation from the ideally proportional response of the detector and some pulse shape deformation appear. In addition, crystal non-homogeneities and PMT gain drifts affect the (measured) energy resolution especially in case of high-energy γ rays. We also measured the time resolution of detectors with different sizes (from 1″×1″ up to 3.5″×8″), correlating the results with both the intrinsic properties of PMTs and GEANT simulations of the scintillation light collection process. The detector absolute full energy efficiency was measured and simulated up to γ-rays of 30 MeV.

  6. Identification of Novel Targets of the Human Cell Cycle Regulatory Protein Cdc34

    Science.gov (United States)

    1999-07-01

    mm-diameter dishes were cotransfected with ICERII’y and either HA pSV-mouse CREM P (P. Sassone-Corsi, Institut de Genetique et de Biologic (pMT133...versus the reciprocal maternal weight fits the observed data well for all three, with aThese data indicate that population screening detects a...that these expansions 148.0965,-0,03133 for PAPP-A. Adjusting for maternal weight reduces population are probably benign in most cases. Direct

  7. Results on CASTOR Performance during LHC Run 2

    CERN Document Server

    CMS Collaboration

    2016-01-01

    The intercalibration of the gains of the fine mesh PMT's using beam-halo muons is discussed, this in combination with results of a study on the noise and baseline. Two methods on obtaining gain correction factors for reweighing the gains between different high voltage settings are compared. Results on the efficiency of a CASTOR jet trigger are compared for LHC Run 2 collision data and Monte Carlo event generator predictions.

  8. Electrochromic devices based on poly(3-methylthiophene) and various secondary electrochromic materials

    Energy Technology Data Exchange (ETDEWEB)

    Rios, Emerson da Costa; Viana Rosario, Adriane [Laboratorio Interdisciplinar de Eletroquimica e Ceramica - Centro Multidisciplinar para o Desenvolvimento de Materiais Ceramicos - Departamento de Quimica, Universidade Federal de Sao Carlos, CP 676, 13565-905 Sao Carlos, SP (Brazil); Flavia Nogueira, Ana [Laboratorio de Nanotecnologia e Energia Solar, Instituto de Quimica, Universidade Estadual de Campinas, CP 6154, 13084-971 Campinas, SP (Brazil); Micaroni, Liliana [Laboratorio de Eletroquimica Aplicada e Polimeros - Departamento de Quimica, Universidade Federal do Parana, CP 19081, 81531-990 Curitiba, PR (Brazil)

    2010-08-15

    In this paper, the electrochemical properties of poly(3-methylthiophene) (PMT), poly(3,4-ethylenedioxythiophene) (PEDOT) and niobium pentoxide (Nb{sub 2}O{sub 5}) films deposited on ITO are described. PMT films were made by galvanostatic electrodeposition. PEDOT and Nb{sub 2}O{sub 5} were deposited by spin-coating from a suspension, in the case of PEDOT, and from a precursor solution obtained by the Pechini method, for Nb{sub 2}O{sub 5}. Three electrochromic devices were assembled from these films, with different arrangements of electrodes, using poly(epichlorohydrin-co-ethylene oxide) (P(EPI-EO))+LiClO{sub 4} as the polymer electrolyte. The PMT films were employed as the working electrode (E{sub 1}) and PEDOT, Nb{sub 2}O{sub 5} or ITO as counter-electrodes (E{sub 2}). The devices showed color changes from red to blue in response to the applied potential from -1.5 to +1.5 V (PMT vs. E{sub 2}), respectively. The transmittance variation was measured in the visible region ({lambda}=650 nm) during the polarization. The systems were also characterized with respect to their coulombic efficiency (CE), electrochromic efficiency ({eta}) and response time ({tau}). The three devices gave similar results, as follows: CE of 107%, {eta} from 92 to 126 cm{sup 2} C{sup -1} and {tau}{proportional_to}2 s. The cycle life and optical memory were also analyzed and the devices showed good durability for 1000 cycles and good optical memory, demonstrating the potential applicability of the electrochromic devices presented here. (author)

  9. A high dynamic range readout unit for a calorimeter

    Institute of Scientific and Technical Information of China (English)

    ZHANG Yun-Long; WU Jian; CHANG Jin; LI Bing; FENG Chang-Qing; LI Xian-Li; WANG Xiao-Lian; XU Zi-Zong; GUO Jian-Hua; CAI Ming-Sheng; HU Yi-Ming

    2012-01-01

    A high dynamic range readout system,consisting of a multi-dynode readout PMT and a VA32 chip,is presented.An LED system is set up to calibrate the relative gains between the dynodes,and the ADC counts per MIPs from dynode 7 are determined under cosmic-ray calibration.A dynamic range from 0.5 MIPs to 1 × 105 MIPs is achieved.

  10. Transposition of Tn5096 from a temperature-sensitive transducible plasmid in Streptomyces spp.

    OpenAIRE

    McHenney, M A; Baltz, R H

    1991-01-01

    Transposon Tn5096 was inserted into a derivative of the temperature-sensitive plasmid pMT660 containing the bacteriophage FP43 pac site. The resulting plasmid, pRHB126, was transduced by FP43 into several Streptomyces species. Tn5096 transposed from pRHB126 into different sites in the genomes of Streptomyces ambofaciens, Streptomyces cinnamonensis, Streptomyces coelicolor A3(2), Streptomyces fradiae, Streptomyces griseofuscus, and Streptomyces thermotolerans.

  11. Testing of photomultiplier tubes for use in the surface detector of the Pierre Auger observatory

    Energy Technology Data Exchange (ETDEWEB)

    Barnhill, D. [Department of Physics and Astronomy, UCLA, Los Angeles, CA 90095-1547 (United States)], E-mail: david.scott.barnhill@gmail.com; Suarez, F. [INFN, Universita degli Studi di Torino (Italy)], E-mail: fedesuarez@auger.org.ar; Arisaka, K. [Department of Physics and Astronomy, UCLA, Los Angeles, CA 90095-1547 (United States); Garcia, B. [UTN-FRM Mendoza (Argentina); Gongora, J.P. [UTN-FRSR San Rafael (Argentina); Lucero, A.; Navarro, I. [UTN-FRM Mendoza (Argentina); Ohnuki, T. [Department of Physics and Astronomy, UCLA, Los Angeles, CA 90095-1547 (United States); Risi, A. [UTN-FRSR San Rafael (Argentina); Tripathi, A. [Department of Physics and Astronomy, UCLA, Los Angeles, CA 90095-1547 (United States)

    2008-07-01

    In the array of water Cherenkov detectors of the Pierre Auger Observatory, 4800 large photomultiplier tubes (PMTs) will be used. Before being deployed, each PMT is evaluated to check that various parameters, such as the linearity, dark noise, and gain, fall within a specified range. The large scale test system, designed and constructed for this purpose, is capable of testing multiple large PMTs simultaneously. The test system and the results of the tests for the first 3964 PMTs are presented in this paper.

  12. High speed optical quantum random number generation.

    Science.gov (United States)

    Fürst, Martin; Weier, Henning; Nauerth, Sebastian; Marangon, Davide G; Kurtsiefer, Christian; Weinfurter, Harald

    2010-06-07

    We present a fully integrated, ready-for-use quantum random number generator (QRNG) whose stochastic model is based on the randomness of detecting single photons in attenuated light. We show that often annoying deadtime effects associated with photomultiplier tubes (PMT) can be utilized to avoid postprocessing for bias or correlations. The random numbers directly delivered to a PC, generated at a rate of up to 50 Mbit/s, clearly pass all tests relevant for (physical) random number generators.

  13. Results of comparison of different photodetector and amplifier-discriminator types used in ozone sensing lidar

    Science.gov (United States)

    Nevzorov, Aleksey V.; Marichev, Valerii N.; Khryapov, Piter A.

    2000-12-01

    In the report, we present and discuss the results of comparison between domestic photomultiplier tubes (PMTs) FEU- 130 coupled with amplifiers-discriminators and PMT R7207-01 coupled with HAMAMATSU C3866 amplifiers-discriminators, used in ozone sensing lidar. It is shown that, because photomultiplier R7207-01 has higher counting rate than FEU- 130, it can provide ozone retrievals in a 4 - 6 km wider (upward plus downward) altitude range.

  14. Sheik’s War and People’s War. Different Playing Field, Same Rule Book

    Science.gov (United States)

    1974-10-15

    AND ADDRESS 12. REPOR• DATE 15 Oct 74 ill. NUPIIR OF PAGES flTONITORING AGEN4CY NAME a ADDRES•,(It different fromn Controlllng Office) 15. SECURIT ...4~ ~ ~ OA 7 ~* ~ - -S Cb4nt-e nxj 4 ’C- ’’’ 1P.mt4 30.~%4 . . 4b . P- l~ S T Jtflak’ ama ’ 4g % R .*P 4 2 -4 ’ 4f~ ’C-2, , MW, & ~-w * 0 t

  15. Predictors of Consistent Condom Use Among Chinese Female Sex Workers: An Application of the Protection Motivation Theory

    OpenAIRE

    Zhang, Liying; Li, Xiaoming; Zhou, Yuejiao; Lin, Danhua; Su, Shaobing; Zhang, Chen; Stanton, Bonita

    2014-01-01

    We utilized the Protection Motivation Theory (PMT) to assess predictors of intention and behavior of consistent condom use among Chinese female sex workers (FSWs). A self-administered questionnaire was used in a cross-sectional survey among 700 FSWs in Guangxi, China. Multivariate logistic regression analysis indicated that extrinsic and intrinsic rewards, self-efficacy and response costs predicted consistent condom use intention and behavior among FSWs. STI/HIV prevention programs need to re...

  16. Modelling protection behaviour towards micronutrient deficiencies: case of iodine biofortified vegetable legumes as health intervention for school-going children

    OpenAIRE

    Mogendi, Joseph Birundu; De Steur, Hans; Gellynck, Xavier; Makokha, Anselimo

    2016-01-01

    BACKGROUND/OBJECTIVES: Despite successes recorded in combating iodine deficiency, more than 2 billion people are still at risk of iodine deficiency disorders. Rural landlocked and mountainous areas of developing countries are the hardest hit, hence the need to explore and advance novel strategies such as biofortification. SUBJECTS/METHODS: We evaluated adoption, purchase, and consumption of iodine biofortified vegetable legumes (IBVL) using the theory of protection motivations (PMT) integ...

  17. Gap-filling methods for 3D PlanTIS data

    Energy Technology Data Exchange (ETDEWEB)

    Loukiala, A; Tuna, U; Ruotsalainen, U [Department of Signal Processing, Tampere University of Technology, PO Box 553, FIN-33101 Tampere (Finland); Beer, S [Zentralinstitut fuer Elektronik, Forschungszentrum Juelich, 52425 Juelich (Germany); Jahnke, S, E-mail: uygar.tuna@tut.f [ICG-3 Phytosphere, Forschungszentrum Juelich, 52425 Juelich (Germany)

    2010-10-21

    of the methods. We observed that all methods improved the reconstructed images both quantitatively and visually. Therefore, the proposed gap-filling methods followed by the analytical 3DRP are alternative for the reconstructions of not only the 3D PlanTIS data, but also other PET scanner data of the ClearPET family.

  18. A Peer Mentor Tutor Program in Physics

    Science.gov (United States)

    Nossal, S. M.; Jacob, A. T.; Buehlman, J. D.; Middlecamp, C. H.

    2001-05-01

    The Peer Mentor Tutor (PMT) program in the University of Wisconsin-Madison's Physics Department matches upper level undergraduate physics majors in small groups with students potentially at-risk for having academic trouble with their gateway introductory non-calculus physics course or for feeling isolated at the University. The program enhances students'learning and confidence by providing an emphasis on problem solving, a supportive environment for asking questions, and opportunities for acquiring missing math skills. The students assisted include, among others, returning adults, students of color,students with English as a second language, and students who have never taken physics in high school. The tutors acquire teaching and leadership experience with ongoing training throughout the year. The Physics PMT program is run in collaboration with a similar program in Chemistry. The peer model is also being applied to other science courses at the University of Wisconsin. We will describe the structure of the Physics PMT program and our current efforts to expand the program into a broader Physics Learning Center that may serve multiple purposes and courses.

  19. Three-dimensional finite element analysis of Eustachian tube function under normal and pathological conditions.

    Science.gov (United States)

    Sheer, F J; Swarts, J D; Ghadiali, S N

    2012-06-01

    A primary etiological factor underlying chronic middle ear disease is an inability to open the collapsible Eustachian tube (ET). However, the structure-function relationships responsible for ET dysfunction in patient populations at risk for developing otitis media (OM) are not known. In this study, three-dimensional (3D) finite element (FE) modeling techniques were used to investigate how changes in biomechanical and anatomical properties influence opening phenomena in three populations: normal adults, young children and infants with cleft palate. Histological data was used to create anatomically accurate models and FE techniques were used to simulate tissue deformation and ET opening. Lumen dilation was quantified using a computational fluid dynamic (CFD) technique and a sensitivity analysis was performed to ascertain the relative importance of the different anatomical and tissue mechanical properties. Results for adults suggest that ET function is highly sensitive to tensor veli palatini muscle (TVPM) forces and to periluminal mucosal tissue (PMT) elasticity. Young children and cleft palate subjects exhibited reduced sensitivity to TVPM forces while changes in PMT stiffness continued to have a significant impact on ET function. These results suggest that reducing PMT stiffness might be an effective way to restore ET function in these populations. Varying TVPM force vector relationships via changes in hamulus location had no effect on ET opening in young children and cleft palate subjects but did alter force transmission to the ET lumen during conditions of elevated adhesion. These models have therefore provided important new insights into the biomechanical mechanisms responsible for ET dysfunction.

  20. A low-power high dynamic range front-end ASIC for imaging calorimeters

    CERN Document Server

    Bagliesi, M G; Marrocchesi, P S; Meucci, M; Millucci, V; Morsani, F; Paoletti, R; Pilo, F; Scribano, A; Turini, N; Valle, G D

    2002-01-01

    High granularity calorimeters with shower imaging capabilities require dedicated front-end electronics. The ICON 4CH and VA4 PMT chip-set is suitable for very high dynamic range systems with strict noise requirements. The ICON 4CH is a 4 channel input, 12 channel output ASIC designed for use in a multi-anode photomultiplier system with very large dynamic range and low-noise requirements. Each of the four input signals to the ASIC is split equally into three branches by a current conveyor. Each of the three branches is scaled differently: 1:1, 1:8 and 1:80. The signal is read out by a 12 channel low noise/low power high dynamic range charge sensitive preamplifier-shaper circuit (VA4-PMT chip), with simultaneous sample- and-hold, multiplexed analog read-out, calibration facilities. Tests performed in our lab with a PMT are reported in terms of linearity, dynamic range and cross-talk of the system. (5 refs).

  1. The Transport of Photons through Light Guides

    Science.gov (United States)

    Mammei, Russell

    2000-10-01

    We have designed and optimized the light collection a set of light guides, which couple the scintillator to the photomultiplier tubes (PMTs) of an instrumented collimator. This collimator will be used with the experiments employing linearly-polarized photons in Hall B of Jefferson Lab in the spring of 2001. Using the Monte-Carlo simulation package, Guidem V1.0, we were able to simulate a scintillator-light guide-PMT construction. The scintillators were simulated to emit photons isotropically through out the whole volume of the scintillator. Parameters varied in the simulation were: radius of curvature of the bend, wrapping reflectivities, attenuation length, ripple angle(smoothness of the light guide surface), metal crumple angle(crumple of the aluminum wrapping), and the optical glue interfaces. Also investigated were the indices of refraction for the scintillator-light guide interface as well as the light guide-PMT interface. Given a bent geometry, our studies concluded that a curved elbow shape, 6 cm in length, with a radius of curvature of at least 1.4 cm, will produce a transmission efficiency between 54-55% with reference to the total light created in the scintillator. These light guides should have a ripple angle between 0^circ-3^circ and a PMT index of refraction between 1.3-1.5. The light guide should be wrapped in aluminum and the scintillator should be wrapped a paper with reflectivity around 0.1 to prevent smudging of the plastic.

  2. KM3NeT: Study of the angular acceptance for a high energy neutrino telescope in the Mediterranean Sea

    Energy Technology Data Exchange (ETDEWEB)

    Sapienza, P. [INFN-Laboratori Nazionali del Sud, Via S. Sofia 62, 95123 Catania (Italy)], E-mail: sapienza@lns.infn.it; Coniglione, R.; Distefano, C. [INFN-Laboratori Nazionali del Sud, Via S. Sofia 62, 95123 Catania (Italy); Migneco, E. [INFN-Laboratori Nazionali del Sud, Via S. Sofia 62, 95123 Catania (Italy); Dipartimento di Fisica e Astronomia, Universita di Catania, Via S. Sofia 64, 95123 Catania (Italy)

    2009-04-11

    Simulations for the study of the angular acceptance for a high energy neutrino telescope in the Mediterranean Sea are performed in the frame of the KM3NeT Design Study. In particular we have investigated how the PMT orientation can affect the performance of a km3 detector based on towers with a pair of Optical Modules equipped with 10 in. PMTs at each edge of the storey. Some preliminary results for three different PMT orientations are presented and the expected effect on the detection of point-sources and a diffuse flux of very energetic neutrinos is discussed. Moreover, a first attempt to study the response to atmospheric muons for different PMT orientations was also undertaken aiming both at the rejection of the atmospheric muons mis-reconstructed as up-going and the detection of the Moon shadow. However, due to the large detector volume, a huge statistics is needed to achieve an adequate live-time. For this reason we started a mass production of atmospheric muons at several detector depths.

  3. CLARO-CMOS: a fast, low power and radiation-hard front-end ASIC for single-photon counting in 0.35 micron CMOS technology

    Science.gov (United States)

    Andreotti, M.; Baldini, W.; Calabrese, R.; Carniti, P.; Cassina, L.; Cotta Ramusino, A.; Fiorini, M.; Giachero, A.; Gotti, C.; Luppi, E.; Maino, M.; Malaguti, R.; Pessina, G.; Tomassetti, L.

    2015-01-01

    The CLARO-CMOS is a prototype ASIC designed for fast photon counting with multi-anode photomultiplier tubes (MaPMT). The CLARO features a 5 ns peaking time, a recovery time to baseline smaller than 25 ns, and a power consumption of less than 1 mW per channel. The chip was designed in 0.35 μm CMOS technology, and was tested for radiation hardness with neutrons up to 1014 1 MeV neq/cm2, X-rays up to 40 kGy and protons up to 76 kGy. Its capability to read out single photons at high rate from a Hamamatsu R11265 MaPMT, the baseline photon detector for the LHCb RICH upgrade, was demonstrated both with test bench measurements and with actual signals from a R11265 MaPMT. The presented results allowed CLARO to be chosen as the front-end readout chip in the upgraded LHCb RICH detector.

  4. Pacemaker-Mediated Tachycardia: Manufacturer Specifics and Spectrum of Cases.

    Science.gov (United States)

    Monteil, Benjamin; Ploux, Sylvain; Eschalier, Romain; Ritter, Philippe; Haissaguerre, Michel; Koneru, Jayanthi N; Ellenbogen, Kenneth A; Bordachar, Pierre

    2015-12-01

    Pacemaker-mediated tachycardia (PMT) is the term used to describe a repetitive sequence of sensed retrograde P waves followed by ventricular pacing at or below the maximum tracking rate. The following events can promote atrioventricular (AV) dissociation, retrograde conduction, and the onset of PMT: ventricular or atrial extrasystole, an excessively long programmed AV delay, external interference or myopotentials sensed by the atrial channel, atrial sensing or pacing failure, the absence of postventricular atrial refractory period extension after removal of a magnet, and VDD pacing at a higher rate than sinus rate. In contemporary devices, each manufacturer has a proprietary algorithm to detect and terminate PMT. Because of the increase in the number and complexity of the pacing algorithms and because of manufacturer-driven differences, a basic understanding of these new algorithms is important for patient care. We review here the main elements of the physiopathology of this type of tachycardia, describe the specific characteristics of the different manufacturers, and present representative clinical cases.

  5. The effects of Earth's magnetic field on 3-inch diameter photomultipliers used in KM3NeT neutrino telescope

    Directory of Open Access Journals (Sweden)

    Giordano V.

    2016-01-01

    Full Text Available The KM3NeT neutrino telescope will be the largest underwater neutrino telescope and will be located in the abyss of the Mediterranean Sea. In neutrino telescopes the key element of the detector is the optical module and for KM3NeT it consists of 31 PMTs stored inside a transparent pressure-resistant glass sphere of 17-inch that serves as mechanical protection while ensuring good light transmission. Since the PMTs installed into an underwater neutrino telescope can change their orientation because of movements of the detector structure due to sea currents, the influence of Earth's magnetic field has been investigated. Magnetic shielding by means of a mu-metal cage is used to reduce magnetic effects and to make the response of the PMT sufficiently orientation independent. In order to quantify the effect on magnetic field, we compared measurements on variation of gain, transit time spread and detection efficiency for a 3-inch PMT in shielded and unshielded condition at 3 PMT inclinations. Data shows that variations are sufficiently low especially for timing properties.

  6. Development and featuring of hemispherical photomultipliers for cosmic ray detection - calibration of surface detectors and analysis of horizontal showers at the Pierre Auger Observatory; Developpement et caracterisation de photomultiplicateurs hemispheriques pour les experiences d'astroparticules - etalonnage des detecteurs de surface et analyse des gerbes horizontales de l'Observatoire Pierre Auger

    Energy Technology Data Exchange (ETDEWEB)

    Dornic, D

    2006-09-15

    The large photomultipliers (PMT) are currently used in astro-particle and neutrino experiments where they have to detect low levels of light. We have studied and characterised large PMTs developed by the PHOTONIS Group Company. The first part of this thesis is dedicated to the full characterization of two types of multipliers currently used in large PMTs. Then, we present results of a new photocathode process, applied on the XPI805 (PMT used in the Pierre Auger Observatory) in order to improve the quantum efficiency. Finally, we study the PMT diameter influence on main parameters (5, 8 and 10 inches). The second part is devoted to the study of the water Cerenkov tank (WCD) response to the shower particles and the horizontal air showers analysis with the Pierre Auger Observatory. The main parameters of a WCD simulation developed in the Auger IPN group were calibrated with several measurements on vertical and inclined muons, performed on dedicated test tanks. The kind of detector used in the surface detector allows detecting very inclined events with a good sensitivity (zenith angle superior to 70 degrees). We have established specific methods to analyze these events (selection and reconstruction). These methods were applied to the Auger data in order to obtain the energy spectrum of the horizontal events. Finally, we detailed two methods to test directly the hadronic models predictions by studying the air showers muonic component. (author)

  7. Developing a beta source based setup for pixel sensor characterization

    CERN Document Server

    Schouwenberg, Jeroen

    2014-01-01

    The main goal of this project is to provide mono-energetic minimum ionizing electrons from a $^{90}$Sr source using a magnetic monochromator, and thus provide a useful tool for in-lab sensor characterization. The monochromator is calibrated using a setup, with a heavy inorganic scintillator and a PMT, which has been calibrated with a $^{22}$Na gamma source. The average energy of the electrons as a function of the current in the monochromator coil is found to be $1.38\\pm0.01$ keV/mA, taking into consideration the effect of the magnetic field on the signal of the PMT. For integration into the pixel sensor test bench, scintillator-counters (a plastic scintillator connected to a PMT) are used. Their response to the electron energies is observed to follow a saturation curve, which leads to a more identical response for high energetic electrons. A preliminary pixel sensor test bench has been set up and properties such as voltage and discriminator settings have been studied as well as count rates for coincidence cou...

  8. Innovative power management, attitude determination and control tile for CubeSat standard NanoSatellites

    Science.gov (United States)

    Ali, Anwar; Mughal, M. Rizwan; Ali, Haider; Reyneri, Leonardo

    2014-03-01

    Electric power supply (EPS) and attitude determination and control subsystem (ADCS) are the most essential elements of any aerospace mission. Efficient EPS and precise ADCS are the core of any spacecraft mission. So keeping in mind their importance, they have been integrated and developed on a single tile called CubePMT module. Modular power management tiles (PMTs) are already available in the market but they are less efficient, heavier in weight, consume more power and contain less number of subsystems. Commercial of the shelf (COTS) components have been used for CubePMT implementation which are low cost and easily available from the market. CubePMT is developed on the design approach of AraMiS architecture: a project developed at Politecnico di Torino that provides low cost and higher performance space missions with dimensions larger than CubeSats. The feature of AraMiS design approach is its modularity. These modules can be reused for multiple missions which helps in significant reduction of the overall budget, development and testing time. One has just to reassemble the required subsystems to achieve the targeted specific mission.

  9. "Curing" of plasmid DNA in acetogen using microwave or applying an electric pulse improves cell growth and metabolite production as compared to the plasmid-harboring strain.

    Science.gov (United States)

    Berzin, Vel; Kiriukhin, Michael; Tyurin, Michael

    2013-03-01

    Plasmid-free acetogen Clostridium sp. MT962 electrotransformed with a small cryptic plasmid pMT351 was used to develop time- and cost-effective methods for plasmid elimination. Elimination of pMT351 restored production of acetate and ethanol to the levels of the plasmid-free strain with no dry cell weight changes. Destabilizing cell membrane via microwave at 2.45 GHz, or exposure to a single 12 ms square electric pulse at 35 kV cm⁻¹, eliminated pMT351 in 42-47 % of cells. Plasmid elimination with a single square electric pulse required 10 versus 0.1 J needed to introduce the same 3,202-bp plasmid into the cells as calculated per cell sample of Clostridium sp. MT962. Microwave caused visible changes in repPCR pattern and increased ethanol production at the expense of acetate. This is the first report on microwave of microwave ovens, wireless routers, and mobile devices causing chromosomal DNA aberrations in microbes along with carbon flux change.

  10. Detection of urinary tract infections on lab-on-chip device by measuring photons emitted from ATP bioluminescence.

    Science.gov (United States)

    Feng, Shilun; Dong, Tao; Yang, Zhaochu

    2014-01-01

    A microfluidic Lab-on-chip (LOC) platform for in vitro detecting Urinary Tract Infections (UTI) for clinical diagnostic applications has been built. Based on one commercial adenosine 5'-triphosphate (ATP) assay kit, one chip designed before was applied to detect UTI with the help of photomultiplier tube (PMT) and quantitative determination was made by measuring the photons of light emitted in the bioluminescent reaction of ATP with the enzyme luciferase. The chip had been tested and materials had been well prepared before testing the PMT detecting system. The data from PMT were visualized by the Labview™, appearing good linearity between voltage values and the concentration of the ATP ranging from 2×10(-12) M to 2×10(-8) M. Fresh urine sample with different amounts of Escherichia coli had been measured by the system, appearing good linearity trend between the voltage values and number of the E.coli. This study successfully expressed the concept of measuring ATP directly in the urine to quickly and accurately detect UTI on a microfluidic chip.

  11. Compressive sensing for nuclear security.

    Energy Technology Data Exchange (ETDEWEB)

    Gestner, Brian Joseph

    2013-12-01

    Special nuclear material (SNM) detection has applications in nuclear material control, treaty verification, and national security. The neutron and gamma-ray radiation signature of SNMs can be indirectly observed in scintillator materials, which fluoresce when exposed to this radiation. A photomultiplier tube (PMT) coupled to the scintillator material is often used to convert this weak fluorescence to an electrical output signal. The fluorescence produced by a neutron interaction event differs from that of a gamma-ray interaction event, leading to a slightly different pulse in the PMT output signal. The ability to distinguish between these pulse types, i.e., pulse shape discrimination (PSD), has enabled applications such as neutron spectroscopy, neutron scatter cameras, and dual-mode neutron/gamma-ray imagers. In this research, we explore the use of compressive sensing to guide the development of novel mixed-signal hardware for PMT output signal acquisition. Effectively, we explore smart digitizers that extract sufficient information for PSD while requiring a considerably lower sample rate than conventional digitizers. Given that we determine the feasibility of realizing these designs in custom low-power analog integrated circuits, this research enables the incorporation of SNM detection into wireless sensor networks.

  12. A system for the characterization of the HAWC PMTs sensitivity

    Science.gov (United States)

    Langarica, R.; Lara, G.; Martinez, L. A.; Tinoco, S.; Alfaro, R.; Iriarte, A.; Sandoval, A.; Vanegas, P.

    2012-07-01

    The HAWC Project is a very high-energy gamma-ray observatory under construction at the Sierra Negra volcano (4100 meters above sea level) in the Pico de Orizaba National Park located in central Mexico. HAWC will reuse the 900 Hamamatsu R5912 photomultipliers (PMTs) from Milagro Observatory for the 300 Water Cherenkov Detectors. In order to characterize their present performance it is necessary to scan the active area of the photocathode by measuring its efficiency and gain. A characterization system was designed and manufactured to achieve an automated measurement of over 100 points distributed on the PMT active spherical surface. Preliminary results show the variation of QE of PMTs with respect of the position of incoming photons, as well as the changes in the PMTs response due to the Earth's magnetic field and gain vs. high voltage. The system allows automated PMT characterization improving its performance, reliability, precision and repeatability. In this work we present the characterization system and preliminary results on the PMT efficiency.

  13. Energy Requirements of US Army Special Operation Forces During Military Training

    Directory of Open Access Journals (Sweden)

    Lee M. Margolis

    2014-05-01

    Full Text Available Special Operations Forces (SOF regularly engage in physically demanding combat operations and field training exercises, resulting in high daily energy expenditure, and thus increased energy requirements. However, the majority of studies assessing energy requirements of SOF have been conducted on soldiers going through intense SOF initiation training. The objective of the current investigation was to determine the energy expenditure of SOF conducting military training operations. Thirty-one soldiers taking part in Pre-Mission Training (PMT n = 15 and Combat Diver Qualification Courses (CDQC n = 16 volunteered to participate in this observational study. Energy expenditure was determined using doubly labeled water. Body weight (83 ± 7 kg remained stable during both training periods. Overall energy expenditure adjusted for body composition was 17,606 ± 2326 kJ·day−1. Energy expenditure was 19,110 ± 1468 kJ·day−1 during CDQC and 16,334 ± 2180 kJ·day−1 during PMT, with physical activity levels of 2.6 ± 0.2 and 2.2 ± 0.3 during CDQC and PMT, respectively. Compared to the Military Dietary Reference Intakes for energy (13,598 kJ·day−1, these data are in agreement with previous reports that energy requirement for SOF Soldiers exceed that of the average soldier.

  14. Women's preferences for contralateral prophylactic mastectomy: An investigation using protection motivation theory.

    Science.gov (United States)

    Tesson, Stephanie; Richards, Imogen; Porter, David; Phillips, Kelly-Anne; Rankin, Nicole; Musiello, Toni; Marven, Michelle; Butow, Phyllis

    2016-05-01

    Most women diagnosed with unilateral breast cancer without BRCA1 or BRCA2 mutations are at low risk of contralateral breast cancer. Contralateral Prophylactic Mastectomy (CPM) decreases the relative risk of contralateral breast cancer, but may not increase life expectancy; yet international uptake is increasing. This study applied protection motivation theory (PMT) to determine factors associated with women's intentions to undergo CPM. Three hundred eighty-eight women previously diagnosed with unilateral breast cancer and of negative or unknown BRCA1 or BRCA2 status were recruited from an advocacy group's research database. Participants completed measures of PMT constructs based on a common hypothetical CPM decision-making scenario. PMT constructs explained 16% of variance in intentions to undergo CPM. Response efficacy (CPM's advantages) and response costs (CPM's disadvantages) were unique individual predictors of intentions. Decision-making appears driven by considerations of the psychological, cosmetic and emotional advantages and disadvantages of CPM. Overestimations of threat to life from contralateral breast cancer and survival benefit from CPM also appear influential factors. Patients require balanced and medically accurate information regarding the pros and cons of CPM, survival rates, and recurrence risks to ensure realistic and informed decision-making.

  15. Determinants of Cancer Early Detection Behaviors:Application of Protection Motivation Theory.

    Science.gov (United States)

    Rahaei, Zohreh; Ghofranipour, Fazlollah; Morowatisharifabad, Mohammad Ali; Mohammadi, Eesa

    2015-01-01

    Cancer is account for 13% of all deaths around the world and is the third cause of mortality in Iran. More than one third of these cases are pre-ventable and about 33% are curable with early detection. The aim of this study was to determine the predictors of cancer early detection (CED) behaviors applying Protection Motivation Theory (PMT). In this cross-sectional study, cluster sampling method was employed to recruit 260 individuals of above 20 years old in Yazd, Iran and a researcher designed questionnaire was completed through interviews for each of the respondents. PMT theoretical variables and CED behaviors were the basis of data collection procedure. Participants acquired 64.47% of the protection motivation, 30.97% of the passive and 45.64% of the active behaviors‟ possible scores. Theory constructs predicted 19.8%, 15.6% and 9.6% of the variations for protection motivation, passive and active behavior respectively. Protection motivation was responsible for 3.6% of passive and 8% of active behaviors‟ variations. Considering the scarceness of CED behaviors and the applicability of PMT in predicting these behaviors, utilization of the PMT‟s constructs in any interventional programs to accelerate CED behaviors could be an alternate methodological choice in the cancer control initiatives.

  16. Women's preferences for selective estrogen reuptake modulators: an investigation using protection motivation theory.

    Science.gov (United States)

    Ralph, Angelique F; Ager, Brittany; Bell, Melanie L; Collins, Ian M; Andrews, Lesley; Tucker, Kathy; Phillips, Kelly-Anne; Butow, Phyllis

    2014-07-01

    Selective estrogen receptor modulators (SERMs) reduce breast cancer risk by 38%. However, uptake is low and the reasons are not well understood. This study applied protection motivation theory (PMT) to determine factors associated with intention to take SERMs. Women at increased risk of breast cancer (N=107), recruited from two familial cancer clinics in Australia, completed a questionnaire containing measures of PMT constructs. Hierarchical multiple linear regression analysis was used to analyze the data. Forty-five percent of women said they would be likely or very likely to take SERMs in the future. PMT components accounted for 40% of variance in intention to take SERMs. Perceived vulnerability, severity and response efficacy appeared the most influential in women's decisions to take or not take SERMs. Many women are interested in SERMs as a risk management option. Accurate risk estimation and an understanding of the benefits of SERMs are critical to women's decision making. Health professionals need to explore women's perceptions of their risk and its consequences, as well as providing clear evidence-based information about the efficacy of SERMs. Exploring the source and strength of beliefs about SERMs may allow more effective, tailored counseling. Copyright © 2014 Elsevier Ireland Ltd. All rights reserved.

  17. Coincidence ion imaging with a fast frame camera

    Energy Technology Data Exchange (ETDEWEB)

    Lee, Suk Kyoung; Cudry, Fadia; Lin, Yun Fei; Lingenfelter, Steven; Winney, Alexander H.; Fan, Lin; Li, Wen, E-mail: wli@chem.wayne.edu [Department of Chemistry, Wayne State University, Detroit, Michigan 48202 (United States)

    2014-12-15

    A new time- and position-sensitive particle detection system based on a fast frame CMOS (complementary metal-oxide semiconductors) camera is developed for coincidence ion imaging. The system is composed of four major components: a conventional microchannel plate/phosphor screen ion imager, a fast frame CMOS camera, a single anode photomultiplier tube (PMT), and a high-speed digitizer. The system collects the positional information of ions from a fast frame camera through real-time centroiding while the arrival times are obtained from the timing signal of a PMT processed by a high-speed digitizer. Multi-hit capability is achieved by correlating the intensity of ion spots on each camera frame with the peak heights on the corresponding time-of-flight spectrum of a PMT. Efficient computer algorithms are developed to process camera frames and digitizer traces in real-time at 1 kHz laser repetition rate. We demonstrate the capability of this system by detecting a momentum-matched co-fragments pair (methyl and iodine cations) produced from strong field dissociative double ionization of methyl iodide.

  18. Performance comparison of scintillators for alpha particle detectors

    Science.gov (United States)

    Morishita, Yuki; Yamamoto, Seiichi; Izaki, Kenji; Kaneko, Junichi H.; Toui, Kohei; Tsubota, Youichi; Higuchi, Mikio

    2014-11-01

    Scintillation detectors for alpha particles are often used in nuclear fuel facilities. Alpha particle detectors have also become important in the research field of radionuclide therapy using alpha emitters. ZnS(Ag) is the most often used scintillator for alpha particle detectors because its light output is high. However, the energy resolution of ZnS(Ag)-based scintillation detectors is poor because they are not transparent. A new ceramic sample, namely the cerium doped Gd2Si2O7 (GPS) scintillator, has been tested as alpha particle detector and its performances have been compared to that one of three different scintillating materials: ZnS(Ag), GAGG and a standard plastic scintillator. The different scintillating materials have been coupled to two different photodetectors, namely a photomultiplier tube (PMT) and a Silicon Photo-multiplier (Si-PM): the performances of each detection system have been compared. Promising results as far as the energy resolution performances (10% with PMT and 14% with Si-PM) have been obtained in the case of GPS and GAGG samples. Considering the quantum efficiencies of the photodetectors under test and their relation to the emission wavelength of the different scintillators, the best results were achieved coupling the GPS with the PMT and the GAGG with the Si-PM

  19. Attitudes toward active euthanasia among medical students at two German universities.

    Science.gov (United States)

    Clemens, Katri Elina; Klein, Eva; Jaspers, Birgit; Klaschik, Eberhard

    2008-06-01

    There has been an ongoing debate about a legalisation of active euthanasia (AE) in Germany. Palliative care education in German medical schools seeks to foster and cultivate a negative attitude toward AE, but little is known about its effectiveness in this respect. The aim of this study was to assess attitudes toward AE among students with and without palliative medicine tuition (PMT). The link to an anonymised online questionnaire was sent out to 1,092 third, fifth and sixth year medical students (YMS) in August-November 2006 at two German universities: university one (U1) with compulsory and additional optional PMT and university two (U2) without any PMT. Thirteen questions addressed active, passive or indirect euthanasia and physician-assisted suicide (statistic: mean +/- SD (range), Wilcoxon, Whitney U Test, significance p circumstances that lack dignity'. Of all students, 21.1% at U1 and 37.2% at U2 could imagine to perform AE in patients, even though 72.6% at U1 and 78.2% at U2 think its legalisation would promote misuse. The high proportion of pro-AE attitudes gives reason to reconsider both 'standard' and palliative medicine tuition for medical students.

  20. Plant-made trastuzumab (herceptin inhibits HER2/Neu+ cell proliferation and retards tumor growth.

    Directory of Open Access Journals (Sweden)

    Tatiana V Komarova

    Full Text Available BACKGROUND: Plant biotechnology provides a valuable contribution to global health, in part because it can decrease the cost of pharmaceutical products. Breast cancer can now be successfully treated by a humanized monoclonal antibody (mAb, trastuzumab (Herceptin. A course of treatment, however, is expensive and requires repeated administrations of the mAb. Here we used an Agrobacterium-mediated transient expression system to produce trastuzumab in plant cells. METHODOLOGY/PRINCIPAL FINDINGS: We describe the cloning and expression of gene constructs in Nicotiana benthamiana plants using intron-optimized Tobacco mosaic virus- and Potato virus X-based vectors encoding, respectively, the heavy and light chains of trastuzumab. Full-size antibodies extracted and purified from plant tissues were tested for functionality and specificity by (i binding to HER2/neu on the surface of a human mammary gland adenocarcinoma cell line, SK-BR-3, in fluorescence-activated cell sorting assay and (ii testing the in vitro and in vivo inhibition of HER-2-expressing cancer cell proliferation. We show that plant-made trastuzumab (PMT bound to the Her2/neu oncoprotein of SK-BR-3 cells and efficiently inhibited SK-BR-3 cell proliferation. Furthermore, mouse intraperitoneal PMT administration retarded the growth of xenografted tumors derived from human ovarian cancer SKOV3 Her2+ cells. CONCLUSIONS/SIGNIFICANCE: We conclude that PMT is active in suppression of cell proliferation and tumor growth.

  1. Characterization of Magnetic Field Immersed Photomultipliers from Double Chooz Experiment. Design and Construction of their Magnetic Shields; Caracterizacion de los fotomultiplicadores del experimento Double Chooz bajo campo magnetico y diseno y construccion de sus blindajes magneticos

    Energy Technology Data Exchange (ETDEWEB)

    Valdivia Valero, F. J.

    2007-12-28

    Flavour oscillations of neutrinos are a quantum-mechanical effect widely demonstrated. It is explained through interferences of their mass eigenstates, therefore, belonging to the physical area beyond the Standard Model. This work deals with the CIEMAT collaboration in the neutrino experiment Double Chooz. Such an experiment aims to measure the mixture angle {theta}{sub 1}3, one of the PMNS leptonic mixture matrix, with a un reached-before sensibility by decrease of systematic errors. For this, two identical scintillator detectors, equipped with PMT's, will be sited at different distances from two reactors located in the nuclear power plant CHOOZ B (France). The electronic neutrino flux from these reactors will be compared, explaining its deficit by flavour oscillations of these particles. The identity of both detectors will be diminished by the magnetic field effects on the PMT's response. Therefore, this study serves as for quantifying such an effects as for fitting the magnetic shields design that minimize them. Shielding measurements and final design of magnetic shields as much as the effect these ones cause in the PMT's response immersed in a monitored magnetic field are presented. (Author) 85 refs.

  2. Photocopia-A Unibody Mono-material Compact and Scalable Photomultiplier

    Energy Technology Data Exchange (ETDEWEB)

    Mulhollan, Gregory [Saxet Surface Science

    2014-12-01

    The Photocopia photomultiplier tube (PMT) takes advantage of two of the many unique properties of the hydrogenated amorphous silicon-germanium (a-SiGe) photoemitter material: its mechanical flexibility and mostly substrate-independent properties. The a-SiGe photoemitter has high secondary electron (SE) yield. It can be used both as the photocathode and as the gain medium. The active material can be grown on a flat, thin unibody substrate, formed and then “rolled up” ex situ. The completed structure would then be activated and sealed within a tube. The Ge component can be increased to enhance red-sensitivity. Compact sizes are possible, minimizing magnetic field effects. The Photocopia PMT will be a low cost alternative to MCPs for TOF detectors and provide better timing discrimination for Cherenkov detectors. Retention of the ability to activate to a normal photoyield state upon flexing (bending) the substrate of the a-SiGe material after growth, but prior to activation has been shown. The SE coefficient of the activated material has been characterized over the voltage range suitable for utilization as the gain material. The time response of the material is suited to PMT use.

  3. Upgrade of the ATLAS hadronic Tile Calorimeter for the High luminosity LHC

    CERN Document Server

    Rodriguez Bosca, Sergi; The ATLAS collaboration

    2017-01-01

    The Tile Calorimeter is the hadronic calorimeter covering the central region of the ATLAS detector at the Large Hadron Collider. It is a scintillator-steel sampling calorimeter read out via wavelength shifting fibers coupled to photomultiplier tubes (PMT). The PMT signals are digitized and stored on detector until a trigger is received. The High-Luminosity phase of LHC (HL-LHC)expected to begin in year 2026 requires new electronics to meet the requirements of a 1 MHz trigger, higher ambient radiation, and for better performance under higher pileup. All the TileCal on- and off-detector electronics will be replaced during the shutdown of 2024-2025. PMT signals from every TileCal cell will be digitized and sent directly to the back-end electronics, where the signals are reconstructed, stored, and sent to the first level of trigger at a rate of 40 MHz. This will provide better precision of the calorimeter signals used by the trigger system and will allow the development of more complex trigger algorithms. Changes...

  4. ANTS — a simulation package for secondary scintillation Anger-camera type detector in thermal neutron imaging

    Science.gov (United States)

    Morozov, A.; Defendi, I.; Engels, R.; Fraga, F. A. F.; Fraga, M. M. F. R.; Guerard, B.; Jurkovic, M.; Kemmerling, G.; Manzin, G.; Margato, L. M. S.; Niko, H.; Pereira, L.; Petrillo, C.; Peyaud, A.; Piscitelli, F.; Raspino, D.; Rhodes, N. J.; Sacchetti, F.; Schooneveld, E. M.; Van Esch, P.; Zeitelhack, K.

    2012-08-01

    A custom and fully interactive simulation package ANTS (Anger-camera type Neutron detector: Toolkit for Simulations) has been developed to optimize the design and operation conditions of secondary scintillation Anger-camera type gaseous detectors for thermal neutron imaging. The simulation code accounts for all physical processes related to the neutron capture, energy deposition pattern, drift of electrons of the primary ionization and secondary scintillation. The photons are traced considering the wavelength-resolved refraction and transmission of the output window. Photo-detection accounts for the wavelength-resolved quantum efficiency, angular response, area sensitivity, gain and single-photoelectron spectra of the photomultipliers (PMTs). The package allows for several geometrical shapes of the PMT photocathode (round, hexagonal and square) and offers a flexible PMT array configuration: up to 100 PMTs in a custom arrangement with the square or hexagonal packing. Several read-out patterns of the PMT array are implemented. Reconstruction of the neutron capture position (projection on the plane of the light emission) is performed using the center of gravity, maximum likelihood or weighted least squares algorithm. Simulation results reproduce well the preliminary results obtained with a small-scale detector prototype. ANTS executables can be downloaded from http://coimbra.lip.pt/~andrei/.

  5. Front-end Design and Characterization for the ν-Angra Nuclear Reactor Monitoring Detector

    Science.gov (United States)

    Dornelas, T. I.; Araújo, F. T. H.; Cerqueira, A. S.; Costa, J. A.; Nóbrega, R. A.

    2016-07-01

    The Neutrinos Angra (ν-Angra) Experiment aims to construct an antineutrinos detection device capable of monitoring the Angra dos Reis nuclear reactor activity. Nuclear reactors are intense sources of antineutrinos, and the thermal power released in the fission process is directly related to the flow rate of these particles. The antineutrinos energy spectrum also provides valuable information on the nuclear source isotopic composition. The proposed detector will be equipped with photomultipliers tubes (PMT) which will be readout by a custom Amplifier-Shaper-Discriminator circuit designed to condition its output signals to the acquisition modules to be digitized and processed by an FPGA. The readout circuit should be sensitive to single photoelectron signals, process fast signals, with a full-width-half-amplitude of about 5 ns, have a narrow enough output pulse width to detect both particles coming out from the inverse beta decay (bar nue+p → n + e+), and its output amplitude should be linear to the number of photoelectrons generated inside the PMT, used for energy estimation. In this work, some of the main PMT characteristics are measured and a new readout circuit is proposed, described and characterized.

  6. Characterization of Large Volume 3.5 x 8 inches LaBr3:Ce Detectors

    CERN Document Server

    Giaz, A; Riboldi, S; Camera, F; Blasi, N; Boiano, C; Bracco, A; Brambilla, S; Ceruti, S; Coelli, S; Crespi, F C L; Csatlòs, M; Frega, S; Gulyàs, J; Krasznahorkay, A; Lodetti, S; Million, B; Owens, A; Quarati, F; Stuhl, L; Wieland, O

    2013-01-01

    The properties of large volume cylindrical 3.5 x 8 inches (89 mm x 203 mm) LaBr3:Ce scintillation detectors coupled to the Hamamatsu R10233-100SEL photo-multiplier tube were investigated. These crystals are among the largest ones ever produced and still need to be fully characterized to determine how these detectors can be utilized and in which applications. We tested the detectors using monochromatic gamma-ray sources and in-beam reactions producing gamma rays up to 22.6 MeV; we acquired PMT signal pulses and calculated detector energy resolution and response linearity as a function of gamma-ray energy. Two different voltage dividers were coupled to the Hamamatsu R10233-100SEL PMT: the Hamamatsu E1198-26, based on straightforward resistive network design, and the LABRVD, specifically designed for our large volume LaBr3:Ce scintillation detectors, which also includes active semiconductor devices. Because of the extremely high light yield of LaBr3:Ce crystals we observed that, depending on the choice of PMT, v...

  7. Sub-aquatic response of a scintillator, fibre optic and silicon photomultiplier based radiation sensor

    Science.gov (United States)

    Jackson, Sarah F.; Monk, Stephen D.; Stanley, Steven J.; Lennox, Kathryn

    2014-07-01

    We describe an attempt at the utilisation of two low level light sensors to improve on the design of a dose monitoring system, specifically for underwater applications with consideration for the effects of water attenuation. The gamma radiation ‘RadLine®’ detector consists of an inorganic scintillating crystal coupled to a fibre optic cable which transports scintillation photons, up to hundreds of metres, to an optical sensor. Analysed here are two contemporary technologies; SensL's MiniSL a silicon photomultiplier (SiPM) and a Sens-Tech photon counting photomultiplier tube (PMT). A clinical radiotherapy linear accelerator (linac) is implemented as test beam, subjecting the RadLine® to a highly controlled dose rate (ranging from 0 Sv h-1 to 320 Sv h-1), averaging at 2 MeV in energy. The RadLine's underwater dose monitoring capabilities are tested with the aid of epoxy resin ‘solid water’ phantom blocks, used as a substitute for water. Our results show that the MiniSL SiPM is unsuitable for this application due to extremely high background noise levels, however the Sens-Tech PMT performs satisfactorily and the detected dose rate due to the effects of water attenuation compares strongly with MCNP simulation data and NIST database values. We conclude that the PMT shows promise for its ultimate use in the First Generation Magnox Storage Pond (FGMSP) on the Sellafield site.

  8. Effect of Motivational Interviewing on Physical Activity Intention among Obese and Overweight Women Using Protection Motivation Theory: A Randomized Clinical Trial

    Directory of Open Access Journals (Sweden)

    K. Mirkarimi

    2016-09-01

    Full Text Available Aims: As a growing problem, obesity is one of the most important worldwide health problems. One of the major factors leading to obesity is the sedentary lifestyle. The aim of this study was to investigate the effects of motivational interviewing on the physical activity intention in the obese or overweight women, using the protection motivation theory (PMT. Materials & Methods: In the clinical trial study, 60 obese or overweight women referred to the health centers of Gorgan were studied in 2015. The subjects, selected via non-probable and available sampling method, were randomly divided into two groups including control and motivational interviewing groups. Data was collected using a researcher-made questionnaire before the intervention and 2 and 6 months after in both groups. Data was analyzed by SPSS 18 software using independent T, Chi-square, repeated measures ANOVA, LSD, and one-variable and multivariable linear regression tests. Findings: The scores of all the constructs of PMT in motivational interviewing group significantly increased 2 and 6 months after he intervention (p0.05. The most powerful constructs predicting the intention towards the physical activities 2 months after the intervention were perceived-reply efficiency, self-efficiency, and perceived intensity, successively. In addition, such factors 6 months after the intervention were attitude and perceived intensity, successively. Conclusion: The motivational interviewing increases the scores of all the constructs of PMT, which leads to an increase in the physical activity intention in the obese or overweight women.

  9. Differential activity of regions of the psoas major and quadratus lumborum during submaximal isometric trunk efforts.

    Science.gov (United States)

    Park, Rachel J; Tsao, Henry; Cresswell, Andrew G; Hodges, Paul W

    2012-02-01

    Controversy exists regarding the function of psoas major (PM) and quadratus lumborum (QL) at the lumbar spine. The functions of discrete regions of PM and QL were studied during trunk loading tasks. Twelve healthy participants performed isometric trunk loading tasks in various directions in upright sitting. Fine-wire electromyography (EMG) electrodes were inserted under ultrasound guidance into PM fascicles arising from the transverse process (PM-t) and vertebral body (PM-v) and the anterior (QL-a) and posterior (QL-p) layers of QL on the right side. Although right PM-t and PM-v were both active during right lateral-flexion trunk efforts, their activity was opposite in the sagittal plane, with greater PM-t towards extension and PM-v towards flexion. QL-a and QL-p were similarly active, though QL-p was active to a greater percentage of MVC during right trunk lateral-flexion efforts. Activity of QL-p was modulated with respiratory phase during the loading tasks with trunk efforts towards the right lateral-flexion/flexion and right lateral-flexion directions. These findings provide novel understanding of the unique activation of discrete regions of PM and QL. These differences must be considered in future EMG studies to better understand the function of these deeply situated trunk muscles in the control of the lumbar spine.

  10. Nonlogarithmic magnetization relaxation at the initial time intervals and magnetic field dependence of the flux creep rate in Bi2Sr2Ca(sub I)Cu2Ox single crystals

    Science.gov (United States)

    Moshchalcov, V. V.; Zhukov, A. A.; Kuznetzov, V. D.; Metlushko, V. V.; Leonyuk, L. I.

    1990-01-01

    At the initial time intervals, preceding the thermally activated flux creep regime, fast nonlogarithmic relaxation is found. The fully magnetic moment Pm(t) relaxation curve is shown. The magnetic measurements were made using SQUID-magnetometer. Two different relaxation regimes exist. The nonlogarithmic relaxation for the initial time intervals may be related to the viscous Abrikosov vortices flow with j is greater than j(sub c) for high enough temperature T and magnetic field induction B. This assumption correlates with Pm(t) measurements. The characteristic time t(sub O) separating two different relaxation regimes decreases as temperature and magnetic field are lowered. The logarithmic magnetization relaxation curves Pm(t) for fixed temperature and different external magnetic field inductions B are given. The relaxation rate dependence on magnetic field, R(B) = dPm(B, T sub O)/d(1nt) has a sharp maximum which is similar to that found for R(T) temperature dependences. The maximum shifts to lower fields as temperature goes up. The observed sharp maximum is related to a topological transition in shielding critical current distribution and, consequently, in Abrikosov vortices density. The nonlogarithmic magnetization relaxation for the initial time intervals is found. This fast relaxation has almost an exponentional character. The sharp relaxation rate R(B) maximum is observed. This maximum corresponds to a topological transition in Abrikosov vortices distribution.

  11. Optical detector selection for 1.5-um KTP OPO atmospheric lidar

    Science.gov (United States)

    Mamidipudi, Priyavadan; Killinger, Dennis K.

    1999-05-01

    A 1.5 micron wavelength KTP OPO Lidar system has been developed and used to study the sensitivity and the system signal-to-noise ratio for hard target and atmospheric aerosol lidar returns. Optimization of the receiver system was studied that included the use of different sizes, types of detectors, and the effect of laser beam quality factor, M2, on the telescope overlap function. Detectors that were studied included several different sizes of InGaAs APDs, direct photodetectors, a transferred-electron intensified photodiode (TE-IPD), and a PMT. The influence of the diffraction or beam quality factor (M2) of the OPO laser was studied and found to have a significant influence on the overlap of the transmit and receiver field of view. This overlap function is also influenced by the size of the lidar detector since a large M2 value can overfill the detector/telescope field of view so that small (high speed) detectors may be subject to a large reduction in the lidar signal. The size of the photodiodes and APDs used in the initial OPO lidar experiments were of the order of 0.1 mm to 2 mm, while the TE-IPD and the PMT are larger in acceptance area. Some initial experimental measurements with the photodetectors and APD, and projected theoretical comparisons with the TE-IPD and PMT detectors have been made.

  12. Occulting Light Concentrators in Liquid Scintillator Neutrino Detectors

    Science.gov (United States)

    Buizza Avanzini, Margherita; Cabrera, Anatael; Dusini, Stefano; Grassi, Marco; He, Miao; Wu, Wenjie

    2017-09-01

    The experimental efforts characterizing the era of precision neutrino physics revolve around collecting high-statistics neutrino samples and attaining an excellent energy and position resolution. Next generation liquid-based neutrino detectors, such as JUNO, HyperKamiokande, etc, share the use of a large target mass, and the need of pushing light collection to the edge for maximal calorimetric information. Achieving high light collection implies considerable costs, especially when considering detector masses of several kt. A traditional strategy to maximize the effective photo-coverage with the minimum number of PMTs relies on Light Concentrators (LC), such as Winston Cones. In this paper, the authors introduce a novel concept called Occulting Light Concentrators (OLC), whereby a traditional LC gets tailored to a conventional PMT, by taking into account its single-photoelectron collection efficiency profile and thus occulting the worst performing portion of the photocathode. Thus, the OLC shape optimization takes into account not only the optical interface of the PMT, but also the maximization of the PMT detection performances. The light collection uniformity across the detector is another advantage of the OLC system. By considering the case of JUNO, we will show OLC capabilities in terms of light collection and energy resolution.

  13. Eighteen-Month Follow-Up of Internet-Based Parent Management Training for Children with Conduct Problems and the Relation of Homework Compliance to Outcome.

    Science.gov (United States)

    Högström, Jens; Enebrink, Pia; Melin, Bo; Ghaderi, Ata

    2015-08-01

    The primary aim of the present study was to evaluate if previously reported treatment gains of a parent management training (PMT) program, administered via Internet, were retained from post to the 18-month follow-up. Another aim was to evaluate homework compliance as a predictor of short and long-term outcomes. Participants were parents of 58 children (3-11 years) with conduct problems who received a 10-week self-directed PMT program, with limited therapist support. Parents of 32 children (55.2 %) responded at all measurement point (baseline, post-test and follow-up) and analyses showed that child conduct problems continued to decrease during the 18-month period after the intervention whereas parenting skills deteriorated somewhat from post treatment. Pre- to post-treatment change in child conduct problems was predicted by parental engagement in homework assignments intended to reduce negative child behaviors. The findings provide support for the use of Internet-based PMT and stress the importance of parental compliance to homework training.

  14. Efficacy of theory-based HIV behavioral prevention among rural-to-urban migrants in China: a randomized controlled trial.

    Science.gov (United States)

    Li, Xiaoming; Lin, Danhua; Wang, Bo; Du, Hongfei; Tam, Cheuk Chi; Stanton, Bonita

    2014-08-01

    Our objective was to evaluate the efficacy of a cultural adaptation of a social cognitive theory-based HIV behavioral prevention program among young rural-to-urban migrants in China. The intervention design and assessment were guided by the Protection Motivation Theory (PMT). The intervention was evaluated through a randomized controlled trial with 6-month and 12-month follow-ups. The primary behavioral outcome was the use of condoms. Other outcome measures include HIV knowledge, condom use knowledge, HIV-related perceptions (PMT constructs), and intention to use condom. The mixed-effects regression models for condom use with regular partners indicated that overall frequency of condom use, condom use in last three sexual acts and proper condom use increased over time for the participants but the increases were significantly greater among the intervention group than the control group at 6-month and 12-month follow-ups. The mixed-effects models for HIV-related perceptions indicated that extrinsic rewards, intrinsic rewards, and response costs decreased while vulnerability, severity, response efficacy, and self-efficacy increased over time for the intervention group. The increases in HIV knowledge, condom use knowledge, and intention to use condom were also significantly greater among the intervention group than the control group. The data in the current study suggested efficacy of a social cognitive theory-based behavioral intervention in increasing condom use among young migrants in China. The intervention also increased protective perceptions and decreased risk perception posited by the theory (i.e., PMT).

  15. New methods of data calibration for high power-aperture lidar.

    Science.gov (United States)

    Guan, Sai; Yang, Guotao; Chang, Qihai; Cheng, Xuewu; Yang, Yong; Gong, Shaohua; Wang, Jihong

    2013-03-25

    For high power-aperture lidar sounding of wide atmospheric dynamic ranges, as in middle-upper atmospheric probing, photomultiplier tubes' (PMT) pulse pile-up effects and signal-induced noise (SIN) complicates the extraction of information from lidar return signal, especially from metal layers' fluorescence signal. Pursuit for sophisticated description of metal layers' characteristics at far range (80~130km) with one PMT of high quantum efficiency (QE) and good SNR, contradicts the requirements for signals of wide linear dynamic range (i.e. from approximate 10(2) to 10(8) counts/s). In this article, Substantial improvements on experimental simulation of Lidar signals affected by PMT are reported to evaluate the PMTs' distortions in our High Power-Aperture Sodium LIDAR system. A new method for pile-up calibration is proposed by taking into account PMT and High Speed Data Acquisition Card as an Integrated Black-Box, as well as a new experimental method for identifying and removing SIN from the raw Lidar signals. Contradiction between the limited linear dynamic range of raw signal (55~80km) and requirements for wider acceptable linearity has been effectively solved, without complicating the current lidar system. Validity of these methods was demonstrated by applying calibrated data to retrieve atmospheric parameters (i.e. atmospheric density, temperature and sodium absolutely number density), in comparison with measurements of TIMED satellite and atmosphere model. Good agreements are obtained between results derived from calibrated signal and reference measurements where differences of atmosphere density, temperature are less than 5% in the stratosphere and less than 10K from 30km to mesosphere, respectively. Additionally, approximate 30% changes are shown in sodium concentration at its peak value. By means of the proposed methods to revert the true signal independent of detectors, authors approach a new balance between maintaining the linearity of adequate signal (20

  16. Regulation of Toll-like receptor 4-mediated immune responses through Pasteurella multocida toxin-induced G protein signalling

    Directory of Open Access Journals (Sweden)

    Hildebrand Dagmar

    2012-08-01

    Full Text Available Abstract Background Lipopolysaccharide (LPS-triggered Toll-like receptor (TLR 4-signalling belongs to the key innate defence mechanisms upon infection with Gram-negative bacteria and triggers the subsequent activation of adaptive immunity. There is an active crosstalk between TLR4-mediated and other signalling cascades to secure an effective immune response, but also to prevent excessive inflammation. Many pathogens induce signalling cascades via secreted factors that interfere with TLR signalling to modify and presumably escape the host response. In this context heterotrimeric G proteins and their coupled receptors have been recognized as major cellular targets. Toxigenic strains of Gram-negative Pasteurella multocida produce a toxin (PMT that constitutively activates the heterotrimeric G proteins Gαq, Gα13 and Gαi independently of G protein-coupled receptors through deamidation. PMT is known to induce signalling events involved in cell proliferation, cell survival and cytoskeleton rearrangement. Results Here we show that the activation of heterotrimeric G proteins through PMT suppresses LPS-stimulated IL-12p40 production and eventually impairs the T cell-activating ability of LPS-treated monocytes. This inhibition of TLR4-induced IL-12p40 expression is mediated by Gαi-triggered signalling as well as by Gβγ-dependent activation of PI3kinase and JNK. Taken together we propose the following model: LPS stimulates TLR4-mediated activation of the NFĸB-pathway and thereby the production of TNF-α, IL-6 and IL-12p40. PMT inhibits the production of IL-12p40 by Gαi-mediated inhibition of adenylate cyclase and cAMP accumulation and by Gβγ-mediated activation of PI3kinase and JNK activation. Conclusions On the basis of the experiments with PMT this study gives an example of a pathogen-induced interaction between G protein-mediated and TLR4-triggered signalling and illustrates how a bacterial toxin is able to interfere with the host’s immune

  17. Laboratory Investigations of Bidirectional Reflectance using the Photomultiplier Tube

    Science.gov (United States)

    Vides, C.; Nelson, R. M.; Boryta, M. D.; Manatt, K. S.

    2016-12-01

    The precise measurement of the intensity of a light source is fundamental data to observational sciences, such as spacecraft imaging and atomic particle detection. Photomultiplier tubes (PMT) have played an integral role in many diverse areas such as spacecraft remote sensing by indicating the physical properties of regolith on a planetary surface and particulate matter in an atmosphere. PMTs are essential in neutrino observatories by detecting Cherenkov radiation, the photons emitted when a neutrino interacts with a dielectric medium at highly relativistic velocities. The PMT utilizes the core principle of Albert Einstein's photoelectric effect, with the aid of secondary emission to multiply the electrons emitted from a primary photon. Traditionally, PMTs are used to measure the intensity of photons reflected from a surface. We designed a photometer such that we could measure the photoelectron current from two Hamamatsu R928 photomultiplier tubes, as amplified by Keithly 610 electrometers. The results provide insight into the behavior of photoelectrons, how temperature affects PMT output current, and the amplification electronics that form a basis for remote sensing measurements. We performed photometry with a maximum error of 1% by measuring the intensity of a coherent light source. The calibration procedure involved incrementing and decrementing the high voltage in steps of 50V on a high voltage power supply to locate the linear range within the Gaussian curve of light intensity as a function of high voltage to maximize the signal to noise. We have measured how the signal to noise ratio changes when transmittance was reduced and compared the performance of the PMTs. We measured the intensity as a function of polarization angle. We then measured the response change of the PMT as the reflectance of the incident surface changed. The data was reduced and analyzed using MATLAB. We corrected aliasing and fit the mathematical function of the photoelectron current in

  18. LaBr 3:Ce scintillation gamma camera prototype for X and gamma ray imaging

    Science.gov (United States)

    Pani, R.; Cinti, M. N.; Pellegrini, R.; Bennati, P.; Betti, M.; Vittorini, F.; Mattioli, M.; Trotta, G.; Orsolini Cencelli, V.; Scafè, R.; Navarria, F.; Bollini, D.; Baldazzi, G.; Moschini, G.; de Notaristefani, F.

    2007-06-01

    LaBr 3:Ce has been showing very promising characteristics as gamma ray imager and spectrometer. In particular its excellent energy resolution values (6% at 140 keV and ˜3% FWHM at 662 keV), obtained when coupled to a PMT, make it the major competitor of semiconductor detectors working at room temperature. In order to improve its imaging performances, the LaBr 3:Ce can easily work as continuous detector allowing sub-millimeter spatial resolution values at 140 keV photon energy when coupled to a Position Sensitive PMT. Further interesting characteristics like a short scintillation decay time (16 ns), a very high light yield (63 000 photons/MeV) and a low afterglow are attracting the scientific community for the potential improvement of a wide range of applications in medicine like PET, SPECT and CT instrumentation. In this paper, we present some preliminary imaging results obtained by coupling H8500 Hamamatsu Flat Panel PMT to two LaBr 3:Ce crystals with 50×50 mm 2 area, 5 and 10 mm thickness respectively. With the aim to propose a single detector able to combine functional information, for example from Single Photon Emission technique, with the morphological ones from X-ray imaging the spatial resolution results obtained in the energy range between 30 and 302 keV are analyzed and discussed. We obtained very interesting spatial resolution results for gamma ray energy value greater than 60 keV (better than 1 mm, intrinsic value), while in the energy range proper to X-ray applications, like RX-Mammography (about 30 keV), the spatial resolution values resulted about 2 mm.

  19. The transport of photons through short light guides

    Science.gov (United States)

    Mammei, Russell; Gisel Olave, Rocio; Cole, Philip L.

    2000-10-01

    We have designed and optimized the light collection from a set of light guides, which couple the scintillator to the photomultiplier tubes (PMTs) of an instrumented collimator, which was designed and built by the University of Texas at El Paso and the Institut de Physique Nucléaire at Orsay. This collimator will be used with the experiments employing a beam of linearly-polarized photons in Hall B of Jefferson Lab in the spring of 2001 (E94-109, E98-109, and E99-013). Using the Monte-Carlo simulation package, Guidem V1.0, we were able to simulate a scintillator-light guide-PMT construction. The scintillators were simulated to emit photons isotropically throughout the whole volume of the scintillator. Parameters varied in the simulation were: radius of curvature of the bend, wrapping reflectivities, attenuation length, ripple angle (smoothness of the light guide surface), metal crumple angle (crumple of the aluminum wrapping), and the optical glue interfaces. Also investigated were the indices of refraction for the scintillator-light guide interface as well as the light guide-PMT interface. Given a bent geometry, our studies concluded that a curved elbow shape, 6 cm in length, with a radius of curvature of at least 1.4 cm, will produce a transmission efficiency between 54-55% with reference to the total light created in the scintillator. These light guides should have a ripple angle between 0 and 3 degrees, and have a PMT index of refraction between 1.3 and 1.5. The light guide should be wrapped in aluminum and the scintillator should be wrapped a paper with reflectivity around 0.1 to prevent smudging of the plastic.

  20. Inter-crystal scatter identification for a depth-sensitive detector using support vector machine for small animal positron emission tomography

    Energy Technology Data Exchange (ETDEWEB)

    Yoshida, Eiji [National Institute of Radiological Sciences, Anagawa 4-9-1 Inage-ku, Chiba-shi, Chiba 263-8555 (Japan)]. E-mail: rush@nirs.go.jp; Kitamura, Keishi [National Institute of Radiological Sciences, Anagawa 4-9-1 Inage-ku, Chiba-shi, Chiba 263-8555 (Japan); Shimadzu Corporation, Nishinokyo Kuwabaracho 1 Nakagyo-ku, Kyoto-shi, Kyoto 604-8511 (Japan); Kimura, Yuichi [Tokyo Metropolitan Institute of Gerontology, Nakamachi 1-1 Itabashi-ku, Tokyo 173-0022 (Japan); Nishikido, Fumihiko [National Institute of Radiological Sciences, Anagawa 4-9-1 Inage-ku, Chiba-shi, Chiba 263-8555 (Japan); Shibuya, Kengo [National Institute of Radiological Sciences, Anagawa 4-9-1 Inage-ku, Chiba-shi, Chiba 263-8555 (Japan); Yamaya, Taiga [National Institute of Radiological Sciences, Anagawa 4-9-1 Inage-ku, Chiba-shi, Chiba 263-8555 (Japan); Murayama, Hideo [National Institute of Radiological Sciences, Anagawa 4-9-1 Inage-ku, Chiba-shi, Chiba 263-8555 (Japan)

    2007-02-01

    In a conventional positron emission tomography (PET) detector, detected events are projected onto a 2D position histogram by an Anger calculation for crystal identification. However, the measured histogram is affected by inter-crystal scatterings (ICS) which occur in the entire detector. Peaks which are projected for each crystal in the histogram are blurred, and this causes ICS mispositioning. A depth-of-interaction (DOI) detector has been developed for the small animal PET scanner jPET-RD. This DOI detector uses 32x32 crystals with four layers and a 256-channel multi-anode flat panel photomultiplier tube (FP-PMT) which was developed by Hamamatsu Photonics K.K. Each crystal element is 1.45x1.45x4.5 mm{sup 3}. The FP-PMT has a large detective area (49x49 mm{sup 2}) and a small anode pitch (3.04 mm). Therefore, the FP-PMT can extensively trace the behavior of incident {gamma} rays in the crystals including ICS event. We, therefore, propose a novel method for ICS estimation using a statistical pattern recognition algorithm based on a support vector machine (SVM). In this study, we applied the SVM for discriminating photoelectric events from ICS events generated from multiple-anode outputs. The SVM was trained by uniform irradiation events generated from a detector simulator using a Monte Carlo calculation. The success rate for ICS event identification is about 78% for non-training data. The SVM can achieve a true subtraction of ICS events from measured events, and it is also useful for random correction in PET.

  1. NaI(Tl) scintillator read out with SiPM array for gamma spectrometer

    Science.gov (United States)

    Huang, Tuchen; Fu, Qibin; Lin, Shaopeng; Wang, Biao

    2017-04-01

    The NaI(Tl) scintillator is widely used in gamma spectrometer with photomultiplier tube (PMT) readout. Recently developed silicon photomultiplier (SiPM) offers gain and efficiency similar to those of PMT, but with merits such as low bias voltage, compact volume, low cost, high ruggedness and magnetic resonance compatibility. In this study, 2-in. and 1-in. NaI(Tl) scintillators were readout with SiPM arrays, which were made by tiling multiple SiPMs each with an active area of 6×6 mm2 on a printed circuit board. The energy resolutions for 661.6 keV gamma rays, obtained with Φ2×2 in. scintillator coupled to 6×6 ch SiPM array and Φ1×1 in. scintillator coupled to 4×4 ch SiPM array were 7.6% and 7.8%, respectively, and were very close to the results obtained with traditional bialkali PMT (7.3% and 7.6%, respectively). Scintillator coupled to photodetector with smaller area was also studied by adding a light guide or using scintillator with tapered head. The latter showed better performance than using light guide. The 1-in. NaI(Tl) scintillator with tapered head coupled to 2×2 ch SiPM array achieved 7.7% energy resolution at 661.6 keV, the same as that obtained with standard Φ1×1 in. scintillator coupled to 4×4 ch SiPM array. While the 2-in. scintillator with similar geometry showed degraded energy resolution, 10.2% at 661.6 keV, but could still be used when high efficiency is preferred over energy resolution.

  2. Expression and humoral immune response to Hepatitis C virus using a plasmid DNA construct

    Directory of Open Access Journals (Sweden)

    Ray S

    2003-01-01

    Full Text Available PURPOSE: The objective of this study was to clone a c-DNA fragment of hepatitis C virus in a eukaryotic expression vector and to measure the efficacy of humoral immune responses in mice inoculated with this recombinant plasmid. This study was an attempt to lay a foundation for HCV nucleic acid vaccine development in the future. METHODS: A c-DNA fragment of BK146, a clone of HCV type 1b, was sub-cloned into an eukaryotic expression vector pMT3. HepG2 and COS cells were transfected with this construct, named pMT3-BK146. The expression of HCV mRNA and proteins was studied by reverse transcribed polymerase chain reaction, radio Immunoprecipitation (RIPA and immunofluorescence (IFA. The DNA of this construct was injected into the footpad of BALB/c mice and antibody response was tested by enzyme immunoassay and indirect immunofluorescence. RESULTS: COS and HepG2 cells transiently transfected with the recombinant plasmid pMT3-BK146 showed the expression of HCV proteins by RT-PCR, RIPA and immunofluorescence. This DNA clone when injected into Balb/c mice was able to generate specific antibody response to hepatitis C virus by ELISA and IFA. CONCLUSIONS: A c-DNA fragment of HCV cloned in an eukaryotic expression vector was able to express core protein. This DNA clone was also able to elicit antibody response in mice. This can be an initial step towards the development of a potential DNA vaccine for hepatitis C virus infection.

  3. TH-C-19A-10: Systematic Evaluation of Photodetectors Performances for Plastic Scintillation Dosimetry

    Energy Technology Data Exchange (ETDEWEB)

    Boivin, J; Beaulieu, L [University Laval, Quebec, QC (Canada); Centre Hospitalier University de Quebec, Quebec, QC (Canada); Beddar, S [University of Texas MD Anderson Cancer Center, Houston, TX (United States); Guillemette, M [Institut Universitaire de Cardiologie et de Pneumologie de Quebec, Quebec, QC (Canada)

    2014-06-15

    Purpose: To assess and compare the performance of different photodetectors likely to be used in a plastic scintillation detector (PSD). Methods: The PSD consists of a 1 mm diameter, 10 mm long plastic scintillation fiber (BCF-60) which is optically coupled to a clear 10 m long optical fiber of the same diameter. A light-tight plastic sheath covers both fibers and the scintillator end is sealed. The clear fiber end is connected to one of the following six studied photodetectors: two polychromatic cameras (one with an optical lens and one with a fiber optic taper replacing the lens); a monochromatic camera with the same optical lens; a PIN photodiode; an avalanche photodiode (APD); and a photomultiplier tube (PMT). Each PSD is exposed to both low energy beams (120, 180, and 220 kVp) from an orthovoltage unit, and high energy beams (6 MV and 23 MV) from a linear accelerator. Various dose rates are explored to identify the photodetectors operating ranges and accuracy. Results: For all photodetectors, the relative uncertainty remains under 5 % for dose rates over 3 mGy/s. The taper camera collects four times more signal than the optical lens camera, although its standard deviation is higher since it could not be cooled. The PIN, APD and PMT have higher sensitivity, suitable for low dose rate and out-of-field dose monitoring. PMT's relative uncertainty remains under 1 % at the lowest dose rate achievable (50 μGy/s), suggesting optimal use for live dosimetry. Conclusion: A set of 6 photodetectors have been studied over a broad dose rate range at various energies. For dose rate above 3 mGy/s, the PIN diode is the most effective photodetector in term of performance/cost ratio. For lower dose rate, such as those seen in interventional radiology, PMTs are the optimal choice. FQRNT Doctoral Research Scholarship.

  4. Simulating Scintillator Light Collection Using Measured Optical Reflectance

    Energy Technology Data Exchange (ETDEWEB)

    Janecek, Martin; Moses, William

    2010-01-28

    To accurately predict the light collection from a scintillating crystal through Monte Carlo simulations, it is crucial to know the angular distribution from the surface reflectance. Current Monte Carlo codes allow the user to set the optical reflectance to a linear combination of backscatter spike, specular spike, specular lobe, and Lambertian reflections. However, not all light distributions can be expressed in this way. In addition, the user seldom has the detailed knowledge about the surfaces that is required for accurate modeling. We have previously measured the angular distributions within BGO crystals and now incorporate these data as look-up-tables (LUTs) into modified Geant4 and GATE Monte Carlo codes. The modified codes allow the user to specify the surface treatment (ground, etched, or polished), the attached reflector (Lumirror(R), Teflon(R), ESR film, Tyvek(R), or TiO paint), and the bonding type (air-coupled or glued). Each LUT consists of measured angular distributions with 4o by 5o resolution in theta and phi, respectively, for incidence angles from 0? to 90? degrees, in 1o-steps. We compared the new codes to the original codes by running simulations with a 3 x 10 x 30 mm3 BGO crystal coupled to a PMT. The simulations were then compared to measurements. Light output was measured by counting the photons detected by the PMT with the 3 x 10, 3 x 30, or 10 x 30 mm2 side coupled to the PMT, respectively. Our new code shows better agreement with the measured data than the current Geant4 code. The new code can also simulate reflector materials that are not pure specular or Lambertian reflectors, as was previously required. Our code is also more user friendly, as no detailed knowledge about the surfaces or light distributions is required from the user.

  5. Gamma and beta intra-operative imaging probes

    Science.gov (United States)

    Hoffman, Edward J.; Tornai, Martin P.; Levin, Craig S.; MacDonald, Lawrence R.; Siegel, Stefan

    1997-02-01

    Small area (˜1.5 cm 2) scintillation cameras for imaging gammas and betas using inter-changeable detector front ends were built and characterized. Components common to both emission imaging cameras include: (1) fiber optic bundles 2-3 m long, comprised of multi-clad fibers which connect the scintillation detector to (2) an MC-PMT; (3) parallel MC-PMT outputs feed a resistive positioning network and i- V converter/line driver network which produce balanced +X, -X, +Y, and -Y outputs; and (4) four ADCs and a Macintosh PC for system control and image display. The beta and gamma devices used distinct scintillation detectors which were characterized by both simulation and measurement. The beta camera utilized a 0.5 mm by 1.25 cm φ CaF 2(Eu) scintillation crystal coupled, through a diffusing light guide, to 19 2-mm φ optical fibers. These front-end fibers are in turn coupled by a more flexible fiber bundle to the MC-PMT. CaF 2(Eu) has high light output, high beta sensitivity, and low gamma sensitivity. Image signals are histogrammed and displayed after Anger logic computations are performed on digitized signals. The beta camera has diffusers between each crystal matrix and fibers were evaluated. The continuous crystals were coupled directly to the fiber optics with signal and data processing analogous to the beta camera. Coupling of discrete crystals to fiber optics by both methods gave essentially perfect identification of the crystal of interaction, allowing spatial resolution to be defined by the crystal size and collimator. The continuous crystal gamma camera gave intrinsic resolution of ˜1.4 mm FWHM.

  6. Characterization of photo-multiplier tubes for the Cryogenic Avalanche Detector

    Science.gov (United States)

    Bondar, A.; Buzulutskov, A.; Dolgov, A.; Nosov, V.; Shekhtman, L.; Sokolov, A.

    2015-10-01

    New Cryogenic Avalanche Detector (CRAD) with ultimate sensitivity, that will be able to detect one primary electron released in the cryogenic liquid, is under development in the Laboratory of Cosmology and Particle Physics of the Novosibirsk State University jointly with the Budker Institute of Nuclear Physics. The CRAD will use two sets of cryogenic PMTs in order to get trigger signal either from primary scintillations in liquid Ar or from secondary scintillations in high field gap above the liquid. Two types of cryogenic PMTs produced by Hamamatsu Photonics were tested and the results are presented in this paper. Low background 3 inch PMT R11065-10 demonstrated excellent performance according to its specifications provided by the producer. The gain measured with single electron response (SER) in liquid Ar reached 107, dark count rate rate did not exceed 300 Hz and pulse height resolution of single electron signals was close to 50%(FWHM). However, two R11065-10 PMTs out of 7 tested stopped functioning after several tens minutes of operation immersed completely into liquid Ar. The remaining 5 devices and one R11065-MOD were operated successfully for several hours each with all the parameters according to the producer specifications. Compact 2 inch PMT R6041-506-MOD with metal-channel dynode structure is a candidate for side wall PMT system that will look at electroluminescence in high field region above liquid. Four of these PMTs were tested in liquid Ar and demonstrated gain up to 2× 107, dark count rate rate below 100 Hz and pulse height resolution of single electron signals of about 110% (FWHM).

  7. Multistage Pressure-Retarded Osmosis

    Science.gov (United States)

    Bharadwaj, Devesh; Fyles, Thomas M.; Struchtrup, Henning

    2016-10-01

    One promising sustainable energy source is the chemical potential difference between salt and freshwater. The membrane process of pressure-retarded osmosis (PRO) has been the most widely investigated means to harvest salinity gradient energy. In this report, we analyse the thermodynamic efficiency of multistage PRO systems to optimize energy recovery from a salinity gradient. We establish a unified description of the efficiencies of the component pumps (P), turbines (T), pressure exchangers (PX), and membrane modules (M) and exploit this model to determine the maximum available work with respect to the volume of the brine produced, the volume of the sea water consumed, or the volume of the freshwater that permeates the membrane. In an idealized series configuration of 1-20 modules (P-M-T), the three optimization conditions have significantly different intermediate operating pressures in the modules, but demonstrate that multistage systems can recover a significantly larger fraction of the available work compared to single-stage PRO. The biggest proportional advantage occurs for one to three modules in series. The available work depends upon the component efficiencies, but the proportional advantage of multistage PRO is retained. We also optimize one- and two-stage PX-M-T and P-M-T configurations with respect to the three volume parameters, and again significantly different optimal operating conditions are found. PX-M-T systems are more efficient than P-M-T systems, and two-stage systems have efficiency advantages that transcend assumed component efficiencies. The results indicate that overall system design with a clear focus on critical optimization parameters has the potential to significantly improve the near-term practical feasibility of PRO.

  8. Comparable flow cytometry data can be obtained with two types of instruments, Canto II, and Navios. A GEIL study.

    Science.gov (United States)

    Solly, Françoise; Rigollet, Lauren; Baseggio, Lucille; Guy, Julien; Borgeot, Jessica; Guérin, Estelle; Debliquis, Agathe; Drenou, Bernard; Campos, Lydia; Lacombe, Francis; Béné, Marie C

    2013-12-01

    Flow cytometry (FC) instruments settings classically rely on local establishment of photomultipliers (PMT) voltages adapted to the measurements expected to be performed. In the era of multiparameter FC (MFC), it appears more and more desirable that comparable patterns of fluorescence are obtained in different settings. This relies on a harmonization of settings between instruments. Although this has been shown to be feasible within a given brand of flow cytometers, little information is available about broader comparisons in a given center or in a multicenter fashion. Here, we report a two-phase series of experiments first performed between a Canto II (BD Biosciences) and a Navios (Beckman Coulter) instruments in the same center. PMT values adjusted on the reference instrument (RI) Canto II were used to establish target values for PMT settings on the paired Navios practice instrument (PI). This allowed to show the good correlation of all but peaks 1 and 2 of Rainbow(®) beads between RI and PI. Using 4- or 8-color stained leukocytes, the similitude of the settings was further confirmed. A complex set of matrices was then established between five centers all equipped with both instruments. Using Bland & Altman difference comparisons for median fluorescence values, it was shown that using either Rainbow beads or CD16 stained polymorphonuclears to set-up target values on the RI CantoII, highly superimposable results could be obtained on all 9 PI. The latter were obtained using Rainbow beads or Compbeads(®) for comparisons. In summary, this two-phase study demonstrates the feasibility of different methods allowing for a robust harmonization of settings for MFC.

  9. Factors influencing timing resolution in a commercial LSO PETcamera

    Energy Technology Data Exchange (ETDEWEB)

    Moses, William W.; Ullisch, Marcus

    2004-10-23

    The CPS Accel is a commercial PET camera based on a block detector with 64 LSO scintillator crystals (each 6.75 x 6.75 x 25 mm)read out with 4 photomultiplier tubes. The excellent timing resolution of LSO suggests that this camera might be used for time-of-flight (TOF) PET, thereby reducing the statistical noise significantly. Although the Accel achieves 3 ns coincidence resolution (a factor of two better than BGO-based PET cameras), its timing resolution is nearly an order of magnitude worse than that demonstrated with individual LSO crystals. This paper quantifies the effect on the timing of each component in the Accel timing chain to identify which components most limit the camera's timing resolution. The components in the timing chain are: the scintillator crystal, the photomultiplier tube (PMT), the constant fraction discriminator (CFD), and the time to digital converter (TDC). To measure the contribution of each component, we construct a single crystal test system with high-performance versions of these components. This system achieves 221 ps fwhm coincidence timing resolution, which is used as a baseline measurement. One of the high-performance components is replaced by a production component, the coincidence timing resolution is re-measured, and the difference between measurements is the contribution of that (production) component. We find that the contributions of the TDC, CFD, PMT, and scintillator are 2000 ps, 1354 ps, 422 ps, and 326 psfwhm respectively, and that the overall timing resolution scales like the square root of the amount of scintillation light detected by the PMT. Based on these measurements we predict that the limit for the coincidence timing resolution in a practical, commercial, LSO-based PET camera is 528ps fwhm.

  10. A LED-based method for monitoring NAD(P)H and FAD fluorescence in cell cultures and brain slices.

    Science.gov (United States)

    Rösner, Jörg; Liotta, Agustin; Schmitz, Dietmar; Heinemann, Uwe; Kovács, Richard

    2013-01-30

    Nicotinamide- and flavine-adenine-dinucleotides (NAD(P)H and FADH₂) are electron carriers involved in cellular energy metabolism and in a multitude of enzymatic processes. As reduced NAD(P)H and oxidised FAD molecules are fluorescent, changes in tissue auto-fluorescence provide valuable information on the cellular redox state and energy metabolism. Since fluorescence excitation, by mercury arc lamps (HBO) is inherently coupled to photo-bleaching and photo-toxicity, microfluorimetric monitoring of energy metabolism might benefit from the replacement of HBO lamps by light emitting diodes (LEDs). Here we describe a LED-based custom-built setup for monitoring NAD(P)H and FAD fluorescence at the level of single cells (HEK293) and of brain slices. We compared NAD(P)H bleaching characteristics with two light sources (HBO lamp and LED) as well as sensitivity and signal to noise ratio of three different detector types (multi-pixel photon counter (MPPC), photomultiplier tube (PMT) and photodiode). LED excitation resulted in reduced photo-bleaching at the same fluorescence output in comparison to excitation with the HBO lamp. Transiently increasing LED power resulted in reversible bleaching of NAD(P)H fluorescence. Recovery kinetics were dependent on metabolic substrates indicating coupling of NAD(P)H fluorescence to metabolism. Electrical stimulation of brain slices induced biphasic redox changes, as indicated by NAD(P)H/FAD fluorescence transients. Increasing the gain of PMT and decreasing the LED power resulted in similar sensitivity as obtained with the MPPC and the photodiode, without worsening the signal to noise ratio. In conclusion, replacement of HBO lamp with LED might improve conventional PMT based microfluorimetry of tissue auto-fluorescence.

  11. Quantitation of myocardial blood flow and myocardial flow reserve with {sup 99m}Tc-sestamibi dynamic SPECT/CT to enhance detection of coronary artery disease

    Energy Technology Data Exchange (ETDEWEB)

    Hsu, Bailing [University of Missouri-Columbia, Nuclear Science and Engineering Institute, Columbia, MO (United States); Chen, Fu-Chung; Chen, Chien-Cheng [Show Chwan Memorial Hospital, Section of Cardiology, Department of Internal Medicine, Changhua (China); Wu, Tao-Cheng [Taipei Veterans General Hospital, Section of Cardiology, Department of Internal Medicine, Taipei (China); Huang, Wen-Sheng [Changhua Christian Hospital, Department of Medical Research and Department of Nuclear Medicine, Changhua (China); Hou, Po-Nien [Chang Bing Show Chwan Memorial Hospital, Department of Nuclear Medicine, Lukong Town, Changhua Shien (China); Hung, Guang-Uei [Chang Bing Show Chwan Memorial Hospital, Department of Nuclear Medicine, Lukong Town, Changhua Shien (China); Central Taiwan University of Science and Technology, Department of Medical Imaging and Radiological Science, Taichung (China); China Medical University, Department of Biomedical Imaging and Radiological Science, Taichung (China)

    2014-12-15

    Conventional dual-head single photon emission computed tomography (SPECT)/CT systems capable of fast dynamic SPECT (DySPECT) imaging have a potential for flow quantitation. This study introduced a new method to quantify myocardial blood flow (MBF) and myocardial flow reserve (MFR) with DySPECT scan and evaluated the diagnostic performance of detecting coronary artery disease (CAD) compared with perfusion using invasive coronary angiography (CAG) as the reference standard. This study included 21 patients with suspected or known CAD who had received DySPECT, ECG-gated SPECT (GSPECT), and CAG (13 with ≥50 % stenosis in any vessel; non-CAD group: 8 with patent arteries or <50 % stenosis). DySPECT and GSPECT scans were performed on a widely used dual-head SPECT/CT scanner. The DySPECT imaging protocol utilized 12-min multiple back-and-forth gantry rotations during injections of {sup 99m}Tc-sestamibi (MIBI) tracer at rest or dipyridamole-stress stages. DySPECT images were reconstructed with full physical corrections and converted to the physical unit of becquerels per milliliter. Stress MBF (SMBF), rest MBF (RMBF), and MFR were quantified by a one-tissue compartment flow model using time-activity curves derived from DySPECT images. Perfusion images were processed for GSPECT scan and interpreted to obtain summed stress score (SSS) and summed difference score (SDS). Receiver-operating characteristic (ROC) analyses were conducted to evaluate the diagnostic performance of flow and perfusion. Using the criteria of ≥50 % stenosis as positive CAD, areas under the ROC curve (AUCs) of flow assessment were overall significantly greater than those of perfusion. For patient-based analysis, AUCs for MFR, SMBF, SSS, and SDS were 0.91 ± 0.07, 0.86 ± 0.09, 0.64 ± 0.12, and 0.59 ± 0.13. For vessel-based analysis, AUCs for MFR, SMBF, SSS, and SDS were 0.81 ± 0.05, 0.76 ± 0.06, 0.62 ± 0.07, and 0.56 ± 0.08, respectively. The preliminary data suggest that MBF quantitation with a

  12. Clinicopathological, but not socio-demographic factors affect the prognosis in cervical carcinoma.

    Science.gov (United States)

    Munagala, Radha; Rai, Shesh N; Ganesharajah, Selvaluxmy; Bala, Nagarajan; Gupta, Ramesh C

    2010-08-01

    The purpose of this study was to investigate the prognostic factors, such as clinical, histological and socio-demographic features affecting the event-free and overall survival of the patients with stage I-III carcinoma of the cervix. Eighty-nine patients with International FIGO stage I-III cervical cancer were treated radiation therapy and follow-up of 5-7 years were analyzed for various clinical, histopathological and socio-demographic factors influencing prognosis. Survival estimations were performed using the Kaplan-Meier method, and were compared using the un-weighted log-rank test and multivariable analysis using the Cox proportional hazards model. The median age was 46 years (range, 28-65 years). The 5-year event-free survival (EFS) and overall survival (OAS), along with standard error (SE), were 65.2% (7.0%) and 81.4% (6.1%), respectively. Significant prognostic factors for EFS include, stage (P=0.019), pelvic lymph node metastasis (P=0.013), parametrial (PMT) involvement (P=0.025), number of parametria involved (P=0.000) and tumor size (P=0.034). However, number of parametrial invasion was only significant prognostic factors for overall survival (P=0.015); 5-year survival rate was significantly lower in patients with both PMT involved (58%) than with one PMT involved (>85%). Using a multivariable analysis, we found that number of PMT involved being the only independent significant factor for the development of recurrent disease. None of the socio-demographic factors analyzed were of prognostic importance on event-free and overall survival in cervical cancer patients. Several clinicopathological factors were of prognostic significance but none of the socio-demographic factors analyzed had any role in determining patient outcome. Hence, in cervical cancer, prognosis is more likely dependent on clinical than socio-demographic factors unlike several other cancers where their significant role is well documented. Study of clinical and demographic characteristics

  13. Temporal Global Changes in Gene Expression during Temperature Transition in Yersinia pestis

    OpenAIRE

    Motin, Vladimir L; Georgescu, Anca M.; Fitch, Joseph P.; Gu, Pauline P.; Nelson, David O.; Mabery, Shalini L.; Garnham, Janine B.; Sokhansanj, Bahrad A.; Ott, Linda L.; Matthew A Coleman; Elliott, Jeffrey M.; Kegelmeyer, Laura M.; Wyrobek, Andrew J.; Slezak, Thomas R.; Brubaker, Robert R.

    2004-01-01

    DNA microarrays encompassing the entire genome of Yersinia pestis were used to characterize global regulatory changes during steady-state vegetative growth occurring after shift from 26 to 37°C in the presence and absence of Ca2+. Transcriptional profiles revealed that 51, 4, and 13 respective genes and open reading frames (ORFs) on pCD, pPCP, and pMT were thermoinduced and that the majority of these genes carried by pCD were downregulated by Ca2+. In contrast, Ca2+ had little effect on chrom...

  14. Test of the photon detection system for the LHCb RICH Upgrade in a charged particle beam

    CERN Document Server

    Baszczyk, Mateusz Karol; Calabrese, Roberto; Cardinale, Roberta; Carniti, Paolo; Cassina, Lorenzo; Cavallero, Giovanni; Cojocariu, Lucian Nicolae; Cotta Ramusino, Angelo; D'Ambrosio, Carmelo; Dorosz, Piotr Andrzej; Easo, Sajan; Eisenhardt, Stephan; Fiorini, Massimiliano; Frei, Christoph; Gambetta, Silvia; Gibson, Valerie; Gotti, Claudio; Harnew, Neville; He, Jibo; Keizer, Floris; Kucewicz, Wojciech; Maciuc, Florin; Maino, Matteo; Malaguti, Roberto; Matteuzzi, Clara; Mccann, Michael Andrew; Morris, Adam; Muheim, Franz; Papanestis, Antonis; Pessina, Gianluigi; Petrolini, Alessandro; Piedigrossi, Didier; Pistone, Alessandro; Placinta, Vlad-Mihai; Sigurdsson, Saevar; Simi, Gabriele; Smith, Jackson William; Spradlin, Patrick; Tomassetti, Luca; Wotton, Stephen

    2016-01-01

    The LHCb detector will be upgraded to use the available luminosity at the LHC in Run III and extend its potential for discovery. The Ring Imaging Cherenkov (RICH) detectors are one of the key components of the LHCb detector for particle identification. In this paper, we describe the setup and the results of the first tests in a particle beam carried out to assess prototypes of the upgraded optoelectronic chain from the Multi-Anode PMT photosensor to the readout and data acquisition system.

  15. Channel control ASIC for the CMS hadron calorimeter front end readout module

    Energy Technology Data Exchange (ETDEWEB)

    Ray Yarema et al.

    2002-09-26

    The Channel Control ASIC (CCA) is used along with a custom Charge Integrator and Encoder (QIE) ASIC to digitize signals from the hybrid photo diodes (HPDs) and photomultiplier tubes (PMTs) in the CMS hadron calorimeter. The CCA sits between the QIE and the data acquisition system. All digital signals to and from the QIE pass through the CCA chip. One CCA chip interfaces with two QIE channels. The CCA provides individually delayed clocks to each of the QIE chips in addition to various control signals. The QIE sends digitized PMT or HPD signals and time slice information to the CCA, which sends the data to the data acquisition system through an optical link.

  16. Secondary Emission Calorimetry: Fast and Radiation-Hard

    CERN Document Server

    Albayrak-Yetkin, A; Corso, J; Debbins, P; Jennings, G; Khristenko, V; Mestvirisvilli, A; Onel, Y; Schmidt, I; Sanzeni, C; Southwick, D; Winn, D R; Yetkin, T

    2013-01-01

    A novel calorimeter sensor for electron, photon and hadron energy measurement based on Secondary Emission(SE) to measure ionization is described, using sheet-dynodes directly as the active detection medium; the shower particles in an SE calorimeter cause direct secondary emission from dynode arrays comprising the sampling or absorbing medium. Data is presented on prototype tests and Monte Carlo simulations. This sensor can be made radiation hard at GigaRad levels, is easily transversely segmentable at the mm scale, and in a calorimeter has energy signal rise-times and integration comparable to or better than plastic scintillation/PMT calorimeters. Applications are mainly in the energy and intensity frontiers.

  17. Light Collection and Pulse-Shape Discrimination in Elongated Scintillator Cells for the PROSPECT Reactor Antineutrino Experiment

    CERN Document Server

    Ashenfelter, J; Band, H R; Barclay, G; Bass, C D; Berish, D; Bowden, N S; Bowes, A; Brodsky, J P; Bryan, C D; Cherwinka, J J; Chu, R; Classen, T; Commeford, K; Davee, D; Dean, D; Deichert, G; Diwan, M V; Dolinski, M J; Dolph, J; Dwyer, D A; Gaison, J K; Galindo-Uribarri, A; Gilje, K; Glenn, A; Goddard, B W; Green, M; Han, K; Hans, S; Heeger, K M; Heffron, B; Jaffe, D E; Langford, T J; Littlejohn, B R; Caicedo, D A Martinez; McKeown, R D; Mendenhall, M P; Mueller, P; Mumm, H P; Napolitano, J; Neilson, R; Norcini, D; Pushin, D; Qian, X; Romero, E; Rosero, R; Saldana, L; Seilhan, B S; Sharma, R; Sheets, S; Stemen, N T; Surukuchi, P T; Varner, R L; Viren, B; Wang, W; White, B; White, C; Wilhelmi, J; Williams, C; Wise, T; Yao, H; Yeh, M; Yen, Y -R; Zangakis, G; Zhang, C; Zhang, X

    2015-01-01

    A meter-long, 23-liter EJ-309 liquid scintillator detector has been constructed to study the light collection and pulse-shape discrimination performance of elongated scintillator cells for the PROSPECT reactor antineutrino experiment. The magnitude and uniformity of light collection and neutron/gamma discrimination power in the energy range of antineutrino inverse beta decay products have been studied using gamma and spontaneous fission calibration sources deployed along the cell long axis. We also study neutron-gamma discrimination and light collection abilities for differing PMT and reflector configurations. Key design features for optimizing MeV-scale response and background rejection capabilities are identified.

  18. JUNO: A Next Generation Reactor Antineutrino Experiment

    CERN Document Server

    Zhan, Liang

    2015-01-01

    The mass hierarchy and the CP phase are the main focus of the next generation neutrino oscillation experiments. Jiangmen Underground Neutrino Observatory (JUNO), as a medium baseline reactor antineutrino experiment, can determine the neutrino mass hierarchy independent of the CP phase. The physics potential on the mass hierarchy, and other measurements are reviewed. The preliminary design options for a 20~kton detector with an energy resolution of $3\\%/\\sqrt{E_{vis}}$ are illustrated. The main technical challenges on the PMT and scintillator are discussed and the corresponding R\\&D efforts are presented.

  19. Interaction Between Ambient Particles and Ozone and Its Effect on Daily Mortality

    Institute of Scientific and Technical Information of China (English)

    2007-01-01

    Objective To examine the effect of particulate matter (PM) less than 10 microns in diameter (PM10) and ozone (O3) on daily mortality in Shanghai, China. Methods A generalized additive model with penalized spline function was used to observe the acute effect of PM10 and O3 on daily mortality. Results Higher PMt0 significantly increased the effect of O3 on total mortality,and O3 also increased the effect of PM10 although the estimated increment was statistically insignificant. Conclusion Our findings provide further evidence for the effect of PM10 and O3 on daily mortality.

  20. Measurement of Compton edge position in low-Z scintillators

    Energy Technology Data Exchange (ETDEWEB)

    Swiderski, Lukasz, E-mail: l.swiderski@ipj.gov.p [Department of Nuclear Detectors and Electronics, Soltan Institute for Nuclear Studies, Otwock-Swierk (Poland); Moszynski, Marek; Czarnacki, Wieslaw; Iwanowska, Joanna; Syntfeld-Kazuch, Agnieszka; Szczesniak, Tomasz [Department of Nuclear Detectors and Electronics, Soltan Institute for Nuclear Studies, Otwock-Swierk (Poland); Pausch, Guntram; Plettner, Cristina; Roemer, Katja [ICx Technologies GmbH, Piepersberg 12, Solingen (Germany)

    2010-03-15

    A method based on a Compton coincidence technique was applied to measure in a wide energy range the position of Compton edge in organic scintillators. The experimental setup comprised a High Purity Germanium (HPGe) detector and a tested scintillator coupled to a PMT. The detectors were set in a face-to-face geometry and the source was placed between them. Thus gating on events backscattered in the tested scintillator and detected in HPGe allowed measuring of Compton edge position for a given {gamma}-ray energy. The presented method provides a valuable tool for energy calibration of low-Z scintillators.

  1. Light collection of the POLAR detector

    Institute of Scientific and Technical Information of China (English)

    2010-01-01

    POLAR is a compact polarimeter dedicated to measuring the polarization of GRBs between 50-350 keV.The light collection of 200 mm×6 mm×6 mm plastic bars has been simulated and optimized in order to get uniform response to X-rays at different points along one single bar.According to the Monte Carlo results,the amplitude uniformity strongly depends on the level of polishing of the scintillator surface and the covering.A uniformity of 89% is achieved with a prototype constructed by a non position-sensitive PMT and an array of 4×4 bars.

  2. 浅析中海油服模块钻机建造项目管理模式%Discussion on project management mode of COSL module drilling rig construction

    Institute of Scientific and Technical Information of China (English)

    朱骁卒; 李杰

    2012-01-01

    @@%结合中海油田服务股份有限公司钻井事业部所承建的PEMEX COSL1 -4四套模块钻机建造经验,对模块钻机建造所采取的“PMT+工程监理+EPC”项目管理模式的优势及流程进行了分析.最后详细阐述了模块钻机建造的项目管理模式的应用.

  3. Design and Demonstration of a Miniature Lidar System for Rover Applications

    Science.gov (United States)

    Robinson, Benjamin

    2010-01-01

    A basic small and portable lidar system for rover applications has been designed. It uses a 20 Hz Nd:YAG pulsed laser, a 4-inch diameter telescope receiver, a custom-built power distribution unit (PDU), and a custom-built 532 nm photomultiplier tube (PMT) to measure the lidar signal. The receiving optics have been designed, but not constructed yet. LabVIEW and MATLAB programs have also been written to control the system, acquire data, and analyze data. The proposed system design, along with some measurements, is described. Future work to be completed is also discussed.

  4. Effect of cyclic, low dose pyrimethamine treatment in patients with Late Onset Tay Sachs: an open label, extended pilot study

    OpenAIRE

    Osher, Etty; Fattal-Valevski, Aviva; Sagie, Liora; Urshanski, Nataly; Sagiv, Nadav; Peleg, Leah; Lerman-Sagie, Tally; Zimran, Ari; Elstein, Deborah; Navon, Ruth; Valevski, Avi; Stern, Naftali

    2015-01-01

    Background Late Onset Tay- Sachs disease (LOTS) is a rare neurodegenerative lysosomal storage disease which results from mutations in the gene encoding the α subunit (HEXA) of β-hexosaminidase enzyme (HexA). At the present time, no effective treatment exists for LOTS and other neurodegenerative diseases involving the central nerve system (CNS). Pyrimethamine (PMT) was previously shown to act as a HexA chaperone in human fibroblasts in vitro carrying some (e.g., αG269S), but not all LOTS-relat...

  5. Light collection of POLAR detector

    CERN Document Server

    Dong, Yongwei; Wu, Bobing; Zhang, Yongjie; Zhang, Shuangnan

    2009-01-01

    POLAR is a compact polarimeter dedicated to measure the polarization of GRBs between 50-300 keV. The light collection of 200*6*6mm3 plastic bars has been simulated and optimized in order to get uniform response to x-rays at different points of one single bar. According to the Monte Carlo results, the amplitude uniformity strongly depends on the polishing level of scintillator surface and the covering. A uniformity of 89% is achieved with a prototype constructed by a non position-sensitive PMT and an array of 4X4 bars.

  6. Observed light yield of scintillation pixels: Extending the two-ray model

    Science.gov (United States)

    Kantorski, Igor; Jurkowski, Jacek; Drozdowski, Winicjusz

    2016-09-01

    In this paper we propose an extended, two dimensional model describing the propagation of scintillation photons inside a cuboid crystal until they reach a PMT window. In the simplest approach the model considers two main reasons for light losses: standard absorption obeying the classical Lambert-Beer law and non-ideal reflectivity of the "mummy" covering formed by several layers of Teflon tape wrapping the sample. Results of the model calculations are juxtaposed with experimental data as well as with predictions of an earlier, one dimensional model.

  7. Status of the Timepix MCP-HPD development

    CERN Document Server

    Tick, T; Michel, T; O'Shea, V; Plackett, R; Pospisil, S; Vallerga, J; Visser, J

    2010-01-01

    This paper describes the design of a high-speed, single-photon sensitive, Hybrid Photon Detector (HPD). The detector consists of a vacuum tube, containing a Micro Channel Plate (MCP) and 4 CMOS pixel readout chips, sealed with a transparent optical input window with a photocathode. The design described here utilizes currently available technologies, specifically the Timepix readout chips and the Photonis Planacon MCP-PMT vacuum tubes. The aim of the project is to demonstrate the feasibility of a 4-side buttable square MCP-HPD with high packing fraction sensitive area. Presented here is the mechanical and thermal design of the prototype detector

  8. Photostimulated phosphor based image plate detection system for HRVUV beamline at Indus-1 synchrotron radiation source

    OpenAIRE

    2014-01-01

    A high resolution vacuum ultraviolet (HRVUV) beamline based on a 6.65 meter off-plane Eagle spectrometer is in operation at the Indus-1 synchrotron radiation source, RRCAT, Indore, India. To facilitate position sensitive detection and fast spectral recording, a new BaFBr:Eu2+ phosphor based image plate (IP) detection system interchangeable with the existing photomultiplier (PMT) scanning system has been installed on this beamline. VUV photoabsorption studies on Xe, O2, N2O and SO2 are carried...

  9. Upgrade Analog Readout and Digitizing System for ATLAS TileCal Demonstrator

    CERN Document Server

    Tang, F; The ATLAS collaboration; Akerstedt, H; Biot, A; Bohm, C; Carrio, F; Drake, G; Hildebrand, K; Muschter, S; Oreglia, M; Paramonov, A

    2013-01-01

    A potential upgrade for the front-end electronics and signal digitization and data acquisition system of the ATLAS hadron calorimeter for the high luminosity Large Hadron Collider (HL-LHC) is described. A Demonstrator is being built to readout a slice of the TileCal detector. The on-detector electronics includes up to 48 Analog Front-end Boards for PMT analog signal processing, 4 Main Boards for data digitization and slow controls, 4 Daughter Boards with high speed optical links to interface the on-detector and off-detector electronics. Two super readout driver boards are used for off-detector data acquisition and fulfilling digital trigger.\

  10. Study of the Light Emission Process from the Double Chooz Photomultipliers

    Energy Technology Data Exchange (ETDEWEB)

    Calvo, E.; Cerrada, M.; Crespo, J. I.; Gil-Botella, I.; Jimenez, S.; Lopez, M.; Novella, P.; Palomares, C.; Santorelli, R.; Verdugo, A.

    2012-09-13

    In this document we present a study of the light emitted by the base of a Hamamatsu R7081MOD-ASSY photomultiplier (PMT) of the same type used in the Double Chooz experiment. Several characteristic features of the light signal have been found in terms of amplitude, length and pulse shape. Additional investigations on the properties of the epoxy used to cover the photomultiplier base have been carried out. A possible explanation of the light emission process is discussed at the end of the study. (Author) 1 ref.

  11. Development of time-of-flight neutron detector with fast-decay and low-afterglow scintillator for fast ignition experiment

    Directory of Open Access Journals (Sweden)

    Nagai T.

    2013-11-01

    Full Text Available A fast-decay and low-afterglow liquid scintillator was developed for the fast ignition experiment at the Institute of Laser Engineering (ILE. The liquid scintillator was coupled to a gated photomultiplier (PMT, and the gating performance under high-intensity γ-rays was experimentally checked. In 2010, a detector with a high detection efficiency of 10−4 was developed and installed in this experiment. The neutron yield in the fast heating experiment was successfully measured using this detector.

  12. Gadolinium-doped water cerenkov-based neutron and high energy gamma-ray detector and radiation portal monitoring system

    Science.gov (United States)

    Dazeley, Steven A; Svoboda, Robert C; Bernstein, Adam; Bowden, Nathaniel

    2013-02-12

    A water Cerenkov-based neutron and high energy gamma ray detector and radiation portal monitoring system using water doped with a Gadolinium (Gd)-based compound as the Cerenkov radiator. An optically opaque enclosure is provided surrounding a detection chamber filled with the Cerenkov radiator, and photomultipliers are optically connected to the detect Cerenkov radiation generated by the Cerenkov radiator from incident high energy gamma rays or gamma rays induced by neutron capture on the Gd of incident neutrons from a fission source. The PMT signals are then used to determine time correlations indicative of neutron multiplicity events characteristic of a fission source.

  13. Compact FPGA-based pulse-sequencer and radio-frequency generator for experiments with trapped atoms

    CERN Document Server

    Pruttivarasin, Thaned

    2015-01-01

    We present a compact FPGA-based pulse sequencer and radio-frequency (RF) generator suitable for experiments with cold trapped ions and atoms. The unit is capable of outputting a pulse sequence with at least 32 TTL channels with a timing resolution of 40 ns and contains a built-in 100 MHz frequency counter for counting electrical pulses from a photo-multiplier tube (PMT). There are 16 independent direct-digital-synthesizers (DDS) RF sources with fast (rise-time of ~60 ns) amplitude switching and sub-mHz frequency tuning from 0 to 800 MHz.

  14. Absorption tomography of laser induced plasmas with a large aperture

    CERN Document Server

    Shabanov, Sergei V

    2010-01-01

    An emission tomography of laser-induced plasmas employed in the laser induced breakdown spectroscopy (LIBS) requires long signal integration times during which the plasma cannot be considered stationary. To reduce the integration time, it is proposed to measure a plasma absorption in parallel rays with an aperture that collects light coming from large fractions of the plasma plume at each aperture position. The needed spatial resolution is achieved by a special numerical data processing. Another advantage of the proposed procedure is that inexpensive linear CCD or non-discrete (PMT, photodiode) detectors can be used instead of costly 2-dimensional detectors.

  15. Photon detection with cooled avalanche photodiodes

    Science.gov (United States)

    Robinson, D. L.; Metscher, B. D.

    1987-01-01

    Commercial avalanche photodiodes have been operated as single-photon detectors at an optimum operating temperature and bias voltage. These detectors were found to be 1.5-3 times more sensitive than presently available photomultiplier tubes (PMTs). Both single-photon detection probability and detector noise increase with bias voltage; detection probabilities greater than twice that of a PMT were obtained with detector noise levels below 100 counts per second. Higher probabilities were measured at higher noise levels. The sources of noise and their dependence on temperature and bias voltage are discussed.

  16. Cooled avalanche photodiode used for photon detection

    Science.gov (United States)

    Robinson, Deborah L.; Metscher, Brian D.

    1987-01-01

    Commercial avalanche photodiodes have been operated as single-photon detectors at an optimum operating temperature and bias voltage. These detectors were found to be 1.5 to 3 times more sensitive than presently-available photomultiplier tubes (PPMTs). Both single-photon detection probability and detector noise increase with bias voltage; detection probabilities greater than 25 percent were obtained with detector noise levels comparable to the noise of a PMT; higher probabilities were measured at higher noise levels. The sources of noise and their dependence on temperature and bias voltage are discussed.

  17. Commissioning of CMS Forward Hadron Calorimeters with Upgraded Multi-anode PMTs and {\\mu}TCA Readout

    CERN Document Server

    Tiras, Emrah; Onel, Yasar

    2016-01-01

    The high flux of charged particles interacting with the CMS Forward Hadron Calorimeter PMT windows introduced a significant background for the trigger and offline data analysis. During Long Shutdown 1, all of the original PMTs were replaced with multi-anode, thin window photomultiplier tubes. At the same time, the back-end electronic readout system was upgraded to {\\mu}TCA readout. The experience with commissioning and calibration of the Forward Hadron Calorimeter is described as well as the {\\mu}TCA system. The upgrade was successful and provided quality data for Run 2 data-analysis at 13 TeV.

  18. Commissioning of CMS Forward Hadron Calorimeters with Upgraded Multi-anode PMTs and uTCA Readout

    CERN Document Server

    Tiras, Emrah; Onel, Yasar

    2016-01-01

    The high flux of charged particles interacting with the CMS Forward Hadron Calorimeter PMT windows introduced a significant background for the trigger and offline data analysis. During Long Shutdown 1, all of the original PMTs were replaced with multi-anode, thin window photomultiplier tubes. At the same time, the back-end electronic readout system was upgraded to uTCA readout. The experience with commissioning and calibration of the Forward Hadron Calorimeter is described as well as the uTCA system. The upgrade was successful and provided quality data for Run 2 data-analysis at 13 TeV.

  19. [Dependence of the dentinal abrasion of human teeth on their microhardness].

    Science.gov (United States)

    Remizov, S M; Pruzhanskiĭ, L Iu

    1989-01-01

    The dentin resistance against abrasion was studied as related to its microhardness. Sections of 15 intact teeth were investigated (central upper incisors). Water suspensions (40% weight-to weight) of dicalcium phosphate (DCP, FRG; and DKF-1 and DKF-2, USSR) were used as abrasives. Dentin microhardness was measured with a PMT-3 device, and abrasion assessed with profilographic technique. Dentin abrasion was related to its microhardness and to the kind of abrasive used. Dentin abrasion increased as its microhardness decreased. DCF showed minimal abrasive effect, DKF-2 had maximal effect with DKF-1 keeping the intermediate position.

  20. Distinct Patterns of Gene and Protein Expression Elicited by Organophosphorus Pesticides in Caenorhabditis elegans

    Science.gov (United States)

    2009-01-01

    triglyceride transfer protein, large subunit -1.7 1 3 -1.3 -2.4 -2.0 pmt-1 NP_494990.2 NP_494991.1 NP_871997.1 phosphoethanolamine N...www.biomedcentral.com/1471-2164/10/202 Page 15 of 21 (page number not for citation purposes) hydrolysis of the phosphate [73]. However, as many car...particular interest because this enzyme is a known tar- get for OP inhibition. The NTE protein affects lipid metab- olism, and its inhibition causes

  1. Evaluation of (alpha,n) Induced Neutrons as a Background for Dark Matter Experiments

    CERN Document Server

    Mei, D -M; Hime, A

    2008-01-01

    Neutrons from ($\\alpha$,n) reaction through thorium and uranium decays are important sources of background for direct dark matter detection. Neutron yield and energy spectrum from a range of materials that are used to build dark matter detectors are calculated and tabulated. In addition to thorium and uranium decays, we found that $\\alpha$ particles from samarium that is often doped in the window material of photomultiplier (PMT) are also an important source of neutron yield. The results in this paper can be used as the input in the Monte Carlo simulation for many materials that will be used for next generation experiments.

  2. Fracture-resistant lanthanide scintillators

    Science.gov (United States)

    Doty, F. Patrick

    2011-01-04

    Lanthanide halide alloys have recently enabled scintillating gamma ray spectrometers comparable to room temperature semiconductors (lanthanide alloy substitution, while preserving scintillation, have been demonstrated. Isovalent alloys having nominal compositions of comprising Al, Ga, Sc, Y, and In dopants as well as aliovalent alloys comprising Ca, Sr, Zr, Hf, Zn, and Pb dopants were prepared. All of these alloys exhibit bright fluorescence under UV excitation, with varying shifts in the spectral peaks and intensities relative to pure CeBr.sub.3. Further, these alloys scintillate when coupled to a photomultiplier tube (PMT) and exposed to .sup.137Cs gamma rays.

  3. Design of a high dynamic range photomultiplier base board for the BGO ECAL of DAMPE

    Energy Technology Data Exchange (ETDEWEB)

    Zhang, Zhiyong; Zhang, Yunlong, E-mail: ylzhang1@mail.ustc.edu.cn; Dong, Jianing; Wen, Sicheng; Feng, Changqing; Wang, Chi; Wei, Yifeng; Wang, Xiaolian; Xu, Zizong; Liu, Shubin

    2015-04-21

    A base board for photomultiplier tube (PMT) with multi-dynode readout has been developed for the BGO electromagnetic calorimeter (ECAL) of the Dark Matter Particle Explorer (DAMPE). In order to cover a high dynamic range of energy measurements, the signals are read out from different sensitive dynodes 2, 5, and 8 (Dy2, Dy5 and Dy8). The performance of this new type of base board is studied with a light-emitting diode (LED) system and cosmic rays. A wide measuring range from 0.5 to 1.0×10{sup 5} MIPs can be achieved using the VA32 readout Application Specific Integrated Circuit (ASIC)

  4. Ultraviolet radiation detector to obtain the rate of particles at different heights

    Science.gov (United States)

    Ponce, E.; Flores, E.; Conde, R.

    2016-10-01

    The nature and origin of cosmic rays remains one of the greatest puzzles of modern astrophysics after more than 50 years since their first registration. Several ground experiments have reported the rate registered at its height of operation. To continue with the study of cosmic rays, we propose obtain the rate at different heights in the Earth's atmosphere, developing a small and portable ultraviolet radiation detector, consisting of a scintillation plastic, a PMT, and a fast DAQ system. In this work we present the design and construction of the UV detector and the rate recorded in the Sierra Negra Volcano near Puebla, Mexico (4200 m.a.s.l).

  5. Surface purity control during XMASS detector refurbishment

    Energy Technology Data Exchange (ETDEWEB)

    Kobayashi, Kazuyoshi, E-mail: kenkou@icrr.u-tokyo.ac.jp [Kamioka observatory, Institute for Cosmic Ray Research, the University of Tokyo, Higashi-Mozumi, Kamioka, Hida, Gifu, 506-1205 (Japan); Kavl Institute for the Physics and Mathematics of the Universe (WPI), the University of Tokyo, Kashiwa, Chiba, 277-8582 (Japan)

    2015-08-17

    The XMASS project aims at detecting dark matter, pp and {sup 7}Be solar neutrinos, and neutrino less double beta decay using large volume of pure liquid xenon. The first physics target of the XMASS project is to detect dark matter with 835 kg liquid xenon. After the commissioning runs, XMASS detector was refurbished to minimize the background contribution mainly from PMT sealing material and we restarted data taking in November 2013. We report how we control surface purity, especially how we prevent radon daughter accumulation on the detector copper surface, during XMASS detector refurbishment. The result and future plan of XMASS are also reported.

  6. R and D status of a large-aperture hybrid avalanche photo-detector

    Energy Technology Data Exchange (ETDEWEB)

    Abe, Toshinori, E-mail: toshi@hep.phys.s.u-tokyo.ac.j [University of Tokyo, 7-3-1 Hongo, Bunkyo-ku, Tokyo 113-0033 (Japan); Aihara, Hiroaki; Iwasaki, Masako; Fujimori, Hiroki; Kasimura, Keizo; Mineo, Sogo; Uchida, Tomohisa [University of Tokyo, 7-3-1 Hongo, Bunkyo-ku, Tokyo 113-0033 (Japan); Tanaka, Manobu [Institute for Particle and Nuclear Studies, High Energy Accelerator Research Organization, 1-1 Oho, Tsukuba, Ibaraki 305-0801 (Japan); Kawai, Yoshihiko; Kyushima, Hiroyuki; Suyama, Motohiro [Electron Tube Division, Hamamatsu Photonics K.K., 314-5 Shimokanzo, Iwata City, Shizuoka 438-0193 (Japan); Shiozawa, Masato [Kamioka Observatory, Institute for Cosmic Ray Research ICRR, University of Tokyo, Higashi-Mozumi, Kamioka-cho, Hida City, Gifu 506-1205 (Japan)

    2010-11-01

    This paper reports on the R and D status of a large-aperture Hybrid Avalanche Photo-Detector (HAPD). We have developed a 13-inch aperture HAPD and its readout system. The HAPD is a photo-detector expected to replace the photomultiplier tube (PMT) in next-generation imaging water Cherenkov detectors such as Hyper Kamiokande. We will present the recent progress made in readout system development. The readout system involves a fast sampling device. The sampling depth (number of cells) has been extended to 256 from 64 in order to measure longer waveform length. The variation in AC gain is now fixed and the input analog bandwidth improved.

  7. Data acquisition system for the TUNKA-133 array

    CERN Document Server

    Budnev, N M; Gress, O A; Kalmykov, N N; Kozhin, V A; Korosteleva, E E; Kuzmichev, L A; Lubsandorzhiev, B K; Mirgazov, R R; Navarra, G; Panasyuk, M I; Pankov, L V; Prosin, V V; Ptuskin, V S; Semeney, Y A; Skurikhin, A V; Shaibonov, B A; Spirieng, Ch; Wischnewski, R; Yashin, I V; Zablotsky, A Z; Zagorodnikov, A V

    2008-01-01

    The new EAS Cherenkov array TUNKA-133, with about 1 km**2 sensitive area, is being installed in the Tunka Valley. The investigated energy range is 10**15-10**18 eV. It will consist of 133 optical detectors based on EMI9350 PMTs. Optical detectors are grouped into 19 clusters with 7 detectors each. The detectors are connected to the cluster box with RG-58 cables. Every PMT signal is digitized in the cluster box with 200 MHz FADC. The cluster boxes are connected to the data acquisition center with a 1 Gb/s optical link. A detailed description of the data acquisition system (DAQ) is presented.

  8. Test of the photon detection system for the LHCb RICH Upgrade in a charged particle beam

    CERN Document Server

    Baszczyk, M.K.

    2017-01-01

    The LHCb detector will be upgraded to make more efficient use of the available luminosity at the LHC in Run III and extend its potential for discovery. The Ring Imaging Cherenkov detectors are key components of the LHCb detector for particle identification. In this paper we describe the setup and the results of tests in a charged particle beam, carried out to assess prototypes of the upgraded opto-electronic chain from the Multi-Anode PMT photosensor to the readout and data acquisition system.

  9. Radioisotope Detection Device and Methods of Radioisotope Collection

    Science.gov (United States)

    Tranter, Troy J [Idaho Falls, ID; Oertel, Christopher P [Idaho Falls, ID; Giles, John R [Pocatello, ID; Mann, Nicholas R [Rigby, ID; McIlwain, Michael E [Idaho Falls, ID

    2011-04-12

    A device for collection of radionuclides includes a mixture of a polymer, a fluorescent organic scintillator and a chemical extractant. A radionuclide detector system includes a collection device comprising a mixture of a polymer, a fluorescent agent and a selective ligand. The system includes at least one photomultiplier tube (PMT). A method of detecting radionuclides includes providing a collector device comprising a mixture comprising a polymer, a fluorescent organic scintillator and a chemical extractant. An aqueous environment is exposed to the device and radionuclides are collected from the environment. Radionuclides can be concentrated within the device.

  10. A new type gamma-ray spectrum monitoring system

    CERN Document Server

    Cheng Bo; Zhou Jian Bin; Zhang Zhi Ming; Tong Yun Fu

    2002-01-01

    This new radiation monitoring system can be used to monitor the radiation of building materials and the radiation of atmosphere, to explore and evaluate rock for building in the field, and this system can be used to monitor the gamma irradiation near the nuclear establishments in the average situation and in the serious situation of the radiation incident have happened. The control core of this monitoring system is SCM-AT89C52, and gamma-ray sensing head consists of scintillator phi 50 mm x 50 mm NaI(Tl) and PMT GDB44. This system can be used to measure the whole gamma-ray spectrum of 256 channels

  11. A method to obtain pulse contrast on a single shot

    Institute of Scientific and Technical Information of China (English)

    Xiaoping Ouyang; Xiaoyan Li; Yanli Zhang; Zhaoyang Li; Guang Xu; Tao Wang; Baoqiang Zhu; Jianqiang Zhu

    2009-01-01

    @@ A novel method for obtaining a single shot multi-point high dynamic range pulse contrast measurement is presented.We use Dammann gratings to generate multiple beamlets by division of amplitude on ultra-short laser pulses.The analysis results show that this method can achieve high dynamic range in pulse contrast measurement on a single shot by using photomultiplier tube (PMT) detectors and the long work-ing distances to minimize cross talk between channels.Some distortion of pulse shape is also analyzed detailedly with the Dammann grating and its compensation grating, which may degrade the pulse contrast measurement in some degree by pulse stretching and spectrum clipping.

  12. Gold-based optical biosensor for single-mismatched DNA detection using salt-induced hybridization

    DEFF Research Database (Denmark)

    Zhan, Zongrui; Ma, Xingyi; Cao, Cuong

    2011-01-01

    In this study, a gold nanoparticle (Au-NP)-based detection method for sensitive and specific DNA-based diagnostic applications is described. A sandwich format consisting of Au-NPs/DNA/PMP (Streptavidin-coated MagnetSphere Para-Magnetic Particles) was fabricated. PMPs captured and separated target...... in the presence of different buffers was well investigated, and thus, the optimized salt concentration allowed for discrimination of single-mismatched DNA (MMT) from perfectly matched DNA (PMT). Therefore, quantitative information concerning the target analyte was translated into a colorimetric signal, which...

  13. A novel framework for analysing stakeholder interest in healthy foods: A case study on iodine biofortification.

    Science.gov (United States)

    Mogendi, Joseph Birundu; De Steur, Hans; Gellynck, Xavier; Makokha, Anselimo

    2016-01-01

    Despite the availability of novel strategies to prevent micronutrient malnutrition, such as biofortification, limited understanding of stakeholders often hampers their success. We build upon the existing literature on protection motivations (PMT) and technology acceptance (TAM) to develop an integrated PMTAM model for analyzing stakeholders' reactions, on both the supply and demand sides. Regarding the latter, the case of the iodine biofortified food chain is used to evaluate African households' interest. All model constructs, and threat appraisal in particular, are decisive in determining the uptake of biofortification, while also social demographics and own nutrition status play an important role.

  14. Improving LADCP Velocity Profiles with External Attitude Sensors

    Science.gov (United States)

    Thurnherr, A. M.; Goszczko, I.

    2016-12-01

    Data collected with Acoustic Doppler Current Profilers installed on CTD rosettes and lowered through the water column (LADCP systems) are routinely used to derive full-depth profiles of ocean velocity. In addition to the uncertainties arising from random noise in the along-beam velocity measurements, LADCP derived velocities are commonly contaminated by bias errors due to imperfectly measured instrument attitude (pitch, roll and heading). Of particular concern are the heading measurements because it is not usually feasible to calibrate the internal ADCP compasses with the instruments installed on a CTD rosette, away from the magnetic disturbances of the ship as well as the current-carrying winch wire. Heading data from dual-headed LADCP systems, which consist of upward and downward-pointing ADCPs installed on the same rosette, commonly indicate heading-dependent compass errors with amplitudes exceeding 10 degrees. In an attempt to reduce LADCP velocity errors, over 200 full-depth profiles were collected during several recent projects, including GO-SHIP, DIMES and ECOGIG, with an inexpensive (work at all.

  15. UGCT: New X-ray radiography and tomography facility

    Energy Technology Data Exchange (ETDEWEB)

    Masschaele, B.C. [Department of Subatomic and Radiation Physics, Ghent University, Proeftuinstraat 86, B-9000 Gent (Belgium)], E-mail: bert.masschaele@ugent.be; Cnudde, V. [Department of Geology and Soil Science, Ghent University, Krijgslaan 281, B-9000 Gent (Belgium); Dierick, M. [Department of Subatomic and Radiation Physics, Ghent University, Proeftuinstraat 86, B-9000 Gent (Belgium); Jacobs, P. [Department of Geology and Soil Science, Ghent University, Krijgslaan 281, B-9000 Gent (Belgium); Hoorebeke, L. van; Vlassenbroeck, J. [Department of Subatomic and Radiation Physics, Ghent University, Proeftuinstraat 86, B-9000 Gent (Belgium)

    2007-09-21

    The UGCT (University Gent Computer Tomography) facility, a cooperation between the Radiation Physics research group and the Sedimentary Geology and Engineering Geology research group is a new CT facility providing a large range of scanning possibilities. Formerly a Skyscan 1072 was used to perform X-ray micro-CT scans at the UGCT facility and although this is a very powerful instrument, there were needs for a higher resolution and more flexibility. Therefore, the UCGT facility started the construction of a multidisciplinary micro-CT scanner inside a shielded room with a maximum flexibility of the set-up. The X-ray tube of this high-resolution CT scanner is a state-of-the-art open-type device with dual head: one head for high power micro-CT and one for sub-micro- or also called nano-CT. An important advantage of this scanner is that different detectors can be used to optimize the scanning conditions of the objects under investigation. The entire set-up is built on a large optical table to obtain the highest possible stability. Due to the flexible set-up and the powerful CT reconstruction software 'Octopus', it is possible to obtain the highest quality and the best signal-to-noise of the reconstructed images for each type of sample.

  16. Acquisition and performance of the Star Imager

    DEFF Research Database (Denmark)

    Jørgensen, John Leif

    1997-01-01

    This document is the final report on the work carried out to fulfill the second and last part (2.1-2.6) of the Statement of Work for the ESTEC purchase order # 151713 of 05/10/1995. This document describes the work performed according to the following statement of work items: 2 Dual Optical Head...... Configuration 2.1 The current DTU SIM will be equipped with a dual head fixed to a common reference frame. 2.2 The angle between heads shall be optimized in terms of accuracy, avoidance of blinding and occultation, and sky coverage. The typical orbit type chosen to perform this trade off will be low earth (say...... calibrations shall be studied. 2.5 Indications will be given about dependence of performance on integration time and on computing time. 2.6 A report shall be provided.The work reported on in this document will answer the above topics in the order they are dealt with scientifically, and will only be summarized...

  17. 18FDG in the diagnostic of head and neck cancer's recurrences. Prospective study on 115 patients with CDET; Place du 18FDG dans la recherche de recidives de cancer des voies aerodigestives superieures. Etude prospective realisee en TEDC sur 115 patients

    Energy Technology Data Exchange (ETDEWEB)

    Chaborel, J.P.; Fontana, X.; Carrier, P.; Bussiere, F.; Darcourt, J. [Centre de Lutte Contre le Cancer Antoine Lacassagne, 06 - Nice (France)

    2006-04-15

    The diagnosis of head and neck cancer recurrence is difficult with MRI or CT due to tissue changes induced by previous surgery or radiation therapy. Based on the increased glucide metabolism in the proliferative cells, 18FDG PET is a promising metabolic imaging modality to solve this problem. Between march 02 and april 05, we prospectively studied the value of 18FDG for this diagnosis in 115 patients using a dual-head coincidence camera. The results were compared with the usual diagnostic modalities (including MRI, CT, clinical examination and endoscopy). The sensitivity (90.2%), negative predictive value (85.4%) and accuracy (78.3%) of 18FDG were significatively higher than the results of usual diagnostic modalities (respectively 77%, 70.8% and 70.4%). It is important to note that the results obtained with dedicated PET cameras in smaller prospective series seem in this indication even better with sensitivity values in the order of 95% and especially specificity values higher than 85%. Finally, these observations tend to prove that the 18FDG PET should be the first additional exam to be performed after clinical examination when a head and neck cancer recurrence is suspected. In particular, its high sensitivity and its good negative predictive value allow to avoid invasive procedures for the patients when the 18FDG study is negative. (authors)

  18. Dual bolus intravenous contrast injection technique for multiregion paediatric body CT

    Energy Technology Data Exchange (ETDEWEB)

    Thomas, Karen E.; Mann, E.H.; Padfield, N.; Greco, L.; BenDavid, G. [The Hospital for Sick Children, Department of Diagnostic Imaging, Toronto (Canada); Alzahrani, A. [King Abdulaziz Medical City, PO Box 22490, Riyadh (Saudi Arabia)

    2015-04-01

    Optimal vascular and parenchymal enhancement for multi-region paediatric body computed tomography (CT) has many challenges. A variety of approaches are currently employed, associated with varying image quality and radiation dose implications. We present a dual bolus intravenous (DBI) contrast technique for single-acquisition imaging of the chest, abdomen and pelvis, with evaluation of multi-compartmental vascular enhancement. A DBI regime was designed for use with a programmable dual head pump injector. A larger initial bolus (two-thirds volume) is followed by a smaller bolus (one-third volume) before imaging the chest, abdomen and pelvis in a single acquisition, 45-65 seconds from the start of initial injection. Flow rates and second bolus timing were tailored to patient weight and contrast volume, using five weight categories. Multi-compartmental vascular opacification was graded and image quality was assessed in a cohort of 130 patients. The DBI technique resulted in concordant multi-compartmental (thoracic aortic, pulmonary arterial, abdominal aortic and portal venous) vascular enhancement. Early splenic parenchymal enhancement artefacts and alterations to renal enhancement were observed. We present a weight-stratified dual bolus intravenous contrast technique to improve image quality in paediatric multi-region body CT. (orig.)

  19. Grafting of [(64)Cu]-TPPF20 porphyrin complex on Functionalized nano-porous MCM-41 silica as a potential cancer imaging agent.

    Science.gov (United States)

    Fazaeli, Yousef; Feizi, Shahzad; Jalilian, Amir R; Hejrani, Ali

    2016-06-01

    Mesoporous silica, MCM-41, functionalized with 3-aminopropyltriethoxysilane (APTES) was investigated as a potential drug delivery system, using [(64)Cu]-5, 10, 15, 20-tetrakis penta fluorophenyl porphyrin complex. [(64)Cu]-TPPF20 complex was grafted on functionalized MCM-41. The product was characterized by paper chromatography, FTIR spectroscopy, low angle X-ray diffraction, CHN and TGA/DTA analyses and atomic force microscopy. The biological evaluations of the grafted complex, [(64)Cu]-TPPF20@NH2-MCM-41, were done in Fibrosarcoma tumor-bearing Sprague-Dawley rats using scarification studies and Sopha DST-XL Dual-Head SPECT system. The actual loading amount of aminopropyl groups was found about 1.6mmol per gram of final silica. The specific activity of the final compound was found to be 3Ci/g. Amine functionalized MCM-41 was found to be a good platform for theranostic radiopharmaceuticals such as copper-64 complexes. Considering the accumulation of the tracer in tumor cells, fast wash-out from normal tissues, the short half-life copper-64 and less imposed radiation doses to patients, [(64)Cu]-TPPF20@NH2-MCM-41 can potentially be a suitable candidate for tumor imaging applications and future PET studies.

  20. The correlation between effective renal plasma flow (ERPF) and glomerular filtration rate (GFR) with renal scintigraphy 99mTc-DTPA study

    Science.gov (United States)

    Ratnasari, D.; Nazir, F.; Toresano, L. O. H. Z.; Pawiro, S. A.; Soejoko, D. S.

    2016-03-01

    The prevalence of chronic renal diseases in Indonesia has an increasing annual trend, because it is frequently unrecognized and often co-exists with other disease. GFR and ERPF are parameters currently utilized to estimate renal function at routine renal scintigraphy 99m-Tc DTPA study. This study used 99m-Tc DTPA to measure GFR and ERPF. The purpose of this study was to find the correlation between ERPF and GFR, for ERPF analysis with Schlegel's method, and GFR analysis with Gate's method, as well as to find correction factor between both variables. Analysis of renal scintigraphy has been performed at Department of Nuclear Medicine Pertamina Center Hospital to thirty patient images acquired from 2014 to 2015 which were analyzed retrospectively data, using gamma camera dual head with counting method from renal scintigraphy 99m-Tc DTPA study. The calculation was executed by means of both display and manual calculation. Pearson's statistical analysis resulted on Positive Correlation for all data, with ERPF and GFR (display) showing Strongly Positive Correlation (r = 0.82; p- value < 0.05). Standard deviation was found to be 27.58 and 107.64 for GFR and ERPF (display), respectively. Our result indicated that the use of 99mTc-DTPA measure ERPF was not recommended.